(data stored in ACNUC7421 zone)

EMBL: AE016822

ID   AE016822; SV 1; circular; genomic DNA; STD; PRO; 2584158 BP.
XX
AC   AE016822;
XX
PR   Project:PRJNA212;
XX
DT   05-AUG-2004 (Rel. 80, Created)
DT   02-FEB-2014 (Rel. 119, Last updated, Version 4)
XX
DE   Leifsonia xyli subsp. xyli str. CTCB07, complete genome.
XX
KW   .
XX
OS   Leifsonia xyli subsp. xyli str. CTCB07
OC   Bacteria; Actinobacteria; Micrococcales; Microbacteriaceae; Leifsonia.
XX
RN   [1]
RP   1-2584158
RX   PUBMED; 15305603.
RA   Monteiro-Vitorello C.B., Camargo L.E., Van Sluys M.A., Kitajima J.P.,
RA   Truffi D., do Amaral A.M., Harakava R., de Oliveira J.C., Wood D.,
RA   de Oliveira M.C., Miyaki C., Takita M.A., da Silva A.C., Furlan L.R.,
RA   Carraro D.M., Camarotte G., Almeida N.F.Jr., Carrer H., Coutinho L.L.,
RA   El-Dorry H.A., Ferro M.I., Gagliardi P.R., Giglioti E., Goldman M.H.,
RA   Goldman G.H., Kimura E.T., Ferro E.S., Kuramae E.E., Lemos E.G.,
RA   Lemos M.V., Mauro S.M., Machado M.A., Marino C.L., Menck C.F., Nunes L.R.,
RA   Oliveira R.C., Pereira G.G., Siqueira W., de Souza A.A., Tsai S.M.,
RA   Zanca A.S., Simpson A.J., Brumbley S.M., Setubal J.C.;
RT   "The genome sequence of the gram-positive sugarcane pathogen Leifsonia xyli
RT   subsp. xyli";
RL   Mol. Plant Microbe Interact. 17(8):827-836(2004).
XX
RN   [2]
RP   1-2584158
RA   Vitorello C.B.M., Camargo L.E.A., Sluys M.A.V., Kitajima J.P., Truffi D.,
RA   Amaral A.M., Harakava R., Franco J.C., Wood D., Oliveira M.C., Miyaki C.,
RA   Takita M.A., Silva A.C.R., Furlan L.R., Carraro D.M., Camarotte G.,
RA   Almeida N.F., Carrer H., Coutinho L.L., El-Dorry H.A., Ferro M.I.T.,
RA   Gagliardi P.R., Giglioti E., Goldman M.H.S., Goldman G.H., Kimura E.T.,
RA   Ferro E.S., Kuramae E.E., Lemos E.G.M., Lemos M.V.F., Mauro S.M.Z.,
RA   Machado M.A., Marino C.L., Menck C.F., Nunes L.R., Oliveira R.C.,
RA   Pereira G.G., Siqueira W., Souza A.A., Tsai S.M., Zanca A.S.,
RA   Simpson A.J.G., Brumbley S.M., Setubal J.C.;
RT   ;
RL   Submitted (23-DEC-2002) to the INSDC.
RL   Laboratorio de Bioinformatica/Instituto de Computacao, Universidade
RL   Estadual de Campinas, Avenida Albert Einstein 1251, Box 6176, Campinas, SP
RL   13083-970, Brasil
XX
DR   MD5; ddc35d3df5c6a5a2bbcf63aadbcc796c.
DR   BioSample; SAMN02603772.
DR   EnsemblGenomes-Gn; EBG00001135283.
DR   EnsemblGenomes-Gn; EBG00001135284.
DR   EnsemblGenomes-Gn; EBG00001135285.
DR   EnsemblGenomes-Gn; EBG00001135286.
DR   EnsemblGenomes-Gn; EBG00001135287.
DR   EnsemblGenomes-Gn; EBG00001135288.
DR   EnsemblGenomes-Gn; EBG00001135289.
DR   EnsemblGenomes-Gn; EBG00001135290.
DR   EnsemblGenomes-Gn; EBG00001135291.
DR   EnsemblGenomes-Gn; EBG00001135292.
DR   EnsemblGenomes-Gn; EBG00001135293.
DR   EnsemblGenomes-Gn; EBG00001135294.
DR   EnsemblGenomes-Gn; EBG00001135295.
DR   EnsemblGenomes-Gn; EBG00001135296.
DR   EnsemblGenomes-Gn; EBG00001135297.
DR   EnsemblGenomes-Gn; EBG00001135298.
DR   EnsemblGenomes-Gn; EBG00001135299.
DR   EnsemblGenomes-Gn; EBG00001135300.
DR   EnsemblGenomes-Gn; EBG00001135301.
DR   EnsemblGenomes-Gn; EBG00001135302.
DR   EnsemblGenomes-Gn; EBG00001135303.
DR   EnsemblGenomes-Gn; EBG00001135304.
DR   EnsemblGenomes-Gn; EBG00001135305.
DR   EnsemblGenomes-Gn; EBG00001135306.
DR   EnsemblGenomes-Gn; EBG00001135307.
DR   EnsemblGenomes-Gn; EBG00001135308.
DR   EnsemblGenomes-Gn; EBG00001135309.
DR   EnsemblGenomes-Gn; EBG00001135310.
DR   EnsemblGenomes-Gn; EBG00001135311.
DR   EnsemblGenomes-Gn; EBG00001135312.
DR   EnsemblGenomes-Gn; EBG00001135313.
DR   EnsemblGenomes-Gn; EBG00001135314.
DR   EnsemblGenomes-Gn; EBG00001135315.
DR   EnsemblGenomes-Gn; EBG00001135316.
DR   EnsemblGenomes-Gn; EBG00001135317.
DR   EnsemblGenomes-Gn; EBG00001135318.
DR   EnsemblGenomes-Gn; EBG00001135319.
DR   EnsemblGenomes-Gn; EBG00001135320.
DR   EnsemblGenomes-Gn; EBG00001135321.
DR   EnsemblGenomes-Gn; EBG00001135322.
DR   EnsemblGenomes-Gn; EBG00001135323.
DR   EnsemblGenomes-Gn; EBG00001135324.
DR   EnsemblGenomes-Gn; EBG00001135325.
DR   EnsemblGenomes-Gn; EBG00001135326.
DR   EnsemblGenomes-Gn; EBG00001135327.
DR   EnsemblGenomes-Gn; EBG00001135328.
DR   EnsemblGenomes-Gn; EBG00001135329.
DR   EnsemblGenomes-Gn; EBG00001135330.
DR   EnsemblGenomes-Gn; EBG00001135331.
DR   EnsemblGenomes-Gn; EBG00001135332.
DR   EnsemblGenomes-Gn; EBG00001135333.
DR   EnsemblGenomes-Gn; EBG00001135334.
DR   EnsemblGenomes-Gn; EBG00001135335.
DR   EnsemblGenomes-Gn; Lxx00090.
DR   EnsemblGenomes-Gn; Lxx00100.
DR   EnsemblGenomes-Gn; Lxx00280.
DR   EnsemblGenomes-Gn; Lxx01380.
DR   EnsemblGenomes-Gn; Lxx01390.
DR   EnsemblGenomes-Gn; Lxx01400.
DR   EnsemblGenomes-Gn; Lxx01610.
DR   EnsemblGenomes-Gn; Lxx01620.
DR   EnsemblGenomes-Gn; Lxx01890.
DR   EnsemblGenomes-Gn; Lxx02160.
DR   EnsemblGenomes-Gn; Lxx02320.
DR   EnsemblGenomes-Gn; Lxx02330.
DR   EnsemblGenomes-Gn; Lxx02880.
DR   EnsemblGenomes-Gn; Lxx03390.
DR   EnsemblGenomes-Gn; Lxx03580.
DR   EnsemblGenomes-Gn; Lxx04110.
DR   EnsemblGenomes-Gn; Lxx05760.
DR   EnsemblGenomes-Gn; Lxx05940.
DR   EnsemblGenomes-Gn; Lxx06790.
DR   EnsemblGenomes-Gn; Lxx07810.
DR   EnsemblGenomes-Gn; Lxx07820.
DR   EnsemblGenomes-Gn; Lxx08140.
DR   EnsemblGenomes-Gn; Lxx08210.
DR   EnsemblGenomes-Gn; Lxx08590.
DR   EnsemblGenomes-Gn; Lxx08640.
DR   EnsemblGenomes-Gn; Lxx09310.
DR   EnsemblGenomes-Gn; Lxx09570.
DR   EnsemblGenomes-Gn; Lxx10620.
DR   EnsemblGenomes-Gn; Lxx10630.
DR   EnsemblGenomes-Gn; Lxx10640.
DR   EnsemblGenomes-Gn; Lxx10650.
DR   EnsemblGenomes-Gn; Lxx11380.
DR   EnsemblGenomes-Gn; Lxx12680.
DR   EnsemblGenomes-Gn; Lxx12900.
DR   EnsemblGenomes-Gn; Lxx13060.
DR   EnsemblGenomes-Gn; Lxx13390.
DR   EnsemblGenomes-Gn; Lxx13468.
DR   EnsemblGenomes-Gn; Lxx13530.
DR   EnsemblGenomes-Gn; Lxx14140.
DR   EnsemblGenomes-Gn; Lxx17020.
DR   EnsemblGenomes-Gn; Lxx17440.
DR   EnsemblGenomes-Gn; Lxx17850.
DR   EnsemblGenomes-Gn; Lxx18170.
DR   EnsemblGenomes-Gn; Lxx18500.
DR   EnsemblGenomes-Gn; Lxx21270.
DR   EnsemblGenomes-Gn; Lxx21560.
DR   EnsemblGenomes-Gn; Lxx21570.
DR   EnsemblGenomes-Gn; Lxx21580.
DR   EnsemblGenomes-Gn; Lxx23840.
DR   EnsemblGenomes-Tr; EBT00001726594.
DR   EnsemblGenomes-Tr; EBT00001726595.
DR   EnsemblGenomes-Tr; EBT00001726596.
DR   EnsemblGenomes-Tr; EBT00001726597.
DR   EnsemblGenomes-Tr; EBT00001726598.
DR   EnsemblGenomes-Tr; EBT00001726599.
DR   EnsemblGenomes-Tr; EBT00001726600.
DR   EnsemblGenomes-Tr; EBT00001726601.
DR   EnsemblGenomes-Tr; EBT00001726602.
DR   EnsemblGenomes-Tr; EBT00001726603.
DR   EnsemblGenomes-Tr; EBT00001726604.
DR   EnsemblGenomes-Tr; EBT00001726605.
DR   EnsemblGenomes-Tr; EBT00001726606.
DR   EnsemblGenomes-Tr; EBT00001726607.
DR   EnsemblGenomes-Tr; EBT00001726608.
DR   EnsemblGenomes-Tr; EBT00001726609.
DR   EnsemblGenomes-Tr; EBT00001726610.
DR   EnsemblGenomes-Tr; EBT00001726611.
DR   EnsemblGenomes-Tr; EBT00001726612.
DR   EnsemblGenomes-Tr; EBT00001726613.
DR   EnsemblGenomes-Tr; EBT00001726614.
DR   EnsemblGenomes-Tr; EBT00001726615.
DR   EnsemblGenomes-Tr; EBT00001726616.
DR   EnsemblGenomes-Tr; EBT00001726617.
DR   EnsemblGenomes-Tr; EBT00001726618.
DR   EnsemblGenomes-Tr; EBT00001726619.
DR   EnsemblGenomes-Tr; EBT00001726620.
DR   EnsemblGenomes-Tr; EBT00001726621.
DR   EnsemblGenomes-Tr; EBT00001726622.
DR   EnsemblGenomes-Tr; EBT00001726623.
DR   EnsemblGenomes-Tr; EBT00001726624.
DR   EnsemblGenomes-Tr; EBT00001726625.
DR   EnsemblGenomes-Tr; EBT00001726626.
DR   EnsemblGenomes-Tr; EBT00001726627.
DR   EnsemblGenomes-Tr; EBT00001726628.
DR   EnsemblGenomes-Tr; EBT00001726629.
DR   EnsemblGenomes-Tr; EBT00001726630.
DR   EnsemblGenomes-Tr; EBT00001726631.
DR   EnsemblGenomes-Tr; EBT00001726632.
DR   EnsemblGenomes-Tr; EBT00001726633.
DR   EnsemblGenomes-Tr; EBT00001726634.
DR   EnsemblGenomes-Tr; EBT00001726635.
DR   EnsemblGenomes-Tr; EBT00001726636.
DR   EnsemblGenomes-Tr; EBT00001726637.
DR   EnsemblGenomes-Tr; EBT00001726638.
DR   EnsemblGenomes-Tr; EBT00001726639.
DR   EnsemblGenomes-Tr; EBT00001726640.
DR   EnsemblGenomes-Tr; EBT00001726641.
DR   EnsemblGenomes-Tr; EBT00001726642.
DR   EnsemblGenomes-Tr; EBT00001726643.
DR   EnsemblGenomes-Tr; EBT00001726644.
DR   EnsemblGenomes-Tr; EBT00001726645.
DR   EnsemblGenomes-Tr; EBT00001726646.
DR   EnsemblGenomes-Tr; Lxx00090-1.
DR   EnsemblGenomes-Tr; Lxx00100-1.
DR   EnsemblGenomes-Tr; Lxx00280-1.
DR   EnsemblGenomes-Tr; Lxx01380-1.
DR   EnsemblGenomes-Tr; Lxx01390-1.
DR   EnsemblGenomes-Tr; Lxx01400-1.
DR   EnsemblGenomes-Tr; Lxx01610-1.
DR   EnsemblGenomes-Tr; Lxx01620-1.
DR   EnsemblGenomes-Tr; Lxx01890-1.
DR   EnsemblGenomes-Tr; Lxx02160-1.
DR   EnsemblGenomes-Tr; Lxx02320-1.
DR   EnsemblGenomes-Tr; Lxx02330-1.
DR   EnsemblGenomes-Tr; Lxx02880-1.
DR   EnsemblGenomes-Tr; Lxx03390-1.
DR   EnsemblGenomes-Tr; Lxx03580-1.
DR   EnsemblGenomes-Tr; Lxx04110-1.
DR   EnsemblGenomes-Tr; Lxx05760-1.
DR   EnsemblGenomes-Tr; Lxx05940-1.
DR   EnsemblGenomes-Tr; Lxx06790-1.
DR   EnsemblGenomes-Tr; Lxx07810-1.
DR   EnsemblGenomes-Tr; Lxx07820-1.
DR   EnsemblGenomes-Tr; Lxx08140-1.
DR   EnsemblGenomes-Tr; Lxx08210-1.
DR   EnsemblGenomes-Tr; Lxx08590-1.
DR   EnsemblGenomes-Tr; Lxx08640-1.
DR   EnsemblGenomes-Tr; Lxx09310-1.
DR   EnsemblGenomes-Tr; Lxx09570-1.
DR   EnsemblGenomes-Tr; Lxx10620-1.
DR   EnsemblGenomes-Tr; Lxx10630-1.
DR   EnsemblGenomes-Tr; Lxx10640-1.
DR   EnsemblGenomes-Tr; Lxx10650-1.
DR   EnsemblGenomes-Tr; Lxx11380-1.
DR   EnsemblGenomes-Tr; Lxx12680-1.
DR   EnsemblGenomes-Tr; Lxx12900-1.
DR   EnsemblGenomes-Tr; Lxx13060-1.
DR   EnsemblGenomes-Tr; Lxx13390-1.
DR   EnsemblGenomes-Tr; Lxx13468-1.
DR   EnsemblGenomes-Tr; Lxx13530-1.
DR   EnsemblGenomes-Tr; Lxx14140-1.
DR   EnsemblGenomes-Tr; Lxx17020-1.
DR   EnsemblGenomes-Tr; Lxx17440-1.
DR   EnsemblGenomes-Tr; Lxx17850-1.
DR   EnsemblGenomes-Tr; Lxx18170-1.
DR   EnsemblGenomes-Tr; Lxx18500-1.
DR   EnsemblGenomes-Tr; Lxx21270-1.
DR   EnsemblGenomes-Tr; Lxx21560-1.
DR   EnsemblGenomes-Tr; Lxx21570-1.
DR   EnsemblGenomes-Tr; Lxx21580-1.
DR   EnsemblGenomes-Tr; Lxx23840-1.
DR   EuropePMC; PMC1266029; 16159395.
DR   EuropePMC; PMC1590026; 16901339.
DR   EuropePMC; PMC2258877; 18192381.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; AE016822.
DR   SILVA-SSU; AE016822.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2584158
FT                   /organism="Leifsonia xyli subsp. xyli str. CTCB07"
FT                   /sub_species="xyli"
FT                   /strain="CTCB07"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:281090"
FT   gene            225..1646
FT                   /gene="dnaA"
FT                   /locus_tag="Lxx00010"
FT   CDS_pept        225..1646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="Lxx00010"
FT                   /product="chromosomal replication initiator protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00010"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88109"
FT                   /db_xref="GOA:Q6AHN6"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AHN6"
FT                   /protein_id="AAT88109.1"
FT                   /translation="MADGEESISVAWQSVLDKLETDDRITPQLHGFLSLVEPKGIMAGT
FT                   FYLEVPNEFTRGMIEQRSRVPLLNAIGTLDNTLAVTTFAIVVNPEIQQESLSTVGEPEP
FT                   TPAPYLDVATFTVAPPAEITAPPRNGDTRLNSKYSFDNFVIGQSNRFAHAAAVAVAEAP
FT                   AKAYNPLFIYGDSGLGKTHLLHAIGHYAMSLYPGIRVRYVSSEEFTNDFINSIANNRGS
FT                   SFQARYRNIDILLIDDIQFLQRAVETQEAFFHTFNTLHDHNKQVVITSDLPPKHLTGFE
FT                   DRMRSRFEWGLITDVQVPDLETRIAILRKKAQSEKIQVPDDILEFMASKISSNIRELEG
FT                   TLIRVTAFASLNRTPVDMPLVQTVLKDLITLDDDNVIAPTDIITNTAEYFKLTVDDLYG
FT                   SSRSQAVATARQIAMYLCRELTNLSLPKIGQLFGGRDHTTVMYANKKISELMKERRSIY
FT                   NQVTELTSRIKQNHR"
FT   gene            2083..3228
FT                   /gene="dnaN"
FT                   /locus_tag="Lxx00020"
FT   CDS_pept        2083..3228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="Lxx00020"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00020"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88110"
FT                   /db_xref="GOA:Q6AHN5"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHN5"
FT                   /protein_id="AAT88110.1"
FT                   /translation="MKFQANRDVFSEAVSFAVKLLPQRTTLPILSGVLIETTENGLQLS
FT                   SFDYEVSAQTKIAAEVEETGRVLVSGRLLAEIAAKLPNAPVQFSTEESKIIVKAGSANF
FT                   TLLSMPVEEYPSIPDVSGEAGLVPAEEFAEAVAQVGVAASRDDVTPVITGVQLEVGDNT
FT                   LGLVATDRYRVAVREIDWDNGTTLGETKTALVPARTLTEIGKTLGHSGTVSIAITNRDD
FT                   RELIAFTDDRKTVTSLLIKGNFPPVRRLFPDQVENHAVMNTAELIEATRRVSLVLEREA
FT                   ALRYTFTADGLTLEAIGSEQAQASESIDALLTGQETVVSLKPQFLLDGLGAVHSEFVRI
FT                   SFTKTENPNKPGPVLITSQTSKDQAGADSYKYLLQPNLLLR"
FT   gene            3266..4153
FT                   /gene="gnd"
FT                   /locus_tag="Lxx00030"
FT   CDS_pept        3266..4153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnd"
FT                   /locus_tag="Lxx00030"
FT                   /product="6-phosphogluconate dehydrogenase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00030"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88111"
FT                   /db_xref="GOA:Q6AHN4"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHN4"
FT                   /protein_id="AAT88111.1"
FT                   /translation="MHIGLIGLGRMGNNMRDRLEKKGIEVTGFDTNPAVSDVPTLADMV
FT                   AALPAPRTVWVMVPAGQITDSVIADLEPLLEKGDLVIDGGNSKFTEDFAHAALLAPKGV
FT                   DFMDAGVSGGIWGLENGYGLMVGGSKEQVERVMPVFDALRPEGPRDEGFVHVGEVGAGH
FT                   YAKMVHNGIEYALMQAYAEGYELLDTRKDIIKDVTGTFKAWQSGTVVRSWLLDLLVRAL
FT                   EEDPEFEHIEGFVQDSFEGRWTIEEALNNAVPVPTISASIFARFVSRQEYSPAMKAVAA
FT                   LRNQFGGHAVKAVD"
FT   gene            4160..5317
FT                   /gene="recF"
FT                   /locus_tag="Lxx00040"
FT   CDS_pept        4160..5317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="Lxx00040"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00040"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88112"
FT                   /db_xref="GOA:Q6AHN3"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AHN3"
FT                   /protein_id="AAT88112.1"
FT                   /translation="MRVTHLSLTDFRNYGTAEVHFEAGANLFVGRNGQGKTNLVESLGY
FT                   LSALGSHRVSSDQAMIRQGAELAVVRARIQHEARELLVEVQLNRGAANRAQVNRAAIKP
FT                   RELPRYFSSVLFAPEDLALVRGEPGVRRRFLDQLLIQRNPRLSAVIAEYERVLKQRNTL
FT                   LKSARASRFREDQLGTLDIWDDRLLTLGAELINARLDLMARLSNPLVAAYRSVAGDDHH
FT                   PRLLPQLTISGAHVEDEDDDSVADMTSAFGDTTDVFRQALAGVRWKELERGLTLVGPHR
FT                   DDVLFELNGLPAKGYASHGESWSFALALKLASAELLRRESVTGDPVLILDDVFAELDWA
FT                   RRRMLATTVAGYEQVLITAAVYEDVPAELAAHTIRIEAGAIVEPS"
FT   gene            5314..5790
FT                   /locus_tag="Lxx00050"
FT   CDS_pept        5314..5790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00050"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00050"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88113"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHN2"
FT                   /protein_id="AAT88113.1"
FT                   /translation="MSEASSVYLRMKALFTGTVSRSRRRREAEADSGAPKPFGAGRDPR
FT                   GLGDVVDSLASQMGWTSALAKSDLMAGWVELAGEENAKHSYPEGITDGVLIVRCETTAW
FT                   ATQLGTLRIELLRKAAERFPDADIQTIHLRGPHAPSWNHGSRSIPGRGPRDTYG"
FT   gene            5914..7905
FT                   /gene="gyrB"
FT                   /locus_tag="Lxx00060"
FT   CDS_pept        5914..7905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="Lxx00060"
FT                   /product="DNA gyrase subunit B"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00060"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88114"
FT                   /db_xref="GOA:Q6AHN1"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHN1"
FT                   /protein_id="AAT88114.1"
FT                   /translation="MTMEPNRAEAEHDYGANEIQVLEGLEAVRKRPGMYIGSTGPRGLH
FT                   HLVYEIVDNSVDEALAGYADNIEVMILPDGSVRVFDNGRGIPVDEHPVQKKSTVEVVLT
FT                   ILHAGGKFGGGGYAVSGGLHGVGSSVVNALSTRLDVEVRRQGHVWRQSYRNGVPQAPLE
FT                   QGEETEATGTTIVFWPSPETFETVEFDYDTLRTRFQQMAFLNKGLRIAIADQRPVSAEG
FT                   EADEESEPRGEVFLYEKGLTDYVHYLNAAKKAEVVHDEIISFELEDTDRKIALEVAMQW
FT                   TTSYNESVFTYANTINTHEGGTHEEGFRAALTSLVNRYAREKNILKDKDDNLSGDDVRE
FT                   GLTAVISVKLSEPQFEGQTKTKLGNTEAKAFVQKVAGDQLADWFDRNPNQAKEIIRKAL
FT                   QAATARIAARKARETARRKGLLESGGMPGKLKDCQSKDPTLSEIFIVEGDSAGGSAVQG
FT                   RNPETQAILPLRGKILNVEKARLDRALANNEVQAMITAFGAGIGEDFDPEKARYHKIVL
FT                   MADADVDGQHITTLLLTLLFRYMRPLIELGYVYLAQPPLYRLKWSNADDEYVYSDRDRD
FT                   AFLAEGLAAGKRIPKDNGVQRYKGLGEMDYKELWETTMNPETRTLLQVTLDDAAAVDEI
FT                   FTTLMGEDVESRRSFIQKNAKDVRFLDI"
FT   gene            7949..10525
FT                   /gene="gyrA"
FT                   /locus_tag="Lxx00070"
FT   CDS_pept        7949..10525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="Lxx00070"
FT                   /product="DNA gyrase subunit A"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00070"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88115"
FT                   /db_xref="GOA:Q6AHN0"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHN0"
FT                   /protein_id="AAT88115.1"
FT                   /translation="MTDEENAGAVFGIHGKIDQVDLQSEMQRSYLDYAMSVIIGRALPE
FT                   VRDGLKPVHRRVIYAMFDGGYRPDKAFSKCARVVGDVMGQFHPHGDSAIYDALVRLVQP
FT                   WSLRYPLALGQGNFGSPGNDGAAAPRYTETKMAPLALEMVRDIDEDTVDFQDNYDGRTQ
FT                   EPSVLPSRFPNLLVNGSVGIAVGMATNIPPHNLREVAQGALWHLAHPEASREELLEELI
FT                   KRIKGPDFPTGAQILGVKGIQDTYRTGRGSITIRAVVSIEEIQGRVCLVVTELPYQVNP
FT                   DNLAIKIAELVKDGRVGGIADIRDETSGRTGQRLVIVLKRDAVAKVVLNNLYKHTQLQE
FT                   NFGANMLAIVDNVPRTLALDGFITAWVDHQIEVIVRRTRFRLRKAEERAHILRGYLKAL
FT                   DALDEVIALIRRSATVDEAREGLKSLLEVDDIQADAILAMQLRRLAALERQKIIDEHDE
FT                   IERQITEFKAILADSARQRSIVSEELTEIVDRFGDDRRTEIMLGFDGDMSLEDLIPEEE
FT                   MVITVTRGGYIKRTRSDNYRSQHRGGKGVKGAQLRGEDVVDHFFVTTTHHWLLFFTKKG
FT                   RVYRAKAYEVQEAGRDAKGQHVANLLALQPDEEIAEILDIRDYEVAQYLVLATRDGLIK
FT                   KTALREYDTNRSGGIIAIKLRDEDELVSALLVEEDSDLLLVSRKGMSIRFTATDEAMRP
FT                   MGRSTSGVIGMHFRGDDSLLDASVVSDEGYVFVVTEGGYAKRTAADQYRLQNRGGLGIK
FT                   VAKLSDDRGDLVGALIVEEDDEVLVVLASGKVVRSAVAEVPAKGRDTMGVVFARFAETD
FT                   KIIALAKNTERNLDSQETDADSSAETETVTGEDAGDGGKEETVDEQ"
FT   gene            10515..10928
FT                   /locus_tag="Lxx00080"
FT   CDS_pept        10515..10928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00080"
FT                   /product="integral membrane protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00080"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88116"
FT                   /db_xref="GOA:Q6AHM9"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHM9"
FT                   /protein_id="AAT88116.1"
FT                   /translation="MSSSVAEKLAKKSSRRPASAKQVRLKLVYIDFWSTVKLSFLAGIC
FT                   LAIIAIVGTFLIWIVLDRTGIFDQVNSLVKDISGAGGGDLRSVLGLGQMMGFAFVVAIL
FT                   DVVVLTALGAVFALLYNLSVKITGGLLVGFTNN"
FT   gene            10986..11065
FT                   /gene="Ile"
FT                   /locus_tag="Lxx00090"
FT   tRNA            10986..11065
FT                   /gene="Ile"
FT                   /locus_tag="Lxx00090"
FT                   /product="tRNA-Ile"
FT   gene            11075..11150
FT                   /gene="Ala"
FT                   /locus_tag="Lxx00100"
FT   tRNA            11075..11150
FT                   /gene="Ala"
FT                   /locus_tag="Lxx00100"
FT                   /product="tRNA-Ala"
FT   gene            11276..11701
FT                   /pseudo
FT                   /locus_tag="Lxx00110"
FT                   /note="similar to DNA modification methyltransferase"
FT   gene            12508..13539
FT                   /pseudo
FT                   /gene="apaLI"
FT                   /locus_tag="Lxx00120"
FT                   /note="similar to type II restriction enzyme"
FT   gene            complement(13624..14487)
FT                   /gene="mutM"
FT                   /gene_synonym="fpg"
FT                   /locus_tag="Lxx00140"
FT   CDS_pept        complement(13624..14487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /gene_synonym="fpg"
FT                   /locus_tag="Lxx00140"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00140"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88117"
FT                   /db_xref="GOA:Q6AHM8"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHM8"
FT                   /protein_id="AAT88117.1"
FT                   /translation="MPELPEVTALAADLEKRLSGHVIDRLSVVAFAALKTFDPSPDALH
FT                   NATITSVSRHGKFLDIAAGELHLIIHLARAGWIGWCQGPPPAPTGWPSKGPLAARLVLE
FT                   DGSGLDITEAGTRKSLSISVVRDPAEVPGVARLGPDPLDPAFTRDVFAAILAGQGRAQI
FT                   KGVLRNQGLIAGIGNAYSDEILHVAKMSPFKPAALTDDELDRLYTAVQSTLREALTRAD
FT                   GLAASELKSEKKSGLRVHGRTGRPCPICGDTVREVIFADSTLQYCPTCQTSGKPLADRV
FT                   LSRLLK"
FT   gene            14528..14959
FT                   /locus_tag="Lxx00130"
FT   CDS_pept        14528..14959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00130"
FT                   /product="MutT-like domain protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00130"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88118"
FT                   /db_xref="GOA:Q6AHM7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHM7"
FT                   /protein_id="AAT88118.1"
FT                   /translation="MTRVDIRIAAYGVIVDGDRVLLAHWNERGRSGWTLPGGGIEPGED
FT                   PVDAVVREIAEETGFEAEAGELLGLDSKVIPAEARFQLRAVPLHVLRIVYRAKVVGGTL
FT                   TNEVGGSTDEAAWFPLDGIPSHRVDLVDTVLSMAGLTSG"
FT   gene            complement(15163..15465)
FT                   /locus_tag="Lxx00150"
FT   CDS_pept        complement(15163..15465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00150"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88119"
FT                   /db_xref="GOA:Q6AHM6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHM6"
FT                   /protein_id="AAT88119.1"
FT                   /translation="MGDVIPAVGTAVGTALSVVDHARAARSAAFTGDVRRAGRELTRRA
FT                   SVAKQRSGPGAGGVIAIGLGVITAAGLLYAVWQTFRADDELWVSDEEPTTPPVSE"
FT   gene            15843..16382
FT                   /gene="ppiB"
FT                   /locus_tag="Lxx00160"
FT   CDS_pept        15843..16382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiB"
FT                   /locus_tag="Lxx00160"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00160"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88120"
FT                   /db_xref="GOA:Q6AHM5"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHM5"
FT                   /protein_id="AAT88120.1"
FT                   /translation="MSKHTAVATLYTNYGDIKVNLFGNHVPKTVRNFAGLATGEIEWTH
FT                   PATGEKTNTPLYDGVIFHRIIPGFMIQGGDPIGQGIGGPGYQFDDEINPELDFAQPYML
FT                   AMANAGSPGGRGTNGSQFFITVGPTTWLQGKHSIFGEVADDASRKVVDKLAEVPTDAGD
FT                   RPLDDVVIESVEIEQV"
FT   gene            16406..17263
FT                   /gene="yggP"
FT                   /locus_tag="Lxx00170"
FT   CDS_pept        16406..17263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yggP"
FT                   /locus_tag="Lxx00170"
FT                   /product="rhomboid family membrane protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00170"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88121"
FT                   /db_xref="GOA:Q6AHM4"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHM4"
FT                   /protein_id="AAT88121.1"
FT                   /translation="MSQPVGAPMSTCYRHPGRVSYVLCQRCERTICGECQTPAAVGVVC
FT                   PECMAQQRSTAPRTKPAWLTRVTAPGAPVVTYAIIAVCVVVFLLQNAPIVGGRIESALI
FT                   YAGGYSHPTGSLSPLIAFEPWRMLTSLFAHASLIHLALNMYTLWVFGIALEPMLGRLRY
FT                   AALFLIAGFAGSLAVLLITPPGQGVLGASGAIFGMFGAFFIIQRRLGGNATQILTLVAI
FT                   NLAIGFIPGLNISWQAHIGGFIGGLLLGLIYVETSKPSRRRWQLSLTALLCALLIAVSL
FT                   LHFF"
FT   gene            complement(17482..17742)
FT                   /gene="whiP"
FT                   /locus_tag="Lxx00180"
FT   CDS_pept        complement(17482..17742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="whiP"
FT                   /locus_tag="Lxx00180"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00180"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88122"
FT                   /db_xref="GOA:Q6AHM3"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHM3"
FT                   /protein_id="AAT88122.1"
FT                   /translation="MARSKSKTKPDRSTRPERSSLASGEEAPNPVWFKPVMFGFMLLGL
FT                   VWIIVFYMSQNQYPVPALGPWNILVGFGIAFIGFLMTTRWR"
FT   gene            17919..18668
FT                   /locus_tag="Lxx00190"
FT   CDS_pept        17919..18668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00190"
FT                   /product="membrane protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00190"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88123"
FT                   /db_xref="GOA:Q6AHM2"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHM2"
FT                   /protein_id="AAT88123.1"
FT                   /translation="MSERTPLAPRITFLGVVGEMLITAGVLVGLFLGWQLWFNNLVMAG
FT                   QQTSAAAKQSQQWVNDALTTPAPTPAPSEDGTITPPVMAQPADYETFAVIYIQRLGADW
FT                   KRSIRQTVDVQRVLNSYTAGVGHYADTQMPGQVGNFAVAGHDSGWGNTFIDLSKLHIGD
FT                   RIYVQTKDGWYTYVFRNFEYVQPSAIQVIAAVPRHPEVEPVERLMTITTCNPPFHSGER
FT                   LIAYNVFERFAPAQDIPAEIAAAVNGG"
FT   gene            18828..19466
FT                   /gene="trpG"
FT                   /locus_tag="Lxx00200"
FT   CDS_pept        18828..19466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpG"
FT                   /locus_tag="Lxx00200"
FT                   /product="anthranilate synthase component II"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00200"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88124"
FT                   /db_xref="GOA:Q6AHM1"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHM1"
FT                   /protein_id="AAT88124.1"
FT                   /translation="MTRVLVIDNYDSFVYTLNGYLLELGAETDVVRNDDIPVEELTARL
FT                   AEYDAVLVSPGPGKPVDAGVSIPAVTAAFESGQPLLGVCLGHQAIAEAFGGGVTNAEEL
FT                   MHGKTSLVEHDSSTLFDGVPQPFTATRYHSLAVVEGTLPEELVVTARTLGGVIMALQHR
FT                   DVAIYGVQFHPESVLTEGGYRMLGNWLEVAGITGAAETARSLNPRVKHS"
FT   gene            complement(19497..21194)
FT                   /gene="pknB"
FT                   /locus_tag="Lxx00210"
FT   CDS_pept        complement(19497..21194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pknB"
FT                   /locus_tag="Lxx00210"
FT                   /product="serine/threonine kinase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00210"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88125"
FT                   /db_xref="GOA:Q6AHM0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHM0"
FT                   /protein_id="AAT88125.1"
FT                   /translation="MSIDGRLLAGRYQVGELIGRGGMSDVHRGTDTRLGRTVAIKLLKP
FT                   SLATDPSFRTRFRQEAQAAARMAHPTIVRVFDAGEETVRETDGHEAQLPFMVMEYVDGV
FT                   LLKDLIKAGTLETEETVRITDGILTALEYSHRAGVVHRDIKPGNVMITKSGQVKVMDFG
FT                   IARAISDSSATVAQTTAVLGTASYFSPEQAKGESVDARTDLYSTGVVLFEMLTGRPPFR
FT                   GDTPVAVAYQHVSETAVAPSTINPKVSPAMDDVVAHSLAKDRFERFQTVAEFRTHLEEA
FT                   AAGRVPRRKGAEKFSKTLFGAPPSEVSGPEAAFRQLAEDQTITRTQRRPPVIWIWAGVA
FT                   VMAVVIVAVLAWVLRLAPSVTMPETSREVPSLTGQTIDAATKQLEGLRLKWTQTTETSS
FT                   IYPEGQIMRTDPAPGIVVATGDTINLFVSSGKKTVTVPDVHNMTVDAAKAALEAAGLAL
FT                   GPTTTESSATIGANIVLSSTPAAGGSAHEGDSIALRVSSGKVTLTDLTGQSISAATGVL
FT                   QQLGLTAQPKADPSCPQDKGAPMVRTQSVTPGDVPQGTTVELTYCTGS"
FT   gene            complement(21267..22988)
FT                   /gene="pknA"
FT                   /locus_tag="Lxx00220"
FT   CDS_pept        complement(21267..22988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pknA"
FT                   /locus_tag="Lxx00220"
FT                   /product="serine/threonine kinase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00220"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88126"
FT                   /db_xref="GOA:Q6AHL9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHL9"
FT                   /protein_id="AAT88126.1"
FT                   /translation="MRPTAGLTFGGRYELQSRIAIGGMGEVWQATDLVIGRTVAIKILK
FT                   DEYLGDPGFLERFRAEARHAALVNHEGIANVYDYGEEEGSAYLVMELVPGEALSTILER
FT                   EHILSTDRTLDIVAQTAAALHAAHAAGLVHRDIKPGNLLITPDGRVKITDFGIARIADQ
FT                   VPLTATGQVMGTVQYLSPEQASGHPASPTTDIYSLGIVAYECLAGRRPFTGESQVAIAM
FT                   AQINEAPPELPAIVAEPVRNLVFTCIAKNPADRPSSAAHLARAAQALRRGDVRAAAASV
FT                   PAILGAAAATDTSTVLMTSSGGAATQATAILPSAAGHRAGEQTTDEEAEEKKRSPWTWP
FT                   LIALIALLALVLIGTIIALLVQPNDKTPETPTGTAHSTPATTPTPVAVAATTPPSTTAQ
FT                   IAEGDFVGLTADQARQRLDTLGMVTDVQTGSAATESSKVSTVYSVNPTGPVPKGTTVTV
FT                   KVYGPVTPIPTPGDSVTVHPPSGQGTANSQIVVSFGSAICPAGQSLTGRALYVNGQKQT
FT                   PVNDTKFTWSPSNAGDYSLTYTIFCNQGESVESAQSAAVDYKVLPATGPVNPPSSP"
FT   gene            complement(22985..24406)
FT                   /locus_tag="Lxx00230"
FT   CDS_pept        complement(22985..24406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00230"
FT                   /product="penicillin binding protein, transpeptidase
FT                   domain"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00230"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88127"
FT                   /db_xref="GOA:Q6AHL8"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHL8"
FT                   /protein_id="AAT88127.1"
FT                   /translation="MLAMFLALLVSTSIIQVFQTDALAADARNTRARNDSYAAQRGAIL
FT                   VAGQPVAQSVPSTDMYKWQRVYSNGPLYSAVTGFYPINGEATGLEGALDDKLSGTSNSQ
FT                   FFDRINAILTGKNPQGASVETTIDPVAQQAAWNALGDQRGAVVLLDPKTGRILAMVSKP
FT                   NYDPNTLAGHDTEAVNATYQHLLEASGDPLINRTIGGNLNPPGSTFKPVMSAAAFGTGD
FT                   YTENSQLPNLASLQLPGSATIVKNDSLSTCGPGETVSIATAQILSCNIPFAELGMQLKP
FT                   EVIKDQADKFGFNQPLSIPIPVAKSTYPLYADPAQRALGSFGQMNDQATPLQMAMVSAA
FT                   VANGGKLMTPNLVDSIRSADLQTIESFQAREFSEPMSQPTADTIKQMMVDGVDRGVASN
FT                   ARIDGVQVGGKTGTAQNGASDPYTLWFTGFAPVDNPRFAVAVVVENGGGRGQSGTGNQI
FT                   AAPIAKKVLEAVLNK"
FT   gene            complement(24441..25820)
FT                   /gene="ftsW"
FT                   /locus_tag="Lxx00240"
FT   CDS_pept        complement(24441..25820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="Lxx00240"
FT                   /product="cell division membrane protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00240"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88128"
FT                   /db_xref="GOA:Q6AHL7"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHL7"
FT                   /protein_id="AAT88128.1"
FT                   /translation="MGERRRARSDIGPVKRLRLPAKQRNLELFLLIIACGINAAAIVLV
FT                   QLGALGHINLTLVYFGAGLSAIVIGMHIALRFVAPQADPFLLPIASVLTGIGIAEIYRI
FT                   DIHFKVTGWNADGIKQIAWAGIAIVCAIAVIVVIRNHRVLQRYTYIFGFAALVLLLLPM
FT                   LPGIGKEIYGARVWIGIGPFSFQPGEIAKLCLAVFFACYLVQARDSLSAVGKKVLGIRF
FT                   PRARDLGPILIVWLMSVAVIVFQRDLGTGLLIFGLFLVMLYVATSRISWVLLGLLLIVG
FT                   GAFVASQVLVYVHDRFENWLIPFSQRVYQEEGGSYQLVQGLFGLAHGGLIGTGLGQGQP
FT                   WVTPVARSDYIIASLGEELGLAGLFALFALYLVFVARGLRIGFAGQDDFGKLLAVGLSF
FT                   TVALQCFIVIGGVTRVIPLTGLTTPLLAAGGSSLVANWIIVALLLRLSDTVRNQPRLVV
FT                   S"
FT   gene            complement(25822..27066)
FT                   /locus_tag="Lxx00250"
FT   CDS_pept        complement(25822..27066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00250"
FT                   /product="protein phosphatase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00250"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88129"
FT                   /db_xref="GOA:Q6AHL6"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHL6"
FT                   /protein_id="AAT88129.1"
FT                   /translation="MAANRAAAVSHVGKIRSNNQDSGYAGRDLFVVADGMGGHAGGDVA
FT                   SAIAIGRIREADRDYATASEAESALQSALIAANSLLAETVFEHPELTGMGTTVSAMIRV
FT                   GDQVALAHIGDSRIYLFRTGKLKQVSTDHTFVQRLVDSGRITEEEAMVHPRRSVLMRVL
FT                   GDVDASPEIDTWTLETRPGDRWLICSDGLSGVVKHDDLQAALAAKDSPKQVADKLLKQS
FT                   LEAGAPDNVTAVVLDIGDVSRGDVIKDPVIVGSAAAPLQFGEPRPVTRASRLPTLRIHP
FT                   IRPATGPTHFESESEGYLDELIEEDARRFRRRRLTWRIGLAALLIAIAGGVLVSYQWTQ
FT                   SRYFVGVSSSGNVAIFQGVQQNLGPIVLSHVYKESDVPVSALTAYDKQLVQQTINADNL
FT                   AAAQTIVDRLSNVRQ"
FT   gene            complement(27070..27627)
FT                   /locus_tag="Lxx00260"
FT   CDS_pept        complement(27070..27627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00260"
FT                   /product="secreted protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00260"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88130"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHL5"
FT                   /protein_id="AAT88130.1"
FT                   /translation="MIPSELTLLVLRFGFLLLLWLFVFGIVYALRTDLFGQRVRKLTEA
FT                   QAAAFPAAPPARVAEPTATVLQHAPVSTLPAGANMAGGTKASVQTAHRLVISSGPRAGT
FT                   ELALGRDPITIGRSNESGLVIRDDYTSTHHARLLLWNDEWMIQDLDSTNGTFLDGRRVT
FT                   VPTQVLLDTPIKIGTTTFELRR"
FT   gene            complement(27624..28337)
FT                   /locus_tag="Lxx00270"
FT   CDS_pept        complement(27624..28337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00270"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00270"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88131"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHL4"
FT                   /protein_id="AAT88131.1"
FT                   /translation="MGILDNFERGLERAVNGAFAKTFRSGLQPVELTSALRKELDTRAA
FT                   VVSRDRVLAPNRFVLRMSPADHKRMGSMGIALTDELIAFAQKHATAQHYQFAGGLSVEL
FT                   REDPDIAVGMLEIDSENVKSEIAWTPVLDVNGQHHPLTHARTVVGRGSEADITVDDTSI
FT                   SRKHVMITWDGNRAQVEDLGSTNGSKLNGEPFGKAILEPDSVIALGRTRIVFRVLPQAA
FT                   PVSGDTNRDNFWGPS"
FT   gene            28490..28579
FT                   /gene="Leu"
FT                   /locus_tag="Lxx00280"
FT   tRNA            28490..28579
FT                   /gene="Leu"
FT                   /locus_tag="Lxx00280"
FT                   /product="tRNA-Leu"
FT   gene            29067..29405
FT                   /locus_tag="Lxx00290"
FT   CDS_pept        29067..29405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00290"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00290"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88132"
FT                   /db_xref="InterPro:IPR003790"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHL3"
FT                   /protein_id="AAT88132.1"
FT                   /translation="MSPFGIWEHKANDSRGSDTPTSSSSTYSKQVYADTLGWVKAGILD
FT                   YIVPQVYWSSDQPVAPYGEIARWWNNAVEGTNVRLYIGQPNYKYTLFGPKEVAWTNPDE
FT                   VPNQLLFN"
FT   gene            complement(30026..30745)
FT                   /gene="aroE"
FT                   /locus_tag="Lxx00310"
FT   CDS_pept        complement(30026..30745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="Lxx00310"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00310"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88133"
FT                   /db_xref="GOA:Q6AHL2"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHL2"
FT                   /protein_id="AAT88133.1"
FT                   /translation="MGLNIVYKAFTTDDLDGAVRGIRALGFRGCSVSMPFKEAIIPLVD
FT                   ILEPSALEIESVNTVLNEGGLLSASNTDYEAVAQLLAEHRVDTAKRVLVRGSGGMAKAV
FT                   VAAFRGSGFDDLTVFARNEQAGLALASRYGYRWVAGEPAAEFDVIVNVTPLGMRGADED
FT                   AVAFGEEHIRRADTVFDVVAFPAETPLIAKSRAAGKSLITGAEVIALQAARQFERYTGV
FT                   TLTPDQIVRASEFSRAE"
FT   gene            31125..32672
FT                   /locus_tag="Lxx00320"
FT   CDS_pept        31125..32672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00320"
FT                   /product="multiple sugar (arabinose, xylose, galactose,
FT                   glucose, fucose) putative porter"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00320"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88134"
FT                   /db_xref="GOA:Q6AHL1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHL1"
FT                   /protein_id="AAT88134.1"
FT                   /translation="MLSNAVILQMRAITKEFPGVKALEDVSLTVRAEEIHAICGENGAG
FT                   KSTLMKVLSGVYPFGTYSGDIVYQSEIMRFKNIKSSEQQGIVIIHQELALIPELSITEN
FT                   IFLGNEPVRFGVIDWREAKSRAVELLARVGLSDDPDTQIKNIGVGKQQLVEIAKALNKH
FT                   VKLLILDEPTAALNEAESAHLLDLIVGLKHKGVSSIIISHKLNEIEKVADQITIIRDGR
FT                   AIETLDVKADGVDEDRIIRGMVGRSLESRFPDRTPDIGEVLFEVRNWVVQHPQDPERLV
FT                   VKNSSFTVRRGEIVGFAGLMGAGRTELAMSVFGRSYGTFVSGELYKDGKQIQVRTVSEA
FT                   IDNGLAYVSEDRKVLGLNLLDDIKQSIVSAKLKKIATRGVVDDQKEYAVAEEYRKSLRI
FT                   KTPDVDRGVATLSGGNQQKVVLAKWMFTDPDILILDEPTRGIDVGAKYEIYAIIQQLAA
FT                   QGKGVIVISSELPELLGISDRIYTIFEGQITDELPILEATPEALLKSMTSAKKKATR"
FT   gene            32675..34024
FT                   /gene="araH"
FT                   /locus_tag="Lxx00330"
FT   CDS_pept        32675..34024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araH"
FT                   /locus_tag="Lxx00330"
FT                   /product="L-arabinose ABC transporter, permease protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00330"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88135"
FT                   /db_xref="GOA:Q6AHL0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHL0"
FT                   /protein_id="AAT88135.1"
FT                   /translation="MSTQIPAKKKSGGIRDLGKMFGGGQSTGRQFGILGALVVIVVLFQ
FT                   ILTDGKTLDPVNLINLVNQNAYVLILAIGMVMVIIAGHIDLSVGSVAAAVGIVVAKAMT
FT                   EWHVPWPLAVLLGLVIGVAIGAWQGWWVAYIGVPAFIVTLAGMLIFRGLNQLIGSANTI
FT                   PVPDGFTFIGGGFLPEWGPDTGYNNSTLLLGLIIAIVIVLLEMRTRRTQTKMGSDKAPL
FT                   WVSTFKVIVLDALVVYFTFLFAGGRVGTSFPVSGIILGVLIIVYSFVTRSTIFGRHIYA
FT                   VGGNSHAAELSGVKIKRVNFFVMMNMSVLAALAGMIAVARSVSSGPQDGLGWELDAIAA
FT                   VFIGGAAVSGGIGTVAGSIVGGLVIAVLNNGLQLLGVTSDWVQVIKGLVLLIAVGVDVY
FT                   SNRRGGPSLIGRLFGGGRRPESATDAVGIDQPAVLPTSSAAEESSRSLTN"
FT   gene            34092..35162
FT                   /locus_tag="Lxx00340"
FT   CDS_pept        34092..35162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00340"
FT                   /product="multiple sugar-binding periplasmic receptor"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00340"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88136"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHK9"
FT                   /protein_id="AAT88136.1"
FT                   /translation="MAAAAAAALVLSGCSSRDGSSGSSTASGFDKGATIGVALPTKTSE
FT                   NWVLAGDLFTNGLKDAGFKGDVQYAGASGAVADQQSQIQSMITNGAKVIIIGAVDGGQL
FT                   AAQAKAAHDAGATVIAYDRLILNTPNVDYYVAYDNEKVGELQGQALLDGMKKRFPDKTK
FT                   YNIELFSGSPDDANSKVFFDGAMKILQPKIDDGTLTVVSKQTDIKQTATQGWLPANAQT
FT                   RMDNLLAANYASTELDGVLSPNDTLARAIITSVKGAGKPIPVVTGQDSEAESVKSIMAG
FT                   EQYSTINKDTRNLVKQAIAMVSDLQQGKKPETNDDKSYNNGVKVVPTYLLKPVIVTKEN
FT                   AAEAYANDPTLEPLTE"
FT   gene            35560..36021
FT                   /pseudo
FT                   /gene="tnp"
FT                   /locus_tag="Lxx00350"
FT                   /note="similar to transposase, ISlxx4"
FT   gene            37296..38450
FT                   /locus_tag="Lxx00370"
FT   CDS_pept        37296..38450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00370"
FT                   /product="DNA-binding helix-turn-helix protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00370"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88137"
FT                   /db_xref="GOA:Q6AHK8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHK8"
FT                   /protein_id="AAT88137.1"
FT                   /translation="MNPQMLTLLRESRGYSGAQLAKLAGIPQPTLSKVENGLAVIDEAR
FT                   LQQLAEALDYPVEAFNWTDPIYGFGSVAFYHRKQQALPQTTLRKIQAQVNLTRMRLDKL
FT                   LRSIEIDTQYVVPCLEVEQYGTPAAVARAVRALWRMPMGPIRDMAAALELAGIIVVRSN
FT                   LESTRIAAISLDNVGIYPALMILNTGLPSDRERFTLAHELGHLVMHSALVDTDEAEREA
FT                   DAFAAEFLMPAAEIRTELKGITLARAAQLKVVWRVAISALIRRAYDLGVIENTRYKSLM
FT                   VSMSQKGWRKSEPIEVTRDHPTVVSSLIKVHLTDHNYTFDELAQVVALNRDEFAARFDM
FT                   EFFHPDQPRSPHLRALNKERHNNQPSVPSSAEWGRGCYGEVVRP"
FT   gene            39767..40810
FT                   /locus_tag="Lxx00380"
FT   CDS_pept        39767..40810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00380"
FT                   /product="secreted hydrolase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00380"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88138"
FT                   /db_xref="GOA:Q6AHK7"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR037460"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHK7"
FT                   /protein_id="AAT88138.1"
FT                   /translation="MTSVVAGLTFSLVGVQSASAFAPAGNLSPRAVGVGSMSSGQRVVM
FT                   TSGHDIVSIGDSFTAAYGVGTDVGGPAAVCGQSDSSVGRLVGSAAGYSVTDVTCKGATA
FT                   REMVNGQDTTDSDGKKIHIPPQINALNPSTGMVLVSAGGNDLGFLGIITSCLAESGKGP
FT                   VIATGSKTCRQDYVKNGHDELDRKITNVVGPALDALYGQISARAPQARKFAYDYPDLFP
FT                   DRANTPAAGCYAFTTTGTGDSKETDMPFTDKDVVYLHQVQDKLNALINREAEKYGFTLL
FT                   PASSRSQARTACSAAPHWVNGLNAFGAPDRNGEAFHPTRVGIAHYVYVFKYETKKNRHG
FT                   VQREPAP"
FT   gene            complement(41320..41652)
FT                   /gene="5"
FT                   /locus_tag="Lxx00390"
FT   CDS_pept        complement(41320..41652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="5"
FT                   /locus_tag="Lxx00390"
FT                   /product="phage-related protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00390"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88139"
FT                   /db_xref="GOA:Q6AH54"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH54"
FT                   /protein_id="AAT88139.1"
FT                   /translation="MSDAVLLGAIGSMQAVAVALIYVMGRRQARSTDAIRYEVTNDHDQ
FT                   PLRDDMDEKHGAVIRGINTVAVTVRTIMRDIGGIRHDIRQLRSDLSHTDQHIDNLEHPR
FT                   LPEGES"
FT   gene            complement(41660..42607)
FT                   /gene="lysL"
FT                   /locus_tag="Lxx00400"
FT   CDS_pept        complement(41660..42607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysL"
FT                   /locus_tag="Lxx00400"
FT                   /product="phage-related lysozyme"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00400"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88140"
FT                   /db_xref="GOA:Q6AH55"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH55"
FT                   /protein_id="AAT88140.1"
FT                   /translation="MTLLEGVDISYMQGDYTPAGEDFVIINASRANIGLTVGSCYRAQV
FT                   AGAREAGKHVGHYFFNGNLDPVVCADFFIANLAYEVGDSLWLDVEAEPSTNTAAWDPAQ
FT                   ALAFLNQVKTRLGVVPGVYLNKSLMDGMDWSAVVAVGAPLWIASYNPPPPPIRWWPTWT
FT                   VWQYTSTPIDRNKAQTSLITAFTTPTLLEDDMRIQMIKTGDASGAIGTLNPDGTLDWLT
FT                   ADEFQALTRTGLVEPVHAEGDGTVWGILASRTARLRAQQGGDPVALAKSVSALLVPAVL
FT                   AGIQANSGLSLTPEQVQAACETAIKDVFAHASQG"
FT   gene            complement(43317..43583)
FT                   /locus_tag="Lxx00410"
FT   CDS_pept        complement(43317..43583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00410"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88141"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHK4"
FT                   /protein_id="AAT88141.1"
FT                   /translation="MCSNKAANVSAFSYLTITIPELGITQTDGPNVFVPSDQQTQRARA
FT                   GTWAELPVTAGDTFTVTARGDAYNTGTNADNYLSIDALAIFQY"
FT   gene            43717..44178
FT                   /gene="tnp"
FT                   /locus_tag="Lxx00420"
FT   CDS_pept        43717..44178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnp"
FT                   /locus_tag="Lxx00420"
FT                   /product="transposase, ISlxx4"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00420"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88142"
FT                   /db_xref="GOA:Q6AHK3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHK3"
FT                   /protein_id="AAT88142.1"
FT                   /translation="MSHVNAALTPRARLRLARLIVEDHWLVSVAAKMFMVSPVTARKWA
FT                   ARFRAEGTGGMTDRSSRPRSMPTRTPLPVLKRIVRARWRRRLGPVQIAGELGLPASTVH
FT                   AVLVCCRINRLCTIDRVTGEPIRRYEHDHPGSLIHVDVTKFGNIPDGGG"
FT   gene            46023..46373
FT                   /gene="mut"
FT                   /locus_tag="Lxx00440"
FT   CDS_pept        46023..46373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mut"
FT                   /locus_tag="Lxx00440"
FT                   /product="MutT-like domain protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00440"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88143"
FT                   /db_xref="GOA:Q6AHK2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHK2"
FT                   /protein_id="AAT88143.1"
FT                   /translation="MQQIPYVTALITDASGRILLGRHTRDQLWGTIGGALKTEEDPRLG
FT                   LSREVFEELSIEVEVGRLLNAHCGPLTTTTYESGDVVNVLALVYECSMTDPAAALTLDE
FT                   TEISEANWFTEA"
FT   gene            complement(46604..47908)
FT                   /locus_tag="Lxx00450"
FT   CDS_pept        complement(46604..47908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00450"
FT                   /product="phage-related integrase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00450"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88144"
FT                   /db_xref="GOA:Q6AGX3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGX3"
FT                   /protein_id="AAT88144.1"
FT                   /translation="MPKKRSPGEGGLHYDRAKGLWRGRYDDGFHPDGRRRQREVSARTQ
FT                   TVARERLKQKLAEIAEYGTTLGRTVTVAAWAEHYIETDCWMRLKPNSLATTESLMRNWI
FT                   VPLLGRRRISELKPSDVRLVHKAVFDAGLATGTARKAHEILSGMLSAAKADGLVTRNVV
FT                   DDVKPPEVIAKNPRGSLSTEQALAVLAASANVEGTRWWVAVLDGIRQSERLGALIEGLD
FT                   LDAGTLRVDWQLEELRSEHGCEPLAEGQWSCLTKRGSSFPQRRFKVKSSLEYIHLYGRL
FT                   ALIRPKLGKSRTVPLIPPVVAVLHEYLEATKDRPNPYGLLWRHEDGRPYLPHEDQQLWR
FT                   DLLFRAGVINQEQTKPPKDRTPGTPGIPTTHWARHTTATALMELGVDAKIVGEIVGHVD
FT                   EKTTRRYQHVSSPTARDAMERLSSHFKDALHTPTG"
FT   gene            complement(48277..48990)
FT                   /locus_tag="Lxx00460"
FT   CDS_pept        complement(48277..48990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00460"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00460"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88145"
FT                   /db_xref="GOA:Q6AHK0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHK0"
FT                   /protein_id="AAT88145.1"
FT                   /translation="MFSLPGGSSPSQPASFRGGNEMPMPTDHVARISLSEEAYVRIEAA
FT                   IMDGTLEPGERLREPDLVEWLGISRTPIRHALDRPAEQGLVEMERNRYTKVARFDIEGV
FT                   LAAVEVAGDLWAGAALRGGPEWDDDADALIADMEANLVEAEETEDLLTFATVFEHLVVA
FT                   FARVEGNEVRLRALTVVIPQVRRVARKLRGSLDPNALREFTSKLRAATTARDGRAARML
FT                   IEDYVTRLSGMLHTL"
FT   gene            49110..49751
FT                   /locus_tag="Lxx00470"
FT   CDS_pept        49110..49751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00470"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00470"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88146"
FT                   /db_xref="GOA:Q6AHJ9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHJ9"
FT                   /protein_id="AAT88146.1"
FT                   /translation="MPALTTDRRLLRNDVFEMLLERIMNGSFAPGERLKDAELTAWLRV
FT                   SRTPVREALSRLAVVGLIKTAPNRFTVVAPMVDAEIAGAIAVLRRIYPDAVAEALETAG
FT                   DDAELELSLLAGRLERDLTVSSVETFQRMMGVVLLYLRNQVLAETVETVHLRLIRYLSL
FT                   DPAAQGLLSRERVLGFSRALCSRDTAAVRAIESLLVDAEHLLTPPVAAAG"
FT   gene            complement(49911..51044)
FT                   /locus_tag="Lxx00490"
FT   CDS_pept        complement(49911..51044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00490"
FT                   /product="serine protease"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00490"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88147"
FT                   /db_xref="GOA:Q6AHJ8"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHJ8"
FT                   /protein_id="AAT88147.1"
FT                   /translation="MIAGLSNGAIKTAGSLIGLACGLALGLALAPAVVEWMAASGLTGV
FT                   SQRSIVAAVVILVCATVMYAIATAAAALIGKLLRHGPVRWLDSLIGGALGVLTWAVAVW
FT                   LVAGFAMATSLATVVQAASSSRVVETLNGIAPLPSSSVLGAVDDALTSAGLPKVFEDAE
FT                   PIKNVQAPGDSVPAAVAKSRNSVVTVLASKPACGIDSEGSGWVVQPGRVVTNAHVVAGA
FT                   ASVVIRDGDTIDRATLLAFDPERDLAVLGVTGLSAPPLDIGQDLGAGEAAYAAGYPGAG
FT                   PFAISPQRVRDQLIARGTDIYQGGVVEREIYSLRGSVRPGNSGGPLLDSAGDVVGVVFA
FT                   RSTVDPETGYALTLDELRPVLSSVGSVAISSGACSAG"
FT   gene            complement(51177..51731)
FT                   /locus_tag="Lxx00500"
FT   CDS_pept        complement(51177..51731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00500"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00500"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88148"
FT                   /db_xref="GOA:Q6AHJ7"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHJ7"
FT                   /protein_id="AAT88148.1"
FT                   /translation="MTLTFNAPALNLTGAGALLTVTGPDGGSQHFETGCAAISGSTISA
FT                   PVSLGIGGRYTVTYQAVSSDGHTVSNSYAFAYQPPPGSAAAAGSATTLCGATAALAGPE
FT                   PTAHATTEPAPAATDTASTLQPAKASDENALGLVIGIAIAIVVLALAAVVVVLTAHRKT
FT                   PASDGDVEEAAEGDSGSGERR"
FT   gene            51946..53229
FT                   /locus_tag="Lxx00510"
FT   CDS_pept        51946..53229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00510"
FT                   /product="transcriptional regulator, ROK family"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00510"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88149"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHJ6"
FT                   /protein_id="AAT88149.1"
FT                   /translation="MPRGANLPAIAAFNETVVLDAVRRSADGLSRVEVAAATGLSAQTV
FT                   TNVTRRLLAQGVIREAGKHSEGSPGKPRTILRLDPAGAYAIGVHLDPTVITCVLLDLEG
FT                   VVVNHLRCLSSPDGDAVATLAVAAEAIAVLLTTQGVDSGRAIGVGVATPGPIDTETGVV
FT                   VRPPLIPGWNDFHLRDELTAATGLPVLLAKDVTSAAVAERWHGPAGASGDYAFVYYGTG
FT                   VGVGFVLGGSVYTGFTDNAVDVGHALVDPGGALCACGRRGCYGESVRPYRLVMQGLWAG
FT                   ILPVPPGLEIVAGEDAPLDVETVDALFTCLAAAAAAGDERAVEIVDRSIRSTAFYLSNL
FT                   TALLDLDRVVFGGPFWTRVESRYLDQLPQRLAELHIDTLTHPTAIVASAVGDDVAAVGA
FT                   ACLVLDATSRREAKAEWNFEFYIPLTWG"
FT   gene            53333..54689
FT                   /pseudo
FT                   /locus_tag="Lxx00520"
FT                   /note="similar to sugar-binding protein"
FT   gene            54720..55652
FT                   /locus_tag="Lxx00540"
FT   CDS_pept        54720..55652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00540"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00540"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88150"
FT                   /db_xref="GOA:Q6AHJ5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHJ5"
FT                   /protein_id="AAT88150.1"
FT                   /translation="MAGPVRSGHRASGRRNVRVPRPAAPSPGLSPWCLPSACWWSSCSG
FT                   PSSLHFYGSFTNMSLTGSAAASSEWVGLRNYIDLFESPDFPVSVWLTLVFLLGSAVIGQ
FT                   NVVGMALALLMRSGSRWVGALVSTFVVGAWVLPEIVAAFASYAFFSQHGTLNAILAVFG
FT                   ITGPSWLFAFPMLSIILANTWRGTAFSMLVYSAALQEVPPEITEAAEVDGANGAKRFFL
FT                   VTLPMIRRSVSTNLMIITLQTLSVFTLIYVMTGGGPGNKSMTLPVLAYQEAFKFSELGY
FT                   GTAIATILLLVGAVFAIVYVRALKTEADS"
FT   gene            55649..56485
FT                   /locus_tag="Lxx00550"
FT   CDS_pept        55649..56485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00550"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00550"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88151"
FT                   /db_xref="GOA:Q6AHJ4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHJ4"
FT                   /protein_id="AAT88151.1"
FT                   /translation="MKLSSPNGIALKWTANVLLLLIGIVFVLPLVWVVLASFDGAATLS
FT                   VAWPKEWTIENFHKVLTPELAFLPLWNSLLLSAGCAIVTVVVAVLAAYPLSRYRNRFNR
FT                   PFLYAILFGMCLPITAMMVPVYSLFVSLNLIDSLGGTILFMAASSLPMAIWMTKNFVDS
FT                   VPISLEEAAWVDGASSMKTLWTVVVPLVRPGIAVVFIYVFVAAWGNFFVPFVLLLSPEN
FT                   QPAAVSIFTFFGQYGAVAYGQLAAYSLIYSVPVIALYVIVSRSLGGSSALAGAVKG"
FT   gene            complement(56559..75368)
FT                   /pseudo
FT                   /locus_tag="Lxx00560"
FT                   /note="similar to alpha-mannosidase; Lxx00580; Lxx00770"
FT   gene            57113..58324
FT                   /gene="tnp"
FT                   /locus_tag="Lxx00570"
FT   CDS_pept        57113..58324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnp"
FT                   /locus_tag="Lxx00570"
FT                   /product="transposase, ISlxx5"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00570"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88152"
FT                   /db_xref="GOA:Q6AGR9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGR9"
FT                   /protein_id="AAT88152.1"
FT                   /translation="MQGRVPGAAEQRALAPRSGGTSRNQPEHGIPLGQSNGRRIYPDGR
FT                   VVDYKDRVPVVVDPVQRASMRSLEAALHPRFLSLQERELIRDLTRAGLSLCRVAAKLGR
FT                   SVSTISREIRRNQLPGEGGYHPYVAHRKAASRRPRPKATRLVRNPQLRSYVQRKLTLRW
FT                   SPEQISRSLIREFPGDAEMRVAHETIYQAFYVQGRGQLRRELTMVLRTGRAKRKPHRSG
FT                   AARRHRFADPMVMISDRPAEIEDRAVPGHWEGDLIIGGHRNSAIGTLVERSTRFVMLIH
FT                   LPIDRTAESVRDGLISAVKTLPRELRRSITWDQGSEMAAHKSFTIATDIPVYFCDPASP
FT                   WQRGSNENTNGLLRQYFPKGKGTDLARFTATDLTNVAHELNTRPRKTLGWETPAERLAK
FT                   LLAS"
FT   gene            60277..60648
FT                   /locus_tag="Lxx00600"
FT   CDS_pept        60277..60648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00600"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88153"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHJ2"
FT                   /protein_id="AAT88153.1"
FT                   /translation="MDFWVLIAVGAIVAAIVVAVKLGFIDLSDKSRRGSGTISGAVGGS
FT                   FDEIFAPARHEAQQELDRHSLLPAPAPLAGGEGGTGLWEGGKIRLDLGAAGRGQRAEGR
FT                   TPGDSGRARLPPSRRYTRG"
FT   gene            complement(60660..61310)
FT                   /pseudo
FT                   /gene="tnp"
FT                   /locus_tag="Lxx00605"
FT                   /note="similar to transposase, ISlxx4-truncated"
FT   gene            61552..62598
FT                   /gene="kdgK"
FT                   /locus_tag="Lxx00610"
FT   CDS_pept        61552..62598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdgK"
FT                   /locus_tag="Lxx00610"
FT                   /product="2-dehydro-3-deoxygluconokinase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00610"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88154"
FT                   /db_xref="GOA:Q6AHJ1"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHJ1"
FT                   /protein_id="AAT88154.1"
FT                   /translation="MEATAEQPRAGVPRTGLLATIGEAMVVLYPEDRRPLAEAHTYASA
FT                   VGGAEYNVATSLARLGLPTAWISRLGADGLGDRILKTANEAGVDTSAVERDELRPTGLY
FT                   LKETSDGPDGVRTRMRYYRRDSAAAALSNGLLRSAPAADLLGRASIVHTSGITPALSAS
FT                   AAEAMSDLRSAIGPQTIVSVDLNHRPLLWAGRETEPLDALIGQADILLLGRDEAEAYAG
FT                   HADPERFFAANPRLGVLVVKDDARRASVYRRDGGETHVPCLTVEVVEPVGAGDAFASGF
FT                   LCGLAEGRDDASALRLGHALAALTLIGHGDRPLTVPDNAQRDRIAAVPETEWAGWSVRP
FT                   GEIPWNGA"
FT   gene            62595..63383
FT                   /locus_tag="Lxx00620"
FT   CDS_pept        62595..63383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00620"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00620"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88155"
FT                   /db_xref="GOA:Q6AHJ0"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHJ0"
FT                   /protein_id="AAT88155.1"
FT                   /translation="MSQSVGRALDLLDLVSSGVATLDAMAAEIGVHKSTVLRLLQTMEQ
FT                   RGYVGRDSNHRYHIGRTVFALASAAQESQDVRATAAPHLRALAAETGQTVHLATYADGV
FT                   VTYIDKMESRQPLRMYSRVGLPAALHATAVGKVLLSALDPAERQSIAAGVPYERYTDRT
FT                   IAGPDELLAEVARTAGRGWAEDHEEHETFMNCVGAPVFGPDGRIAAAVSLSVPNVVLPY
FT                   ADVLGLLPALLDTTARISAELGAHPDDLPQPVLPPSDLPR"
FT   gene            63395..63799
FT                   /locus_tag="Lxx00630"
FT   CDS_pept        63395..63799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00630"
FT                   /product="protein synthesis inhibitor"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00630"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88156"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHI9"
FT                   /protein_id="AAT88156.1"
FT                   /translation="MTDRIALSTTDAPAPAHTFSQGVKRGPFVQVSGQGPVDPVTNEYL
FT                   HPGDVRAQTVRTLQNVEAILATGDATFDDVMMLRVYLTTRDDFAAMNEAYGDFVGSRVT
FT                   TGVLPSRTTVFTGLPREDMLVEIDAIALTD"
FT   gene            63914..64954
FT                   /pseudo
FT                   /locus_tag="Lxx00633"
FT                   /note="similar to chalcone/stilbene synthase family
FT                   protein"
FT   gene            65036..65536
FT                   /pseudo
FT                   /locus_tag="Lxx00636"
FT                   /note="similar to conserved hypothetical protein"
FT   gene            65549..66595
FT                   /locus_tag="Lxx00640"
FT   CDS_pept        65549..66595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00640"
FT                   /product="oxidoreductase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00640"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88157"
FT                   /db_xref="GOA:Q6AHI8"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHI8"
FT                   /protein_id="AAT88157.1"
FT                   /translation="MSDAGLIVVGGGPVGLACAIEARLLGMDVLVVEPRSAPIDKACGE
FT                   GLMPGSLAALHRLGVDPPGRTLAGIAYLDAASRAEHRFKERPGRGVRRTALHSALAARA
FT                   AELGTHTLHDRVTGVTSASSGTMLTLGRERSTLSAPWVIAADGLHSPLRRLLELGGRPQ
FT                   PESRRRFGVRRHYTVEPWTDLVEVHWSPTAEVYVTPVDDRTIGVAVLGPRPLDQEAIIS
FT                   TVPALAAHLDGAPPASDPRGAGPLLQRSRTRTSGRVLLVGDASGYVDALTGEGMRVGFA
FT                   QARAAVAAIRSGDSRQYERAWRTSTKDFRTLTTGLVIAARSRLRPRIVPTAAARPALFG
FT                   AIVERLSQ"
FT   gene            66911..67027
FT                   /locus_tag="Lxx00660"
FT   CDS_pept        66911..67027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00660"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88158"
FT                   /db_xref="InterPro:IPR040851"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHI7"
FT                   /protein_id="AAT88158.1"
FT                   /translation="MLNKALLAEVERREAAYNDGEKFTGTDEPLSPGRPIGF"
FT   gene            67113..67583
FT                   /locus_tag="Lxx00670"
FT   CDS_pept        67113..67583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00670"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88159"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHI6"
FT                   /protein_id="AAT88159.1"
FT                   /translation="MARPHGSPISLPSARRPKHTRTIDGPLWCAGSSRAYNGGMADAIT
FT                   IWIDRYRRAWESNDPEDIRYLFTEDASYRTEPFAEPWVGHLEIVEGWLDAQDDPGAAEF
FT                   GWRLAGKDGSTYFVEGVTDYRDGPTYSNLWVIALAPDGRAEEFTEWWMEQEV"
FT   gene            complement(67552..67965)
FT                   /gene="crcB"
FT                   /locus_tag="Lxx00680"
FT   CDS_pept        complement(67552..67965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crcB"
FT                   /locus_tag="Lxx00680"
FT                   /product="integral membrane protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00680"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88160"
FT                   /db_xref="GOA:Q6AHI5"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AHI5"
FT                   /protein_id="AAT88160.1"
FT                   /translation="MTPLVVLAVAIAGGLGAVARLVLDGVLRSRAPVSFPLGTTAINVT
FT                   GSFVLGLVTALALGHGLPPEWRAILGTGFIGGYTTFSTASYEAVRLAQQRQYRAALLTG
FT                   VGMMFLALGAAGLGLWLGGLAVAPTPPAPSTTL"
FT   gene            complement(67962..68399)
FT                   /gene="crcB"
FT                   /locus_tag="Lxx00690"
FT   CDS_pept        complement(67962..68399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crcB"
FT                   /locus_tag="Lxx00690"
FT                   /product="integral membrane protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00690"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88161"
FT                   /db_xref="GOA:Q6AHI4"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AHI4"
FT                   /protein_id="AAT88161.1"
FT                   /translation="MSRRSSFPVHLHGRSMLLVFVGGALGTAARALLSAAAPTVAVISV
FT                   ITFVINVIGAFVLGWLLESLALRGPDEGRRRDVRLFAGTGVLGGFTTYSAFAVDTDGLI
FT                   VASNVGGGILYAAATIAIGAAAYLAGIALGAAIGCRRGVSA"
FT   gene            complement(68492..69034)
FT                   /locus_tag="Lxx00710"
FT   CDS_pept        complement(68492..69034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00710"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88162"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHI3"
FT                   /protein_id="AAT88162.1"
FT                   /translation="MVHTRGMSGKGSAGSGVIVVAVVPGQPVIVLEQAARLAGDLGVPL
FT                   VCANVDPTRYLVPNGVDGTVVALPFDPDLPEAGEEAFDAELEQRIRETLEGCRVPFALR
FT                   QLAGDPAWALACLADEVDARYIVVGTREAGLCGSVREFFTGYVAAHLAHRQHRPVVVVP
FT                   LAPISGGEKLPWEGRPV"
FT   gene            69024..69770
FT                   /locus_tag="Lxx00700"
FT   CDS_pept        69024..69770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00700"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00700"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88163"
FT                   /db_xref="GOA:Q6AHI2"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHI2"
FT                   /protein_id="AAT88163.1"
FT                   /translation="MCTIRGRLAGPFLWPRCWGTVGRWGDGHGKEAEMTDRPTAIDRKA
FT                   ALPRERRYTTRGLRSLPTLMKAALDQLKRLASAELALFKAEMAAKAKAAGIGAGLLAGA
FT                   LVFAFFATGVLIAAAVLAFALIVPGWLAALIVAGLLIAVAALAALVGRAALKRGLPPVA
FT                   DDIGSELKADAQALRKESVREPGQRNQHTQAGARGDPGGTRGNPRRPLRDTQPARADPL
FT                   APDGCDGPVRRVARRSGNAAVPERRA"
FT   gene            69767..70813
FT                   /locus_tag="Lxx00730"
FT   CDS_pept        69767..70813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00730"
FT                   /product="membrane protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00730"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88164"
FT                   /db_xref="GOA:Q6AHI1"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHI1"
FT                   /protein_id="AAT88164.1"
FT                   /translation="MSADRPRTAVPHGRLPWGHILKRTLRSFGRDACTDLAAGLTYFGV
FT                   LALFPALIALVSVLGLVGQSKTGIDALFGMADQLAPGMLDVAHGPIEALSTSPATGWGL
FT                   VIGIVGALWSASGYVGGFGRALNRVYGVEEGRSAFVLRPVQLGVTVAAVALVAIVAVVL
FT                   VVSGPIARTIGGAIGLGDAAQTAWEILRWPAVAVALVVLVALLYSATPNVKRPGFRWLT
FT                   AGSFTAIVLLGVASVLFAFYVANVGSYDKTYGALAGVIVFLLWIWIANVALLLGAELDS
FT                   EIERARQLIAGEEAERRLLLPLKSDAAIAKARDAEAGEILAAREIRRRSRGSVSGQTRS
FT                   TRTAEGNR"
FT   gene            complement(70810..71991)
FT                   /locus_tag="Lxx00740"
FT   CDS_pept        complement(70810..71991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00740"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88165"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHI0"
FT                   /protein_id="AAT88165.1"
FT                   /translation="MLSSEPPSGSRLPQSPESLRPRRGFRGPVRRDAGQRNPLIAAPVQ
FT                   HAASAEDLIAALEEAAEPAGHAATGAPAIPAVAPAAPESFSRRTARAAERAKGRGRPVR
FT                   ERLVATLSPAVATAAAALPSRKAARVAGPRRVSASQPAHPPSRTRRWSSKTVVVLALAA
FT                   FFGTAALPAYATTGEGSAVGAARTALAVQTLAGGDTAAQLVSRDTLGISEAPQTLTSTT
FT                   NSTVSPSVQALAIQLMGAVASGRLVGSTPNHLPEIANLAAGKAVPGCGVDYRVLQAISI
FT                   ALDHFAQAGVSDINRRCTGQIEGAGTESAHYTDGGGHALDFYLLNGSPLTGGDAKSIQL
FT                   IKILDPLVPSGTGLGQIECRPSIRLGAFQPFSDSCDHLHIDFLKAQGATLRYG"
FT   gene            complement(72235..73395)
FT                   /locus_tag="Lxx00750"
FT   CDS_pept        complement(72235..73395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00750"
FT                   /product="two-component system, sensor protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00750"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88166"
FT                   /db_xref="GOA:Q6AHH9"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHH9"
FT                   /protein_id="AAT88166.1"
FT                   /translation="MEAVLDHLQEAADTAEQDGISPPDAARLLRGLAEQVVRPASHRLY
FT                   DSAEPAPAPGEGEIRVRRRDWGASVLGHLHAAPPFLLALVYTALVTPFGLQLFGPGSVL
FT                   LLGTGLVAVWVGNNLLAWLVEATAPALRIVVLLLGYLAIGTLLAATMMLVVQGIGTHPR
FT                   LVWFEAGTYAIFGLGVSLVASLSSRIRQDQGELEAAVQLKVGTAAELRAAYDHERSTLA
FT                   RLLHSGVQAELIAAALALGTSDGEDASGELRAVVERIRAELLVPRPEPDPAERISALVE
FT                   SWGSAISLRVEIGAEVWDRLRDPVRAETVVDAISEGLANAVRHGDGTQVTLEVRPQGPA
FT                   GVAVVVTSGGVLTEAGPGIGLRQLAEHGAVVLREEAGRVELAVAIP"
FT   gene            complement(73920..74543)
FT                   /locus_tag="Lxx00760"
FT   CDS_pept        complement(73920..74543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00760"
FT                   /product="two-component system, response regulator"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00760"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88167"
FT                   /db_xref="GOA:Q6AHH8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHH8"
FT                   /protein_id="AAT88167.1"
FT                   /translation="MEDHALMRSLVADAFRQRGFEASSFGSAAEALASADEFDPDLLVT
FT                   DIDLRVRPNGVELATILRERAPHIAVLFLSNLSREAAAAAERGTVEGASFVNKAAIDSV
FT                   DELVDAADSVLADRPVSRVEPRTGAQAVLLRLSPAQLETTRLLAAGLTNAEIARRRGVS
FT                   VRAVEKSVERVFQTLGLSAGERTAPRFAAATLYTLTFGDAGSGL"
FT   gene            75361..75671
FT                   /pseudo
FT                   /locus_tag="Lxx00780"
FT                   /note="similar to sugar transport integral membrane
FT                   protein"
FT   gene            complement(75783..76934)
FT                   /gene="mtlD"
FT                   /locus_tag="Lxx00800"
FT   CDS_pept        complement(75783..76934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlD"
FT                   /locus_tag="Lxx00800"
FT                   /product="mannitol-1-phosphate 5-dehydrogenase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00800"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88168"
FT                   /db_xref="GOA:Q6AHH7"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AHH7"
FT                   /protein_id="AAT88168.1"
FT                   /translation="MKAVHFGAGNIGRGFVGLLLHEAGYEVVFADVNAELIEALAAADS
FT                   YDVRLVGDETVTKTVTGFRALNSATAEDELVGEIATADVVTTAVGPRILRFVAPVIARG
FT                   LGARASGAPRLVVMACENAIGATDLLAAELMDGLQDGDTRDELAARAVFANTAVDRIVP
FT                   AQDPASGVDVTVEAFFEWVVDRSPFAGAEPPIPGAHFVDSLGPYIERKLFTVNTGHATT
FT                   AYTGFLEGAATISEAIAKPSVLATVEAVLEETSAALTAKHGLDPEELAEYRAKILNRFR
FT                   NPHLVDEVTRVGREPLRKLGRNDRFIGPASDYARYVGGAPSALLAAVGAALRFDLPGDS
FT                   QSAELQQLLRKTEPGGIVTEVMGVEPGDALYEPLVAVVRTAQG"
FT   gene            complement(76947..77384)
FT                   /locus_tag="Lxx00810"
FT   CDS_pept        complement(76947..77384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00810"
FT                   /product="PTS system, mannitol-specific enzyme II, A
FT                   component"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00810"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88169"
FT                   /db_xref="GOA:Q6AHH6"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHH6"
FT                   /protein_id="AAT88169.1"
FT                   /translation="MTDTILDRANVVAAGAATTREEAIREAGALLLAAGAVEPGYTESM
FT                   RQREETVSTFMGNGLAIPHGTNESKDEIKRSALSFVRYSSPLDWGGEEVRFVVGIAGQN
FT                   DEHLEILSKIAILFSEEDDVRSLIEAPDADALFALLSDVNE"
FT   gene            complement(77381..78895)
FT                   /gene="EIIBC-Mtl"
FT                   /locus_tag="Lxx00820"
FT   CDS_pept        complement(77381..78895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="EIIBC-Mtl"
FT                   /locus_tag="Lxx00820"
FT                   /product="PTS system, mannitol-specific IIBC component"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00820"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88170"
FT                   /db_xref="GOA:Q6AHH5"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004718"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHH5"
FT                   /protein_id="AAT88170.1"
FT                   /translation="MTTAAETSATSTPKQPGTARVAVQRFGTFLSSMVMPNIPAFIAWG
FT                   IITALFIPKGPFPTESIASMVGPMITYLLPLLLANTGGRLVYGVRGGVVGTIAAMGVIV
FT                   GSDIPMFIGAMVMGPLGAYLMKLVDRIWEGKIKAGFEMLVNNFSAGILGFLLAIGAFFG
FT                   IAPLVEGLSKALEAGVDWLVSVHLLPLVSVLVEPGKVLFLNNAINHGVFTPIGTLEAQQ
FT                   AGKSILFLIETNPGPGAGILLAWAIFGLGAARASAPGAFIIQFFGGIHEIYFPYVLMKP
FT                   ILIVGAILGGMTGVAVNVAFQTGLRAPAAPGSVFAIFAQAPVENMFGIGLSIVAAAAVS
FT                   FAFSAIVLRASRKRDLDSGNAGDLSAAVAQTEANKGTSSSVLGALVQEGEHGTDDAQGE
FT                   ATGRLVRTIVFACDAGMGSSAMGASVLRKKIEKAGVTGVTVTNQAISALDGTADLVITQ
FT                   QQLTDRAKGQSPDSLHVSVDNFMNSPRYDEVVDLVKQQETTEDAGK"
FT   gene            complement(78892..80538)
FT                   /gene="ptsI"
FT                   /locus_tag="Lxx00830"
FT   CDS_pept        complement(78892..80538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsI"
FT                   /locus_tag="Lxx00830"
FT                   /product="PTS system, enzyme I"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00830"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88171"
FT                   /db_xref="GOA:Q6AHH4"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHH4"
FT                   /protein_id="AAT88171.1"
FT                   /translation="MLRMSEPLPEPADAPSARTPGEEKARVADAVAAVAADLRARAGTV
FT                   TGAAADVLEAQSMMAEDSTLADDVSSRIDSGKTAERAVFEGFAVFRDMLIGLGGYMGER
FT                   ATDLDDVSQRVIAALEGRAAPGVPESDEPYVLVAHDLAPADTALLDLDKVLGLVTREGG
FT                   PTSHTAILAREKAIVAIVGVASADTLTDGTEVIVDARAGIVTASPDTAQSAEAQRRIDE
FT                   RAAALSGGLGPGALADGTSVPLLANLGSAEGAGKALAAGAEGVGLFRTEFLFLDQRLAP
FT                   TVEQQREQYAAVLRAFPGQKVVVRVLDAGADKPLEFLNDAHEDNPALGLRGLRALRSNE
FT                   DILREQLTALAEADAQTGADLWVMAPMVSTVEETRYFVELASEFGLKTAGVMVEVPSAA
FT                   LLAGRVLQKAAFVSIGTNDLTQYTLAADRLLGSVASFQDPWHPAVLRLIGETGKAGAAT
FT                   GKPVGICGEAAADPLLAVVLVGLGATTLSMSTTAIADVRLSLKRYTLEQARGLAEIALA
FT                   ADGAAEAREAVRLAATASTSPAHPDRNEAPE"
FT   gene            complement(80598..80864)
FT                   /gene="ptsH"
FT                   /locus_tag="Lxx00840"
FT   CDS_pept        complement(80598..80864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsH"
FT                   /locus_tag="Lxx00840"
FT                   /product="phosphocarrier protein HPr"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00840"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88172"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHH3"
FT                   /protein_id="AAT88172.1"
FT                   /translation="MAERIITVGSSHGLHARPAKLFVEAVNATGAKVQLTKEGGKTVNA
FT                   GSILGVISLGIDHGDKIVLTTDTPEGEAVLDGLAEILATDHDA"
FT   gene            complement(80857..81213)
FT                   /locus_tag="Lxx00850"
FT   CDS_pept        complement(80857..81213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00850"
FT                   /product="PTS system, IIB component"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00850"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88173"
FT                   /db_xref="GOA:Q6AHH2"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHH2"
FT                   /protein_id="AAT88173.1"
FT                   /translation="MKIVVVCGAGASSAFVAMKLRTAAADRGVDVAVSAGSTEQLASLD
FT                   GIDIVLVGAHLESSVPALRDRTAGTGTAIVVLPPVSPAALDGAWTLDLALGAKRDRRAN
FT                   DPLVTPPERNHTNG"
FT   gene            81494..83287
FT                   /pseudo
FT                   /locus_tag="Lxx00860"
FT                   /note="similar to alpha-glucosidase"
FT   gene            83740..83997
FT                   /pseudo
FT                   /locus_tag="Lxx00875"
FT                   /note="similar to polysaccharide lyase"
FT   gene            84065..85180
FT                   /locus_tag="Lxx00880"
FT   CDS_pept        84065..85180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00880"
FT                   /product="acetyltransferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00880"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88174"
FT                   /db_xref="GOA:Q6AHH1"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHH1"
FT                   /protein_id="AAT88174.1"
FT                   /translation="MTGGPALASVARDAPVPSAAPSARLAALDCLRLLVALSVVSYHWL
FT                   FWGPRYGEVAFAAPAPVAALAAYGNLGVQLFFLISGFVIFLSASGRDAASFAAGRATRL
FT                   YPAFWAGVLLTPAPLLVTAQASLPSILGRLLANLTMAPAAFGQAQLDGVYWTLTLELEF
FT                   YALVFLFLLAGRREWLEPFFAVWAIAMLPTTLFLPRIAGLPLLGGLFELFAGGALIAMI
FT                   AYTGWTPLRAVALAASVAGSAAATVRRAQESDPGAVDPVVLAVAVAALYALVFVLTTSR
FT                   IAAWRIPGSRLAGGLTYPIYLCHAVFGYALLNAFGSVDAPGPATGSPLLSCWRRRPRST
FT                   SVSSVRRRRCGGVCSRSHWPHRSGRCRPCCR"
FT   gene            85621..87519
FT                   /locus_tag="Lxx00900"
FT   CDS_pept        85621..87519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00900"
FT                   /product="transcription antiterminator, BglG family"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00900"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88175"
FT                   /db_xref="GOA:Q6AHH0"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHH0"
FT                   /protein_id="AAT88175.1"
FT                   /translation="MALSAKRTRMLGILSRRAAWVTAAELARDLGVTTRSIRSYAAALG
FT                   ELIESGPDGYRVRPDAYAASLAGMASPDSTAGSPQERLVLLVRRLLDAPEGVEVYETAE
FT                   SLFVSDSTIESDLTRIRGLLSGTELALERQGAVVRLTGPEIARRKLISRLFRDEMTQSV
FT                   VDIARIQEVFSSRGLAEFKDDLVETLDARGFFVNEYGINDVLLHMAVALDRVAKDRVLP
FT                   ATADPEVSDEIRALAVDLGELVLHHFGAQLDPVELRSLAILLRTRVIVPGARDTLAEFV
FT                   SDEDLAAVRCIVASASAEYLVDLRDESFIVRLTLHLQNLVARAHEKSYSRNPLTRSIKS
FT                   AYPMIYELAVYIASRLQAAEGIAVNDDEIAYIAMHVGAHLEQQSRRRDAVTCAVVCPNY
FT                   YDMHILLRERLERALGDELDITNVITSADADWNVIGEDLVLTTIDPRGHRENAVIVQPF
FT                   LTETDIGRIRQSVARIRRQRRRARIKSELLEYFDESLFLRDFHARDPLTMIRALGDRMI
FT                   AAGAIDSAYVEQSVEREQMSSTAFTDTLAVPHAMTMTAKRTAIAIVVNDTAMDWGDARV
FT                   NVIAFIAFSEGGRAAFQTVFDQFVEVFSDPEAVRGLIRRADTFTAFIDELVRIIDA"
FT   gene            complement(87549..88247)
FT                   /locus_tag="Lxx00910"
FT   CDS_pept        complement(87549..88247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00910"
FT                   /product="hydrolase, haloacid dehalogenase-like family"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00910"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88176"
FT                   /db_xref="GOA:Q6AHG9"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHG9"
FT                   /protein_id="AAT88176.1"
FT                   /translation="MTDPTSTTEPASAPTVTRTWTCVLFDLDSTLTDSAAGITSSLAHT
FT                   FETIGLPVPAPAQLVEYVGPPLLDSLQSMAGLTEAGARDALTAYRAHYAEHGALDSAVF
FT                   PGIRGLLQRLSAAGVPLAVATSKPETQAVRILEHFGLAQHFEVIAGATDESRSAKADVV
FT                   AEALRRLTAAGVGIGHAVMVGDRLYDVEGAAAHGLPTILVEWGYGSPAEAAGEIAVVHS
FT                   TDQLSALLLG"
FT   gene            complement(88285..88704)
FT                   /locus_tag="Lxx00920"
FT   CDS_pept        complement(88285..88704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00920"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88177"
FT                   /db_xref="InterPro:IPR009839"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHG8"
FT                   /protein_id="AAT88177.1"
FT                   /translation="MGARGRFPPSYENVPVRKALAVIAAEPTLENLAALLAAAKKGGLV
FT                   VDVTGSGPGEVRLRTIGSTTGEAVLPLFTSMRALRAAVGGAAGGGTRVQAVIVPGPEAL
FT                   GHISSADFVAVQFDPGTPHALVVARSHIEAALSER"
FT   gene            complement(88704..89399)
FT                   /locus_tag="Lxx00930"
FT   CDS_pept        complement(88704..89399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00930"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00930"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88178"
FT                   /db_xref="GOA:Q6AHG7"
FT                   /db_xref="InterPro:IPR002793"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHG7"
FT                   /protein_id="AAT88178.1"
FT                   /translation="MRLVIANCSVDYAGRLSAHLPLAKRLLMLKADGSMLVHSDGGSYK
FT                   PLNWMSPPCTLAVDKPDEAQREAGVTQLWRVSQAKTADMLVVSIHEVLHDSAHELGIDP
FT                   GLQKDGVEAHLQKLLAEQIHLLGDGHVLVRREHMTAIGPVDILARDAAGASVAVELKRR
FT                   GDIDGVEQLTRYLELMNRDPLLAPVAGVFAAQEIKPQARTLAEDRGIRCLVLDYDAMRG
FT                   FDNSDSRLF"
FT   gene            89414..90487
FT                   /locus_tag="Lxx00940"
FT   CDS_pept        89414..90487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00940"
FT                   /product="secreted protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00940"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88179"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHG6"
FT                   /protein_id="AAT88179.1"
FT                   /translation="MRQDGGMVHQLLIGTYTESLPHVDGHAEGLLAATFDGAAVSPAGV
FT                   AAFLENPSWIAVGPGARTVYAVEETGPDGSVTAFSREGGGALLPSGRESAGGSSPAHLA
FT                   VHPSGRFLLVGSYGSGTVSVWSLDAEGMPLERTAFVQHEGSGPDPERQEGPHVHQLSVD
FT                   PVTGDLVVVDLGLGEVRWYAFSEEGCLTLRPEATVVTGGAGPRHLAFHPDGGHAFLVNE
FT                   LESTVAVLRRGADGRFRLAGAASTRAPGADGPNFPAAVRVTGDGRTVLVSNRGDDTIAV
FT                   FAFDGAESRLRLATFAPAGGRSPPPPDLVLTPEGDRVLVSCQDSDRVTVFAFDPETRAL
FT                   TWLSDNAVPTPVCVVVL"
FT   gene            complement(90531..91160)
FT                   /locus_tag="Lxx00950"
FT   CDS_pept        complement(90531..91160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00950"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88180"
FT                   /db_xref="GOA:Q6AHG5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHG5"
FT                   /protein_id="AAT88180.1"
FT                   /translation="MSFTPFKTRSRTLSAWFATRPDLFTPERSPRKTMSWMIVAGLMAA
FT                   LTLIVFLNPAAIVETLGGRVKAGLAIAGAFAMPPAIFVVCVAMVIAGSRRWRVTGGGVL
FT                   TNPVIHSFRPGFPIDDLLAAMQRGAVASAAIVAGLAAVQKDGGNTRLITVWASEADRVL
FT                   YVGLLRVDGDELWIDTEPFAVGPDRYFDAKKHDRTAMRARTSVDGL"
FT   gene            complement(92167..93552)
FT                   /gene="dinF"
FT                   /locus_tag="Lxx00960"
FT   CDS_pept        complement(92167..93552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinF"
FT                   /locus_tag="Lxx00960"
FT                   /product="DNA-damage-inducible protein F"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00960"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88181"
FT                   /db_xref="GOA:Q6AHG4"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHG4"
FT                   /protein_id="AAT88181.1"
FT                   /translation="MPALGALVAEPLFLLADSAVVGHLGVAPLAGLGIAAAVLQTIVGL
FT                   MVFLAYSTTPAVARWLGAGDERAAVAAGVDGCGLGLGLGLGAVLAAGRLASPVLVSLFA
FT                   ASAAVSEQAEVYLSISMAGLPAMLFVFAATGLLRGLQDTRTPLAVAGGGFAANIALNAV
FT                   FIGVLGLGIAGSALGTVVAQWAMVAVYAVVVARHARRAGAGLLPRHTGLGRTAVAGGWL
FT                   FLRTASLRGAMLLAIAAATRLGPDDLAAFQVAMTVFATLAFALDTLAIAAQALVGKGLG
FT                   AGKLPEVRAVLRRCVQWGVGSGAVLGAVTVALSPVAAGLFTRDAAVTALLPAALAIVGL
FT                   SAPLGGYVFVLDGVLIGAGDTRYLALTGLLNVAVFAPLAVAVIARGDHDAGGLAALAAA
FT                   FAFGYLGSRALTLGPHLRVAPARRGVLGEELAGGGDQRPGRGGGRSPAPSSRTPSVCEG
FT                   TDR"
FT   gene            93566..94297
FT                   /locus_tag="Lxx00970"
FT   CDS_pept        93566..94297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00970"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88182"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHG3"
FT                   /protein_id="AAT88182.1"
FT                   /translation="MSRSSGRRGRGFTAPPRYSTGASPSVSGCSYSGVMSSLMPELLAT
FT                   WSWRLERGRTGRTVLTRGQAATAKRDLEHDRSAHPGDYAAYEDELAAALDALEILSRQA
FT                   NRADDLLAVLAAERRQRGGAEGGDHARRTPGPGEPARARGPLTAEHEGIPAGLPELLDQ
FT                   WVHRLIRYRNGAKLIAPIEAARAEIRLRNEAHLHPGAYRNAVTRPYYGRVMRELGEIAT
FT                   AQRPGVRVGGRGMRRTLGDLW"
FT   gene            94294..94611
FT                   /locus_tag="Lxx00980"
FT   CDS_pept        94294..94611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00980"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88183"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHG2"
FT                   /protein_id="AAT88183.1"
FT                   /translation="MSWGSRRLVRSFPLGALAVLVVIGVAGYVASSGGAGGLPDGSAVA
FT                   ASTPPSALPGSSARDAGVPSPIVATALLAGLAVKGRAPATGYACSLHYDQPMRSRGTTL
FT                   L"
FT   gene            95288..95512
FT                   /locus_tag="Lxx00990"
FT   CDS_pept        95288..95512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx00990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx00990"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88184"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHG1"
FT                   /protein_id="AAT88184.1"
FT                   /translation="MEPVDGWTFLLTSDRNCPSARVVSGFADTEDGDTVEEHSQVVSLE
FT                   RGVPYSYTIPDSASDREYASIDDIICETI"
FT   gene            95597..96193
FT                   /locus_tag="Lxx01000"
FT   CDS_pept        95597..96193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx01000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01000"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88185"
FT                   /db_xref="GOA:Q6AHG0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHG0"
FT                   /protein_id="AAT88185.1"
FT                   /translation="MAEDVLGRDLRRRGGPRRGRGRSPCCATREPVSSPLTRPLSEPRR
FT                   AVPVERAESDILGIEHSGDSTMRFITPKEKAIVVAILVGVDLLLILLLDALNTQGGSIA
FT                   LSILQLVAWYLATRVFRGPGEPVRAARPWWRMTNRPLLSGVLGVGYGLLAVVNAGFSLA
FT                   GYGSVSGVVSILVELVLAGLFLTSFWRLRALALLV"
FT   gene            96210..98165
FT                   /locus_tag="Lxx01010"
FT   CDS_pept        96210..98165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx01010"
FT                   /product="metallopeptidase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01010"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88186"
FT                   /db_xref="GOA:Q6AHF9"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHF9"
FT                   /protein_id="AAT88186.1"
FT                   /translation="MTQVSGIATDELDPTIRPQDDLFRHVNGKWLDRTEIPADKARWGS
FT                   FMVLAEEAENAVRDIVEAAQTAPEGTEERRFGDLFASFMDEERVDALGVQPIEAQLALA
FT                   SYAHSVPALLETLGRLERHGVGGFYQLFVDNDPGDPERYLVFAEQAGISLPDESYFREE
FT                   RFAPIREAFVAHLQRMFELAGLSDAPERAQRVFELETEIAAQHWDNVRSRDSEKTYNLF
FT                   TWADVTALFGSAGLDDWARGLSAPEGALAEVVLRQPSFASGLASLLTEDRLASWKDWLA
FT                   WQIIHSAAPYLPGDFVNANFDFYGRTLTGTPEMRVRWKRGVSLVEGAMGEAVGRIYVEK
FT                   HFPPAAKQTMDTLVATLIEAYRQSIQKLEWMGAETRSRALDKLAKFTSKIGYPVRWRDY
FT                   SALTIDPADLLGNVRATALFEFHRELAKIGRPLDRDEWFMTPQTINAYYNPGFNEIVFP
FT                   AAILQYPFFDADRDAAANYGAIGAVIGHEIGHGFDDQGSKFDGDGRLEDWWTAADRAAF
FT                   EERTASLIEQYNALSPAQVPGHHVNGALTIGENIGDLGGLGIAWKAYLLSRGGEEPPVI
FT                   DGLSGAERFFLSWAQAWQQKGRDEEVLRLLAIDPHSPNEFRCNQIVRNIGAFYDVFEVS
FT                   EGDRLWLAPEKRVTIW"
FT   gene            98366..99202
FT                   /locus_tag="Lxx01020"
FT   CDS_pept        98366..99202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx01020"
FT                   /product="beta-lactamase related protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01020"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88187"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHF8"
FT                   /protein_id="AAT88187.1"
FT                   /translation="MPSRETFSRAFDALGKLAVQGVQVSGRVTDLSTGEVLFSVDDHVV
FT                   MPTASIGKVLLLVEVAARLQSGGLSSLALLDRAPQDAVGDSGIWQHLQVPALPVADLAA
FT                   LVGATSDNLATNVLLRRVGLEAVSARTEALGLTRTALLDLVRDHRGPDDAPQLSIGSAN
FT                   ELTWLFAALARGEVVNPQTSRQVISWLSLNSDFSLVSGAFGLDPHSHRHAEHGILLVNK
FT                   TGSDAGVRSEVGVLRGPRAGLTFAVSTYFDDTSLSSRLAVIDGMRTVGLDLLEYVF"
FT   gene            complement(99376..100767)
FT                   /gene="glyS"
FT                   /locus_tag="Lxx01030"
FT   CDS_pept        complement(99376..100767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="Lxx01030"
FT                   /product="glycyl-tRNA synthetase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01030"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88188"
FT                   /db_xref="GOA:Q6AHF7"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR022961"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR033731"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AHF7"
FT                   /protein_id="AAT88188.1"
FT                   /translation="MAAAPSRLDSVITLAQHRGFVFPSGDIYGGTRSAWDYGPLGVELK
FT                   ENIKREWWNSFVRGRGDMVGLDSAIILPTAVWEASGHVKVFSDPLTESLITHKRYRADH
FT                   LFEAYEAEHGHPPANGLDDIADPDHPEKVGQWTPIRPFSGLMKTYLGIVDDESGLHYMR
FT                   PETAQGIFTDFASVLQTSRKKPPFGIGQIGKAFRNEITPGNFIFRTREFEQMEIEFFVE
FT                   PGTDEEWFDTWIDLSWEWFTGLGIKPENIRRFEHPKDSLAHYSKRTIDIEYKFEFAGSE
FT                   WGELMGVANRADFDLKTHIEHSGKDLSYFDQNKNERYVPFVIEPSFGLTRALMAFLVDA
FT                   YDEEQAPNAKGGTDKRTVLHLDPRLAPVKVAVLPLSRNEALSPLARGLADRLRQRRAVD
FT                   FDDSGAIGRRYRREDEIGTPLAVTVDFDSLEDDAVTVRDRDSMRQERIPLEGLDRYLAE
FT                   RLREV"
FT   gene            complement(100844..102142)
FT                   /gene="hemA"
FT                   /locus_tag="Lxx01050"
FT   CDS_pept        complement(100844..102142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemA"
FT                   /locus_tag="Lxx01050"
FT                   /product="glutamyl-tRNA reductase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01050"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88189"
FT                   /db_xref="GOA:Q6AHF6"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AHF6"
FT                   /protein_id="AAT88189.1"
FT                   /translation="MLICFSSSHRTAAFDLLDQLERHAPAVATALAEHSELVTGSVVLA
FT                   TCNRFEAYLDIDEPLPAARAVSAETVIAAVGNAAGIDADLLRSSSRVYCDDAAAEHLLS
FT                   VSSGLDSVVVGEGEIAGQVRRALTTARQAGTVSQDLERLFQVASRTSRGVKNRTGIATA
FT                   GRSIVRLALDLAESRVSDWSRMRVLLIGTGKYAGASLAALRDRGVADVQVHSPSGRAEK
FT                   FALSHGVTAVPAGGLGAALAHAHLIVTCTTVRDYTLTPGNFGQAQQQDGIERRLVIDLG
FT                   LPRNVDSAVAELPGVELLDLETISLHAPVAELNAADDAREIVGAAAAEFAAQTAEQAVK
FT                   PALIALRKHVFDILDAEIARARTRGDSSEQTEAALRHLAGVLLHTPSVRARELARAGDA
FT                   QRFADAAETLFGLRIEEAPVHPRLIAVDRVTAS"
FT   gene            102252..103385
FT                   /gene="hemE"
FT                   /locus_tag="Lxx01040"
FT   CDS_pept        102252..103385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /locus_tag="Lxx01040"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01040"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88190"
FT                   /db_xref="GOA:Q6AHF5"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AHF5"
FT                   /protein_id="AAT88190.1"
FT                   /translation="MIVTALDPTHPLAAGLTHASRLVRSYQGERQEVTPVWFMRQAGRS
FT                   LPEYRDLRVGTRMLDVCLDPAMASEITLQPVRRHGVDAGIFFSDIVVPLKLAGVEVEIQ
FT                   PGKGPVFERAVRTSADVDRLSAVDPAALAADTFAAVQEAVRLTTAELNETPLIGFAGAP
FT                   FTLAAYLVEGGPSKDHLRARTLMHAAPGAWARLMDWTADLSGAFLRAQVLAGASAAQLF
FT                   DSWAGSLSLRDYAEHAAPASARAFSHVRDLTYTVPSADPDGEAVVRAVPIVHFGVGTGE
FT                   LLPAMHEAGADAIGVDHRTLLDEASRRLGHIVPLQGNADPAMLAAPWEVLSGHALDVLD
FT                   RGRAAPAHVFNLGHGVPPETDPAVLTRVVELVHGWRA"
FT   gene            103382..105214
FT                   /gene="hemG"
FT                   /locus_tag="Lxx01060"
FT   CDS_pept        103382..105214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemG"
FT                   /locus_tag="Lxx01060"
FT                   /product="protoporphyrinogen oxidase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01060"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88191"
FT                   /db_xref="GOA:Q6AHF4"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR004572"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHF4"
FT                   /protein_id="AAT88191.1"
FT                   /translation="MTSLGAELRQTIEADPTRIAVVGGGMAGLVAARECARPGFEVIVL
FT                   EAADRIGGSVAPLELDGMTLDAGAESFATRGGHVAELLDELGLAGDVVSPNPAGAWVRT
FT                   GTKSVPLPKAGLLGIPSSPLASDVVAAIGWGGALRAYLDRLLPVLKIGQERRLGTLVRK
FT                   RMGAKALHELVAPVVTGVYSAAPDDLDIEVVAPGLNAALTRLGSLSGAVGELWSQAKAG
FT                   SAVQGLRGGMWRLPAALAADFRARGGSVRTAAAVTAIEPWAASETHAPAGVAHPESDGG
FT                   RRPARWTLRLADGTAIDTDAVVMAAPAHAALALLPTASPSLAGLAGLDWPPASSVELVT
FT                   LVLTTPAAAEAPRGTGVLVADAPGSGVTAKALTHASAKWAWVAEAAGDGCHVVRLSYGR
FT                   AGQPGTRELGDQRLREIALADASALLNIPLAVSDVAAFARILWTNALPYATVGQRERIQ
FT                   RVRDGVGSVEGLEVTGSWLTGTGLASVVPDARQAAERARGSTLESTDRGHGGVRMRGKI
FT                   LFVAGAAVGYVLGARAGRKRYDQLKAAAARVWESPSVQKRVHAVEDFMAEKACEAPEAV
FT                   FVAIKKAVVRVNERRREARSPIPEPETAGDGSAS"
FT   gene            105650..105865
FT                   /locus_tag="Lxx01080"
FT   CDS_pept        105650..105865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx01080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01080"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88192"
FT                   /db_xref="GOA:Q6AHF3"
FT                   /db_xref="InterPro:IPR022062"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHF3"
FT                   /protein_id="AAT88192.1"
FT                   /translation="MTTDRSDAERARAELAATLDAIEYKLNIPKRAAECVRTLRRENPL
FT                   AFAGIAVGAAIVAATAAWGLVALVRR"
FT   gene            105929..106654
FT                   /pseudo
FT                   /locus_tag="Lxx01085"
FT                   /note="similar to conserved hypothetical protein"
FT   gene            106682..107851
FT                   /gene="hemZ"
FT                   /locus_tag="Lxx01090"
FT   CDS_pept        106682..107851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemZ"
FT                   /locus_tag="Lxx01090"
FT                   /product="ferrochelatase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01090"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88193"
FT                   /db_xref="GOA:Q6AHF2"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AHF2"
FT                   /protein_id="AAT88193.1"
FT                   /translation="MLGATPAAAGVAEHVTEPVAYDAILLAGFGGPEGQDDVIPFLRNV
FT                   TRGRGILDERLEEVAQHYRHFGGVSPINDQNRALKAALEAELASRGIDLPVLWGNRNWD
FT                   PYLADALTEADQRGFTKLIAVATSAYSSYSSCRQYREDFARALRETGLEGRIQIDKVRQ
FT                   FFDHPGFVEPFIEGVKNAVEELRERAPEIHPATGVRILFSTHSIPSTDAGKSGPSGRPD
FT                   SGEPWGEGGAYAAQHLAVAEIVSHEATGGTIGWDLVYQSRSGPPSMPWLEPDINDRIAE
FT                   LPELGVKAIIIVPLGFVSDHMEVLWDLDTEAMESSEENGLLAVRVPTPGTHAKYVKGLV
FT                   DLVLERRDGLPVAQRPSLTTLGPWYDVCRPGCCENVRLGFKPAVAGLTP"
FT   gene            107848..108837
FT                   /gene="hemC"
FT                   /locus_tag="Lxx01100"
FT   CDS_pept        107848..108837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="Lxx01100"
FT                   /product="porphobilinogen deaminase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01100"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88194"
FT                   /db_xref="GOA:Q6AHF1"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AHF1"
FT                   /protein_id="AAT88194.1"
FT                   /translation="MIVSDGPAERRQGALRVGTRGSPLAVAQTQAVSAAVARATGFDIE
FT                   LVTVTTHGDTSRESLSELGGTGVFATALRDALRNGECDLVVHSLKDLPTAPAPGLVLGA
FT                   VPKRADARDTLCARDGLRFGELPEGASVGTGSPRRAAQLRAQRPGLDIVDIRGNVDTRL
FT                   SRVSAGDLDAVVLAAAGLGRLGRLDAATDFFSLSTMPTAPGQGALALEVREGDERGRGP
FT                   IARALAAVDHATTCAATTAERAVLAGLEAGCAAPVGATAMIDDGLLFLTATVYRPDGAA
FT                   QLTASHAATPDSFGAAHLDEAARDVGERVVAELLASGAADLAPLKGLR"
FT   gene            108834..109616
FT                   /gene="hemD"
FT                   /locus_tag="Lxx01110"
FT   CDS_pept        108834..109616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemD"
FT                   /locus_tag="Lxx01110"
FT                   /product="uroporphyrinogen-III synthase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01110"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88195"
FT                   /db_xref="GOA:Q6AHF0"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHF0"
FT                   /protein_id="AAT88195.1"
FT                   /translation="MTTGSVPKPLAGWRVLVPRGGPWGDSVAADLRAVGASPVVAAMIN
FT                   FAPAADASALERALHRLAAGEFDWVTITSATTVDVLSASRAVVPPRTRIAAVGETTAAA
FT                   LTAASYKMDLVPAEDNSAHGLLAEWEAATQGQVPLRILTLRSDIAKPLLTEGLRRIGHD
FT                   VDSVVAYRTIGVTVPESVVADVRQGLVQAILVTSGSVAEQVQLQLGPIPESTLVAAIGP
FT                   RTARDARDCGLRVDVVAEERTAAALIQAVVAVAASRVG"
FT   gene            109644..110624
FT                   /gene="hemB"
FT                   /locus_tag="Lxx01120"
FT   CDS_pept        109644..110624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="Lxx01120"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01120"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88196"
FT                   /db_xref="GOA:Q6AHE9"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHE9"
FT                   /protein_id="AAT88196.1"
FT                   /translation="MSELHPVIRPRRLRQSPAMRRLVAETRLHPAELILPLFVREGLAE
FT                   PRPVASMPGVVQHTLDSLSRAASGAAEAGVGGVMLFGVPEMRDAAGSAATDPDGILNVA
FT                   TRTVAAEVGDALVVQTDLCLDEFIDHGHCGVLDGAGAVDNDATLLRYRDMALAQVEAGS
FT                   QLLGLSGMIDGQVAAVRQALDAAGHTETVLLAYAAKYASGFYGPFRDAVDSPLVGDRRA
FT                   YQQDPANRREGLREARLDLDEGADILMVKPALSYLDVLSDVAAISEVPVWAYQVSGEYA
FT                   MVEAAAANGWIDRDRIIEETLVGARRAGADAIVTYWATEVAGWQR"
FT   gene            110645..111988
FT                   /gene="hemL"
FT                   /locus_tag="Lxx01130"
FT   CDS_pept        110645..111988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="Lxx01130"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01130"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88197"
FT                   /db_xref="GOA:Q6AHE8"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AHE8"
FT                   /protein_id="AAT88197.1"
FT                   /translation="MAAAAIGEANLAQFGRAQRVIPGGVNSPVRAFRSVGGTPRFMVFA
FT                   NGPYIVDAEGREYVDLVASWGPAILGHAHPAVVSAVQEAAARGLSFGASTPAETELAEA
FT                   VIARVPFVEKLRLVSTGTEATMTAIRLARGFTGRPLLIKFAGHYHGHSDSLLAEAGSGL
FT                   ATLSLPGSAGVTEATAAQTLVLPYNDLGAVRAVFEANGPDIAAVIAEAAAANMGVVPPD
FT                   EGFNAALTDLAHEYGALLILDEVLTGFRVSEAGFWGLDRGYTPDLVAFGKVIGGGMPLA
FT                   AVGGRAELMDILAPAGPVYQAGTLSGNPVAVAAGLATLAHAGEAVYDRLDIVAGTLSAA
FT                   VSDALTAEGVAHSVQRAGNLFSFVFGDVAAAPRTFAEVQRQEAFRYRAFFHAMLDAGVS
FT                   LPPSVFEAWFVTAAHDDAAVGRVLEALPAAARAAASACPGRPLLFVRR"
FT   gene            112143..112751
FT                   /locus_tag="Lxx01140"
FT   CDS_pept        112143..112751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx01140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01140"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88198"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHE7"
FT                   /protein_id="AAT88198.1"
FT                   /translation="MTVRGSTPERRRRARKVVVRVTRPLSHTRRGVVSGFRSPAGAPPR
FT                   HPVRFQRNGCRFVEVRSPRPGGGLGRIEAMADLHVHPDRWEIHLTRAEKALALRRENLV
FT                   IPRESIRSVAITEDPWIWIRGIRAPGTAVPLTLSVGTWKFHGGKDFLLIKGKQRAAVVV
FT                   DLDGEEFSRVIVSSPHAAKLVEALRVDISEIPGDGEGGR"
FT   gene            113470..114183
FT                   /locus_tag="Lxx01150"
FT   CDS_pept        113470..114183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx01150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01150"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88199"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHE6"
FT                   /protein_id="AAT88199.1"
FT                   /translation="MRRPATKPRPRAPSPMSRRRTGVGPRAWQTNGKSGIALTVTGATL
FT                   AAIILRPKRAPEAPGKTGWATAPHTRTHPTATHTRPLGQRSTGRRDPLLGEHPMTDPIT
FT                   LTAVEALTADRDAYAQALGDMYSLLGFDRDGNPTPAASLTSGAEDFANMMVAAAGAARE
FT                   NAEEAVREARDDALEEVRAHRIEHVFQERPHEYSYRCSCGFLIKHMPFGGLVECPDLSD
FT                   LIRGTAAEEAPHDRN"
FT   gene            114224..114649
FT                   /locus_tag="Lxx01160"
FT   CDS_pept        114224..114649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx01160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01160"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88200"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHE5"
FT                   /protein_id="AAT88200.1"
FT                   /translation="MDHIAQRTDSGKWIKAHTVEHPPLLKQMREAVWPSTGNDGNSKSS
FT                   PQERALADNSMLFAYVTINAAIADWVRMAGGKPTRYPIPNLNQWARLHMSDPDRDDDWY
FT                   VRMLHGWAYTIRHCSTNRSHSPSPVPARCAVPLSGAT"
FT   gene            complement(116688..117068)
FT                   /locus_tag="Lxx01180"
FT   CDS_pept        complement(116688..117068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx01180"
FT                   /product="membrane protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01180"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88201"
FT                   /db_xref="GOA:Q6AHE4"
FT                   /db_xref="InterPro:IPR009732"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHE4"
FT                   /protein_id="AAT88201.1"
FT                   /translation="MIVLATVVVTLAAALHIAIFFMESVAWTRPTVWRRFGVADQAAAE
FT                   TTRPLAYNQGYYNLFLAIGAIVGLILYGAGTLGAGLALILFTMGSMLAAAVVLVTTGRG
FT                   HLRSALIQGTLPLAGIVLMLLS"
FT   gene            complement(117132..118154)
FT                   /gene="adhT"
FT                   /locus_tag="Lxx01190"
FT   CDS_pept        complement(117132..118154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhT"
FT                   /locus_tag="Lxx01190"
FT                   /product="alcohol dehydrogenase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01190"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88202"
FT                   /db_xref="GOA:Q6AHE3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR014188"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHE3"
FT                   /protein_id="AAT88202.1"
FT                   /translation="MTGFRAIVIDQQTEGGRVLAHSAEIRRVSDDILMPGAVTIDVDFS
FT                   DLNYKDGLVIAGRPGVARISPLIPGIDLAGSVAASDDARWRPGDRVVLNGDGLGERHHG
FT                   GFAERARVRGDALVRIPDSITAEQAAAIGTAGFTAMLAVLALERSGADPDRVRAEGSSV
FT                   LVTGAAGGVGSVAVAILAKLGYPVTAATGRAQELGGYLTDLGAEAIIHRDEIARGGKPL
FT                   QAQRWACAVDAVGGTTLATVLAQTRYGGAVAACGLAQSPDLPTTVLPFILRAITLIGIN
FT                   SVEAPVTLRETAWQRLATDLDRDTLATMTRTIPLAEAIPAAEEILAGHIHGRTVVDVRA
FT                   "
FT   gene            118621..119262
FT                   /locus_tag="Lxx01200"
FT   CDS_pept        118621..119262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx01200"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01200"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88203"
FT                   /db_xref="GOA:Q6AHE2"
FT                   /db_xref="InterPro:IPR025902"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHE2"
FT                   /protein_id="AAT88203.1"
FT                   /translation="MLTESFGWGLLLLPFFVLFWVVLAYLVLPRLHRILTRIYVPDYFI
FT                   GRSRTSDGLLGDPINLALLGSEAQLDEAMSAAGWTRADEVTAASSRRIVASTILRRSYD
FT                   EAPVSPLFLFGRQQDVAYQQEVLGNPAKRHHVRFWRCPDGWLLPGGHRVDWLAAGTFDR
FT                   AVGFSLFTLQITHKIDANTDIERDHIVSTLTGSGLDVEVSVIRDFSTGYH"
FT   gene            119326..119421
FT                   /locus_tag="Lxx01210"
FT   CDS_pept        119326..119421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx01210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01210"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88204"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHE1"
FT                   /protein_id="AAT88204.1"
FT                   /translation="MTVEPASTGSARNADARRAALAARRPHSASS"
FT   gene            119421..119900
FT                   /locus_tag="Lxx01220"
FT   CDS_pept        119421..119900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx01220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01220"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88205"
FT                   /db_xref="GOA:Q6AHE0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHE0"
FT                   /protein_id="AAT88205.1"
FT                   /translation="MLLRVLAGVLTVVLTALGWPAFVRSQLATAGPSLTAVEQSQAEGA
FT                   IGVAVGVFAAGLVFYSVLALLVFAGSNWARIASMSYSALLIVVAAIDFFNGGPQATLSV
FT                   NALGLPLDILVVLALSSQGARLWARRLRPGSRGERRLHNHPFAHLDPETPAITRS"
FT   gene            complement(120082..120867)
FT                   /pseudo
FT                   /locus_tag="Lxx01240"
FT                   /note="similar to conserved hypothetical protein"
FT   gene            120874..121749
FT                   /locus_tag="Lxx01230"
FT   CDS_pept        120874..121749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx01230"
FT                   /product="glycosyltransferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01230"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88206"
FT                   /db_xref="GOA:Q6AHD9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHD9"
FT                   /protein_id="AAT88206.1"
FT                   /translation="MLAAKTSSTVRFVRLPFIRGEDGRTMRSIVIIPTYNEWENIGPVV
FT                   GRLRASVPDADVLIVDDGSPDGTGDLADALAATDANVQVLHRAGKSGLGAAYRAGMTWA
FT                   LDAGYDAIVEMDADGSHQPEQLPRLLAVLRRPPGEAPGPGSAGADLVLGSRWVPGGGVV
FT                   NWPAHRRLLSRGGSVYSRIALGVPARDVTGGYRAFTADALRSVRLDDVESQGYCFQIDM
FT                   LRRVHAAGLTVTEVPITFVEREHGASKMTGCIVAEAMLRVTGWGIAGLPRRFRRRTVTP
FT                   AEVTETAPQA"
FT   gene            121753..122289
FT                   /locus_tag="Lxx01250"
FT   CDS_pept        121753..122289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx01250"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01250"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88207"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHD8"
FT                   /protein_id="AAT88207.1"
FT                   /translation="MAMPNDPLQRFRSVPHFTLTSDDIADGRPLSREQWGAGGGGGDRS
FT                   PQLSWSGFPAETKSFAVTIHDPDAPTGSGFWHWAVYNIPASVTALAANAGAEGGAGLPQ
FT                   GAAMLSNELRSKSFTGAGPPPGTGTHRYFVIVHALDVDRLDLDPESTPALLGFTASFHV
FT                   LARALLVPLATAGDI"
FT   gene            122372..123941
FT                   /pseudo
FT                   /gene="prpD"
FT                   /locus_tag="Lxx01260"
FT                   /note="similar to propionate catabolism protein"
FT   gene            123941..124840
FT                   /gene="prpB"
FT                   /locus_tag="Lxx01280"
FT   CDS_pept        123941..124840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpB"
FT                   /locus_tag="Lxx01280"
FT                   /product="phosphonomutase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01280"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88208"
FT                   /db_xref="GOA:Q6AHD7"
FT                   /db_xref="InterPro:IPR012695"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHD7"
FT                   /protein_id="AAT88208.1"
FT                   /translation="MLYSSVPTHEKRAAFRARLASGELMRMPGAFTPLSARLIERKGFE
FT                   GVYLSGAVLSADLGLPDIGLTTLTEVAARSTQTARMTSLPALVDADTGFGEPMNVARMV
FT                   QTLEDAGVSGLHIEDQVNPKRCGHLDGKQVVDEGVALKRIRAAVDARRDPNLLIMARTD
FT                   IRAVEGLDVAIDRAKALVDAGADAIFPEALVGLSEFAAVSAAVDVPILANMTEFGKSEL
FT                   FTVDQLRDIGVNIVIWPVSLLRLAMGAAERGLDQLLTGGTLEPALGEMQHRAELYDLID
FT                   YEGYNAFDSSVFTFEVRR"
FT   gene            124873..126258
FT                   /pseudo
FT                   /gene="gltA"
FT                   /locus_tag="Lxx01290"
FT                   /note="similar to citrate synthase"
FT   gene            126230..126928
FT                   /pseudo
FT                   /gene="radC"
FT                   /locus_tag="Lxx01310"
FT                   /note="similar to DNA repair protein"
FT   gene            complement(126892..128169)
FT                   /gene="aspS"
FT                   /locus_tag="Lxx01320"
FT   CDS_pept        complement(126892..128169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspS"
FT                   /locus_tag="Lxx01320"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01320"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88209"
FT                   /db_xref="GOA:Q6AHD6"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004523"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHD6"
FT                   /protein_id="AAT88209.1"
FT                   /translation="MSVAGWVETVRDQKKVQFVVLRDESGAVQLVNPRTVNEDGTVAAD
FT                   EPALTVSGLSQGSFVRATGELKHDERVKLGGIEIKLSALDVETAAIPETPIAADSGIDK
FT                   RMDWRFLDLREPKHNLIFRVQTTFENALRHYWVDNGFIEIHTPKLMASASESRAELFEL
FT                   PYFETTAYLAQSPQIFKQMAQAAGFGKVFEIGPAFRADPSFTSRHATEFTSVDTEISWI
FT                   ESHEDVMKVHEDLLVAGFTAVKEKHGAEIEALFGVEITVPTTPFPRIPLAEAKRIVAER
FT                   GYEVPRHDDDMDPEGERQISAYVKETFGHEFVFLTDYAASIRPYYHMRHSEDRSITKSY
FT                   DLIFNGVEISTGAQREHRVETIEQQAREKGLSVEELEDVLAFFRYGVPPHGGFGMGLAR
FT                   VLMLMLHLSNLRETTYLFRGPTRLTP"
FT   gene            128327..129016
FT                   /gene="gpm"
FT                   /locus_tag="Lxx01330"
FT   CDS_pept        128327..129016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpm"
FT                   /locus_tag="Lxx01330"
FT                   /product="phosphoglycerate mutase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01330"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88210"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHD5"
FT                   /protein_id="AAT88210.1"
FT                   /translation="MVASQVHLVRHGEVFNPDGILYGRLSGFGLSKLGHRMAQAAADEL
FT                   VSRGRPVTAIRISPLQRTRESAAPIAAAFGRERAVDERLIEPANRFEGTVMRRALRKPV
FT                   NWPYLVNPLRPSWGEPYTSIEKRMREAIEDAFDSVESGDVVLVSHQLPIWVAHLSVVGA
FT                   RFPHDPRNRRCSLSSVTTFEYTTVEAGDAEGLPGSANVGPGGRLVEVAYVEPAARLGSA
FT                   ATDVGAV"
FT   gene            129013..129618
FT                   /gene="dsbE"
FT                   /locus_tag="Lxx01340"
FT   CDS_pept        129013..129618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbE"
FT                   /locus_tag="Lxx01340"
FT                   /product="thiol:disulfide interchange protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01340"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88211"
FT                   /db_xref="GOA:Q6AHD4"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHD4"
FT                   /protein_id="AAT88211.1"
FT                   /translation="MSPRPRLRRALPAVAVVAALLLAGCSSNDSLAAQYRSGSGQGYIA
FT                   GDGSVSEYPSGKRGEPVRFQGKLADGAAVFSKDYAGRVLVVNFWYAGCPPCRLEATDLE
FT                   ALSQKHASDGVEFLGVNLYDTASTAASFEKDKGVTYPSVLDRDTGSVLLAFSKTVPPKA
FT                   TPTTLVIDKKGRVAARILGGLPDRSILDALISDAVAEN"
FT   gene            129620..130357
FT                   /gene="ccdA"
FT                   /locus_tag="Lxx01350"
FT   CDS_pept        129620..130357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccdA"
FT                   /locus_tag="Lxx01350"
FT                   /product="cytochrome C-type biogenesis protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01350"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88212"
FT                   /db_xref="GOA:Q6AHD3"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHD3"
FT                   /protein_id="AAT88212.1"
FT                   /translation="MNVGQIVFSGQLLIALPIAVLAGLVSFLSPCVFPLVPGYLAYVGG
FT                   ISDPGAQRDRGRVLLGVSLFVLGFAVVFVAYGSAFGALGQWLFRWQDFIVQFLGVLVIL
FT                   MGLVFIGQFSFLQRTIKPSWRPSTGLVGAPLLGIVFGLGWTPCIGPTLAAISALSVDAG
FT                   SPWRGALLGLFYCVGLGIPFLLVALGFDWVAGSVSFLKRHIRVINAIGGALLVVIGVLM
FT                   ATGLWTALLSQSLAVITGFEPAL"
FT   gene            130341..131963
FT                   /gene="resB"
FT                   /locus_tag="Lxx01360"
FT   CDS_pept        130341..131963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="resB"
FT                   /locus_tag="Lxx01360"
FT                   /product="cytochrome C biosynthesis associated protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01360"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88213"
FT                   /db_xref="GOA:Q6AHD2"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHD2"
FT                   /protein_id="AAT88213.1"
FT                   /translation="MSRPSDHIDGAPPREYPDVVQPRLGLTGWLRWAWRQLTSMRTALF
FT                   LLLLLAIAAVPGSLFPQRGADPNGVTRYFSENPQLAPVLDKLQLFDVYTSFWFSAIYLL
FT                   LFASLIGCIVPRTGHHLDAMRAKPPRTPVRLSRMAGFQVRMLPAGLRTGGPDPIGSARE
FT                   ILRRSVYRVALFQDATSTSVSAERGYLRESGNLVFHIALVGVLVAVGIGGGFGYTGQKV
FT                   VVEGQSFVNSLPSYNSFNPGRFFSDSSLQPFSIRVDKLDVAYETQNEHAKGIPLDYTAT
FT                   VTTTGPGEATGISRIKVNKPLAIGGTNVYLLGNGYAPTITVRDPEGKVVFTDSVPFLAQ
FT                   DPRLTSLGWVKVPDGLRQQVGMIGFFYPTVGESGTAGALTSTFPGLDDPVLSLNVYVGD
FT                   LGVDSGVPQSVYSLNTDRLDQLTGPPTKTKALELRPGQKVELPNGLGTISLDGVKRYAS
FT                   LEVHHDPAQVWVLVFAVLILAGLLTSLFVPRRRIWVKAVENGDGSLMLEYAGLARGEDP
FT                   NLLATISAVADEHAAILSRPSTK"
FT   gene            132162..133067
FT                   /gene="ccsA"
FT                   /locus_tag="Lxx01370"
FT   CDS_pept        132162..133067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccsA"
FT                   /locus_tag="Lxx01370"
FT                   /product="cytochrome C assembly protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01370"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88214"
FT                   /db_xref="GOA:Q6AHD1"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR017562"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHD1"
FT                   /protein_id="AAT88214.1"
FT                   /translation="MTTIAPASAPGSGIPVIGGADAQPPSSALGRLSSRISSRVEQDVL
FT                   YGSASSVSLKWAFGLTIAGWVAHFVATLLRGIAAARVPWANMWEFSMTGTLVIIGVFLV
FT                   ATLKWDIKYLGTFILGLVLVLQGIALLNYFVPVVPLQPALKSYWLVIHIIVAVLGTAFF
FT                   ALGFALSALQLLQYRRERQLEESRPPQFAFLATLPTSAALENLAYRVNIVGFIAWTFTL
FT                   IAGAIWAEKAWGRYWGWDTKEVWTFIIWVIYAGYIHARATRGWRGSRSAWLAIVGFVAV
FT                   LFNFGIVNVFFHGLHAYSGL"
FT   gene            133817..135263
FT                   /locus_tag="Lxx01380"
FT   rRNA            133817..135263
FT                   /locus_tag="Lxx01380"
FT                   /product="16S ribosomal RNA"
FT   gene            135816..138903
FT                   /locus_tag="Lxx01390"
FT   rRNA            135816..138903
FT                   /locus_tag="Lxx01390"
FT                   /product="23S ribosomal RNA"
FT   gene            139040..139203
FT                   /locus_tag="Lxx01400"
FT   rRNA            139040..139203
FT                   /locus_tag="Lxx01400"
FT                   /product="5S ribosomal RNA"
FT   gene            139277..140953
FT                   /locus_tag="Lxx01410"
FT   CDS_pept        139277..140953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx01410"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01410"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88215"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHD0"
FT                   /protein_id="AAT88215.1"
FT                   /translation="MSDTPADDGKTPRARRNSGRSAGHGDARPGDAGGKNTGWIRGGDA
FT                   AGGGGDRAGTPRTGSGEGKPPFRAKRSADGRQPSRGERPYAVSPYRGDRSGDRKPYRRE
FT                   PSEGGAPPYRGERSGQGKPSFRGERSGGGKTSYRDDRAGRPSPRGERSRGEKPEKPEKP
FT                   AYRGERAGEGKPPYRCGRAGAGDSAGERAGRFGNGNDRGSDGRPDRNGQRPKRNDRRSG
FT                   YGDRDAPSSRGWRSSGGGRLHASRATQGRRDDERLWTKGGRPARGDWSAQDTALTPEQD
FT                   RARELRSVRPRHDDPDLPHDIEARDLDKAARVELKTLSKDNAEWVARHLVMVSRVIEED
FT                   PVLAHRHALSASRRAGRIGVVRETLAITAYATGDFALALRELRTYRRITGSNDQLPLMV
FT                   DSERGVGRPDRALELGRSVDRATLPSDVQVSLAIAMSGARLDRAQPEAALAELEIPQLD
FT                   PDRAFSWSPDLFHAYAEVLEELGRAEQAASWRGHAERAAAALAEAYAGGERETIAVVEE
FT                   EYRIEGLDAIHDEGAGDGADEGEAEAGVQEGEPGDGVAPEE"
FT   gene            140937..141950
FT                   /locus_tag="Lxx01420"
FT   CDS_pept        140937..141950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx01420"
FT                   /product="4-nitrophenylphosphatase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01420"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88216"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHC9"
FT                   /protein_id="AAT88216.1"
FT                   /translation="MLRRNENGVSPLDGRDLILADLDGVVYKGPDAIPHAVESLNRAAE
FT                   TTRVGYITNNASRTAVSVAGHLTELGLRVEPTDVVTSPQAAVRLLSQQVPPGATVLVVG
FT                   GDGLVDEVRKGGFGVTRSAEDDPAAVIQGFAPDVGWTQLAEAAFALQGRTDAERPWIAT
FT                   NIDWTIPVARGVAPGNGTLVSAVHTAAGRLPMVAGKPEVAIFAEAVARFAAARPLFIGD
FT                   RLDTDVLGANRAGIDSVLVLTGIDRAKQLIAADADSRPAYILDDLRGLAQPYPVAKVAR
FT                   NGAVSVGDATVTIDGNDVRILTSGSDELNLLRAACVAIWNSGRAIYGLDVPERLYI"
FT   gene            complement(141955..142947)
FT                   /gene="menC"
FT                   /locus_tag="Lxx01430"
FT   CDS_pept        complement(141955..142947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menC"
FT                   /locus_tag="Lxx01430"
FT                   /product="O-succinylbenzoate-CoA synthase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01430"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88217"
FT                   /db_xref="GOA:Q6AHC8"
FT                   /db_xref="InterPro:IPR010196"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="InterPro:IPR041338"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHC8"
FT                   /protein_id="AAT88217.1"
FT                   /translation="MMPGLSDLLATSHVVRLPMTSRFRGIAAREAVLFDGPQGWTEFSP
FT                   FTEYDDAESAAWLHAAIDFGWRATPPGLRERIPVNATVPAVAAGEVPRVLSRYPGSRTA
FT                   KVKVAEPGQTLADDIARVRAVRERLGPEGRLRIDANALWNVDEAEHAIHALAPFDLEYV
FT                   EQPCPSVEELAEIRRRTAYMGIPIAADESVRRAGDPLAVARAGAADLLVIKAQPLGGIH
FT                   SALRIVEAAGLPVVVSSAIDTSVGVAMGAHLAAAVPELEFDCGLGTVAMFERDVAVDPL
FT                   LPVGGSIPVVRPAIAPDRLAELAAPAERREWWRNRVRRCYGQLERTLER"
FT   gene            143004..143915
FT                   /gene="menB"
FT                   /locus_tag="Lxx01440"
FT   CDS_pept        143004..143915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menB"
FT                   /locus_tag="Lxx01440"
FT                   /product="naphthoate synthase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01440"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88218"
FT                   /db_xref="GOA:Q6AHC7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR010198"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHC7"
FT                   /protein_id="AAT88218.1"
FT                   /translation="MAAAVSETFDPREWDDVPGFGGLTDITYHHDVSGRVARVAFDRPE
FT                   VRNAFRPHTVDELHAALDDARTNPRIGVVLLTGNGPSPKDGGWAFCSGGDQRIRGRDGY
FT                   KYAGGETSAGIDAERSGRLHILDVQRLIRFMPKVVIAVVPGWAAGGGHSLHVVCDLTIA
FT                   SEEHGRFKQTDADVGSFDAGYGSAYFARQVGQKFGREVFFLAREYSARRAYEMGAVNAV
FT                   VPHAALETTALDWAREILTKSPTAIKMLKFAFNAVDDGMVGQQVFAGEATRLAYGTDEA
FT                   VEGRDAFLEKREPDWSPFPWQY"
FT   gene            143928..145181
FT                   /gene="menE"
FT                   /locus_tag="Lxx01450"
FT   CDS_pept        143928..145181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menE"
FT                   /locus_tag="Lxx01450"
FT                   /product="O-succinylbenzoate-CoA ligase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01450"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88219"
FT                   /db_xref="GOA:Q6AHC6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHC6"
FT                   /protein_id="AAT88219.1"
FT                   /translation="MRPLRALDAGRPADVFVALRAALSEGGPAVLPRDGGAEGGRRSGD
FT                   RAPVEGTVAQSVALVIETSGSTGPPKRVALSADALLASAAASAGAMGGQGQWLLALPAR
FT                   YVAGVQVLVRSLAAQTEPVYAEEGRFEAERFARAAGRLDHDLRYTSLVPVQLARLMDAI
FT                   EGGSRTVAEAVRRFDGILIGGQSLDPLLRQRAVTAGARILSTYGSSETAGGCVYDGAPI
FT                   GTTVVREVAGMLEISGPSLAEGYLGEAERTAAAFHEQEGVRWYRTGDLGSVVDGRVRVR
FT                   GRADNVIVSGGEKVLLDAVERVVRERPGYEAAVVVGAADAEWGQAPVVVVGGGKRERGV
FT                   VIGGGAGGSGRGPAVEDMEGGEELTALRASVVRRLGRAAAPSRIVRVGELPRLGSGKPD
FT                   RPEIGRIAAGSGYPGTEA"
FT   gene            145307..146191
FT                   /gene="menA"
FT                   /locus_tag="Lxx01460"
FT   CDS_pept        145307..146191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menA"
FT                   /locus_tag="Lxx01460"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01460"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88220"
FT                   /db_xref="GOA:Q6AHC5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR004657"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHC5"
FT                   /protein_id="AAT88220.1"
FT                   /translation="MRPATGRDWIAGARLRTLPLAIAPVLIGVGAAKVAEGPGVWHPVR
FT                   SLLCLVVAVLLQIGVNYANDYSDGIRGTDQFRVGPGRLTGSGKAAPRRVLTVALVSFGL
FT                   AAIAGLALIVLTQHWWVLLVGAAAIAAAWFYTGGKRPYGYYGLGEVFVFLFFGLVAAAG
FT                   TTYMLAGVINQESWFGAVLAGLIACAVLMANNIRDIEPDRLAKKRTLAVLLGDVASRIV
FT                   FCVLVLAAFAILGMLALLYPIAWFGMFALLAALPTCVIALFARTARELVTALQLTSLTG
FT                   LLVAIALGLAYAL"
FT   gene            complement(146263..146586)
FT                   /locus_tag="Lxx01470"
FT   CDS_pept        complement(146263..146586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx01470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01470"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88221"
FT                   /db_xref="GOA:Q6AHC4"
FT                   /db_xref="InterPro:IPR025323"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHC4"
FT                   /protein_id="AAT88221.1"
FT                   /translation="MKRIPSWLTYSALRLLVFAVPLVILLLLGIIWWASAIAAALIGLC
FT                   LSYIFLSSPRNAVSTDLYAARHREKPGASPDDDVEDAAVDAAQDALGPIRATDQEQKPG
FT                   APA"
FT   gene            146629..146985
FT                   /locus_tag="Lxx01480"
FT   CDS_pept        146629..146985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx01480"
FT                   /product="membrane protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01480"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88222"
FT                   /db_xref="GOA:Q6AHC3"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHC3"
FT                   /protein_id="AAT88222.1"
FT                   /translation="MVRLWIVLGVAAAVFYIYSLVDCAFFDRSRVRALPKSVWLLVTVV
FT                   FPLIGGLLWFVVGRRRLSQAPGRRVVAPDDDPEFLGKLRFDRDQEERIRRLEKEFADLD
FT                   DKNKPDDQTGYRGA"
FT   gene            146978..148756
FT                   /gene="menD"
FT                   /locus_tag="Lxx01490"
FT   CDS_pept        146978..148756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menD"
FT                   /locus_tag="Lxx01490"
FT                   /product="2-succinyl-6-hydroxy-2,
FT                   4-cyclohexadiene-1-carboxylate synthase"
FT                   /note="identified by sequence similarity; 2-oxoglutarate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01490"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88223"
FT                   /db_xref="GOA:Q6AHC2"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AHC2"
FT                   /protein_id="AAT88223.1"
FT                   /translation="MPDARAADEPAQRLPRTGNPATDYALALLAHLIGAGVRDIVVSPG
FT                   SRSQALALAAAELERAGAVRLHVRLDERVGGFLALGIGRETGAPAAVVTTSGTATANLH
FT                   PAVLEAHESGVPLIVITADRPPELRGIRSSQTTHQDGLYGVAVRLAKDVPAPSGEEEDV
FT                   ATAARLAVESVRAAVGAETADPGPVHLNLAFREPLSVAVPPLPVVERGALPALAGAQKL
FT                   GRETVVPGIGPSTVVIAGADAGPEAEEYARSAGFPLLAEVSSGSRFGPNLVVAYRELLR
FT                   EPEFGGRVRRAVVFGHPTLSREVPALLLRDDVETVVVAPRGRQAYNPGRRAVIVGAVRP
FT                   AVEADPRSPEARAWVGLWVSASRRLVEAAERVASPDATAPDLAKARSLDPSDALAFARM
FT                   ELAAVRAPITRPLLAEALWRHTWPHDRLVLGASRLIRDADRIVPGKRLRVHSNRGLAGI
FT                   DGTIATAIGVALASQAVAVETGTLPGITRVLLGDLALLHDAGALLGGSGEAWPNVQVIV
FT                   GNDGGGTIFDGLEVATIASPAAFDRVLYTPQRGDIAALSTAYGWAHRVVRTKGELDQAL
FT                   SAPPAGASVLEVPLER"
FT   gene            148962..149885
FT                   /locus_tag="Lxx01500"
FT   CDS_pept        148962..149885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx01500"
FT                   /product="phage-related integrase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01500"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88224"
FT                   /db_xref="GOA:Q6AHC1"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHC1"
FT                   /protein_id="AAT88224.1"
FT                   /translation="MPKKRSPGEGGLHYDRAKGLWRGRYDDGFHPDGRRRQREVSARTQ
FT                   TVARERLKQKLAEIAEYGTTLGRTVTVAAWAEHYIETDCWMRLKPNSLATTESLMRNWI
FT                   VPLLGRRRISELKPSDVRLVHKAVFDAGLATGTARKAHEILSGMLSAAKADGLVTRNVV
FT                   DDVKPPEVIAKNPRGSLSTEQALAVLAASANVEGTRWWVAVLDGIRQSERLGALIEGLD
FT                   LDAGTLRVDWQLEELRSEHGCEPLAEGQWSCLTKRGSSFPQRRFKVKSSLEYIHLLSLA
FT                   RRRRARGVRAALTWDTKASWIVKRLN"
FT   gene            150188..151045
FT                   /gene="xbaIM"
FT                   /locus_tag="Lxx01520"
FT   CDS_pept        150188..151045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xbaIM"
FT                   /locus_tag="Lxx01520"
FT                   /product="DNA methyltransferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01520"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88225"
FT                   /db_xref="GOA:Q6AHC0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHC0"
FT                   /protein_id="AAT88225.1"
FT                   /translation="MPLWHPGAPDTVVCADNVSVVTALPDGAFRLIYLDPPFNTGRPQA
FT                   RQQTTSVRSEGGSVIGFKGRSYERIKGDLLSFDDRFDDYWQFLEPRLIEAWRLLADDGT
FT                   LYLHLDYREAHYAKVLLDALFGRECFLNEIVWAYDYGAKAKNRWPAKHDTILVYVKNPR
FT                   GYFFDSAAVDREPYMAPGLVTPEKAELGKLPTDVWWHTIVSPTGREKTGYPTQKPEGIL
FT                   RRIVQASSREGDWVLDFFAGSGTTGAVAAGLGRRFLLVDSSPDALAVMRERFAAAVSPV
FT                   RFVG"
FT   gene            151081..151923
FT                   /locus_tag="Lxx01530"
FT   CDS_pept        151081..151923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx01530"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01530"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88226"
FT                   /db_xref="GOA:Q6AHB9"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHB9"
FT                   /protein_id="AAT88226.1"
FT                   /translation="MGGWVTMRTKLRVLPFLVGALGCAVAFAGVYLLFVRSYIGQVIDE
FT                   SAFTGADVWKGDLIEFASTFLEVLPVVAVVIGVVTAIAIVAVRRNGTVFAVAVGAALAA
FT                   NVCTQVLKYAILSRLEKGVDIGLANSLPSGHTSVAGSAALVVFLVTAPAYRPLAAVIGS
FT                   VFTIVAGASTLVEQWHRPSDVVAAMLVIAFWGCVAGVVLAVLRLPPADPPVRSKLLPLL
FT                   SIAVVCAVAAVIALAATYFSAQAGSEHLFIAYAGSVAAIVTTGFLIAVVGNRLYRALA"
FT   gene            151994..153379
FT                   /locus_tag="Lxx01540"
FT   CDS_pept        151994..153379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx01540"
FT                   /product="Na+/H+ antiporter"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01540"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88227"
FT                   /db_xref="GOA:Q6AHB8"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHB8"
FT                   /protein_id="AAT88227.1"
FT                   /translation="MTDWGSQPSRPGGALTGTEVRVPVIVLIGFAAVVLWSLVARRFER
FT                   TGIAGPAALAALGAIVVLVDVPAFTAAIDSDIAERVVELILAVLLFVDACEVRGGLFGG
FT                   KGRSLVRLVLIALPLSLALLVVVGAWLLPTTGIFVLVVIACIVMPIDFAPVTALLRSQL
FT                   IPARVRRILNVESGYNDGLISPVFGMSLAVAVALPALIRIVDTGNEAGVDGKHLEKGIA
FT                   DFLQAFLGAVPATVFAIVVGLVVGGALGFLTHWTSRRGWADATGIRFVTLLAPLLAFGV
FT                   ATLPGIGANGFVAAFVAGVVFRVARMRKSGMRSVPNEELLLVEEASTVAANFVWFILGG
FT                   MMTAVTVAGIDGRLVVIALLALTVFRALPVFLAMLGSPLGWRDRTFLGLIGPRGTTSIV
FT                   FGLLAFNQLPEGDGKSILSVTALTVVGSILLHGVVAPLVLRRLPDGGHRERSAGYSPAV
FT                   CGR"
FT   gene            153261..153942
FT                   /pseudo
FT                   /gene="tcr"
FT                   /locus_tag="Lxx01560"
FT                   /note="similar to tetracycline efflux protein"
FT   gene            155170..155918
FT                   /pseudo
FT                   /locus_tag="Lxx01570"
FT                   /note="similar to aryl-alcohol dehydrogenase"
FT   gene            156036..156497
FT                   /gene="tnp"
FT                   /locus_tag="Lxx01585"
FT   CDS_pept        156036..156497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnp"
FT                   /locus_tag="Lxx01585"
FT                   /product="transposase, ISlxx4"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01585"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88228"
FT                   /db_xref="GOA:Q6ADW2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ADW2"
FT                   /protein_id="AAT88228.1"
FT                   /translation="MSHVNAALTPRARLRLARLIVEDHWLVSVAAKMFMVSPVTARKWA
FT                   ARFRAEGTGGMTDRSSRPRSMPTRTPLPVLKRIVRARWRRRLGPVQIAGELGLPASTVH
FT                   AVLVCCRINRLCTIDRVTGEPIRRYEHDHPGSLIHVDVTKFGNIPNGGG"
FT   gene            complement(157358..158242)
FT                   /gene="scrK"
FT                   /locus_tag="Lxx01600"
FT   CDS_pept        complement(157358..158242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scrK"
FT                   /locus_tag="Lxx01600"
FT                   /product="fructokinase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01600"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88229"
FT                   /db_xref="GOA:Q6AHB6"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHB6"
FT                   /protein_id="AAT88229.1"
FT                   /translation="MIAGIETGGTKIVCGVAERGNPAEPAQTRRFPTTTPGETLGRIAD
FT                   FLREVGPVEAVGVASFGPVDADPSSSRFGWVTSTPKPGWADTDVLGAVRSAANAPVAFV
FT                   SDVTGAAIGEFRAGAGQGARNLGYTTIGTGVGVGLILDGRPVTGNGWPELGHLLVRRHP
FT                   ADRFAGNCPYHGDCLEGLTAGPAVSARWGADASSFSTDLRDEAFDILAYYIAQLAVTTV
FT                   FTLGLDRMVLGGGVMLAPGLLERTRPALSAIAGGYGPPQLASGDPRDLLVAPALECASG
FT                   LVGALSLAADLVA"
FT   gene            complement(159477..159863)
FT                   /pseudo
FT                   /gene="tnp"
FT                   /locus_tag="Lxx01603"
FT                   /note="similar to transposase, undefined"
FT   gene            complement(161086..161162)
FT                   /gene="Met"
FT                   /locus_tag="Lxx01610"
FT   tRNA            complement(161086..161162)
FT                   /gene="Met"
FT                   /locus_tag="Lxx01610"
FT                   /product="tRNA-Met"
FT   gene            complement(161194..161271)
FT                   /gene="Thr"
FT                   /locus_tag="Lxx01620"
FT   tRNA            complement(161194..161271)
FT                   /gene="Thr"
FT                   /locus_tag="Lxx01620"
FT                   /product="tRNA-Thr"
FT   gene            complement(161262..161729)
FT                   /pseudo
FT                   /locus_tag="Lxx01625"
FT                   /note="similar to peptidase"
FT   gene            complement(161836..162117)
FT                   /pseudo
FT                   /gene="tnp"
FT                   /locus_tag="Lxx01628"
FT                   /note="similar to transposase, ISlxx4"
FT   gene            complement(162235..162936)
FT                   /locus_tag="Lxx01640"
FT   CDS_pept        complement(162235..162936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx01640"
FT                   /product="transcriptional regulator, DNA binding domain"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01640"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88230"
FT                   /db_xref="GOA:Q6AHB5"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHB5"
FT                   /protein_id="AAT88230.1"
FT                   /translation="MSLATLDTLRPTAQPAAAAPAPRIRAVPEGTEARGFVLYVGIDEL
FT                   KAASAGTDLGRIVEALKQLTAELAPESETYAAVALAPAGAGGRDVDVVRLALQDPSAIA
FT                   KHRHTRAADEDEDEDRASSGVVIDISRKRLVLDNQAVALTYKEFELLQYLVLRKGRTIE
FT                   RAELISSLWAAADEDEVPNERTIDVHIRRLRSKLGRYEDIVRTVRGVGYRFDRRADVSI
FT                   RHASAPSPDLF"
FT   gene            complement(163344..163976)
FT                   /gene="upp"
FT                   /locus_tag="Lxx01650"
FT   CDS_pept        complement(163344..163976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="Lxx01650"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01650"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88231"
FT                   /db_xref="GOA:Q6AHB4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AHB4"
FT                   /protein_id="AAT88231.1"
FT                   /translation="MRVHVADHPLITHKLSVLRNKETPAPTFRALTEELVTLLAYEATR
FT                   AVRVEPVEIETPVTSTRGVTISEPRPLVVPILRAGLGMLEGMVSLMPTAEVGFLGMARN
FT                   EETFEPTTYAERLPMDLSERQCFVLDPMLATGGSLGAAIDFLFKRNAVDVTAICILAAP
FT                   EGLAALEKATEGRDVTIVLGALDERLNENGYIVPGLGDAGDRLYGTV"
FT   gene            164051..164482
FT                   /locus_tag="Lxx01660"
FT   CDS_pept        164051..164482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx01660"
FT                   /product="cytosine/adenosine deaminase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01660"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88232"
FT                   /db_xref="GOA:Q6AHB3"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHB3"
FT                   /protein_id="AAT88232.1"
FT                   /translation="MRRALADAARAAATGDVPVAALVVDAGERVIGTGRNERELLRDPT
FT                   AHAEVLALREAASSRADWNLEGCTLVVTLEPCAMCAGAILGARVTTVVFGAWDEKAGAA
FT                   GSLYDILRDRRLPARSEVYAGVLAEECRALLLAFFEAKR"
FT   gene            complement(164847..165659)
FT                   /locus_tag="Lxx01680"
FT   CDS_pept        complement(164847..165659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx01680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01680"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88233"
FT                   /db_xref="GOA:Q6AHB2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHB2"
FT                   /protein_id="AAT88233.1"
FT                   /translation="MIIIPSPIAPIVVQVLVGSVVVGWLTARTADLLRRSWLGSAMVLP
FT                   FLLPPILLYNMLPLRTTILLYIEIAILFRLLLKLRPELLTNRYREFVLLTVAIVVVAFW
FT                   RSENLLYLLIPYAAVSLRIFRRDPGSSRRALATALVIAAGFSGAMAGVNVVLANSKYLM
FT                   TATMNPLSVMLAGNLGGPHLEANLAAIDRSTSPSSGSTRTRWTSRRCGRAKARFSATGT
FT                   ERMPVRSSGRTSHSSERTRECSSRPGCRPSSRRIRWAASRRPRSEAKR"
FT   gene            complement(165822..165974)
FT                   /locus_tag="Lxx01690"
FT   CDS_pept        complement(165822..165974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx01690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01690"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88234"
FT                   /db_xref="GOA:Q6AHB1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHB1"
FT                   /protein_id="AAT88234.1"
FT                   /translation="MTVEAPPPAIGRPLIWFGMRVLAFAMVYSAVLCAMAFIRKWRNGD
FT                   PAMRR"
FT   gene            complement(166133..166438)
FT                   /locus_tag="Lxx01700"
FT   CDS_pept        complement(166133..166438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx01700"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01700"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88235"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHB0"
FT                   /protein_id="AAT88235.1"
FT                   /translation="MTKTALILQHSPSIHLGNIGPVLTEHGYDLCVIDATRTDVAAIDP
FT                   TEADLVVVLGGEKAAYQSEEFPFLAAEQPLLRVAGRDLTQNDERHTAIAHIAMAVV"
FT   gene            complement(166435..167397)
FT                   /locus_tag="Lxx01710"
FT   CDS_pept        complement(166435..167397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx01710"
FT                   /product="cation transporter"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01710"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88236"
FT                   /db_xref="GOA:Q6AHA9"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="InterPro:IPR040177"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHA9"
FT                   /protein_id="AAT88236.1"
FT                   /translation="MSASGGTRAIVAAFAANLGIALTKLIAWLFSGSSSMLAEGVHSIA
FT                   DCGNQLLLLLGGRRAKKKADRKHPFGYGRERYVYAFVVSIVLFSAGGVFSLYEGVEKLT
FT                   HRHSLENSWLPLLVLLIAIGLESFSLRRAIHESRPHKQSISWLQFIRRAKAPELPVVLL
FT                   EDVAALAGLLFALIGISLSVLTGDAVWDAIGTLLIGTLLIVVALVLGFETKSLLVGEGA
FT                   SDSDAAAIERAVLSGGEVERIIHMKTLYLGPDELLFGAKVAMSGESRLADVSAAIDAVE
FT                   RRIREVVPAARVIYVEPDVWVDPNERNPPTDAIVIKGLE"
FT   gene            167459..168268
FT                   /gene="proC"
FT                   /locus_tag="Lxx01720"
FT   CDS_pept        167459..168268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="Lxx01720"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01720"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88237"
FT                   /db_xref="GOA:Q6AHA8"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHA8"
FT                   /protein_id="AAT88237.1"
FT                   /translation="MLGAGSMGRAILSGLTAPGVTVTGGIRATNRSAASAEGLGDLPGV
FT                   TAYATEADPDANRLAVAGTEIVVVAVKPGMVPGLLREIAPSLTPGAVVVSVAAGVTTAT
FT                   FESLLPESVAVVRSMPNTPAVVGRAVTGISAGTRSEPDDLALVRSLFETVGEVVDVPES
FT                   QLDALGTISGSGPAYVFFLVEALTAAALEKGFTPEQARTLVNGTFLGAADLLVASGEDP
FT                   ADLRRRVTSPGGTTERAIGVLAAADLPALFARATDAALARSRELAAT"
FT   gene            complement(168392..168833)
FT                   /pseudo
FT                   /locus_tag="Lxx01725"
FT                   /note="similar to acetyltransferase"
FT   gene            complement(169145..169816)
FT                   /gene="trkA"
FT                   /locus_tag="Lxx01730"
FT   CDS_pept        complement(169145..169816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA"
FT                   /locus_tag="Lxx01730"
FT                   /product="potassium uptake protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01730"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88238"
FT                   /db_xref="GOA:Q6AHA7"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHA7"
FT                   /protein_id="AAT88238.1"
FT                   /translation="MVDRIKHNAPVLVIGLGRFGAATAGQLDRLNREVLAIDTDPSLVQ
FT                   KWADRVTHTVQADARSIETLRQIGAEDFSIAVVAVGSSIEASVLITANLVDLRIPQIWA
FT                   KAISQSHGKILERIGANHVIYPEAEAGERVAHLVSGRMLDFIEFDDDFALVKMYPPKPI
FT                   RGLNLTESGVRTKHNITVVGVKSPGKPFTYATADTVVSNHDLIIVSGASADIERFAALD
FT                   A"
FT   gene            complement(169809..171203)
FT                   /gene="trkH"
FT                   /locus_tag="Lxx01740"
FT   CDS_pept        complement(169809..171203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkH"
FT                   /locus_tag="Lxx01740"
FT                   /product="potassium uptake protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01740"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88239"
FT                   /db_xref="GOA:Q6AHA6"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHA6"
FT                   /protein_id="AAT88239.1"
FT                   /translation="MGRVRAAVNGFAQRSPSRFAILVFAALILVFTLLFSLPISSASGH
FT                   VTGLADSLFTAISVICVTGLSTVDMATHWSVFGHLLVYLGVQIGAVGVLTMASILGLVI
FT                   SRRLGLRAKLIAASDSNPLRMHSGPVAEGQAVLLGDVGKLLRTVAISMIVIEGLVAVLL
FT                   FPRMLIAGVNVGTALWESVYYSAMAFTNTGFAPNAEGLTPFVNDFWFLGALMIGVFLGA
FT                   IGFPVILAIASNLRRRRRRWSIHVKLTLLMSVILLVVGAVLYIVLEHDNAKTFGGLDAG
FT                   HTVFQSFFLSTMARSGGFSTIDIDDLHGSSLLVTDMLMFIGGGSASTAGGIKVTTLAVL
FT                   FLAAVAEARGVEPMDAFRRRIPVDVLRLAVAVALWGATIVAVSAVLILQITKAPLDHVL
FT                   FDVISAFATCGLSTGLTEKLPDAGVYVMAATMFCGRVGTVTLAAALAQSQRKQLYQNPE
FT                   ERTLVG"
FT   gene            171313..171735
FT                   /gene="arsR"
FT                   /locus_tag="Lxx01750"
FT   CDS_pept        171313..171735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsR"
FT                   /locus_tag="Lxx01750"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01750"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88240"
FT                   /db_xref="GOA:Q6AHA5"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHA5"
FT                   /protein_id="AAT88240.1"
FT                   /translation="MADIFDVIADPTRRDILRVLLDRNSDQSSPAGEISVSEIVARLEL
FT                   SQPTVSKHLKVLREAALVVVREEGQHRYYRIDPTPLEAVEDWVIPFTAADMDVSALSAQ
FT                   LAQETREFASTVGKVLADTRHRVERVTPKIWRRDER"
FT   gene            171831..172040
FT                   /locus_tag="Lxx01760"
FT   CDS_pept        171831..172040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx01760"
FT                   /product="excisionase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01760"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88241"
FT                   /db_xref="GOA:Q6AHA4"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHA4"
FT                   /protein_id="AAT88241.1"
FT                   /translation="MGHDAASSALSDVRFLTVAEVAEMMRVSRMTVYRLVHSGQLPAIR
FT                   FGRSFRVPESAVTQALKQGVAVTA"
FT   gene            172325..172594
FT                   /locus_tag="Lxx01770"
FT   CDS_pept        172325..172594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx01770"
FT                   /product="redoxin"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01770"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88242"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHA3"
FT                   /protein_id="AAT88242.1"
FT                   /translation="MPPAYRLLALIGKPGCHLCDDARRVVAAVVAGLPEDAPAVTVEEH
FT                   DILRDPVLHEKYVEEIPVVLIDGRMHTFWRVDPARLRTALLEDR"
FT   gene            172591..172893
FT                   /locus_tag="Lxx01780"
FT   CDS_pept        172591..172893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx01780"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01780"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88243"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013097"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHA2"
FT                   /protein_id="AAT88243.1"
FT                   /translation="MTIRHVVMLKLATEDPSERAEQVARIKAGIESLPAVVPEILSFEV
FT                   GINALFSGENHDVVLIGDFADAEALQRYVDAPAHREIAGYIRTVVRGRSAVDFEL"
FT   gene            complement(172964..173653)
FT                   /gene="gntR"
FT                   /locus_tag="Lxx01790"
FT   CDS_pept        complement(172964..173653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntR"
FT                   /locus_tag="Lxx01790"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01790"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88244"
FT                   /db_xref="GOA:Q6AHA1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHA1"
FT                   /protein_id="AAT88244.1"
FT                   /translation="MKDSAPVERQLLRDVVYNRLYEGILDGTLEPGETLLDEKLTTWLG
FT                   VSRTPIREALMKLADIGLVEMAPNRYTRVAPIDLRAIDEAVYTSGLLHEYAARTAVSTL
FT                   DNAAIGRLEKALKQVKKTAKSGQAPALGQALNDFFLEFGRDSHNQALLAISEGLGPQLL
FT                   RYVSVWHLPFATEDIAERVAEIFDAAKAKDADRTGELIKTLFEPTYDQFVADYRRTHAE
FT                   IDEAPII"
FT   gene            complement(173665..174339)
FT                   /gene="gntR"
FT                   /locus_tag="Lxx01800"
FT   CDS_pept        complement(173665..174339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntR"
FT                   /locus_tag="Lxx01800"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01800"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88245"
FT                   /db_xref="GOA:Q6AHA0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AHA0"
FT                   /protein_id="AAT88245.1"
FT                   /translation="MPVPITEAVSPRRLIRDEVFERLLDAIVGGDLTPGEQLYDAEIEK
FT                   WVGVSRTPVREALNQLAAMGLVEILPQKRTRVTPINPARLRGLIETTGTLLSGVARDAT
FT                   AFLTDADKQKLRDFQERISGGTDRLDRDRALTESFINVFVRRLDNKTIARLANRHLPEV
FT                   RRALIVAPSSEAFEKAQPFVEPIVDAAIAGDGKTVAQGVADYWNKGLITVVDEFEAVER
FT                   NS"
FT   gene            complement(174841..176115)
FT                   /gene="menF"
FT                   /locus_tag="Lxx01810"
FT   CDS_pept        complement(174841..176115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menF"
FT                   /locus_tag="Lxx01810"
FT                   /product="isochorismate mutase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01810"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88246"
FT                   /db_xref="GOA:Q6AH99"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH99"
FT                   /protein_id="AAT88246.1"
FT                   /translation="MTVLSVETTPLDDVHQLIPFLDSRRPLVWLRNGEGMAGIGEALRL
FT                   EFSGADRIREASATWRATVDAAIVTDSVRTPGTGLVAFGAFAFADDSAATSTLIVPDFI
FT                   VGRRDGRSWVTRISPIRAEKAAEAGRTAEPGKGNPAATAIPRPTAFGDKCRVNFLPGSL
FT                   SEDGYREAVATAVDRIRKHGLAKAVLARDLSAHLPLGSDARRALAELALGYPDCWTFAV
FT                   DGLIGSSPETLVRVHHGTVTARVLAGTMSRGQDAAADREAADALAASAKDQDEHRFAVA
FT                   SVIGALRPHSADLAASDRPFTLKLPNLWHLATDVAGTLSDGSSSLGLADALHPTAAVAG
FT                   TPTRDAVALIRELEPFDRGRYAGPVGWVGGDGDGEWAIALRCAQLGENGDLTAYAGAGI
FT                   VADSDPDRELAETAIKFRPIVEAFG"
FT   gene            176260..177357
FT                   /gene="ubiE"
FT                   /locus_tag="Lxx01820"
FT   CDS_pept        176260..177357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="Lxx01820"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01820"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88247"
FT                   /db_xref="GOA:Q6AH98"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH98"
FT                   /protein_id="AAT88247.1"
FT                   /translation="MVSKADLSKQPVQVVAMFDEVSTHYDRTNAVLSMGNASLWRAATT
FT                   RAVGPLAGETILDIAAGTGTSSASLARNGARVVAADFSPGMIEVGRRRQSGNPFVTFQQ
FT                   ADATDLPFPDDTFDAVTIAFGLRNIVEPRRALAEFYRVTKPGGRVVICEFSHPPVALIR
FT                   SGYNVYLRWGMPVLARAASSNPAAYEYLMDSIQAWPEQPELAAWLREAGYQDVAWRNLT
FT                   AGIVALHRGWKPLTAKAAPAAESVLKQSAPEDSAPGEPERGKPGPDSSATATSATAKPA
FT                   TRKSAPAKSESVAPSPRKSAPEKSVAAKPASPKPATAKPAIDKSTDSAGKPSGSAGRSS
FT                   GRGAASGGGAGSEYSSSAIPPEGEQ"
FT   gene            177375..178436
FT                   /gene="hepB"
FT                   /locus_tag="Lxx01830"
FT   CDS_pept        177375..178436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hepB"
FT                   /locus_tag="Lxx01830"
FT                   /product="trans-hexaprenyltranstransferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01830"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88248"
FT                   /db_xref="GOA:Q6AH97"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH97"
FT                   /protein_id="AAT88248.1"
FT                   /translation="MRRPVTLTGQLGFTERIFARGEARQVATAVDDGLALVEEALHREV
FT                   RFADNLADVTTRYLLEAGGKRVRPMLTLLTAQLGKGNTPEVLQAAQAVEITHLASLYHD
FT                   DVMDDSQMRRGVPTAQFVWGNSVAVLTGDLLFARASKLVSSLGERAIQLQADTFERLCL
FT                   GQLHETIGPQDGEDAVAHYIRVLEDKTGSLIAVAAQMGIVFSGADSSYEEPVVTFGEKI
FT                   GVAFQLIDDVIDLSSEGVAETGKTPGNDLRAGVATLPVLRLRERALRDPEAAALLDRLD
FT                   RDVMGSTADDGEVTPEATAAISALREHEVTRQTLEEAHRWAREAFEALEPLPEGPVKKA
FT                   LVRFADTIVERSS"
FT   gene            178455..179825
FT                   /gene="frp"
FT                   /locus_tag="Lxx01840"
FT   CDS_pept        178455..179825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frp"
FT                   /locus_tag="Lxx01840"
FT                   /product="ferredoxin/ferredoxin-NADP reductase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01840"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88249"
FT                   /db_xref="GOA:Q6AH96"
FT                   /db_xref="InterPro:IPR021163"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH96"
FT                   /protein_id="AAT88249.1"
FT                   /translation="MTKLRLAIVGAGPAGIYAADILLKAERGFDVSIDLFETLPAPYGL
FT                   VRYGVAPDHPRIKGIITALRDVLDRGDIRIFGNVTYGVDITLDDLKRHYNAVIFATGAV
FT                   HDADLEIPGIGFGGSYGAADFVSWFDGHPDVPRTWPLAAKSVAVIGNGNVALDVSRILA
FT                   KHADDLLPTEIPDNVYRVLRDSPVTDVHVFGRRGPAQVKFTPLELRELGELRDVDMIVY
FT                   DEDFDYDEQSRAAIASNKQVMVIDRVLQQWRQREVGRASRRLHLHFYAKPLEVVGDEAG
FT                   KVRALRYERTEPDGEGGTRGTGEVRELDIQALYRAVGYFGSPLPGIPFDKKHGVIPNHE
FT                   GQVLRKGDNERMYGVYATGWIKRGPVGLIGHTKSDAMETIKHVINDQGNWWSPIDPAEE
FT                   AVENLLRERGVEYTNLDGWHSLDTHEQALGAEQGRARIKVVPREEMVRVSNGAAVES"
FT   gene            complement(180915..182055)
FT                   /pseudo
FT                   /locus_tag="Lxx01850"
FT                   /note="similar to lipopolysaccharide modification
FT                   acyltransferase"
FT   gene            complement(182471..182917)
FT                   /locus_tag="Lxx01880"
FT   CDS_pept        complement(182471..182917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx01880"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01880"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88250"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH95"
FT                   /protein_id="AAT88250.1"
FT                   /translation="MEADNAVKQARKEVDQRYDFKNVGASVEWSGEKILLKASTEERVK
FT                   AVLEVVESKMIKRGITLKSLDTGAAYPSGKEFRLEISLKNGIEQDAAKKIGKLIRDEAP
FT                   KSVKSQIQGDELRVSSKSRDDLQATMALLKSADLDVALQFVNFR"
FT   gene            183370..183457
FT                   /gene="Tyr"
FT                   /locus_tag="Lxx01890"
FT   tRNA            183370..183457
FT                   /gene="Tyr"
FT                   /locus_tag="Lxx01890"
FT                   /product="tRNA-Tyr"
FT   gene            184144..185316
FT                   /pseudo
FT                   /gene="wecB"
FT                   /locus_tag="Lxx01900"
FT                   /note="similar to UDP-N-acetylglucosamine 2-epimerase"
FT   gene            185869..188013
FT                   /pseudo
FT                   /locus_tag="Lxx01920"
FT                   /note="similar to transcriptional regulator, LuxR family"
FT   gene            188236..190275
FT                   /locus_tag="Lxx01930"
FT   CDS_pept        188236..190275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx01930"
FT                   /product="acetyltransferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01930"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88251"
FT                   /db_xref="GOA:Q6AH94"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH94"
FT                   /protein_id="AAT88251.1"
FT                   /translation="MQAPTSSRAGDRTPAPAQGVLRRDRTSPSNLRGAKLEFLHLSALD
FT                   GARGLAIISVVLYQSGWSERGLFGVDAFFVISGFLITLLLIREAVNRGRISIRGFYARR
FT                   ARRLLTPVVFTLTAVLLLVWTYGTVSELKQAGETAVFSLLQVANWHQIGNDNAYWEASG
FT                   AIIPLGQMWSLSATGQFYLVWPLLFALLWFVARKSITKFGLYIGVVFVAASLVAPLLYD
FT                   GTNTDRLYLGTDARAVAFIAGAVCACFVAGALRYAPRWAGPEAGGLAKFVITALSVVSL
FT                   TATVTASVMVSSYHEPWLYQGGFAIVALIVDVFVSTLCFPANGLRSFFSWKPFQRIGVI
FT                   SYAIFLVHMPVLWMLKTFNPELPPLPLFGIGLVVSWAVAWVLHYLWAEPLRTARWNLKR
FT                   GLVASTIGAATVVALTVSLPTVSLPRVDHAAARAGANSSTASIFPVDGNIALPVKSDGT
FT                   PVTVAVIGDSVAGNMYESLADYYDGSQGSLSAVNVTTGGCGIFDADSARSGEGFVMDTV
FT                   KLCWPWQEKLQDANAEQSPDVYILHNLWDANDQLIAGEWVDPGDPAWADRYRAQLERLV
FT                   EIGHESGNEPLILLSNDRHRDPGGSLSPTRLGAVDAVADEIIAEHPNVKRLDFRGGVCP
FT                   DGTCAYTFSNGEPVYRDGAHFASQGLTAMAPWLVEQIARGLTEG"
FT   gene            190687..191265
FT                   /locus_tag="Lxx01940"
FT   CDS_pept        190687..191265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx01940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01940"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88252"
FT                   /db_xref="GOA:Q6AH93"
FT                   /db_xref="InterPro:IPR026392"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH93"
FT                   /protein_id="AAT88252.1"
FT                   /translation="MSAVESRVGATPVSTTNRWMPALRVLSAVVCLELVGVLLLTQEKF
FT                   RAYEATLVSAVGNFFEGRISSHMGDAVLVQTSDLVWTAFRITMECTSLVMIIPLLLFSA
FT                   LIVLPAKAHWGSWLTATVVGLVLIEIINVARIWLIILATRTWSEAGFWWTHVVSGSVLA
FT                   IFGASVTVTVMLKIVNGKIRNRAERTPSA"
FT   gene            191262..191387
FT                   /locus_tag="Lxx01950"
FT   CDS_pept        191262..191387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx01950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01950"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88253"
FT                   /db_xref="GOA:Q6AH92"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH92"
FT                   /protein_id="AAT88253.1"
FT                   /translation="MMLLYVLAMGLTISFISYVAFIAIPFLRRKPFAAGDPSQFT"
FT   gene            191397..191945
FT                   /pseudo
FT                   /locus_tag="Lxx01960"
FT                   /note="similar to glycosyltransferase"
FT   gene            192255..192611
FT                   /locus_tag="Lxx01970"
FT   CDS_pept        192255..192611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx01970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01970"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88254"
FT                   /db_xref="GOA:Q6AH91"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH91"
FT                   /protein_id="AAT88254.1"
FT                   /translation="MIAMFTWIVVDALLVTTIIRSPYGPLEWVQQNWILTILVLVVGIA
FT                   PFAIWGPIYRRLAAPERSVASGVWWGVLVYFYNLYIMITTPRAFYRAVRGKQGWAKTRR
FT                   NGENLGLGAVAREA"
FT   gene            192608..193273
FT                   /locus_tag="Lxx01980"
FT   CDS_pept        192608..193273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx01980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01980"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88255"
FT                   /db_xref="GOA:Q6AH90"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH90"
FT                   /protein_id="AAT88255.1"
FT                   /translation="MMNTRSTRRNRARSSPPGTSRADSRQRKPRHLAGWALLLTVVAFD
FT                   ALAIAFTSQLLWMSGGHTVRRGSEFVLTAAFITCTLCAAARIVTVRRSVRLRDSRLLWS
FT                   AVGVLESVLALSCLYLGVANSSYRLCWIAAFAGGYMLMNAIIQAVLIVLFRLGRGPVVA
FT                   GLVQLVAALVVLAFTSHVWGSNGVLGDLLVLAGGALLAAEVPAALAGLAFPPETPSEA"
FT   gene            193961..194074
FT                   /locus_tag="Lxx01990"
FT   CDS_pept        193961..194074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx01990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx01990"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88256"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH89"
FT                   /protein_id="AAT88256.1"
FT                   /translation="MNLDDPQVEADSEKANEDSLLYQKICHTLLGTDLFQP"
FT   gene            194200..194265
FT                   /locus_tag="Lxx02000"
FT   CDS_pept        194200..194265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02000"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88257"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH88"
FT                   /protein_id="AAT88257.1"
FT                   /translation="MIDPVAGEIIDQKDLAQRLLA"
FT   gene            194390..194590
FT                   /pseudo
FT                   /locus_tag="Lxx02005"
FT                   /note="similar to transposase"
FT   gene            complement(194907..195371)
FT                   /pseudo
FT                   /locus_tag="Lxx02010"
FT                   /note="similar to conserved hypothetical protein"
FT   gene            complement(195480..196355)
FT                   /locus_tag="Lxx02020"
FT   CDS_pept        complement(195480..196355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02020"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88258"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH87"
FT                   /protein_id="AAT88258.1"
FT                   /translation="MLSGDIYSTDSALGMVYLREDGNVYLENVTMINAPAGVTFKQVSG
FT                   GLDTGNGAVMVGAIATDGTPYFSYGSSTFAHSSNVPASTSTVNGIWFLGDEGQVYGGGG
FT                   AHIAAPADVSFTSISASQNPVTGTWMVAGVTADGSAYVSESMGDFSKAPVTDVEESAIG
FT                   MAFLSSDGDVYTRTGTKIAAPAGVKFKELTGTINSGNQAWMLGAIATDGTPYSSYNSAA
FT                   FAKNNTLASAESSANGMFFLGADGQVYSGSGVKVAAPAGVSFKSISASVHPLSGAWEVG
FT                   GTATDGKSYT"
FT   gene            196797..197480
FT                   /gene="suhB"
FT                   /locus_tag="Lxx02030"
FT   CDS_pept        196797..197480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="suhB"
FT                   /locus_tag="Lxx02030"
FT                   /product="inositol monophosphatase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02030"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88259"
FT                   /db_xref="GOA:Q6AH86"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH86"
FT                   /protein_id="AAT88259.1"
FT                   /translation="MLTARRSRSSIRDALAAARPRDGFLGEETGADRGSSGLTWVVDPI
FT                   DGTVNYFYGIPAYAVSVAVVEGDPDPASWVTLARAVANLESREVFTAAAGAGARLNGTA
FT                   LRVNGGVELPLALVGTGFGYDAAMRTRQAQFVAELVGRVRDVRRIGAASLDLCGLAAGR
FT                   LDAYFERWLNPWDHAAGALIAREAGARVGGRAGGAEGRELLIAAAPGLYEQLDPLVQRF
FT                   YAGWE"
FT   gene            197647..198036
FT                   /pseudo
FT                   /gene="tnp"
FT                   /locus_tag="Lxx02035"
FT                   /note="similar to transposase, ISlxx4"
FT   gene            complement(198580..200076)
FT                   /locus_tag="Lxx02040"
FT   CDS_pept        complement(198580..200076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02040"
FT                   /product="dolichyl-phosphate mannose synthase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02040"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88260"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH85"
FT                   /protein_id="AAT88260.1"
FT                   /translation="MKTIIAIPAYNCAPQLPRVLAALDAGRAASVQEVWVVDNGSTDGT
FT                   AEVAVEHAANWGNLRVFRNRRNVNLGGTYKTVFLKAREARATHVVILHGDDQARAEEAY
FT                   DLIAYAAAGGPQTVLGSRFGRGSRLHGYDLKRIFGNRVLNAIYSVCTFRALTDLGSGLN
FT                   LFALADLDPRSYLRFGDRLSFNYELILDLIRRRVDFRYEPITWREEDQVSNARNVRVFS
FT                   EGLGILARWRFRHDPWGPVAPASDYELGSTGMTEPLQIVLPMAELGQRFRATSETQPKP
FT                   LIEVDGGPMFRKALDSLTAAGIRGDVTAIIRAELQRDHGLGTALRAASPDLRVVELAAP
FT                   TGGAAETVLAAPLDPERPLLIMDCDIAFESPGYASELARATAGGADGVLLSFPSSDPRY
FT                   SFAATDDNGRVVRTAEKVAISRNALMGVYFFRRAGEFQECAREVVEAAQAGDVTESYLS
FT                   LVYNRMLSRGSTVRLARGTFYCFGTPEELASYRETGLPVG"
FT   gene            complement(200073..202058)
FT                   /locus_tag="Lxx02050"
FT   CDS_pept        complement(200073..202058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02050"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88261"
FT                   /db_xref="GOA:Q6AH84"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH84"
FT                   /protein_id="AAT88261.1"
FT                   /translation="MMGNLARALRTQTVLDQARPGGLVQHVDALSAGVLFTLLLPLSAG
FT                   EVVRTLVLSRRLRIGLLYTGTAIALERLLDVIVVAGALLIFGSVVGLSVAVVGPAILIL
FT                   AVTGSILLLFVLLVRENRLLMRMVVAVTSVLADRPRARVRMSVWSTVHGYQSFLRSPRK
FT                   LGAYVAAFGLSWLGYLTAVYVVLAGALPDSAAGNASAGVLAPFLFPETLLGLPSVGEYS
FT                   RSISGFLNSSGAFEGLGWTLAPGFLIWIVLTLPTALYGAFRLCLPSFFARVDATATGGD
FT                   IGGLDHTQRRDAELATFVDSFLRRDDLALALHRLEVRGDLEVVRFFKGGSDAVTALVRE
FT                   DGVARVRKVVPEQHREKLAQQYRWLRRHSATPNVVRALGETDGPGYYSFDIEFDPATTT
FT                   MFGYLHSASPEDGQRALRRVWDTMFDHVYDLRTEARHPETVAQYLQERLADRLDQAAAL
FT                   HPELAAVLACETVGIAGQEHPGLRQLLSAIVADERAWEDLITYRESAAIHGDLTIDNLL
FT                   IDPDSGDILIIDPSDDNQVRGPVLDFARHFQSLWGGYEFLNESDRSPRIRIDPAGGRAE
FT                   IGFESYRSARYQELAEWTEALAGERLTPTERRSLPFHVGLLYGRMLSHRVVIDPATVLV
FT                   YYARSVQILDRFLAQYAHRPLTSGRP"
FT   gene            complement(202209..202781)
FT                   /locus_tag="Lxx02060"
FT   CDS_pept        complement(202209..202781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02060"
FT                   /product="hydrolase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02060"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88262"
FT                   /db_xref="GOA:Q6AH83"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH83"
FT                   /protein_id="AAT88262.1"
FT                   /translation="MAIVRGVFCDLDGTLVATEKANFAAYRAALGEFGIEFTWPVFLTT
FT                   WGEDSRDFLPRIAPELSAGEVAGVRAAKARHYPAFLGETELNRPLARTLQTWSGTARVA
FT                   LVTTAKAGAVAAVLKHHDLTQLFSFVVTGDDTERSKPAPDPYLLALATAGLRPEDCITF
FT                   EDSESDIRSAEGAGVDVGRIEWSADVA"
FT   gene            complement(202859..203245)
FT                   /locus_tag="Lxx02070"
FT   CDS_pept        complement(202859..203245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02070"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88263"
FT                   /db_xref="GOA:Q6AH82"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH82"
FT                   /protein_id="AAT88263.1"
FT                   /translation="MRFLSTTVAGVTVDVGGYAALTAAGVAAGPANLVSASSSVFVVYL
FT                   LSRGMVFPGRHTVAGLIAFFGWYGFSIALFSLLLQGGVDAFALAPLAAKLISLPFSFAV
FT                   NFFAVRAIFAVVDRLATRKEPTIP"
FT   gene            203671..204117
FT                   /locus_tag="Lxx02080"
FT   CDS_pept        203671..204117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02080"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02080"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88264"
FT                   /db_xref="GOA:Q6AH81"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH81"
FT                   /protein_id="AAT88264.1"
FT                   /translation="MGTAKQTRATAVATWESLFRAQVAVMRTLTAEFPTRDISLNEYDV
FT                   LFTLSRQPNRELRLRDLNKHVLLTQPSVSRLVDRLAARGLVAKGPEPTDARGTVIRMTG
FT                   TGFELFRRVAVEHMKTITERVGGRLDAQELETLAALCDKLRGGS"
FT   gene            204175..206487
FT                   /gene="ponA"
FT                   /locus_tag="Lxx02090"
FT   CDS_pept        204175..206487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ponA"
FT                   /locus_tag="Lxx02090"
FT                   /product="penicillin-binding protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02090"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88265"
FT                   /db_xref="GOA:Q6AH80"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH80"
FT                   /protein_id="AAT88265.1"
FT                   /translation="MTRMTDELRRGKWAPALVGFVALSGLAGVLAAVAVTPAVALTGSA
FT                   ANSTISVFDGLPEYIKVEPLAQASTMYATSNGQSVPIATFYSQNRVEVGWESISQNLKD
FT                   AAIATEDPRFYEHGGVDVTGTIRGALLTALHKSVQGGSSITQQYVKNILVQRCENKQPD
FT                   PTATAAVQKKQLTAYESCYNDATEVDPVRKLKEMRYAIGLEKQYSKDDILQSYLNIALF
FT                   GGRTYGVQSAAAYYFGVPAKDVNLQQAATLIAILNNPDNLRIDRPGNEENGAANGYKET
FT                   LDRRNYVLNRMLANGRITQKEHDTSIKSPVEPKITPVQNGCMTAQQHNAAFFCDYVERI
FT                   IERDPIFGKTDDERLSYLTRGGLKIYTTLNLDLQSAAQSAVSSYIPSTSPRLDLGSSQV
FT                   SVEVGTGRVVTMVQNRPYDNTSSPAAGTTAVNYNADYAYGGSEGFQTGSSYKAFDLLEW
FT                   LHEGHSLYQTVSGTQHSFSQSSFHSNNPCNDIGGAPWNVSNDEGETVGSSTVMNATAAS
FT                   INSIFAKMATQLDLCGIKQRAKDLLVHGADEEANPFMANPSSVLGTNYIAPITMATAYA
FT                   GIANNGVACSPVAIDKIIGADDTAHGVPKTQCSTTPIDPGVAAAAIYALQGVLRGGTAT
FT                   SANPGDGVPLFGKTGTTDDSLQNWLVTSTSKVAQATWVGNVEGKVALRSQSFQGIGGGN
FT                   VKFAIVKRIQAALDAAYGGSAFSAPPAKYLFAPAAPSTPTPPAVGAPTQVAPGAGAGAG
FT                   DSGGDSTGTGGNDGERR"
FT   gene            206573..207166
FT                   /locus_tag="Lxx02100"
FT   CDS_pept        206573..207166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02100"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02100"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88266"
FT                   /db_xref="GOA:Q6AH79"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH79"
FT                   /protein_id="AAT88266.1"
FT                   /translation="MGRKPDPNRKPELLARIMDHVATEALSRMTFRSLASALGVSTYSF
FT                   VYHFGSRQEMIDAILEEGVRQQTTPQQSVDLSAFDRDQFHGWYKEAFRASLKEQNRTGL
FT                   RLQFEAGTLEQIDPDIGRRITTSFTAWRNAIKAWLKNQGIETRRAGVLAHWMVDSAAGF
FT                   HFGFLLSGDRTATVQGFDLFLNAFFREALGEEGR"
FT   gene            207416..209572
FT                   /gene="ptrB"
FT                   /locus_tag="Lxx02110"
FT   CDS_pept        207416..209572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptrB"
FT                   /locus_tag="Lxx02110"
FT                   /product="protease II"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02110"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88267"
FT                   /db_xref="GOA:Q6AH78"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH78"
FT                   /protein_id="AAT88267.1"
FT                   /translation="MLTPPATPKRPTERRHHGDVVVDEYEWLRDRDDPAVSAHLHEENA
FT                   YTNARTEHLAVLREQIFDEIKGRTRESDLSVPTREGDWWYYTRTVEGKQYGIHCRAPIA
FT                   GPDDWEPPALDETAQRSRLPGEQVLLDDNAEAEGHAFYALGSFDVSADGSRLLYAIDTE
FT                   GDERYTIRVRSLNGDGDGFPDLIAGTGAGALFDQSGEYIFYTTVDDAWRPSTVWRHRVG
FT                   EGPDEQADATVFHEPDERYWIGVGMTRSRRFLVIEARSNITSETWLLRSDDPTGEFSVV
FT                   WPRKEGVEYDVEHSIFGAHDRLLLVHNDGAVNFELVSVAAEAPQGKRRMLLPHNPAVRL
FT                   ESVDAFRDFVALEYRRDGLTRIAIGRVPDPAEFAAHPDSAPDDMLHELRFDEELFTVGV
FT                   GSNPEWTQPHLRLGYTSFVTPPSVYDYDIRSHERVLRKKQAVLGAFDPELFEQKREWAT
FT                   ADDGTRIPLSLVYRRDLVTPGEPAPLVLYGYGSYEASIDPSFGIPRLSLLDRGVVFAIA
FT                   HVRGGGELGRLWYENGKKLHKKNTFTDFVAAAEHLTTQGWTSPDRLAAQGGSAGGLLMG
FT                   AVANLAPRALAGILAEVPFVDPLTSILDPSLPLTVIEWDEWGDPLHDEDVYYYMKSYAP
FT                   VENIHATRYPRILAITSLNDTRVLYVEPTKWVATLREAGADALLKTEMTAGHGGVSGRY
FT                   AAWRERAFALAWLLDVVGVHPSGA"
FT   gene            complement(209645..209791)
FT                   /pseudo
FT                   /locus_tag="Lxx02120"
FT                   /note="similar to oxidoreductase"
FT   gene            complement(210003..211859)
FT                   /gene="pimB"
FT                   /locus_tag="Lxx02130"
FT   CDS_pept        complement(210003..211859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pimB"
FT                   /locus_tag="Lxx02130"
FT                   /product="ABC transporter, NBP/MSD fusion protein
FT                   (pimaricin)"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02130"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88268"
FT                   /db_xref="GOA:Q6AH77"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH77"
FT                   /protein_id="AAT88268.1"
FT                   /translation="MFGGTPAKKAEHFWPSFNRLIGLLRTERLAMVWVTLLVVVSVALT
FT                   VIAPKILGNATDVIVNGVTGARQANGQPAPGPGVDFTDLGRLLMIVLAMYIAASLLQWW
FT                   QGYILNALVMRVVYRLRAEIEDKLNRLPLSYFDTRQRGDLMSRVTNDVDNIQTALQQAF
FT                   SQLIQSVLMVIGIGVMMFIVSWQLALIALISIPLSGIIAGVIGTRSQKLFKQQWNSTGA
FT                   LNGHIEESYSGLDLVRAFGRDEVMLERFDERNGKLWSSMVGAQFVSGMIMPAMNFVSYL
FT                   SYVLIAVVGALRVTAGQLSIGDVTAFIQYSREFSQPIGQIAGMANMLQSGVASAERTFE
FT                   FLDSDEQTPEHETEHLPERANGRVELDSVDFSYDPETELIRDLSLSVEPGHTVAIVGPT
FT                   GAGKTTLVNLIMRFYELNGGAIRLDGIDTTDLSRSELRGQVGMVLQDAWLFSGTIRENI
FT                   RYGRLEASDEEVVAAAKATMVDRFVRQLPDGYDTVIEADGGNVSAGERQLLTIARAFIA
FT                   NPSLLILDEATSSVDTRTELLVQHAMAALRSDRTSFVIAHRLSTIRDAHTILVMEKGRI
FT                   VEQGDHKTLLAKKGAYYDLYMTQFRGAAEESGQEEPEGVAAR"
FT   gene            complement(211984..213714)
FT                   /gene="pimA"
FT                   /locus_tag="Lxx02140"
FT   CDS_pept        complement(211984..213714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pimA"
FT                   /locus_tag="Lxx02140"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02140"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88269"
FT                   /db_xref="GOA:Q6AH76"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH76"
FT                   /protein_id="AAT88269.1"
FT                   /translation="MTLLRLALRFARPYGGAVAAVVILQLIATLAALYLPTLNKDIIDK
FT                   GIIPRDIGFIWSTGGTMLIVCFVQVVAAITATYFGARASMSVGRDMRRAFYRKVDSLPA
FT                   LDLARWGTPTLITRNTNDVQQVQMLVLMTLNFMVSTPIMCIAGIVLAVQVDAGLSWLIW
FT                   VSVVVLFLVVGVLVWLLLPLFREMQERIDGVNGVIREQIVGIRVIRAFVRERFETARYD
FT                   DANAALTRVSVRVGNIFVLMFPLIMLILNGATAAVLWFGGASVNAGEIQIGALTAFLQY
FT                   LLQILTAVMMGVFMAMMIPRAMVCAERIQEVLAVEPSGAAAGAGAPEPADGRVEIDAVT
FT                   FGYPGAERPVLNRVSFTAEPGRITAIVGSTGSGKSTLVSVIANLFTPQSGHIRIGGVEV
FT                   DSLSRKQLSGVLGLVPQKPYLFSGTIASNLCFGRPDATDEELWAALRVAQAEDFVRAKE
FT                   HDLQERIAQGGTNVSGGQRQRLCIARALVANPKVFLFDDSFSALDVATDARLRRALAES
FT                   TGDATVIVVAQRVSTIREADTIVVLDGGTVAGSGTHDELLETSETYREIVESQLSQEVA
FT                   "
FT   gene            complement(213852..214391)
FT                   /locus_tag="Lxx02142"
FT   CDS_pept        complement(213852..214391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02142"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02142"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88270"
FT                   /db_xref="GOA:Q6AH75"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH75"
FT                   /protein_id="AAT88270.1"
FT                   /translation="MTFANRYRHDHPASPGGRPQAELPVASPPPQLRRMGTITVHEFVS
FT                   LDGVFEDPGWTAEHGFDPAMGEDLARITGSSDAILLGRRTFEVFAPVWSARTAEDDPGA
FT                   PSRSCGCVPVRSTATASSTSATSPADRRLVLLRARRSWGAARGRDSGRAAPVRIGTSTL
FT                   SRPDGRSCPSFRAHGT"
FT   gene            complement(214995..215261)
FT                   /pseudo
FT                   /gene="tnp"
FT                   /locus_tag="Lxx02145"
FT                   /note="similar to transposase, ISlxx4"
FT   gene            215303..216055
FT                   /pseudo
FT                   /locus_tag="Lxx02150"
FT                   /note="similar to transcriptional regulator, TENA/THI-4
FT                   family"
FT   gene            complement(216011..216086)
FT                   /gene="Arg"
FT                   /locus_tag="Lxx02160"
FT   tRNA            complement(216011..216086)
FT                   /gene="Arg"
FT                   /locus_tag="Lxx02160"
FT                   /product="tRNA-Arg"
FT   gene            complement(216681..217394)
FT                   /locus_tag="Lxx02170"
FT   CDS_pept        complement(216681..217394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02170"
FT                   /product="phosphatase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02170"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88271"
FT                   /db_xref="GOA:Q6AH74"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH74"
FT                   /protein_id="AAT88271.1"
FT                   /translation="MQQLTAAGFLFDMDGTLVDSTPVVEAVWTEFSRANGLDPAEVLGY
FT                   AHGRQAIDTLARFLPQRSPAERGELLSALVAEEVARTEGIVEVPGAGALLTALIGAGAP
FT                   VAVVTSAPRELAVARMTAAGVPVPPVLVAAEDVERGKPDPQAYLLAAERLGVPAASCFA
FT                   FEDAPAGLAAAVASGACVVVVGVYESAVSEGLGRVLDYVGELSVTEAGGEWSTGLVAAS
FT                   TTPAARTAAGQPSAR"
FT   gene            complement(217562..217735)
FT                   /locus_tag="Lxx02180"
FT   CDS_pept        complement(217562..217735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02180"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02180"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88272"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH73"
FT                   /protein_id="AAT88272.1"
FT                   /translation="MGLDDKIKNAVEDAGGKAKEAAGKVTGDEQLEGECKLDQVKADLK
FT                   NAAEKVKDAFKR"
FT   gene            217889..220195
FT                   /gene="treY"
FT                   /locus_tag="Lxx02190"
FT   CDS_pept        217889..220195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treY"
FT                   /locus_tag="Lxx02190"
FT                   /product="malto-oligosyl trehalose synthase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02190"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88273"
FT                   /db_xref="GOA:Q6AH72"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012767"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH72"
FT                   /protein_id="AAT88273.1"
FT                   /translation="MSTDLPRNTYRLQIAPEFTLRDAAQVLGQLARLGVDGVYLSPLLQ
FT                   AEPGSAHGYDVTDPTRVDAERGGPDGLHEFADAAHARGIRVIVDIVPNHLGVATPANTA
FT                   WWWDVLAGGPEARHAGFFDIDWAFGGGRVRIPVLGEGADELGTVRVQGGELRYGEHRFP
FT                   IATGTEGGSPREVHERQHYELVSWRRADAELNYRRFFAVNTFAGVRVEDPRVFEETHRE
FT                   IGRWLREGLVDGLRVDHPDGLRDPGAYLKRLAELADGKPVWVEKILEGDERIPAWPISG
FT                   TTGYDALGAVDRVFIDPSGEEPLTALAEEVDDREESRDWSALVHRRKRSAADGILRSEV
FT                   LRVTRELTTAGATADPGTLADAVAELAAAFPVYRSYLPFGLGHLTAAREAATAARPDLA
FT                   EALDEATGLLSRARSGPAERFQQTTGSIMAKGVEDSAFYRVSRLASLTEVGADPSAFAL
FT                   TVEAFHRLQAERLVRLPHSLTALSTHDTKRGEDTRARIAVLAELPEQWKRFLIAVRERV
FT                   AIGDGSLENLLWQSIVGAWPASRERMHAYALKAAREAGASTSWADPDADVETALAGLVD
FT                   AAFDDEGVRHEVLAMTSRVEGPGAINGLGAKLVQLTMPGIPDVYQGSERWERSLVDPDN
FT                   RRPVEFEVSAGLLARLDAGWLPEVDSSGATKVLVTSRALRLRRDRPELFAEYWPVAAEG
FT                   PQAGHLLGFDRGGATTLATRLPAGLERAGGWGETTVELGDELLRDELTGREHCGRVRVA
FT                   AILSRYPVALLAVPR"
FT   gene            220192..221874
FT                   /gene="treZ"
FT                   /locus_tag="Lxx02200"
FT   CDS_pept        220192..221874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treZ"
FT                   /locus_tag="Lxx02200"
FT                   /product="malto-oligosyl trehalose trehalohydrolase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02200"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88274"
FT                   /db_xref="GOA:Q6AH71"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012768"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH71"
FT                   /protein_id="AAT88274.1"
FT                   /translation="MSDRRFPVWAPRANDVAVVAPALGTFALTAAPDGWWRLPEPLDAG
FT                   PEPLDYGFVVDGGGPYPDPRSRRQPNGVHALGREFDPDPVEPWPGRELTGAVLYELHIG
FT                   TFTPEGTLDAAAGRLGHLVDLGVEAVELLPVNAYNGPYGWGYDGVFWYAVHEPYGGPEA
FT                   YQRFVAACHRHRIAVIQDVVYNHLGPSGNCLPVFGPYLSEGRTAWGSSVNLDGALSDEV
FT                   RRHILDNAAYWLRDLGADGLRLDAVHAFQDSRAEHILEALARQTAELREETGRPLTLIA
FT                   ESDLNDPRLIRSRARHGYGLDAQWNDDAHHSVHANLTGETSGYYVDFGEPDALVKVFEG
FT                   GFFHDGTYSAFRERHHGRPLDADQPHSQLVAFSQNHDQIGNRAAGDRLSATLDDGRLAV
FT                   AAALTLLGPFTPMLFMGEEWAAGTPWPFFASHPEPDLAEATRSGRIAEFARMGWDPTAV
FT                   ADPMDPATFHAAMLDWSERDSERGALMLDWYRALTRLRRAIPADARARDVWFADGAFSF
FT                   VRDRTRVTASLSGGGLSHSDGTDAVLASFGDAVLVTRTPAHPA"
FT   gene            221954..223999
FT                   /gene="treX"
FT                   /locus_tag="Lxx02210"
FT   CDS_pept        221954..223999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treX"
FT                   /locus_tag="Lxx02210"
FT                   /product="glycogen debranching enzyme"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02210"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88275"
FT                   /db_xref="GOA:Q6AH70"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH70"
FT                   /protein_id="AAT88275.1"
FT                   /translation="MTDPVSSPYPLGVTLLSGGANVAVYSERADRVTVCVFGEDGAETR
FT                   TELTDRTGHVFHGVVPGMATGARYGLRVDGPWDPTGGQRFSPAKVLLDPHARAVVGAWD
FT                   LSQADFGHQLRHPHRRDDTDGSGHVALGVATGPGFDWGDDRPPRIPLGETVIYEMHVKG
FT                   FTQRMPGVPEELRGTYAGLANEAAIDYLKGLGVTAVELLPVHQFVQDLHLLEKGLRNYW
FT                   GYNSIGFFAPHNEYAATGAIGQQVDEFKGMVKALHAAGIEVILDVVYNHTAEGNHLGPT
FT                   LSFKGIDNPSYYRLVEGDERHYFDTTGTGNSVNVSHPAALQLILDSLRYWVEEVHIDGF
FT                   RFDLATALTRQGGDASLHSAFLTLVQQDPTLKPVKLIAEPWDVAGYQLGGFPADWSEWN
FT                   GRFRDDVRDFWRGTEGMLATLSQRVLGSPDIYEDSRRTPLSSVNFVTAHDGFTLADLTS
FT                   YEQKRNEDNGEDNQDGESDNRSANYGAEGPTDAPGILAVRLRQRKNFLATVLLSAGVPM
FT                   ILGGDEIGRTQRGNNNAYCQDGEISWFDWAAADEELRAFTERLIRLRRAEPALRPEWYR
FT                   RAPEAGGRDVVRILRADGEPFAAEDWEEPDARSIAFELRHEGADTFLLLLNAAANGVEF
FT                   TLPATVDGPWSLELSSDPGLELGDGESVIAGEISFALLRSALREGL"
FT   gene            complement(224122..225033)
FT                   /locus_tag="Lxx02220"
FT   CDS_pept        complement(224122..225033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02220"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88276"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH69"
FT                   /protein_id="AAT88276.1"
FT                   /translation="MALRPGPAGRVPVRGKGRAPRTACGSAAPWSLSRFRCVSGRGGGS
FT                   LPGSLPSRFWYPQSGMQLASAPPRRRGRRVAGRPVALHAQPSRFPLRHRIGVTLAVIGL
FT                   ICGFSIVPTESALQTKPATTVALGESVTQGQDKDQYQYLFTAATFAAPIARRESFGATD
FT                   SVQSLVQIGTNESWAKLVLVFGGWPMTDANVTVMLRWMRQENGPPDWWNRNNPLNNGYG
FT                   SGGGAGLGSYPSLVSAAEYCAKNLQRGYPGIAAGLRAGTSADATAAAIWASPWASSHYA
FT                   NGAHWSTRPVEIVKAPALSWGR"
FT   gene            225245..225868
FT                   /locus_tag="Lxx02230"
FT   CDS_pept        225245..225868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02230"
FT                   /product="phosphatidylglycerophosphatase B-related protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02230"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88277"
FT                   /db_xref="GOA:Q6AH68"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH68"
FT                   /protein_id="AAT88277.1"
FT                   /translation="MWTAVLFAVTFALGFAAKAVPSLRFGDVVVAVNAVSSPVLDRVAL
FT                   LADLLDRPAVAVGILVAVFVVLFVATGWRRAMGTCVATGFGWLTTLLVKAVVAEPRPST
FT                   AELTHPLHISPATLSYPSGHVVFAVAVVTGLMLACRRTVPAVMVGVIGGAIALVVGWAR
FT                   LYAGVHYPTDIVGGFLNGIAGVLLSAGLWNLPFGRRQPRSAAEQ"
FT   gene            complement(226071..226367)
FT                   /pseudo
FT                   /locus_tag="Lxx02235"
FT                   /note="similar to methyltransferase"
FT   gene            complement(226488..226742)
FT                   /pseudo
FT                   /gene="dtxR"
FT                   /locus_tag="Lxx02250"
FT                   /note="similar to transcriptional regulator, DtxR family"
FT   gene            complement(227211..227273)
FT                   /locus_tag="Lxx02260"
FT   CDS_pept        complement(227211..227273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02260"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88278"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH67"
FT                   /protein_id="AAT88278.1"
FT                   /translation="MLSLLELLAQRGVAVLTLAD"
FT   gene            complement(227344..228441)
FT                   /pseudo
FT                   /gene="tpase2"
FT                   /locus_tag="Lxx02270"
FT                   /note="similar to transposase, ISlxx1"
FT   gene            complement(228602..229400)
FT                   /pseudo
FT                   /gene="tpase1"
FT                   /locus_tag="Lxx02290"
FT                   /note="similar to transposase, ISlxx1"
FT   gene            complement(229533..229697)
FT                   /locus_tag="Lxx02300"
FT   CDS_pept        complement(229533..229697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02300"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88279"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH66"
FT                   /protein_id="AAT88279.1"
FT                   /translation="MAVFGYIFVGPLEHSAEFQLDLLRQQGTGTIFEDISLNTASPRRP
FT                   ELARCARTR"
FT   gene            complement(230645..231259)
FT                   /locus_tag="Lxx02310"
FT   CDS_pept        complement(230645..231259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02310"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88280"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH65"
FT                   /protein_id="AAT88280.1"
FT                   /translation="MDITIPTDPTDPIALDGGTSSVRIALPYTGRADNAAIEKAGVVSF
FT                   DNNNNNGSTIVPVVQKDGSVQINTIIETAKAPIEYAYPVSVPAGGKLQAEPRELSVLDA
FT                   TGGWVAGFLPAWAKDANGAAVYTHYEIRGDTLVQVVEHDRPNVTYPVVADPWLGVNLIN
FT                   HWWWTGSGNSRAVHIDVTPMMGVVTEAIAIWVGRSFQPNRV"
FT   gene            complement(232050..232141)
FT                   /gene="Ser"
FT                   /locus_tag="Lxx02320"
FT   tRNA            complement(232050..232141)
FT                   /gene="Ser"
FT                   /locus_tag="Lxx02320"
FT                   /product="tRNA-Ser"
FT   gene            complement(232468..232558)
FT                   /gene="Ser"
FT                   /locus_tag="Lxx02330"
FT   tRNA            complement(232468..232558)
FT                   /gene="Ser"
FT                   /locus_tag="Lxx02330"
FT                   /product="tRNA-Ser"
FT   gene            complement(232592..233836)
FT                   /locus_tag="Lxx02340"
FT   CDS_pept        complement(232592..233836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02340"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02340"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88281"
FT                   /db_xref="GOA:Q6AH64"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH64"
FT                   /protein_id="AAT88281.1"
FT                   /translation="MTRIETEERSAALVRAAGLSYFPVALLARLPYAMIVVGVLTLVVT
FT                   ARGELALGGLTSAMAGIGTALFGPLIGALADRIGQRRVVLVSGVLNSLALLGMAWAAFI
FT                   PAPDVALLAVAFAIGATAPQVSPMSRSRLVGIIERMLPADRHAPVLNGTIAYESAADES
FT                   VFVFGPFIVGLLATTLNPAAPVIAAAVLALVFVTAFALHPSGATRPLAPEGLAVRQAPV
FT                   SRLFCPALLVVVVAGVLGMGFFGSTLTALTAFLTRFGHPEQAGLIYGVMGVGSAVLALG
FT                   VAWAPLRFSLRARWLTFAGLLAAATIALPFAATVPGMLVLLLLAGFGVGPTLVTQYAFA
FT                   AERSPLGRSATVMNMLGSALVVGQAAASALVGALAPAAVTEAALLAPTVSALVVFAAAA
FT                   ANWFLTGRRSPSQVR"
FT   gene            complement(233968..235221)
FT                   /locus_tag="Lxx02350"
FT   CDS_pept        complement(233968..235221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02350"
FT                   /product="membrane protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02350"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88282"
FT                   /db_xref="GOA:Q6AH63"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH63"
FT                   /protein_id="AAT88282.1"
FT                   /translation="MNETPTPTRAQARAQEKAPGPSMARHGRLKRRSPFKTVAALLAAV
FT                   LAVGAASGVGVAAYAAMDIVGGIKPSVKLVDAKGNEVTPQLGAMDGSFNVLLAGSDSGG
FT                   GNQTYGERGENLNDVTMLLHVSADHKNATVVSFPRDMFVAIPSCPDPRGGSFDAMSRQK
FT                   INNTLSYGGLACTVLTVEKLTGLQIRYAGVIEFDGVIEMSNAVGGVNVCVAGDIVDPYT
FT                   GLNVKAGDNTLQGAQALAFLRTRHGVGDGSDLGRISNQQVFLSALVRQIKSADTLVNPV
FT                   KVYTLAKAATSNITLSDSLNNVTTIASMAMALKSIDISKVVFVQYPNHYVEGGVAPTTD
FT                   AAQTLMTAMQNDRPVSLTGDTGVGSEAAPNTQTPTAETPTQAPTDDSTAAADASVQLPS
FT                   DVHGQTAAQVTCSKPFQD"
FT   gene            complement(235329..236141)
FT                   /locus_tag="Lxx02360"
FT   CDS_pept        complement(235329..236141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02360"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02360"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88283"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH62"
FT                   /protein_id="AAT88283.1"
FT                   /translation="MTRTAGSDRLLIALDVDGTLIHEDGTVGRAVREAVARVRDAGNEV
FT                   MLATGRSWETARPIHEEFGLVSEFVVCANGALTMRADETVEEGYRREFIQTFDPSQVLR
FT                   TIRPHLPSGRFMVEDPTGHRRYTEGMTDWELVNAEQVSFEELTRHPATRVVVVSPQHDE
FT                   EEFLAIVEQMGLHRVSYSIGWAAWLDISPDGVNKATAMERVRRALDIPLANVVAVGDGR
FT                   NDLELLRWAGTEGRSVAMGQAPAEVKAAARTVTGAVVEDGVATLLDRL"
FT   gene            complement(236138..237403)
FT                   /gene="serS"
FT                   /locus_tag="Lxx02390"
FT   CDS_pept        complement(236138..237403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="Lxx02390"
FT                   /product="seryl-tRNA synthetase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02390"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88284"
FT                   /db_xref="GOA:Q6AH61"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AH61"
FT                   /protein_id="AAT88284.1"
FT                   /translation="MIDPVLLREHPDVLRRSQEARGDSVQLVDEALQVDIERRAAITAF
FT                   EELRAEQNAFGKRVAQAPKQEKKELVAQAQQLAGRVKEAQQVAAAAEARFESVLRKIGN
FT                   PVVAGVPSGGEDDYAVLKEVGGIPAFGFEPRDHLALGELLGAIDMARGAKVSGARFSFL
FT                   RGLGARLEIALMNLALDKALANGFVPLITPTLVKPEVMQGTGFLGEHSDEVYHLETDDL
FT                   YLTGTSEVALAGYHADEILDVTEPLRYAGWSTCYRREAGSAGKDTRGIIRVHQFTKLEM
FT                   FVYTLPEHAEAEHARLLAWQEEMMQALGLSYRVIDTAAGDLGSSAARKYDVEAWIPTQG
FT                   RYRELTSTSNCGTFQARRLETRYRTESGKTAPVATLNGTLATTRWIVAILETHQREDGS
FT                   VLVPETLRPYLGGLEILEPIGK"
FT   gene            complement(237687..238670)
FT                   /gene="pheA"
FT                   /locus_tag="Lxx02400"
FT   CDS_pept        complement(237687..238670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheA"
FT                   /locus_tag="Lxx02400"
FT                   /product="prephenate dehydratase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02400"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88285"
FT                   /db_xref="GOA:Q6AH60"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH60"
FT                   /protein_id="AAT88285.1"
FT                   /translation="MSSAAPEPSAELPASIDEVYSFLGPSGTFTEAALAQVPEARGKRW
FT                   RAVGNVGEALADVVARRSVAAMIAIENSIEGGVSVAQDALATVPGLRIVGEYLVPVDFI
FT                   LVARPGTTLGDVRTINAHPVAYAQCHRWLDANLPEHGHLPAASNVAAAAALFGGGAGGS
FT                   ADAAIAPPGIVDHHDVVVLAESIGDDPNAVTRFVLVSTSHSVPAPTGADKTSLIAELPD
FT                   DRPGALLELLEQFSTRGINLSLIESRPIGDALGRYRFVIDADGHIRDERVAEALLGLRR
FT                   FSPGVLFLGSYPRADGVGVDFDQRYRNGVFTEAREWLASLVDDAGR"
FT   gene            238740..240389
FT                   /gene="pgm"
FT                   /locus_tag="Lxx02380"
FT   CDS_pept        238740..240389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgm"
FT                   /locus_tag="Lxx02380"
FT                   /product="phosphoglucomutase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02380"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88286"
FT                   /db_xref="GOA:Q6AH59"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR005852"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH59"
FT                   /protein_id="AAT88286.1"
FT                   /translation="MDPRAGIPAQPSDLIDVDALRRAYYELKPDVSVPGQRVVFGTSGH
FT                   RGSSLNTAFNEDHIAATTQAIVEYRTSQGIAGPLFIGADTHLLSEFATTTALAVLAGNE
FT                   VRALVDEFGDWVPTPALSHAIVAYNRAGHPDRADGIVVTPSHNPPADGGFKYNPPHGGP
FT                   ADTDATGWIAKRANEIIANGMREVRMAEPSGVETYDFRRKYVDDLESVIDIAAIRDSGI
FT                   RIGADPLGGASVSYWQAIAETYDLNLEVVNPAVDPAWGFMTLDWDGKIRMDPSSPSAMA
FT                   SVVARSRDFDILTGNDADADRHGIVTPDGGLMNPNHYLAVAIDYLFRTRTGWRKDAAVG
FT                   KTLVSSSIIDRVAESLGRRLWEVPVGFKWFVPGLIDGTVGFGGEESAGASFLRFDGSAW
FT                   TTDKDGILLSLLASEIRAVTGKSPSQLYRELTERFGDPVYRRVDAPASPEQKAAMSKLD
FT                   SDAIAATELAGEPIAAKLSHAPGNDAPLGGVKVETATAWFAARPSGTENVYKIYAESFA
FT                   GEESLREVQEQAKRIVGEALGGEARRLVAGPA"
FT   gene            240436..240831
FT                   /locus_tag="Lxx02410"
FT   CDS_pept        240436..240831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02410"
FT                   /product="transposase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02410"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88287"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH58"
FT                   /protein_id="AAT88287.1"
FT                   /translation="MSRFQMLSDSQWVLIEGMLQRPTGRPGRKFSVARLMVEGIVYRYR
FT                   TGIAWRDLPEVFGLWQTVWTWHRRMAFDGMWDRVLAKVTAVADTAGMVDWSLSVDSTIA
FT                   RVHQHATNMKRLTGGWIELQGSDARAA"
FT   gene            241083..241325
FT                   /pseudo
FT                   /locus_tag="Lxx02420"
FT                   /note="similar to transposase"
FT   gene            complement(241311..242114)
FT                   /pseudo
FT                   /gene="vanY"
FT                   /locus_tag="Lxx02430"
FT                   /note="similar to D-alanyl-D-alanine carboxypeptidase"
FT   gene            complement(242155..243000)
FT                   /locus_tag="Lxx02440"
FT   CDS_pept        complement(242155..243000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02440"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02440"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88288"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR024301"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH57"
FT                   /protein_id="AAT88288.1"
FT                   /translation="MVAALAFTGCAGEPSSLAKAVAKAAVVHTAASVTVSAIEPTAGSV
FT                   SGGTVTITGANLGKVARIEIGGQQATVTKGSGNKMIVAVPAAQGFAPGAVPIAITDKTG
FT                   KAISTGSKTYDYRVQTPVDKQLSYAMTYWKEYNTAEYGDLNPVGGDCANFVSQTLIARG
FT                   WTMNSEWYNKDAGDDWSPSWGYVLAMDDYLRDNAAKLGLTEYSFDQRDKIKLGDIVMFD
FT                   WSGDDSLDHVQIVSGVQRENSQIKILMAGHNEDSDYRDLDQTITVDHPGGSGFFWSLPR
FT                   "
FT   gene            complement(243750..244211)
FT                   /pseudo
FT                   /gene="tnp"
FT                   /locus_tag="Lxx02450"
FT                   /note="similar to transposase, ISlxx4"
FT   gene            244342..244611
FT                   /locus_tag="Lxx02460"
FT   CDS_pept        244342..244611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02460"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88289"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH56"
FT                   /protein_id="AAT88289.1"
FT                   /translation="MVCSNKAANVSAFSYLTITIPELGITQTDGPNVFVPSDQQTQRAR
FT                   AGTWAELPVTAGDTFTVTARGDAYNTGTNADNYLSIDALAIFQY"
FT   gene            245320..246267
FT                   /locus_tag="Lxx02470"
FT   CDS_pept        245320..246267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02470"
FT                   /product="phage-related lysozyme"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02470"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88290"
FT                   /db_xref="GOA:Q6AH55"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH55"
FT                   /protein_id="AAT88290.1"
FT                   /translation="MTLLEGVDISYMQGDYTPAGEDFVIINASRANIGLTVGSCYRAQV
FT                   AGAREAGKHVGHYFFNGNLDPVVCADFFIANLAYEVGDSLWLDVEAEPSTNTAAWDPAQ
FT                   ALAFLNQVKTRLGVVPGVYLNKSLMDGMDWSAVVAVGAPLWIASYNPPPPPIRWWPTWT
FT                   VWQYTSTPIDRNKAQTSLITAFTTPTLLEDDMRIQMIKTGDASGAIGTLNPDGTLDWLT
FT                   ADEFQALTRTGLVEPVHAEGDGTVWGILASRTARLRAQQGGDPVALAKSVSALLVPAVL
FT                   AGIQANSGLSLTPEQVQAACETAIKDVFAHASQG"
FT   gene            246275..246607
FT                   /gene="5"
FT                   /locus_tag="Lxx02480"
FT   CDS_pept        246275..246607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="5"
FT                   /locus_tag="Lxx02480"
FT                   /product="phage-related protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02480"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88291"
FT                   /db_xref="GOA:Q6AH54"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH54"
FT                   /protein_id="AAT88291.1"
FT                   /translation="MSDAVLLGAIGSMQAVAVALIYVMGRRQARSTDAIRYEVTNDHDQ
FT                   PLRDDMDEKHGAVIRGINTVAVTVRTIMRDIGGIRHDIRQLRSDLSHTDQHIDNLEHPR
FT                   LPEGES"
FT   gene            248725..249201
FT                   /locus_tag="Lxx02495"
FT   CDS_pept        248725..249201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02495"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02495"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88292"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH53"
FT                   /protein_id="AAT88292.1"
FT                   /translation="MLRDIANMLADVGVVFMVVEPPKRFLLLGMTRWIDKRVPVIQQTG
FT                   RWGRDGFVIWTLFHELGHVLGDPRGEMHLEYSTEKKRNSAAEQKANAFAMEVLFGKDGL
FT                   AHFRGLTRDREIASTARDLGIAPGVAVHQMHRKRMLEYKYGNRLFEDLSGTFTG"
FT   gene            250083..251306
FT                   /locus_tag="Lxx02510"
FT   CDS_pept        250083..251306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02510"
FT                   /product="DNA methyltransferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02510"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88293"
FT                   /db_xref="GOA:Q6AH52"
FT                   /db_xref="InterPro:IPR017985"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH52"
FT                   /protein_id="AAT88293.1"
FT                   /translation="MTDILARNEHMTFKANAGVGRHGWLRLTPSYGIRLVRERLEALEP
FT                   GSVVTDPFSGTGTTPLAVAELGHLGQSVDVNPFLIWLGGVKIRHYAAETPRQFSELAVV
FT                   VVEASRSYPVRDRLWQPRIFKIERWWSRGALHALRTLRASIDEYDGEVRDLLDIAFCRT
FT                   LIDVSGAAFNHQSMSFKDAAPRTRFDIADAEQTREVFLTEARYLAVSASIDLPGSAVIR
FT                   RGDSRTGVTTLEPADLVLTSPPYCNRMSYIRELRPYMYWMRFLDEASDAGALDWKAIGG
FT                   TWGTATSKLATWAADYPTPVDDELLKVASAIEQDGGKSGRLLAAYVHKYHYDMWLHFQA
FT                   IAPHVKSGGSVSYIVGNSTFSGHEVPVQRWYAEMLRALGFTDVHVETIRKRNSNKALFE
FT                   YDVTARKP"
FT   gene            complement(251772..251945)
FT                   /locus_tag="Lxx02520"
FT   CDS_pept        complement(251772..251945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02520"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88294"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH51"
FT                   /protein_id="AAT88294.1"
FT                   /translation="MGVGRDFRLDRLVAAHDGKTPPDWDDYYPSMLEHYETLCRELDHD
FT                   LRTERLSAQQRR"
FT   gene            complement(252391..253980)
FT                   /locus_tag="Lxx02540"
FT   CDS_pept        complement(252391..253980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02540"
FT                   /product="phytoene dehydrogenase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02540"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88295"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH50"
FT                   /protein_id="AAT88295.1"
FT                   /translation="MSDPEAHRGTASHDVVIVGGGHNGLTAAAYLASAGKSVIVLERLD
FT                   DVGGAAVSTQAFPGVEARLSRYSSLVSLLPQRIVDDLGLDIRLARRRHSSYVPVPGDPD
FT                   SAGLLIDGDDDAATASSFSLIGAAGDAAALTAFSAATGKAARALWPTVTEPLLTRSEAR
FT                   ALVADDELWEALIERPIGGFIETRLRNDLVRGVVATAGLIGTFASTDDPELAQNRCFLY
FT                   HVIGQGTGHWDVPVGGMGAVTDELLRVAREAGARIVTGAEVTGIAPGGSVRYTRNGHER
FT                   RVDGTHILVNAAPAVLDRLLGEEPTTPRPQAEGAQVAVNLLLKRLPHLRDQSIDPKAAF
FT                   GGTIHINESYTQLEQAHSGMLRGVMPDLLPCQISCHTLTDPSVLDPDLAASGAQTIAVF
FT                   GLHTPDRWLTDENNEATRQRLQTAALASLNSVLAEPIEDLLLTDANGDPCIETKTTRDL
FT                   ERDLNLPGGNIFHGPLTWPFAEDGDPLDTPAERWGVATEHPRILLCGSGARRGGAVSGL
FT                   GGHNAAMAVLEG"
FT   gene            complement(254029..254919)
FT                   /locus_tag="Lxx02550"
FT   CDS_pept        complement(254029..254919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02550"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02550"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88296"
FT                   /db_xref="GOA:Q6AH49"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH49"
FT                   /protein_id="AAT88296.1"
FT                   /translation="MLDTRKLRLLHELRIRGTVSGVAKALSYSPSSVSQQLAALEREVG
FT                   TVLLVKSGRRLRFTPQGELLAERTTGILDALDAAESAVATSGTTVSGVVRIAVFQSAAH
FT                   AILPTALDSLARDFPELRVEIAEREPDQGLFEVSARDVDLAIAEQYPGSARGMRSDLDR
FT                   AELATDSIHLATAKRRDARIRTTSLTAAAGLPWVLEPEGTAARTWAVQLCRTAGFEPDV
FT                   RFETADLVAHIRLIASGNAVELLPGLVWSGDEPSICLLPLPGSPRRTIFTSARRSVAAS
FT                   PGVVACRRALAAAIP"
FT   gene            255026..258733
FT                   /gene="poaA"
FT                   /locus_tag="Lxx02530"
FT   CDS_pept        255026..258733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="poaA"
FT                   /locus_tag="Lxx02530"
FT                   /product="proline dehydrogenase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02530"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88297"
FT                   /db_xref="GOA:Q6AH48"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH48"
FT                   /protein_id="AAT88297.1"
FT                   /translation="MSTDSDGRHPAQAVRNTVVDMVESRDVAASRLADEAVELVRSWLA
FT                   QSAGRGGETVHEDPAAERLAGVLRDPDGLEFAVGFVDGVARPQDLFVAGYNLQRVAKKI
FT                   PAFLPWYMRFAIWLGGVFGPVLPWVVIPIARRVLRRMVGHLVVDATPEKLGPAIAHLRA
FT                   PHDPAGHGARLNLNLLGEAVLGEREAARRLKGTRALLARDDVDYVSIKVSSIASQLSMW
FT                   SFDETVARVVERLTPLYQLAASSPTPTFINLDMEEYRDLDLTMAVFTGVLSKPEFLRLE
FT                   AGIVLQTYLPDALDALQRLTEWATERRIAGGAPIKVRVVKGANLAMERVDAAIHGWPLA
FT                   TYSSKQATDANYKRVLDWALRPEHTDAVKIGVAGHNLFDVAFAWLLASRRGVAERIDVE
FT                   MLLGMATAQAEAVKRTVGELLLYTPVVNPAEFDVAISYLIRRLEENASPENFMSAVFEL
FT                   GSDPELFERERQRFLASVAEFEADALSHEAAPLPNRTQDRTREWEESTADAFTRPPADD
FT                   PVAGAADEGLTSVVLGLTRGSSGGLEADGAVGERTSRDEGRSGFENAADTDPSLAANRA
FT                   WGRRILSRSGASELGAAAIASAAVSEPATLDGLLESVRAAGAAWGARSGKERAGLLDRA
FT                   GHALEANRDRLIEVMAAETGKTIAEADPEVSEAVDFAHYYATLARELDSIQGARFVPSQ
FT                   LTVVVPPWNFPVAIPAGGVLAALAAGSGVIVKPAPQAKRSGAVMVEALWEAGIPRELLV
FT                   LVDIGEDELGQQLVADARVDRVILTGSYETAKLFRSWRPDLPLLAETSGKNAIIVTPSA
FT                   DYDLAVSDIVKSAFGHAGQKCSAASLVILVGSVAKSERFRNQLVDAATSLRVGYPQDPM
FT                   SQMGPLIEPASGKLLHALTTLGADEDWLVQPKQLDGSGRLWSPGIRTGVQPGSYFHLTE
FT                   FFGPVLGIMTARTLEEAVRYQNAIEYGLTAGLHSLDSEELAQWLDTVEAGNLYVNRGIT
FT                   GAIVRRQPFGGWKRSAVGAGAKAGGPNYLIGLGSCEPDLGQSSSSLHLRGLEQRVTDLI
FT                   ESGQSSMGYPAFDLVRRSALSDAIAMATEYHQVRDVSGLGAERNLFRYLPVPVTIRLSE
FT                   GASLPELLRVMASATVARSRFSVSTSVKLPRGTAHLLREREVEVVVESDAHWLSRVRAQ
FT                   RIPDHRIRLIGGDPAELAAALGGIPDVAVYSGLVTPSGRVEVLPFLHEQAISITNHRFG
FT                   NPTRSTEEAI"
FT   gene            complement(258746..260179)
FT                   /locus_tag="Lxx02560"
FT   CDS_pept        complement(258746..260179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02560"
FT                   /product="two-component system, sensor protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02560"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88298"
FT                   /db_xref="GOA:Q6AH47"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH47"
FT                   /protein_id="AAT88298.1"
FT                   /translation="MTWLRRLSITSRITIGSLIVSALFGLAAVLVIRVGVSSILHNATV
FT                   TLLTNDISGPEASVQKNPDGPFDLPGGGQELAVVGADGQLLETTLPSAMAARVPQLLGL
FT                   GDDPTTVQIRDDQYLVLVRSVQTTAGAMHIIAARNDETTALILDRLTLALLVGAGIVVL
FT                   SFGAASCLLTRTALRPVSRMREQAERIAGSERAGRDESAGLLSVGPARDELSELATTLN
FT                   DLIRRLRASAERERQMVSDASHELRTPLAVLRGRLELAELNAGDPDALLADIRSSHATT
FT                   IRLGQLANNLLELSRIEAGPADGRIGWRTLVDELTDAIDRARLLVSSDEDSGDISVDFS
FT                   YDPQRRPGPSARIALSPTDFGRILDNLLGNAITAIRAMPADRRHGEAIVTADLTVAEDF
FT                   ALLTVRDTGPGMPEEFIPVALDRFTRADDARTSQSGTGGGLGLAIVSALAGAAEGSVRL
FT                   TNADDGGLVVVVRLPLVTE"
FT   gene            complement(260176..260898)
FT                   /gene="tcrA"
FT                   /locus_tag="Lxx02580"
FT   CDS_pept        complement(260176..260898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tcrA"
FT                   /locus_tag="Lxx02580"
FT                   /product="two-component system, regulatory protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02580"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88299"
FT                   /db_xref="GOA:Q6AH46"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH46"
FT                   /protein_id="AAT88299.1"
FT                   /translation="MKLLVVEDDPDMRGLVQRGLAAEGYDVTLMTNGVDALIALRDDTY
FT                   SAAAIDVMLPGMSGFELCRHIRDSGTAMPILLLTARDAIEDRVHGLDSGADDYLTKPFA
FT                   FAELAARVRALLRREPTGMRPQIIVGRLTIDSHEHQTLVSGHEMPLSRREFTLLRLFAT
FT                   NPDKTLSRADILESVWGTTENIGTNVIDQYVSYLRKKLDVAGAGLSIVTERGRGYRLDA
FT                   KNALEPKPSGGAAEAAAP"
FT   gene            261436..262929
FT                   /locus_tag="Lxx02570"
FT   CDS_pept        261436..262929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02570"
FT                   /product="peptide transporter, PTR family"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02570"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88300"
FT                   /db_xref="GOA:Q6AH45"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH45"
FT                   /protein_id="AAT88300.1"
FT                   /translation="MGNTSNISNSDSSLAKTREPLGHGFFGQPRALANVFGVELWERFS
FT                   FYGMQGILLIYLYYSVELGGLGVDQRTAAGVVGSYGGVVYLSTILGAWLADRVFGSERV
FT                   LFWSAVVIMAGHLALAVLPGVAGVIAGLVFVSIGSGGLKANATRIVGSLYDEGDSRRDA
FT                   GFSIFYLGINLGALLGPLLTGLLQSKLGFHWGFGLAAVGMAIGLVQYSLGRKRLPDRVR
FT                   EVPNPLPAKLYPLVAGVGVAGAILILALVLTGVITAENLALCVIGVVIVAAIAYCAVIL
FT                   GSRALSGEERSRIVALIPLFVTNAAFWSLYQQQFTVVTFYSDERLDRNLFGWVFPVSWV
FT                   QSINPIFVVVLSGVFAAIWTKWGAKQPSTPIKFAAGTVVMGLAFWLFIIWAGGGENSTP
FT                   LLALVGILLVFTVAELLISPVGLSAATKLAPRSFQAQMVALYFLSVSLGTAMAGQLAEL
FT                   YKELPEGIYFGILGGAAIVVGIALAVLSPWVLRMMSGVR"
FT   gene            263460..264629
FT                   /gene="malE"
FT                   /locus_tag="Lxx02590"
FT   CDS_pept        263460..264629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malE"
FT                   /locus_tag="Lxx02590"
FT                   /product="maltose/trehalose porter"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02590"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88301"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH44"
FT                   /protein_id="AAT88301.1"
FT                   /translation="MWIMQGTNPESTSFFKEVGDEFKKETGATLDVQFVQWADAHDRFV
FT                   TSIAGGTTPDVAETGTTWTAELADVGALAPIGDYVKKADLEKDLVKGLEEAGTYDGDLY
FT                   GMPWYAGVRSLVYRADVFQELGIEVPKTWDEIVAAAEKIKAAKPDMMPFVVPGNAEFGV
FT                   CPWVWGAGGQVATEKDGKWTSQLDSAKSREGIQFYTDLQTKYGFSSAGATTWKETDVID
FT                   NFNKGKVAMSLQGSWTPATVAKNAPDLVDKIGATPIPGKSSGISPSVLGGSHLSMFETA
FT                   KNKDLAWKFIEMMTTGTFEKKWTEQIGYFAGLNSLVKDTMKLDDPMVKPFATQMVDGGA
FT                   SLPVTPNFGKVQAKQTTNTMIPAILSGQKTVEQATSDAAKEMTDLLNSK"
FT   gene            264689..265612
FT                   /gene="palF"
FT                   /locus_tag="Lxx02600"
FT   CDS_pept        264689..265612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="palF"
FT                   /locus_tag="Lxx02600"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02600"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88302"
FT                   /db_xref="GOA:Q6AH43"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH43"
FT                   /protein_id="AAT88302.1"
FT                   /translation="MSVAPGPKRSRSFLSVSRPWLLLAPALAVLAVLLLWPLARVVLIS
FT                   LQDYGLREIVSGKTNFVGFANYAEVFGNATLWTVALPNTVVLAILSVVGTVALGTLVAV
FT                   LMANLGPVWRTVVGSAIMVAWAMPAVTGIYVWIWIFDAENGIVNQTLKNLGLMDESFNW
FT                   FTNPISFYAIVLLNIVHHGFPFVAIIVLAGLLGVPKETLEAAEMDGAGLVRRFFSIVVP
FT                   SLKQVFAVVIILSTIWDFKVFAQVYLMPGGSGSNRPVLNLGVWSYVESFGQNRYGFGSA
FT                   IAVLLTLVLLAITVIYVRTMLKEEKL"
FT   gene            265609..266436
FT                   /gene="palG"
FT                   /locus_tag="Lxx02610"
FT   CDS_pept        265609..266436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="palG"
FT                   /locus_tag="Lxx02610"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02610"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88303"
FT                   /db_xref="GOA:Q6AH42"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH42"
FT                   /protein_id="AAT88303.1"
FT                   /translation="MTRKLRGNIAKAVFVTLLLIFTLFPVYWMLSSAFDKQASSGGQSL
FT                   VPQEFTFDNFAYVLTKGGFDVFLRNSAIVAVSVVLLSAAFALLASVAVARFKFQFRTAI
FT                   LFIVLTVQMVPLEALVIPLFVQVRDLGLLNQLLGLIIVYMALSLPFGIWMLRGFVAAVP
FT                   VELEEAAYLDGASWWRMFRSVLFPLVMPGLVATSVFSFITAWNEFVFAMTLLGGASDNY
FT                   TVAIGLKQFFGENANEWGYVMAASTIITLPVMIFFVVVQRRLSNGLVAGAVKG"
FT   gene            267019..267846
FT                   /pseudo
FT                   /locus_tag="Lxx02620"
FT                   /note="similar to conserved hypothetical protein"
FT   gene            268033..268902
FT                   /locus_tag="Lxx02630"
FT   CDS_pept        268033..268902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02630"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02630"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88304"
FT                   /db_xref="GOA:Q6AH41"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH41"
FT                   /protein_id="AAT88304.1"
FT                   /translation="MSDVLSAVRQAVPRLSATEARIAQTVIEHPQRVVDLTIAELAAVC
FT                   DASQASIARFCQALRYSGYREFRLAVAAATSREQATRERFELTESEIDPSDSLQEVVAK
FT                   IAYQETLAIERTARELDAEALDAVVAAIIAASRVDLYGIGSSILTAQDLQQKLSRIGLT
FT                   AFCSVDSHLALSSAALQKPGNVAIAFSHSGETRETNHALAVARAAGATTVAITNVPESS
FT                   IAAVSDLLLMTQARENFYRSGAMASRTAQLALVDFLFVRVAQRLYDQMTDSLRLTYEAV
FT                   RSQRPERS"
FT   gene            268987..269469
FT                   /pseudo
FT                   /locus_tag="Lxx02650"
FT                   /note="similar to glycosyl hydrolase"
FT   gene            269471..270532
FT                   /pseudo
FT                   /locus_tag="Lxx02660"
FT                   /note="similar to conserved hypothetical protein"
FT   gene            272289..272732
FT                   /pseudo
FT                   /locus_tag="Lxx02680"
FT                   /note="similar to ABC transporter, ATP binding protein"
FT   gene            272869..273273
FT                   /locus_tag="Lxx02690"
FT   CDS_pept        272869..273273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02690"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88305"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH40"
FT                   /protein_id="AAT88305.1"
FT                   /translation="MVFLVDQDSRTAAKHIFSDENMKARGFCPENDALYIGDQEFEDVF
FT                   SDQEWTDVANRHWRRVDGENWQAAHIAELRSQKKFSDALLGLFKSGSYDGPAGKPVMSN
FT                   RMALDLKENNADVPPKLVKIFERLVEKANY"
FT   gene            complement(273655..274962)
FT                   /gene="pimH"
FT                   /locus_tag="Lxx02700"
FT   CDS_pept        complement(273655..274962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pimH"
FT                   /locus_tag="Lxx02700"
FT                   /product="integral membrane efflux protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02700"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88306"
FT                   /db_xref="GOA:Q6AH39"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH39"
FT                   /protein_id="AAT88306.1"
FT                   /translation="MRAMFRSLAGTNYLIWAAGALVSNIGTWMQRTAQDWIVLTQLTQN
FT                   NATAVGFVMALQFGPQLLLLPVTGWAADHLDRRRLLLATQGAMGALGLGLGLLTVTSAV
FT                   QLWHVYAFALALGVAAAFDAPARQTFVSELVAGPNLSNAVALNSASFNAARLIGPAIAG
FT                   LLTAAIGAGWVFLINAGTFGAVLLSLTLLRREQLYRTERAKRSPGSLIGGFRYVRRRPD
FT                   ILVILIMVFLIGTFGLNFPIFISTMSVSVFHQGAGEYGVLSSIMAIGSVAGALLSARRE
FT                   RPRVALLFAGAALFGVGCAITAVMPVYGLFALALILIGISAQTLMTTANGAIQLTTDPA
FT                   LRGRVMAIYMAIFMGGTPIGAPIVGWVADTFDPRWALGVGAASGFAAALVGELYLVRHR
FT                   GMRMRFSGIRPHVTMKPRERLREGLEETEATATQAS"
FT   gene            complement(274959..275246)
FT                   /gene="marR"
FT                   /locus_tag="Lxx02710"
FT   CDS_pept        complement(274959..275246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="marR"
FT                   /locus_tag="Lxx02710"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02710"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88307"
FT                   /db_xref="GOA:Q6AH38"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH38"
FT                   /protein_id="AAT88307.1"
FT                   /translation="MREGSGTIGRLSERVKPPSMNRTVNHLERAGYVERTADADDGRKA
FT                   VVIPTVDGRRLVDETRRRDAWLHQRLNALSAGQRATLAEAAAILRELADS"
FT   gene            275496..276077
FT                   /locus_tag="Lxx02720"
FT   CDS_pept        275496..276077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02720"
FT                   /product="lysophospholipase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02720"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88308"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH37"
FT                   /protein_id="AAT88308.1"
FT                   /translation="MSTRPRMREPSSSWRVGEHVDRYAALAGRLAARGYTVYADDHRGH
FT                   GRTGMPQWNGDAARLGRLGSGGLRAAVRDLRDFGHRIRAENPGLPLVLIGHSWGSLMGQ
FT                   MVLNGHSDEYDAAVLCGTAYRVVGSINSGDLNKRHAHLGATGAEWLSRDPAVAEAFSAD
FT                   PLTTLVPLQKLFGMADAAPASRPPLRGRNR"
FT   gene            complement(276283..277002)
FT                   /pseudo
FT                   /locus_tag="Lxx02740"
FT                   /note="similar to regulatory protein"
FT   gene            277084..278567
FT                   /pseudo
FT                   /gene="gabD"
FT                   /locus_tag="Lxx02750"
FT                   /note="similar to succinate-semialdehyde dehydrogenase"
FT   gene            278621..279850
FT                   /locus_tag="Lxx02770"
FT   CDS_pept        278621..279850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02770"
FT                   /product="hemagglutinin/hemolysin-related protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02770"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88309"
FT                   /db_xref="GOA:Q6AH36"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR041498"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH36"
FT                   /protein_id="AAT88309.1"
FT                   /translation="MLLTSHPDPRLEFPGRRHLSILTAAALTLGLTVAGAAVAAPAAAP
FT                   AIASPAEGSTISHPQPTIEGTAVPDAVIAVTFDAGTAAESTESTIASPAGEWSLIPDAP
FT                   FSDGAHTVQATATLGGETGPASAPVAFTVDSAAPARPLIASPANGSTVADARPVLTGTA
FT                   EPNATLVVHIDGVAAGEAPIESTGAWTFVPAAALANGPHTIQVVARDAAGNVSLPRVLS
FT                   LTVDAPAPVAPVISTPAAGAVVPTGTPTIAVTIDGVTAGTTRADSAGLWSFVPSAALAE
FT                   GVHTVRATAASDSGSVSDASDEVSFSIVSAVSSDGDDDGKTVPIGSDPVAGAPATIDTT
FT                   AETGALARTGSTGALPLLGAGFALLLLGVGLTVAVRLRRAVSWRPRRGRPEMRYARISG
FT                   LLSRVSPPRR"
FT   gene            complement(280254..281747)
FT                   /gene="katA"
FT                   /locus_tag="Lxx02780"
FT   CDS_pept        complement(280254..281747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="katA"
FT                   /locus_tag="Lxx02780"
FT                   /product="catalase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02780"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88310"
FT                   /db_xref="GOA:Q6AH35"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR040333"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH35"
FT                   /protein_id="AAT88310.1"
FT                   /translation="MSENHTTTQTGTPVASDAHSLTAGQDGATALHDRYLVEKLAQFNR
FT                   ERIPERIVHAKGGGAFGTFAVTGDVTAYTKAAVFQPGAKTETVQRFSSVAGEQGSPDTW
FT                   RDVRGFSVKFYTSEGNYDIVGNNTPVFFIRDGMKFPDFIHSQKRLPGSGLRDADMQWDF
FT                   WTLSPESAHQVTYLMGDRGLPRSWRTMPGYGSHTYQWINAAGERFWVKYHFHALHGNEE
FT                   MHGAEAEKIAGEDADYYRRDLYEAIERGDFPAWKLSVQVMPYEDAKTYRLNPFDLTKVW
FT                   PHSDYPLIEVGVHTLNRNPENFFAQIEQAAFSPANTVPGIDISPDKMLTARVFSYPDAQ
FT                   RYRVGTNYNELPVNAPVAPVHNYSQDGAARHGFKAAEAPVYAPNSFGGPVADPALAGEG
FT                   SWESDGALVRAAATLHAEDDDFGQAGSLYRDVFDAKAKERFLDTIAGAVGGVQRDDIRE
FT                   RAIQYWTSVDAGLGGLLRTRLASGVTDADEAAEFVGVAG"
FT   gene            complement(281761..282204)
FT                   /gene="fur"
FT                   /locus_tag="Lxx02790"
FT   CDS_pept        complement(281761..282204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fur"
FT                   /locus_tag="Lxx02790"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02790"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88311"
FT                   /db_xref="GOA:Q6AH34"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH34"
FT                   /protein_id="AAT88311.1"
FT                   /translation="MDTAQLEDTLRSAGLRVTRGRLAVLSALSDRPHSDAETVLAAVQP
FT                   ALPGTSIQNIHNVLGDLTLTRMVRRIEPAHSPALYERRIGDNHHVVCTLCSTVADVDCV
FT                   VGHAPCLRLSEAAGFAVDTAEVTFWRLCPSCQESTAATPSRSE"
FT   gene            complement(282371..284077)
FT                   /locus_tag="Lxx02800"
FT   CDS_pept        complement(282371..284077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02800"
FT                   /product="Na+/H+ antiporter"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02800"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88312"
FT                   /db_xref="GOA:Q6AH33"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH33"
FT                   /protein_id="AAT88312.1"
FT                   /translation="MIAVAVIVGVAAFARKLGVAAPIILAVVGVTLSWLPGVPEIVVPP
FT                   EVILDGLLPPILYAAAISVPLTDFRRNLAPIAGLSIVLVIITAFAVGFVLYALLPDLNL
FT                   AAAIALGAIISPPDAVAATSIGRKLGLPPRLLTVLEGEGLVNDATALVLLRTALAAAVG
FT                   ALATPLDGVLDFLSAVLIALVIGLVVGFLSVWVRSKLNDTALDTALSVIVPFAAFAPTE
FT                   ALHGSGVLAVVITGLYTGHASSKHFTAQARISDQINWRTIQFLLENGVFLLIGLELRTL
FT                   IADVEHPEVLSVWDAVGIGLVGLLCLVAIRSLLIVPLIYFLKHRGERAEKSVLREWLMI
FT                   SYFRDHPVRFRWQAIRKQRAELRYERHRSDLEEFRQEAIDWRGGIVLGWSGMRGVVTLA
FT                   AAQSLPADIPYRPQLILIAFTVAFVSLVLQGGTLPGLIRALGVQGIDAKDDRRLLAQLL
FT                   DDLSETGLAVLDDPEATSGSAKPVDPEVVERVRQTTYLGAEAAWERIILYDEPAESRPH
FT                   HVYRTLRLAVVDAERDRLLLERSRGAYPSRILSEAQAMLDIEETRLRSRAR"
FT   gene            284701..285150
FT                   /locus_tag="Lxx02810"
FT   CDS_pept        284701..285150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02810"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02810"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88313"
FT                   /db_xref="InterPro:IPR016709"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AH32"
FT                   /protein_id="AAT88313.1"
FT                   /translation="MVPVNPALPGRSYPPTPPYLVAREKIREFASAVFATNPISFDVEA
FT                   ARAAGHADLVGPPTFPIVVQEYTLQQLLADPEAGIDFSRVVHGDQRFTYTRAVVAGDQL
FT                   TATMTVTSVKSLGAHSMVTAESMIVDAGGEHVVTAISTLVVRGDE"
FT   gene            285147..285575
FT                   /locus_tag="Lxx02820"
FT   CDS_pept        285147..285575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02820"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02820"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88314"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH31"
FT                   /protein_id="AAT88314.1"
FT                   /translation="MMATPDFDTLAVGDVVAERAVDLSRDSLVRYAGASGDFNPIHYRD
FT                   DIAAAVGLPGVIAHGMLTMGLSVQPVVDWAGDPARVADYQVRFTRPIVVDPAEGATVSV
FT                   TAKIGQLEAEARVVRVDLTTTFNGETVLGKAQVRVCLA"
FT   gene            285610..286746
FT                   /gene="murB"
FT                   /locus_tag="Lxx02830"
FT   CDS_pept        285610..286746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="Lxx02830"
FT                   /product="UDP-N-acetylmuramate dehydrogenase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02830"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88315"
FT                   /db_xref="GOA:Q6AH30"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AH30"
FT                   /protein_id="AAT88315.1"
FT                   /translation="MTDPPALSALTTMRVGGTPERLLEPADRDALVATAREVWSTGDEW
FT                   LLLGGGSNTIAADDGFEGTVLRIVTRGVERLAAEKGRIRLRVQAGEPWDALVALTVRNG
FT                   WAGIEALSGIPGSTGAAPVQNIGAYGQEIESALIGVEFLDYLTGEVYTLARAELGLGYR
FT                   TSALKRGMAGVVLSVDLELADHSVPGGVGASLSAPIAYAQLADALAVPLGSRVSVDELR
FT                   RAVLALRASKGMVLDPADPDSVSAGSFFTNPIVSENVARALPSDAPRWSLGPPEPDTIL
FT                   SLGPEGVHPLDVPPFAAGPYEAKLSAAWLIENAGIRSGFALPGSGAAISSKHTLAIVNR
FT                   GAATAADVAQLASFVRGRVQADFGVVLHPEPVLVGLTL"
FT   gene            286803..287531
FT                   /locus_tag="Lxx02840"
FT   CDS_pept        286803..287531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02840"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02840"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88316"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH29"
FT                   /protein_id="AAT88316.1"
FT                   /translation="MGFLDRLLGREEPRRDAPQSAEGWNADSQSTHGSNAYARNAPQPP
FT                   ARSDDEIAVERYRYLLRTAPPETIEQVHEEAFARLTADQRRLLFQQLSEGAPAGERPRG
FT                   DDPRSLAQAATRSELRQPGTLERSLGGSGGGVGAASGMGFGGMLATSLLGSVAGYVIGS
FT                   ALVSTFLPTPGADQAADGTAEDGSGGDGSGGDGTATDTGSGDAGVETASADAGWGGDSG
FT                   DWGGGGGGGWDGGGFGGDFL"
FT   gene            complement(287623..289677)
FT                   /pseudo
FT                   /locus_tag="Lxx02850"
FT                   /note="similar to ATP-dependent DNA helicase"
FT   gene            290058..290136
FT                   /gene="Trp"
FT                   /locus_tag="Lxx02880"
FT   tRNA            290058..290136
FT                   /gene="Trp"
FT                   /locus_tag="Lxx02880"
FT                   /product="tRNA-Trp"
FT   gene            290173..290445
FT                   /gene="secE"
FT                   /locus_tag="Lxx02890"
FT   CDS_pept        290173..290445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="Lxx02890"
FT                   /product="preprotein translocase SecE subunit"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02890"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88317"
FT                   /db_xref="GOA:Q6AH28"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH28"
FT                   /protein_id="AAT88317.1"
FT                   /translation="MVRKVIDEPSEEIVANAKRDRAARRNPFARIALFIRQVIGELKKV
FT                   VTPTRKELVSYTGVVLVFVVIMMALVSLLDWIFGLGLVWVFGNPA"
FT   gene            290489..291436
FT                   /gene="nusG"
FT                   /locus_tag="Lxx02900"
FT   CDS_pept        290489..291436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="Lxx02900"
FT                   /product="transcription antitermination factor"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02900"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88318"
FT                   /db_xref="GOA:Q6AH27"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH27"
FT                   /protein_id="AAT88318.1"
FT                   /translation="MNSVSETNRDDVDWATAAEQSSEDDEAQTGNVLAGDEQSVDAAER
FT                   EALHIVAEDGSEVDLDAVLDAMAEAVDPEADRAVDEALEVDSAQEVEVAEEAEVAQEAV
FT                   PDEDELATDPYEEFRAELRGKIGKWYVIHSYAGFERRVKSNIENRMVSMNMEDYIYEVQ
FT                   VPMEDVVEIKNGQRKMVNRVRIPGYVLVRMDLNEDSWSVVRHTPGVTGFVGNAHNPTPL
FT                   RFEEAFSMLKSLVQVDAAPAKGAAKGQKAAARVIPAEVDFEIGETITIKEGSFAGLPGS
FT                   ISEIKPESGKLTVLVSLFERETPVELSFDQVTKL"
FT   gene            291557..291988
FT                   /gene="rplK"
FT                   /locus_tag="Lxx02910"
FT   CDS_pept        291557..291988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="Lxx02910"
FT                   /product="50S ribosomal protein L11"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02910"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88319"
FT                   /db_xref="GOA:Q6AH26"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AH26"
FT                   /protein_id="AAT88319.1"
FT                   /translation="MAPKKKVTGLIKLQINAGAANPAPPIGPALGQHGVNIMEFCKAYN
FT                   AATESQRGNVIPVEITVYEDRSFTFVLKTPPAAELIKKAAGVAKGSGVPHTTKVGKLTQ
FT                   EQVRAIAEQKMVDLNANDIDAASKIIAGTARSMGITVEA"
FT   gene            292063..292752
FT                   /gene="rplA"
FT                   /locus_tag="Lxx02920"
FT   CDS_pept        292063..292752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="Lxx02920"
FT                   /product="50S ribosomal protein L1"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02920"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88320"
FT                   /db_xref="GOA:Q6AH25"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AH25"
FT                   /protein_id="AAT88320.1"
FT                   /translation="MAQKSKAYRAAAEKIEAGKYYTPTEAVALAKETGSAKFNSTVEVA
FT                   LKLGVDPRKADQMVRGTVILPHGTGKTARVIVFATGPAAEAAIAAGADEVGGSDLIEKV
FT                   AGGYTDFDSAVSTPELMGQVGRLGKVLGPRGLMPNPKTGTVTPDVAKAVFDIKGGKIEF
FT                   RVDKHANVHFVVGKAGFTADQLNDNIKVALDEVVRLKPSAAKGRYIQKGAVSTTFGPGI
FT                   PLDVNAI"
FT   gene            293327..293701
FT                   /locus_tag="Lxx02930"
FT   CDS_pept        293327..293701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02930"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88321"
FT                   /db_xref="GOA:Q6AH24"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH24"
FT                   /protein_id="AAT88321.1"
FT                   /translation="MVGYLKASGLTITGVPASREYVVFRGAPSQFNSTFKTSLHAFKLK
FT                   GMQVVAPASAPSLPSRIGAEVAGVSLDQSRMLTRPNLLSPDGPRSSNESQLRTEATQRA
FT                   PLRTPPSSTRRARATSASTL"
FT   gene            293698..294993
FT                   /pseudo
FT                   /locus_tag="Lxx02940"
FT                   /note="similar to xanthomonapepsin-related protein"
FT   gene            complement(295048..296016)
FT                   /locus_tag="Lxx02950"
FT   CDS_pept        complement(295048..296016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02950"
FT                   /product="zinc-binding oxidoreductase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02950"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88322"
FT                   /db_xref="GOA:Q6AH23"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH23"
FT                   /protein_id="AAT88322.1"
FT                   /translation="MPNTMRAALLDAAGGPGSLRIGETPAPDRVNAEFLIKVVAAGVNP
FT                   IDVKTRAGTGVFGAIRSFPAVLGYDFSGIVVESPFDAHPLRPGDEVFGMAMVPRFGGSY
FT                   AEYVSAPSLSVVRKPATLSHIEAAAAPLAALTAWGMVIEVARAHEGQRMLIHAGSDGVG
FT                   HFAVQFAAYFGATVIATASGANTAWLRSLGAAQVIDYTTMRFEEVVSDVDVVIDLVGNV
FT                   LDDTGARSLGVLRPGGLIVNAPTGSWPGIAEDAAAAGVRGTGYRVAPDGSTLAVIARLL
FT                   ESGSVRVHVDAIYPLEQIAEAHRAVESGHTRGKVVVKVAEG"
FT   gene            complement(296219..296980)
FT                   /locus_tag="Lxx02960"
FT   CDS_pept        complement(296219..296980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx02960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx02960"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88323"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR019080"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH22"
FT                   /protein_id="AAT88323.1"
FT                   /translation="MFDRSTASATADLYRPLVLAGSDRRASAPAPRAVVPAVPGAEGHL
FT                   ARIVASSSDHVGWLRARSRGITATDVAKLSTPRSLRAAAREKLNGSGFSGNVFTQQGRV
FT                   REPEIAAWVAATHGIQPSDLLFHAERDRRHLATPDEVALREGGRIELAKIKTTNKPFRS
FT                   VPRHYLRQIWWQQYVLGAERTLFVWEQHDGFVPVHDEPTCRWVDRDDAEIARLLALAGD
FT                   LIELLRQATAPAAAPVAAAPAMAWSRTGDSE"
FT   gene            297242..298568
FT                   /pseudo
FT                   /locus_tag="Lxx02965"
FT                   /note="similar to sugar ABC transporter, solute-binding
FT                   protein"
FT   gene            298787..299611
FT                   /pseudo
FT                   /gene="malF"
FT                   /locus_tag="Lxx02980"
FT                   /note="similar to ABC transporter, permease protein"
FT   gene            299719..300444
FT                   /pseudo
FT                   /gene="malG"
FT                   /gene_synonym="thuG"
FT                   /locus_tag="Lxx03000"
FT                   /note="similar to ABC transporter, permease protein"
FT   gene            complement(300486..301214)
FT                   /gene="thuA"
FT                   /locus_tag="Lxx03010"
FT   CDS_pept        complement(300486..301214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thuA"
FT                   /locus_tag="Lxx03010"
FT                   /product="ThuA protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03010"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88324"
FT                   /db_xref="InterPro:IPR009381"
FT                   /db_xref="InterPro:IPR029010"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH21"
FT                   /protein_id="AAT88324.1"
FT                   /translation="MTLRVTVWNEGVHETTQPEIAAIYPDGIHRAIATGLSELLGDAVL
FT                   VRTATLADPEHGLSEQVLAETDVLLWWGHIAHDQVTDAVVERVREHVLGGMGLIVLHSG
FT                   HFSKIFTRMLGTTCSLRWRNLEGGERELVWNVNPAHPIAEGVEQPIVIEAQEMYGEFFD
FT                   IPAPDDLVFISSFTGGEVFRSGVTFTRGRGKIFYFSPGDQEYPVYFHPQVRRVLANGVR
FT                   WAAPSPGARRAPAVSNPQPV"
FT   gene            complement(301218..302366)
FT                   /locus_tag="Lxx03020"
FT   CDS_pept        complement(301218..302366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03020"
FT                   /product="NADH-dependent dehydrogenase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03020"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88325"
FT                   /db_xref="GOA:Q6AH20"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH20"
FT                   /protein_id="AAT88325.1"
FT                   /translation="MTTASHPLRAGVVGLGWAGQQHMDAYAALPGAKLVAIAGMEDGPR
FT                   AELGDKYGIARRYSDWRELVADGNLDVVSVAVPTFLHAPIAIGALDAGIHVLSEKPIAR
FT                   TATEAQGMVDAAHRSGRVLEVAFNHRRRGDIEALKAAIDDGRIGRPYHARASWLRRSGI
FT                   PALGSWFTNREMAGGGPLIDIGVHVLDYALYLFGEPRVTAVSAVTHSELGVRGRGGSAS
FT                   DRRNVGSAYEVEDLASLLLRLEGGGSIIVETSWAAYRPAGDEFGITLYGTEGGADLRVK
FT                   DYAPTGELTLFSGEGEESEDVSITADAGRGHLAVVETFLEHVADRANWSQWDGSLALER
FT                   ARVIDAAYESARLSTEVRLTPASPGREDPATATATATATKGA"
FT   gene            complement(302466..303659)
FT                   /locus_tag="Lxx03030"
FT   CDS_pept        complement(302466..303659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03030"
FT                   /product="transcriptional regulator, ROK family"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03030"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88326"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH19"
FT                   /protein_id="AAT88326.1"
FT                   /translation="MTDSPREPGIVATDAADLLAILRDGIPRTRAQLAELTGLARSTIA
FT                   VRIDSLTAAGLVAPAGDDVSTGGRPPARIRFNPGSRVAIAIDLGATHGVVALADLAGNI
FT                   MTSESQRLLISDGPEAVLDWAIASAKRLYAATGRPPDDLIGIGIGVPGPVEHSTGLPVN
FT                   PPIMAGWDRFGIPAYVRRVFDVPVLVDNDVNLLALGEHALIWPDQTDILFVKVATGIGA
FT                   GIISGGRLQRGAQGSAGDLSHVRVPFGIETPSHGAQEADLEALASGPAIARTLTAAGVP
FT                   ADSSDDVVALARTGSPAVLQAIRQAGRDLGEVIATCVNLLNPSLVIVGGSLSRVGEQLL
FT                   AGVREVVYHRSTPLATQHLTITQSRSGETGGAIGAAIMVIQHALDPETASARSFSSR"
FT   gene            303809..304552
FT                   /locus_tag="Lxx03040"
FT   CDS_pept        303809..304552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03040"
FT                   /product="sugar phosphate isomerase/epimerase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03040"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88327"
FT                   /db_xref="GOA:Q6AH18"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH18"
FT                   /protein_id="AAT88327.1"
FT                   /translation="MSTSKLSVQLYTVRELLTEDMVATLGRITEIGFTQVEPFAFLSFG
FT                   EKLRQGLIGAGLAAPTAHQGFIGGDVDEVFAAAAELGIQTVIDPYVPAERWQTAAQVAA
FT                   TADQLNAAVEIAARHGVRVGYHNHAHELESTIEGVSALEYFAGLLAPEVVLEVDTYWVT
FT                   VGGHDPVTLLPALGDRVVALHVKDGPGTTETKDQVAVGHGSLPIEQIIAAAPGALRVIE
FT                   LDDSRGDRFQAVADSYAFLTEKGLA"
FT   gene            304549..305646
FT                   /locus_tag="Lxx03050"
FT   CDS_pept        304549..305646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03050"
FT                   /product="NADH-dependent dehydrogenase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03050"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88328"
FT                   /db_xref="GOA:Q6AH17"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH17"
FT                   /protein_id="AAT88328.1"
FT                   /translation="MSGGVVGVGVIGAGVISDQYLENLTSFPDLDVRFVADIDEERAHV
FT                   QAEKNGVPGAGSVAELLVDDSIEIVVNLTIPKVHVAVALQALEAGKHVWSEKPFALDRV
FT                   SGKQLLAASNAKGLRVATAPDTFLGAGIQSARRLVESGAIGVPLTALTLMQSPGPESWH
FT                   PNPDFLFQEGAGPLFDIGPYYLTALVQLFGPIRRVSAAASRAKPSRVIGSGPRAGESFE
FT                   VTVPTHVSALYEFVSGQTAQAIFSFDSKLGRTLFEVAGVDATVAVPDPNTFEGDLLVHG
FT                   ADGVETVPATGSTASRGIGVVELARAIRAEVPERASGEQAYHVLDVMAATIEAGESGVP
FT                   VEIESIVKVAPALPEGWDPCEATLV"
FT   gene            305965..307033
FT                   /pseudo
FT                   /locus_tag="Lxx03060"
FT                   /note="similar to oxidoreductase"
FT   gene            307030..308082
FT                   /pseudo
FT                   /locus_tag="Lxx03080"
FT                   /note="similar to DNA-binding protein"
FT   gene            complement(308269..308940)
FT                   /locus_tag="Lxx03100"
FT   CDS_pept        complement(308269..308940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03100"
FT                   /product="lipoprotein translocation system"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03100"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88329"
FT                   /db_xref="GOA:Q6AH16"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH16"
FT                   /protein_id="AAT88329.1"
FT                   /translation="MYTLTNVTKKYNRSKREVIAFDDVTLEIPDGQLVAIQGPTGGGKS
FT                   TLLQMLGALDRPSSGDISLGASSLSTLGDHKLTALRASEIGFVFQSFNLIPTLSAQENV
FT                   ETALAPLRISAGERKLRAAEALASVGLADRGNHLPSELSGGQQQRVAIARALAKNPGVL
FT                   LADEPTGNLDEETRDEIMDLLEGLWRDRGLTMAIVTHDTAVAKRAQRRLNIKHGQVKEV
FT                   A"
FT   gene            complement(308958..310502)
FT                   /locus_tag="Lxx03110"
FT   CDS_pept        complement(308958..310502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03110"
FT                   /product="integral membrane protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03110"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88330"
FT                   /db_xref="GOA:Q6AH15"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH15"
FT                   /protein_id="AAT88330.1"
FT                   /translation="MFGTYLRRELLNRRKQTAIIAIGMALAIALVIIVDAVSAGVKEAQ
FT                   ASVLQSVYGVGTDITVSQPATAQTANAQRGAGGGPRFDFGAEAGADTGTGRQVDTSRLE
FT                   PARGATAMDASTLATAKKVENVSAAAAVLSLTNTSFSGTLPDFQQMPEQRQTGGTGASQ
FT                   TETTPPPTGGADGAGGSSFTVDSFSVLGLDPAGESVGPLASVSLSSGRTFTAADKGADV
FT                   TILDAAYAKTASKAVGDTIAIGGTDFKVIGIVSATGADSTTAANAYLPLDVAQTLSGQS
FT                   GKVSSVYVTAASSSDIDQIKADLTKALPGATVSTQADLASTVSGSLGSAGQLIANLGTW
FT                   LSVIVLAAAFLIAILFTISGVTRRTREFGTLKAIGWSNRRIVGQVAGESVVQGLIGGVI
FT                   GVAVGLLGVLVVNVISPTLTGSIGSGSAGAAGRGAGTTPGGPGPGAGASAEGGFGVGGF
FT                   EGLRAATRNTAEIALHAPITVWIVVGLALLGGLIAGAIGGWRASRLRPAAALRSVA"
FT   gene            310610..311425
FT                   /locus_tag="Lxx03120"
FT   CDS_pept        310610..311425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03120"
FT                   /product="two-component system, regulatory protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03120"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88331"
FT                   /db_xref="GOA:Q6AH14"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH14"
FT                   /protein_id="AAT88331.1"
FT                   /translation="MSMVFSKTPSRPLLIMRKVTINARAASGPSTQPRTLLRRADGSSI
FT                   RVLVVDDEHTLTDLLAMALHYEDWEVKTASNGQQALQFSREFRPDVVVLDIMLPDIDGL
FT                   QVLSRMRADGNEAPVLFLTAKDALDDRIAGLTAGGDDYVTKPFSLEELVARLRGLLRRS
FT                   RAAVADQDDPVLVVGDLVLDEDSYEVHRDGEPIQLTATEFELLRFLMRNPRRVLSKAQI
FT                   LDRVWSYDFGGSSSVVELYISYLRKKIDAGRTPMIHTVRGAGYMVKAVQ"
FT   gene            311464..313062
FT                   /locus_tag="Lxx03130"
FT   CDS_pept        311464..313062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03130"
FT                   /product="two-component system, sensor protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03130"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88332"
FT                   /db_xref="GOA:Q6AH13"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH13"
FT                   /protein_id="AAT88332.1"
FT                   /translation="MRGWFAHIRPFRSWALRSRVVLVVVAMLAVLGAAIGTVSVLALRT
FT                   YLMQRLDGQLTSALSRGAHAADSLFGASPTGPEGIRIVAAPGQPTGTFGTIRSGNQFLF
FT                   PVILTDRPAGSADNHPAEPRVVGLIPGDQLRSLPADANPRTIDFGSAYGDYRVAAYPLE
FT                   NGDSVIIGLPLSDVQATVGRLTFVIVLVTLAGIVSAFFLASFVIRLAMRPLERVAGTAE
FT                   QVAHMPLDRGDVALSVRVPEEDTDAHTEVGKVGAALNRMLGHVASALTARQASELKVRQ
FT                   FVADASHELRTPLASIRGYAELTRRSPHELPRDVTHSLGRIESEATRMTSLVEDLLLLA
FT                   RLDEGRELDRDPVDLSLLLVDALSDAHAAGPGHAWSILLPEEPVDVLGDAQRLHQVVAN
FT                   LLANARLHTPEATKVTASLTVDAEAGQAVVTVADDGPGIPEGLQSTLFERFARGDSSRA
FT                   RTTGSTGLGLAIVQAVVVAHDGTVSVQSRPGDTVFTVRLPLALAAEQTAAVDGAGAEAA
FT                   APVAPETGPGVGDVR"
FT   gene            313059..313844
FT                   /locus_tag="Lxx03140"
FT   CDS_pept        313059..313844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03140"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03140"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88333"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH12"
FT                   /protein_id="AAT88333.1"
FT                   /translation="MTPTLVAVTEYGLSSAPPLLYIRALPAESGRPCGFGRAFERWVLR
FT                   GPARERAVYAVGRPMSLPVDADMSRLAEVYANVVRGRFDGPVSLMGMSTGASVALQLAA
FT                   DHPELVDSLVVAAGAGRLSPRGRAVQRRYAAMLAAGGHRAAAELASATMSFRRLDPLVR
FT                   AATRLLPAPDDIESLLTILRAEDGFDVRDRLGRVGAPTLILSGGRDVFYPAELGRETAV
FT                   RMPRATHIVYRDRAHGGVPLHPRFAADIAAFLRRTQPTG"
FT   gene            314078..314596
FT                   /gene="rplJ"
FT                   /locus_tag="Lxx03150"
FT   CDS_pept        314078..314596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="Lxx03150"
FT                   /product="50S ribosomal protein L10"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03150"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88334"
FT                   /db_xref="GOA:Q6AH11"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AH11"
FT                   /protein_id="AAT88334.1"
FT                   /translation="MANKEATVAELENLFDSSTAVLLTEYRGLTVAQLKTLRTSISEHA
FT                   TYAVVKNTLTKIAANKKGISSFDEELVGPSAIAFVHGDPVAVAKSLRDFAKANPLLVVK
FT                   SGYFDGNPLTAEEVGKLADLESREVLLAKLAGAFKASLFGAAYLFNAPLSQAVRTVDAL
FT                   REKQESAAE"
FT   gene            314619..315017
FT                   /gene="rplL"
FT                   /locus_tag="Lxx03160"
FT   CDS_pept        314619..315017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="Lxx03160"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03160"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88335"
FT                   /db_xref="GOA:Q6AH10"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AH10"
FT                   /protein_id="AAT88335.1"
FT                   /translation="MAKLSTDELLEAFKDLTLIELSEFVKKFEETFEVTAAAPPVAVAA
FT                   APAAGGAGAAAEDAEQKDSFDIVLESVDASKKIQVIKEVRALTSLGLGEAKALVDGAPS
FT                   TVLEGANKEAADKAKTQLEGAGGTINLK"
FT   gene            complement(315454..315567)
FT                   /locus_tag="Lxx03170"
FT   CDS_pept        complement(315454..315567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03170"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88336"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH09"
FT                   /protein_id="AAT88336.1"
FT                   /translation="MTAARMLLEELGGAEPYTRSVGAAATLVVRSSTAPPH"
FT   gene            316073..316264
FT                   /locus_tag="Lxx03180"
FT   CDS_pept        316073..316264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03180"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88337"
FT                   /db_xref="GOA:Q6AH08"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH08"
FT                   /protein_id="AAT88337.1"
FT                   /translation="MRGVGGGGVRSRVSGGDAEAQKALNATAPRIPHLFRRIMALFAPY
FT                   RAAIALTMALVLIGPRCR"
FT   gene            316261..317946
FT                   /gene="novA"
FT                   /locus_tag="Lxx03190"
FT   CDS_pept        316261..317946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="novA"
FT                   /locus_tag="Lxx03190"
FT                   /product="ABC transporter, NBP/MSD fusion protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03190"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88338"
FT                   /db_xref="GOA:Q6AH07"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH07"
FT                   /protein_id="AAT88338.1"
FT                   /translation="MIPPLLTQRAFDDGLFPKTGRPDLPMLIETVALMVVVFVSSALLG
FT                   VWQTYLTASVGNKLMMGALRVRLFSHLQSMELSFFTKTKTGIIQSRLQNDVGGVANVLT
FT                   NTVSSVLGNTVTVIAALVAMLLLNGQLTIVAVILMPLLVIAQRRVGQARARIVTKTQES
FT                   LSDMTAITQETLSVSGILLAKSFNRQRAEVERYSDENRTQIRLQVSQAMSGQWFFAMVN
FT                   IFLSSIPAIVYLVSGWLVLGGATDITAGTIVAFTTVQARLLFPLLALMRVALDLQTSGA
FT                   LFARIFEYLDLKPAIVDRPDAAPVDSGRELGRIEFDRVAFRYPDARQGERNTLDDVFFV
FT                   IEPGQFAAFVGPSGAGKTTVSYLIPRFYDATSGRILFGGTDLRALRQESLVSHIGVVSQ
FT                   ETYLFHATIAENLRYARPDATQEEVESAARRANIHDTIVGFPDGYETVVGERGYRLSGG
FT                   EKQRIAIARVLLKDPAVLILDEATSALDSISERVVQQALDTASRGRTTIAIAHRLSTIV
FT                   AADVIFVVDRGRIVERGNHRQLLEAGGVYALLHGEQLEGSLLDS"
FT   gene            complement(318051..318509)
FT                   /locus_tag="Lxx03200"
FT   CDS_pept        complement(318051..318509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03200"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03200"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88339"
FT                   /db_xref="InterPro:IPR026004"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH06"
FT                   /protein_id="AAT88339.1"
FT                   /translation="MTIAATAFVVNAASTTASPSLDASETEDAVSDASIAVEDLKVGDC
FT                   LALPASGIASTIEVLDCAGPHTAEVFHTFEMAGDAAFPGAEAVKAAAGKACTGEAFAQY
FT                   IGAETDASGYAINYFGPTSASWSMQKRGITCFLVSAEESGELTGSARG"
FT   gene            complement(318947..319615)
FT                   /gene="sirR"
FT                   /locus_tag="Lxx03210"
FT   CDS_pept        complement(318947..319615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sirR"
FT                   /locus_tag="Lxx03210"
FT                   /product="iron-dependant repressor, DtxR metalloregulatory
FT                   family"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03210"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88340"
FT                   /db_xref="GOA:Q6AH05"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH05"
FT                   /protein_id="AAT88340.1"
FT                   /translation="MPVSSLSSVAQDYLKVIWCATEWEGDPITVKQLAERMGVRAATVS
FT                   DGIRRLADQGLLAHEPYGGIELTDAGRHGAVAMVRRHRLIETFLVEELGYGWDEVHDEA
FT                   EVLEHAVSDELIDRIDRRLGYPARDPHGDPIPTADGTPRRADAAPLLTAQTGVALTVVR
FT                   ISDADPAILRYLGERGIGLDAEVTVDEHREFAGDVTVRLHGEPMVLGSTAAGAVWVATR
FT                   "
FT   gene            complement(319649..320683)
FT                   /locus_tag="Lxx03220"
FT   CDS_pept        complement(319649..320683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03220"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03220"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88341"
FT                   /db_xref="GOA:Q6AH04"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH04"
FT                   /protein_id="AAT88341.1"
FT                   /translation="MRILGVDLARGVALLAVFIAHTAPLTRDSPFPLKLLNFSDHFAMP
FT                   LFAVTVGVSAGLASRRALADGRGMSRSRFRYGFAIRGLLLIALGILVGLFGAQVYPILH
FT                   YCGAVCLLLLPFLFVRARWLAVAAAVAAVASSTLMPVVANGTPASWGLPGALLPRLTTI
FT                   VAGFLFFDPAFRVTSVLAFALVGLTIARVGFRTRTMLATGATGIALLTAGYAAAALLDV
FT                   AVSPHSGTLPELSVSTGWALIVLALCVLAGQVTARPGSPLGRVLSPLATLGSMTLTFYV
FT                   AHLAVLGVWTRFFSPSDDHWWMVALLSAGSLAGAALFRRFLGGGPLERMVAVIAHGGRR
FT                   AHPA"
FT   gene            320962..322116
FT                   /gene="metB"
FT                   /locus_tag="Lxx03230"
FT   CDS_pept        320962..322116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metB"
FT                   /locus_tag="Lxx03230"
FT                   /product="cystathionine gamma-synthase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03230"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88342"
FT                   /db_xref="GOA:Q6AH03"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH03"
FT                   /protein_id="AAT88342.1"
FT                   /translation="MTHGFSTRAIHIGQEPDPTTGAIIPPIHQTSTFVQDGIGGLRSGY
FT                   EYGRAANPTRDSLQSLLASLEGGVSALSFASGLAAEDALLRAVLRPGDHIVLGNDVYGG
FT                   THRLIDRIHGAWDVRNTTVDLTDLDAVGVALATGRTRLLWIETPSNPLMKISDLAALTS
FT                   LGHGAGALVVVDNTFASPALQQPLSFGADVVVHSTTKYLGGHSDVIGGALVFGGEELAE
FT                   KVRFIQFAAGAVSVPMDAWLTVRGIKTLAVRMQRHTENAQAIADALLGRPGVQAVYYPG
FT                   LPTHPGRALAVRQMSGFGGMLSVALAGGAAVARRFAESTEVFQLAESLGGVESLIGYPA
FT                   EMTHASVRGTELDVPGNVIRLSVGIEDIADLLADVEQALGRASL"
FT   gene            complement(322239..322343)
FT                   /locus_tag="Lxx03240"
FT   CDS_pept        complement(322239..322343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03240"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88343"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH02"
FT                   /protein_id="AAT88343.1"
FT                   /translation="MLCTYLGGTPQHWIVEQHGKRVRLEREEWAQFAF"
FT   gene            complement(322611..322910)
FT                   /locus_tag="Lxx03250"
FT   CDS_pept        complement(322611..322910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03250"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88344"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH01"
FT                   /protein_id="AAT88344.1"
FT                   /translation="MTVAGYPSYWPLTGESQGACTGDAEPFPGFTEHATVLHGCRMTPG
FT                   SSGGPWFSTMASADSGKVFAVTTLGKSLLTNPYTVAVPNDAEVWCMYLIASARS"
FT   gene            complement(322940..323620)
FT                   /locus_tag="Lxx03260"
FT   CDS_pept        complement(322940..323620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03260"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03260"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88345"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AH00"
FT                   /protein_id="AAT88345.1"
FT                   /translation="MSFNPIRGRSSRAVGALATLAVAGALALVPHGVPGASPAEPSATE
FT                   PVRNMANAVVLSPPEPRAAISYRPAPPDSDPLGYWTADRMRSAVRAGSPVGARTEAPAG
FT                   SSASGHPMKTVGKLFYVDANNQDSWCTATVINGSSHNLVETAGHYVYTYRRGWNTKFAF
FT                   APGYDNGRAPYLVWNYSRAFTLKAWALHQDDEQTRRSSPSRSAWCTPIVRTGLISPTES
FT                   AATH"
FT   gene            324068..325381
FT                   /locus_tag="Lxx03270"
FT   CDS_pept        324068..325381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03270"
FT                   /product="glycosyl transferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03270"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88346"
FT                   /db_xref="GOA:Q6AGZ9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGZ9"
FT                   /protein_id="AAT88346.1"
FT                   /translation="MSNSSTSPLALDIVVPVYNEEATLQTSIRRLHAYLNGAVQASWRI
FT                   TIADNASTDAKPALADALAAELPRVAAVHLPLKGRGCALKAVWGSSPAEVHVYLDEDLS
FT                   TDLAALPPLVAPLLSGHSDLAIGTRLGSSARVTRGGKREFISRSYNLLLRRTMAVGFSD
FT                   AQCGFKAIRREAAQRLLPLVEDDGWFFDTELLILAERAGLRIHEIPVDWVDDPHSSVDI
FT                   VRTAREDLKGMLRVGTNIARGRIPLESVYAELGRRPFAPAREPGFFGQVVRFAVVGALS
FT                   TAAYAVLYLLFSGLVGGQTANFAALLITAVANTGANRRFTFGVRGRPGMARHQFQGLIV
FT                   FGIAWALTGCSLALLHTPAPGASSHVELLVLTVANLAATLLRFALLRLWVFRASRRQET
FT                   ARATEAPAAPAVLPAAVPPAPAPASGTPLVLTITETEQ"
FT   gene            325378..327359
FT                   /pseudo
FT                   /locus_tag="Lxx03280"
FT                   /note="similar to integral membrane protein"
FT   gene            complement(327746..328087)
FT                   /locus_tag="Lxx03300"
FT   CDS_pept        complement(327746..328087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03300"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88347"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGZ8"
FT                   /protein_id="AAT88347.1"
FT                   /translation="MTRTRTATLALAVSLGACTMTPPPPPQPGARRTGLQLRDQLLEHI
FT                   HDSLQASGLPDGWRYNPEPDGKPWDPTTSEFLGESCYVGSGDSQRLSVGLFHDPVGAAA
FT                   DFATTMSDY"
FT   gene            complement(328084..328215)
FT                   /locus_tag="Lxx03310"
FT   CDS_pept        complement(328084..328215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03310"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88348"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGZ7"
FT                   /protein_id="AAT88348.1"
FT                   /translation="MSATALGRPDLIDGDLTSTTADADAHNQRAEKIKEYQRQKALP"
FT   gene            complement(328747..329193)
FT                   /locus_tag="Lxx03320"
FT   CDS_pept        complement(328747..329193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03320"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88349"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGZ6"
FT                   /protein_id="AAT88349.1"
FT                   /translation="MTAVGCHSARPGDLRAYASGSSALDAELAGYLHRVRQAVDAFDRG
FT                   CRWGDLDASAVLTGFQRWLDGNRAEGTAAGFEKAGGGANGTVWAVYDRVRKRWAAATPA
FT                   ELLGLLKSRTAADLARLLRNNPDLAQNFWNHPPTRSRSPPGGPT"
FT   gene            complement(329958..330176)
FT                   /locus_tag="Lxx03330"
FT   CDS_pept        complement(329958..330176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03330"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88350"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGZ5"
FT                   /protein_id="AAT88350.1"
FT                   /translation="MSTPIIVDEDYTTIPYLRQGQRINLIHWRRIDERWTYETMHGNYC
FT                   GRNQSSWLLEVNGETCSVSRAMWAFFT"
FT   gene            330609..330827
FT                   /locus_tag="Lxx03340"
FT   CDS_pept        330609..330827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03340"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88351"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGZ4"
FT                   /protein_id="AAT88351.1"
FT                   /translation="MTGRDCLAENIAAFAPRINYDGSRRIFYSKKDGTIWDGNADQVTS
FT                   TQIARNVGLVTVIRAASNGSSVVVFLS"
FT   gene            330858..330950
FT                   /locus_tag="Lxx03350"
FT   CDS_pept        330858..330950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03350"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88352"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGZ3"
FT                   /protein_id="AAT88352.1"
FT                   /translation="MIAENVPAFDANVDSSSTRQVFYAQYQAVC"
FT   gene            complement(331041..332474)
FT                   /gene="xylB"
FT                   /locus_tag="Lxx03360"
FT   CDS_pept        complement(331041..332474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylB"
FT                   /locus_tag="Lxx03360"
FT                   /product="xylulose kinase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03360"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88353"
FT                   /db_xref="GOA:Q6AGZ2"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGZ2"
FT                   /protein_id="AAT88353.1"
FT                   /translation="MTLVAGVDSSTQSCKVVVRDLGSGTLVRSGRAAHPGGSEVNPAAW
FT                   RCALTKAVSAAGGLDDVAAISIAGQQHGMVVLDADGRVIRDALLWNDTRSAAAARDLIA
FT                   EVGAGAYAARAGVVPVASFTATKLRWLRDAEPENAGRVAAVALPHDWLTWRLQGYGPAD
FT                   ESPLGPDLEALTTDRSDASGTAYWSSARGTYDLDLFERSLGRAGREAGYPGDGVVLPRV
FT                   LGPAESADCTPAGAHVGPGAGDNAGAALGLSAADGDVVVSIRTSGTVFAVTGTPVSDAS
FT                   GTVAGFADASGRWLPLVATLNAARVLDAIAGVLGVDHAGLSALALRAEPGSGGAVLVPY
FT                   FEGERTPNLPDATASVHGLTLASTRRENLARAAIEGMLCGLADGIDALRASGVRERHVL
FT                   LIGGAAQSPAVATIAAQVFDAVVVVPSPGDYVADGAAVQAAWSLTGQRPRWAVAMSRTL
FT                   CVDTRTVIREQYAAARTTG"
FT   gene            complement(332485..333639)
FT                   /gene="xylA"
FT                   /locus_tag="Lxx03370"
FT   CDS_pept        complement(332485..333639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylA"
FT                   /locus_tag="Lxx03370"
FT                   /product="xylose isomerase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03370"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88354"
FT                   /db_xref="GOA:Q6AGZ1"
FT                   /db_xref="InterPro:IPR001998"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR013453"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGZ1"
FT                   /protein_id="AAT88354.1"
FT                   /translation="MLARAQAPPELSSRGATRPPLDVVEAVTRLSELGAYGLTFHDDDL
FT                   FAFGSADAERQKQIDRLKQALADTGIIVPMVTTNLFSAPVFKDGGFTSNDRAVRRFALR
FT                   KALRNLDLAAELGAQTFVLWGGREGAEYDSAKEIRMALERYREAVDLLGDYVTGKGYGI
FT                   RFALEPKPNEPRGDILLPTIGHALAFISSLERPELVGLNPEVGHEQMAGLNAAAGVAQA
FT                   LYHSKLFHIDLNGQRGVKYDQDLVFGHGDLQNAFALVDLLENGGPAYGGPAYDGPRHFD
FT                   SQTPAPRTSRASGSRRPRTCAPNLLLKERAASFRADPDVQEALAASRVAELSQPTLGPS
FT                   ESYGDLLADCSAFEDFDADAYFGGRGFGFVRLQQLALEHLLGAR"
FT   gene            complement(333606..334457)
FT                   /locus_tag="Lxx03380"
FT   CDS_pept        complement(333606..334457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03380"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88355"
FT                   /db_xref="GOA:Q6AGZ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGZ0"
FT                   /protein_id="AAT88355.1"
FT                   /translation="MGPRLRRRCYILTMTKKMFAQLCATGAIAAVTLLIGRNMHDTATV
FT                   ALFAVGVLATLLSAFRVHSLRARELAKRRRQDPVPKIPLPGRGPVHQARSDERTEKIGR
FT                   STETLRVTVLHPFQRLYVRGLVAALALTTPVFAQLYWLTVPDGPWLAVLLAHIVVTGLT
FT                   ALGAYAFFSTRITLGPDGVSERRFFGRTVLTRPGDADAILLVRLYDGNALDTLPELFVT
FT                   GHGGRLLIRMRGRFWSLEDMERVAEKLDAPVTRTEKPMTRTHLRRNSPELHCWLERRLH
FT                   RS"
FT   gene            complement(334516..334606)
FT                   /gene="Ser"
FT                   /locus_tag="Lxx03390"
FT   tRNA            complement(334516..334606)
FT                   /gene="Ser"
FT                   /locus_tag="Lxx03390"
FT                   /product="tRNA-Ser"
FT   gene            334899..335126
FT                   /locus_tag="Lxx03400"
FT   CDS_pept        334899..335126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03400"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88356"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGY9"
FT                   /protein_id="AAT88356.1"
FT                   /translation="MTGQAIMGQLPAGAFPAGFPAVLDPESFTVDRIPYDGGLTITMNA
FT                   TGPSEDHTTAELPPEHGRRLAAPGTIERAS"
FT   gene            335128..337257
FT                   /gene="pta"
FT                   /locus_tag="Lxx03410"
FT   CDS_pept        335128..337257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pta"
FT                   /locus_tag="Lxx03410"
FT                   /product="phosphate acetyltransferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03410"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88357"
FT                   /db_xref="GOA:Q6AGY8"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR016475"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGY8"
FT                   /protein_id="AAT88357.1"
FT                   /translation="MARSLYITSAEGHTGKSTVALGVLEALRHSVERVAVFRPIARSTV
FT                   ERDYVLDLLLTRVTAQIGYEEAVGVSYEDVHADADAALGEIVRRFRAVEAKADAVVILG
FT                   SDYTDVGSPTELGYNARIAANLGAPALLVLGGRVGQGFGERLGQADPRSPEELRQLAEL
FT                   AVAELRAEHAGLLAVVANRADSDRLETIVEAVGEAVAAGAPAQGARPQVWAIPEDPFLV
FT                   APSIRSIMEVTAGELLAGDRELLAREALGVVVAGMSMNNVLPRLVEGAVVVVPGDRTEV
FT                   LLAVLMANASGTFSSVAGIVLNGGFELPEPIERLLAGLRSPLPIVYTWLDTYETVVRIT
FT                   HARGRLAADSQRKYDTALALFERHVDAGALLARLDVTRHEVVTPLMFEYDLIERARAAD
FT                   KHIVLPEGEDDRILRAAATLLARGVARLTILGEPFEVRSRAIEIGLDISGAEVLSPFDD
FT                   VLRLRFAHEYAELRAHKGITVDQASDTVTDPSYFGTMMVHAGLADGMVSGAANTTAHTI
FT                   RPAFEIIKTSPSVSVVSSVFLMALADRVLVYGDCAVIPDPTAEQLADIAVSSARTAGQF
FT                   GIEPRVAMLSYSTGDSGTGADVDKVRTATALVRDRAPQLPVAGPIQYDAAADAAVGAAK
FT                   MPGSEVAGRATVFVFPDLNTGNNTYKAVQRSAGAVAIGPVLQGLRKPINDLSRGATVDD
FT                   IVNTVAITAIQAALS"
FT   gene            337254..338447
FT                   /gene="ackA"
FT                   /locus_tag="Lxx03420"
FT   CDS_pept        337254..338447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="Lxx03420"
FT                   /product="acetate kinase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03420"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88358"
FT                   /db_xref="GOA:Q6AGY7"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AGY7"
FT                   /protein_id="AAT88358.1"
FT                   /translation="MSAVLVVNSGSSSLKYQLIDAKSEEALATGLIERVGEGEGRIRHR
FT                   GPGGSAEYTLVIPDHTAAFRAMLAAFGTDGSSLVEHPLDAVGHRVVHGGKRFFEPTIVT
FT                   PLVEANIDDLADLAPLHNPANLDGIRAARQAFPAVPHVAVFDTAFHQTLEPAAYTYAID
FT                   AALAEEHRVRRYGFHGTSHKYVSGAVAELLGRPLGELKQIVLHLGNGASACAVDGGRSI
FT                   DTSMGMTPLEGLVMGTRSGDIDPAVLFHLSRRAGLGIDELDELLNRRSGLLGLTGHGDM
FT                   RDVRRVAESGDAVARLALDTVAHRLKHYIGAYTALLGGLDALTFTAGVGENDPDLRAAA
FT                   CKGLGVLGIQLDPERNAARSPGARIVSADGSPVTVLVVPTNEELEIARQALQAVAAG"
FT   gene            338721..341090
FT                   /gene="dnaZ"
FT                   /locus_tag="Lxx03430"
FT   CDS_pept        338721..341090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaZ"
FT                   /locus_tag="Lxx03430"
FT                   /product="DNA polymerase III, gamma and tau subunit"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03430"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88359"
FT                   /db_xref="GOA:Q6AGY6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGY6"
FT                   /protein_id="AAT88359.1"
FT                   /translation="MWVVTALYRRYRPDTFAEMIGQSQVTDPLTTALRTNRVNHAYLFS
FT                   GPRGCGKTTSARILARCLNCAEGPTDIPCGVCPSCVELSRGGGGSLDVVEIDAASHNGV
FT                   DDARDIRERAIFAPARDRYKIFILDEAHMVTPQGFNALLKIIEEPPDHVKFIFATTEPE
FT                   KVIGTIRSRTHHYPFRLVPPALMLEYVQTLCDSEGITVAPGVLPLVVRAGGGSPRDTLS
FT                   LLDQLMAGSEGSSIEYERAVALLGYTHAALLDEVVDAIAARDAAGAFAAVDRVIQTGQD
FT                   PRRFVDDLLERLRDLIVVAATSVEGAAAVLRGVPADVLDTMGRQAMMFGAAELSRCADI
FT                   VNAALTEMTGATSPRLHLELMVARVLVPSSDDTERGALARVERLERRVGVSDAAGGGPA
FT                   RGAALTAAAARSAPAPEPPAIRAAEPAPRAEPPARAEKAAPESDAVAEPQPESAPSIGP
FT                   VTTQQVKDSWPQILDAVQRAKRSAWMVVFTAQVRALSDDVLTLSFPSDNDVQSFRQPPA
FT                   PGTQGVSEYLRQAIVDILGIRVKFIARADGGSGSPGPGEPAASAAETWPGADGPGGAPH
FT                   GGGGMAAGVPDRLAFEGPASGSPVSGRSAPGASPSATAPPGTSGSGVAATAAAEASGAA
FT                   GAASRSAAAPSSRPVTEWATVAIPVAEPVGAASPVVTLERPGPAAVPAASRADSPTRGG
FT                   TPLSDDVPPEETEPPFEPDVPEEPGEGGAGAPPPPLGSAPAPSTVPAPRTVRAPSTGVR
FT                   PPAFQAPQRYGEAVVREILGATFLEEQPAPATPGMR"
FT   gene            341094..341690
FT                   /gene="recR"
FT                   /locus_tag="Lxx03440"
FT   CDS_pept        341094..341690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="Lxx03440"
FT                   /product="recombination protein RecR"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03440"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88360"
FT                   /db_xref="GOA:Q6AGY5"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AGY5"
FT                   /protein_id="AAT88360.1"
FT                   /translation="MYAGIVQELIDELGRLPGIGPKSAQRIAFHILQTEAFDVTRLAEV
FT                   LLEVRDKVRFCEICGNVSEQATCSICRDPRRDPALICVVEEAKDVVAIERTREFRGLYH
FT                   VLGGAISPIDGVGPDDLRIRQLVQRLADGTVQEVIIATDPNLEGEATATYLSRLLTTLE
FT                   VRVTRLASGLPVGGDLEYADEVTLGRAFEGRRQVS"
FT   gene            341764..343050
FT                   /gene="lysC"
FT                   /locus_tag="Lxx03450"
FT   CDS_pept        341764..343050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysC"
FT                   /locus_tag="Lxx03450"
FT                   /product="aspartate kinase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03450"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88361"
FT                   /db_xref="GOA:Q6AGY4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGY4"
FT                   /protein_id="AAT88361.1"
FT                   /translation="MALIVQKFGGSSVSDAESIKRVAKRIVETRKAGNEVVVAVSAMGD
FT                   TTDELVDLAHEVTPIPAPRELDMLLTAGERISMALLAMAIKSMGSDARSFTGSQAGMIT
FT                   DAVHGSARIVDVTPGRIQDALSEGAIAIVAGFQGFSRESRDITTLGRGGSDTTAVALAV
FT                   ALGAEVCEIYTDVDGVFTSDPRQVPLARKIDRITSEEMLELAAAGAKVLHIRAVEYARR
FT                   HDVTLHVRSSFSNREGTYVLNEAAAAAAAKKDGIVEEPIIAGVATDLSEAKITVVGVPD
FT                   VPGKAAQIFKIVAKANANVDMIVQNVSAAATSLTDISFTLPKSEGQRVLTALTAEKYEV
FT                   GFQSLQYDDQIGKLALVGAGMRTNTGVSAKLFEALFDAGINIEMISTSEIRISVVTCAD
FT                   TVAEAARVVHSAFRLDGDQQAIVYAGTGR"
FT   gene            343125..344195
FT                   /gene="asd"
FT                   /locus_tag="Lxx03460"
FT   CDS_pept        343125..344195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="Lxx03460"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03460"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88362"
FT                   /db_xref="GOA:Q6AGY3"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGY3"
FT                   /protein_id="AAT88362.1"
FT                   /translation="MSEHAGLSIAVVGATGQVGAVIRRLLDEREFPVGSVRFFASSRSA
FT                   GTTLPFRGENIAVEDVEAADVSGIDIALFSAGATGSRAHAPRFAEAGAIVIDNSSGWRL
FT                   DPDVPLVVSEVNPEAIADARKGIIANPNCTTMAAMPVLKVLHDEAGLERLVVSTYQAVS
FT                   GSGLAGAEELAGQIRASAADENLLQLVHDGSAVELPAPVKYVRPIAFDVIPLAGSLVAD
FT                   GFNETDEEKKLRNESRKILDLPGLLVSGTCVRVPVFTGHSLSINAEFANPISPEWAAEL
FT                   LADAPGVRLADVPTPLEAAGQDPSFVGRIRSDEGVPEGRGLALFVSSDNLRKGAALNAV
FT                   QIAELVAKRLTASVGV"
FT   gene            344343..345818
FT                   /gene="mqoA"
FT                   /locus_tag="Lxx03470"
FT   CDS_pept        344343..345818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mqoA"
FT                   /locus_tag="Lxx03470"
FT                   /product="malate/quinone oxidoreductase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03470"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88363"
FT                   /db_xref="GOA:Q6AGY2"
FT                   /db_xref="InterPro:IPR006231"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AGY2"
FT                   /protein_id="AAT88363.1"
FT                   /translation="MSNDPIDVVLIGGGIMSATLGAMIQRVQPGWSIRIYESLGEVAQE
FT                   SSNPWNNAGTGHAALCELNYMPEAEDGTVDPAKAISINEQFQLSRQFWASLVAAGDLPE
FT                   PQTFINSTPHMTFVRGRENVRYLRRRYEELKDQPLFAGMEYSEDAETIAEWAPLLTKKR
FT                   NRKQRIAATRQLAGTDVDFGALTRALVDDLVASGAELALNHRVCSLKRTKDGLWRIRAR
FT                   HEVGRTPREALARFVFVGAGGGALHLLQKSGISEIEGFGGFPISGQFLRTTNPAIVAQH
FT                   KAKVYGKAAVGAPPMSVPHLDTRVVDGETSLLFGPYAGFSPKFLKTGTWWDLPGSIRLG
FT                   NIGPMLAVARDNFDLMKYLIGELMAGREKKLAALREFMPTAKSEDWELIAAGQRVQVMK
FT                   KDERKGGVLQFGTEVIAAADGSIAGLLGASPGASTAVPIMVDLLKRCFPERFEGWLPVL
FT                   RELIPTVGTTLNDRPEEAEFVLKRTAAVLKLAQ"
FT   gene            345976..347019
FT                   /locus_tag="Lxx03480"
FT   CDS_pept        345976..347019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03480"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03480"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88364"
FT                   /db_xref="GOA:Q6AGY1"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGY1"
FT                   /protein_id="AAT88364.1"
FT                   /translation="MRWSGQELTAETPAALSGLARLSAFVRSVRTPEFANITFHEILAK
FT                   SALNRVPGGGGPMPFGWTVNPYRVCSHACVYCFARPTHSYLDLDQGKDFDQEIIVKVNV
FT                   AEVLRKELARPSWGRHPVALGTNTDPYQRAEGRYALMPGIIDALASSGTPFSILTKGSL
FT                   LRRDLDRLADAATRVPVDLALSIAVYDDELQQSVEPGTPTTKARLATVAAVRDRGLDCA
FT                   VFLMPILPYLTDTRGNLDRALRQARDAGATSVLYSALHLNPGVKEWYYLWLGREHTELL
FT                   PQYRAMYGRGTYAPKEYRRWLATRIKPLRTLRDSEGERRAFAGAAIAGEVPGVAGLMTL
FT                   GVQPTLF"
FT   gene            347270..347515
FT                   /locus_tag="Lxx03490"
FT   CDS_pept        347270..347515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03490"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88365"
FT                   /db_xref="GOA:Q6AGY0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGY0"
FT                   /protein_id="AAT88365.1"
FT                   /translation="MPLPGLDAGTSPSSGITLLMPAPMIVLLALLARRHAIEDDRDEGL
FT                   SVEFSGDRDILARLDDGTGRALGLTVRIASPGTPIR"
FT   gene            347512..348201
FT                   /pseudo
FT                   /locus_tag="Lxx03500"
FT                   /note="similar to two-component system, regulatory protein"
FT   gene            348253..348855
FT                   /gene="tdk"
FT                   /locus_tag="Lxx03510"
FT   CDS_pept        348253..348855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdk"
FT                   /locus_tag="Lxx03510"
FT                   /product="thymidine kinase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03510"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88366"
FT                   /db_xref="GOA:Q6AGX9"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGX9"
FT                   /protein_id="AAT88366.1"
FT                   /translation="MAKLYFRYGAMNSGKSTAMLQAACNYEERGHRVLLAKPSIDTKGD
FT                   MGILSRLGVTRQVDYLIAPGTDSYGAFQQHRDRIRERFDRDISAVLVDEAQFLTEAQVD
FT                   DLLRIALLDDVPVLAYGIRTDFQTVAFPGSRRFLEVAHSLEELKTICRCGRKAIFNARK
FT                   IDSVFVFDGGPGRHRRRFGGLRIALRVLLSAREPWCA"
FT   gene            348959..350266
FT                   /gene="udgA"
FT                   /locus_tag="Lxx03520"
FT   CDS_pept        348959..350266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="udgA"
FT                   /locus_tag="Lxx03520"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03520"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88367"
FT                   /db_xref="GOA:Q6AGX8"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGX8"
FT                   /protein_id="AAT88367.1"
FT                   /translation="MRISVIGCGYLGAVHAAAMADLGHTVIGVDVDEAKVTALSEARAP
FT                   FFEPGLPEVLASATASGRLRFTTDFSAVAEAEVHFVGVGTPQSAEGDAADMRFVDAAFA
FT                   SLLECVKPGDLIVGRSTVPVGTAARLAELVAQRAPEVTLAWNPEFLREGFAVKDTISPD
FT                   RLVYGVPPGEAGERTARILDAIYARAVGAGTPVIVTDYATAELVKVSANAFLATKISFI
FT                   NAMAEIAEAAGADVTRLADAIGHDARIGRRFLNAGVGFGGGCLPKDIRAFSARARELGQ
FT                   GDAVRFLDEVDKINLRRRARVVDLVAEVAGGVEGVRVGMLGLAFKPHSDDIRDSPALDV
FT                   ATRLAARGAIVIATDPEAVPNASLRAPQLTFAANAHEAVAGADVVVLITEWPEFTGLDP
FT                   AELGELVAHRRVIDGRNALDPVAWRAAGWEYRGLGR"
FT   gene            350556..351176
FT                   /pseudo
FT                   /locus_tag="Lxx03530"
FT                   /note="similar to oxidoreductase"
FT   gene            351128..351451
FT                   /pseudo
FT                   /locus_tag="Lxx03540"
FT                   /note="similar to conserved hypothetical protein"
FT   gene            351527..352138
FT                   /gene="msuE"
FT                   /locus_tag="Lxx03550"
FT   CDS_pept        351527..352138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msuE"
FT                   /locus_tag="Lxx03550"
FT                   /product="NADH-dependent FMN reductase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03550"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88368"
FT                   /db_xref="GOA:Q6AGX7"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR019912"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGX7"
FT                   /protein_id="AAT88368.1"
FT                   /translation="MKAVPGMAHAPTVVGVSGSLTTPSRTTVLVDEVTRAFADATGGTP
FT                   NAIGLAPLLGDLGVGPFRSHLSPRVLAALEAVESADIIVVGSPAYRSTYTGLFKLFFDH
FT                   IDQYALLDKPVVLTATGGSDRHALFVEHQMRPLFGFFQSLTLPLGIYASEADFEDYAIA
FT                   SDDLLERIATAVTRTLPLVRSRVDPEARDTGAEFARPDAF"
FT   gene            complement(354949..355218)
FT                   /locus_tag="Lxx03555"
FT   CDS_pept        complement(354949..355218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03555"
FT                   /product="phage-related protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03555"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88369"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGX6"
FT                   /protein_id="AAT88369.1"
FT                   /translation="MSAAERSESAKKAAEVRWSSEPVREVLAGSPDHPLRIGEVEIECY
FT                   VLDDDTRVITQASMLTAIGRSRRIPGAEGASVLDHSVRSEPDAR"
FT   gene            complement(355564..356760)
FT                   /locus_tag="Lxx03560"
FT   CDS_pept        complement(355564..356760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03560"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03560"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88370"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGX5"
FT                   /protein_id="AAT88370.1"
FT                   /translation="MRHGPAKYEETHPCLTFQFSPQVNFLWAKLGEAFSKNQHLAGIPL
FT                   QPELATRLASIILRKGALGTVAIEGNTLTEDEVEKILQDGLKLPPSQEYLEQEIRNVAG
FT                   ALEVIDESGRAGDQFQVTPEWLQAQNAKLLNELETEEHVVPGEYTTTGLVVGSVYRAAP
FT                   AEDVPYLIDRMCIWLNDAFVIPSQNPNLTDEMRFFNAFFGAVLGHLYLAWIHPFGDGNG
FT                   RTARLLEVAILAHSGVVPWVASNLLSDHYNRTRSRYYQRLASTSREGKVEEFVTYAAEG
FT                   LVDLLREQIGEVRESQMRVAWINYVHDRLRYESPGKTKDRRRNLVLALPVDSPITKREM
FT                   RRLTPELAEAYAGHEDRMIARDLHALQKLGLVDEFAGGKQYRARAYIMYAFVPIPPGA"
FT   gene            complement(357623..358060)
FT                   /locus_tag="Lxx03565"
FT   CDS_pept        complement(357623..358060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03565"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03565"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88371"
FT                   /db_xref="GOA:Q6AGX4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGX4"
FT                   /protein_id="AAT88371.1"
FT                   /translation="MITAGVPAAVIALGIRCGKLQNRFIPDRRARSPLAIISILAAATA
FT                   LCVLPMMGAPTLVYRAVLATMLAVAAVGIVSVWWKISAHTTIASLVAVAVWSWTFWGVV
FT                   AIAVVAAVATSRVILRAHTVWQVIAGVILGGAIGLAFFVLA"
FT   gene            complement(358429..359733)
FT                   /locus_tag="Lxx03570"
FT   CDS_pept        complement(358429..359733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03570"
FT                   /product="phage-related integrase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03570"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88372"
FT                   /db_xref="GOA:Q6AGX3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGX3"
FT                   /protein_id="AAT88372.1"
FT                   /translation="MPKKRSPGEGGLHYDRAKGLWRGRYDDGFHPDGRRRQREVSARTQ
FT                   TVARERLKQKLAEIAEYGTTLGRTVTVAAWAEHYIETDCWMRLKPNSLATTESLMRNWI
FT                   VPLLGRRRISELKPSDVRLVHKAVFDAGLATGTARKAHEILSGMLSAAKADGLVTRNVV
FT                   DDVKPPEVIAKNPRGSLSTEQALAVLAASANVEGTRWWVAVLDGIRQSERLGALIEGLD
FT                   LDAGTLRVDWQLEELRSEHGCEPLAEGQWSCLTKRGSSFPQRRFKVKSSLEYIHLYGRL
FT                   ALIRPKLGKSRTVPLIPPVVAVLHEYLEATKDRPNPYGLLWRHEDGRPYLPHEDQQLWR
FT                   DLLFRAGVINQEQTKPPKDRTPGTPGIPTTHWARHTTATALMELGVDAKIVGEIVGHVD
FT                   EKTTRRYQHVSSPTARDAMERLSSHFKDALHTPTG"
FT   gene            complement(360885..360964)
FT                   /gene="Pro"
FT                   /locus_tag="Lxx03580"
FT   tRNA            complement(360885..360964)
FT                   /gene="Pro"
FT                   /locus_tag="Lxx03580"
FT                   /product="tRNA-Pro"
FT   gene            complement(361078..362058)
FT                   /locus_tag="Lxx03590"
FT   CDS_pept        complement(361078..362058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03590"
FT                   /product="phosphohydrolase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03590"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88373"
FT                   /db_xref="GOA:Q6AGX2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGX2"
FT                   /protein_id="AAT88373.1"
FT                   /translation="MRARALRAAGAALTALAAGGATAFAYGSLIERQAFTLRTVTVPVL
FT                   PAGSDAIRVLHLSDLHMAPWQHDKQQWIRSLARFEPDLIVDTGDNLSHQDGLRGIRAAL
FT                   DVFRGVPGVFVHGSNDYFGPQLKNPFKYFTGPSKRRGSTSPRLDTAALTEYLSGLGWLD
FT                   LNNAAGALEVRGTHLELFGVDDPHIRYDRMAAIPGALDELRENDPYSDDTAWPGDGPRP
FT                   ERPTVTLGVVHAPYRRVLDSFVTYGASMIFAGHTHGGQVCVPGYGALVTNCDIPRKQAK
FT                   GLSLWRHAFRTAYLNVSAGLGTSIYAPVRFACRPEATLVTLTAAE"
FT   gene            complement(362055..364613)
FT                   /gene="ponA"
FT                   /locus_tag="Lxx03600"
FT   CDS_pept        complement(362055..364613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ponA"
FT                   /locus_tag="Lxx03600"
FT                   /product="penicillin-binding protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03600"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88374"
FT                   /db_xref="GOA:Q6AGX1"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGX1"
FT                   /protein_id="AAT88374.1"
FT                   /translation="MSAKKPQARGGLGAVGAFVGMSAVAGLLVTAAVTPAIAVTGMAAN
FT                   NSIGIFEGLPEYLQIGQLAQPTTIYAKNADGSDIVLATFYSQNRLPVAFDQISQSAKDA
FT                   AIAGEDPRFYTHGGVDIQGTMRGVLSTVSGGGVQGGSSITQQYVKNVLLQKCEAMPVKT
FT                   KDQKAKYQDCVDDSTGITPDRKVKEMKYAIGLEKKYPKDELLVGYLNIAGFGGSVYGIE
FT                   AAAHYYYNTTAAALTPAQAASLIAIVNEPTGLKLDNSDSESNGAANGYAKNKERRNYIL
FT                   SKMYEYKKLTKAQYDEAVGTPIQPQITPSLRGCQTAGGAAYFCDYVQKIVLNDASFGKD
FT                   ADTRAANFNRGGYKIYTSLDVDLQQTAEETLASYVPPVYDKADLGGVLVGVQPGTGRVL
FT                   YMAQNKQYSQDPDVLKSGAQYSSVNYATDQDYGGSNGFQVGSTYKVFTLAEWLKQGHSL
FT                   NETVNANVRTYTKFKNSCSGDWNGTYRPANDSGNEEGIRSAQNATTNSINTAFVAMASE
FT                   LDLCDIKGDAEAFGVHTATGSSLNMDPASVLGTNNIAPLTMATAFAGIANNGMTCSPIA
FT                   IDKIVGGNGKEVSAPQSKCTQSVDPAIANTMAKALKDPIESGTAAGMNRTGKDMLGKTG
FT                   TTDNNEQLWLIASTTKVAGAYWVGNITRHQDMRRISPTHGTTPAAARTAVMRTMMSAAV
FT                   GKYGGDPFPSPPDKLVRGVQVSIPDLAGKTPAEAKSILTGLGLDSADGGPQDSAQPAGT
FT                   VSATDPATGTPVSKGTQVTVYTSNGALVTIPNVVGMKVSDAQKTMADAGFVIKLTGESS
FT                   PDAIVQAEEPGAGSAARPGTQVTLTAQRATQPTPAPGAGG"
FT   gene            364686..364853
FT                   /locus_tag="Lxx03620"
FT   CDS_pept        364686..364853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03620"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03620"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88375"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGX0"
FT                   /protein_id="AAT88375.1"
FT                   /translation="MLRWQYTTTPLIVHNTAAILNNWGSQGWELVQVVIGPEGGLVAYL
FT                   KRPVPDGADT"
FT   gene            364853..365323
FT                   /locus_tag="Lxx03610"
FT   CDS_pept        364853..365323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03610"
FT                   /product="translation initiation inhibitor"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03610"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88376"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGW9"
FT                   /protein_id="AAT88376.1"
FT                   /translation="MAGVEARLAELGIDLPEVVPPVAAYTPAVVDGGRVYTSGQLPMVA
FT                   GALPATGKVGEGDGLVPAADAKEYARICALNALAAVESVIGSLDRVTRVVKVVGFVASD
FT                   PAFTGQPGVVNGASEVFGEVFGDAGVHARSAVGVAVLPLDAPVEVELIVAFE"
FT   gene            complement(367286..369226)
FT                   /pseudo
FT                   /gene="acsA"
FT                   /locus_tag="Lxx03630"
FT                   /note="similar to acetyl-coenzyme A synthetase"
FT   gene            369843..370532
FT                   /pseudo
FT                   /gene="tadA"
FT                   /locus_tag="Lxx03650"
FT                   /note="similar to type IV secretion ATPAse"
FT   gene            370583..370669
FT                   /locus_tag="Lxx03670"
FT   CDS_pept        370583..370669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03670"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88377"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGW8"
FT                   /protein_id="AAT88377.1"
FT                   /translation="MEASHRGALNYNEARLKKDGVVMSLTVQ"
FT   gene            370771..371061
FT                   /locus_tag="Lxx03680"
FT   CDS_pept        370771..371061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03680"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88378"
FT                   /db_xref="GOA:Q6AGW7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGW7"
FT                   /protein_id="AAT88378.1"
FT                   /translation="MRGTTTSVTYRARRRVARILSMNDIPPANPFMRALTYIVLVGLVL
FT                   GVILLFVGFSNPYMGTLPLAYVGIGLIGFASTALLVELGAAAARWGRDQSE"
FT   gene            375552..375857
FT                   /locus_tag="Lxx03690"
FT   CDS_pept        375552..375857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03690"
FT                   /product="transposase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03690"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88379"
FT                   /db_xref="GOA:Q6AGW6"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGW6"
FT                   /protein_id="AAT88379.1"
FT                   /translation="MPGPYPREFREDVVAVARRCESGVTIKQIATDFGISEATLQNWLR
FT                   QADVEEGNRPGQTAAEAAELREARKRIRLLEQENEVLRRAAAYLSQANLKLGGSPK"
FT   gene            376084..376392
FT                   /pseudo
FT                   /locus_tag="Lxx03695"
FT                   /note="similar to transposase"
FT   gene            376712..377821
FT                   /gene="tpase"
FT                   /locus_tag="Lxx03700"
FT   CDS_pept        376712..377821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpase"
FT                   /locus_tag="Lxx03700"
FT                   /product="transposase, ISlxx2"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03700"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88380"
FT                   /db_xref="GOA:Q6AER0"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AER0"
FT                   /protein_id="AAT88380.1"
FT                   /translation="MTIIPDTGKQPQSRTSVFAGVDTHKEIHVAAVVDETGTILGTHSF
FT                   STTRAGYRALLAWVRSQGALVRIGIEGTGSYGAGLARHLAKNEVTILEVDRPDRSDRRR
FT                   KGKDDDLDAINAARAALHERRTTIPKSKDGAVEALRILRVARAQAVRERRNTLQLLRMS
FT                   IVAAPDEVRDQVRNLTRMQLIRHLAAWRPDTSNATDPVVAYRVALKSFGRRYIELTDEI
FT                   VDLDDLINPIVESLAPQLLERVGIGIEVAGQMLVTAGDNPESMKSEAAFAMLCGVSPLP
FT                   ASSGMTQRHRLNRGGDRQANRALHLAVISRLRIDPRTKAYAAKKTAEGHSKMEIIRCLK
FT                   RYLAREVYFLLNPGIKHIAPNTKPRKIAA"
FT   gene            377904..378140
FT                   /pseudo
FT                   /locus_tag="Lxx03710"
FT                   /note="similar to transposase"
FT   gene            complement(379735..380019)
FT                   /locus_tag="Lxx03720"
FT   CDS_pept        complement(379735..380019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03720"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88381"
FT                   /db_xref="GOA:Q6AGW4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGW4"
FT                   /protein_id="AAT88381.1"
FT                   /translation="MILPQVIDALGLPVTSRVYLWMVGLAGIVTAIAAALTRIMAIPTI
FT                   NHWLTTIGLGTMKKPTPKPPPPHPPTRHRTPPPSHPQTPDTQHALAPAR"
FT   gene            380148..380603
FT                   /locus_tag="Lxx03730"
FT   CDS_pept        380148..380603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03730"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88382"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGW3"
FT                   /protein_id="AAT88382.1"
FT                   /translation="MFEAGEAFAEAVPGAGLFLVGGGAQPWLVAVVPALRAGGGRFPVA
FT                   FALDAADESSAAAVGDVAELRHVDMDQRSRVVVLVATEWLFVTWSLTSRASDAMCLTSR
FT                   RVRAPSTIEMTIAAIPPAAVTAAAINVAHPMGISAIASPLMGFGTGF"
FT   gene            complement(380600..381547)
FT                   /gene="lysL"
FT                   /locus_tag="Lxx03750"
FT   CDS_pept        complement(380600..381547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysL"
FT                   /locus_tag="Lxx03750"
FT                   /product="phage-related lysozyme"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03750"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88383"
FT                   /db_xref="GOA:Q6AGW2"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGW2"
FT                   /protein_id="AAT88383.1"
FT                   /translation="MAALLEGVDISYMQGDYTPAGEDFVIINASRANIGLTVGSCYRAQ
FT                   VAGAREAGKHVGHYFFNGNLDPVVCADFFIANLAYEVGDSLWLDVEAEPSTNTAAWDPA
FT                   QALAFLNQVKTRLGVVPGVYLNKSLMDGMDWSAVVAVGAPLWIASYNPPPPPIRWWPTW
FT                   TVWQYTSTPIDRNKAQTSLITAFTTPTLLEDDMRIQMIKTGDASGAIGTLNPDGTLDWL
FT                   TADEFQALTRTGLVEPVHAEGDGTVWGILASRTARLRAQQGGDPVALAKSVSALLVPAV
FT                   LAGIQANSGLSLTPEQVQAACETAIKDVFAHASA"
FT   gene            complement(381558..382043)
FT                   /locus_tag="Lxx03760"
FT   CDS_pept        complement(381558..382043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03760"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88384"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGW1"
FT                   /protein_id="AAT88384.1"
FT                   /translation="MDDAPALAEGHRLQRFSQFGNVCVELSFQRVGASAVWPSWPFPAG
FT                   RSRGYFGGVSVGMDILTITANSIGGVCMVDVAANVYNPNSGAARASGLRLVCDGVQIDD
FT                   IWQLDIPNPGGASSGVAGVVRAESTPGAGSHTWTFQANASAAASVAIRSAVITVQEV"
FT   gene            complement(383000..383269)
FT                   /locus_tag="Lxx03770"
FT   CDS_pept        complement(383000..383269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03770"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88385"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGW0"
FT                   /protein_id="AAT88385.1"
FT                   /translation="MAQGYKAPRDGMDALTGALSDQRERLRELERPTGTSIGSLVQQVQ
FT                   QTLANIVGQVNTIATRWMAANAYTRAQVDSQVASPGAINPTRAT"
FT   gene            complement(383269..384372)
FT                   /locus_tag="Lxx03780"
FT   CDS_pept        complement(383269..384372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03780"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88386"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGV9"
FT                   /protein_id="AAT88386.1"
FT                   /translation="MQDPDVQALDLRNTASKGKAFLGVVEDDTIKACGPIWTRSYNQPD
FT                   RTLQIGAKGLMSLFDHRLVIPLLAESLDVTQWTIPDLADNTKTIANPLLTTQYTAIWWG
FT                   TMAKRLVQQTLARTGGNLPIVFQADEIDGVADHTKTYLGVDFKPVGEALKQLTELQGGV
FT                   EINFAPRFTTDGLGVEWFMQTGTVAQPLIYAKSVSSWNVTVDDSPVSDFQIDEDGTMLG
FT                   SFSWGTGGRQADDVLVSRAYDSTLIDQGFPMMEIVDSSHSTVSIQSTLDKYAAQNAING
FT                   RGSEETWSFTVEARPTDDDGNPAGPWVNSYNVGDFCDITIAPYHPTTGVGDPYLTSGGT
FT                   FRRRIVSISADEKGETVKIKCVPEVVS"
FT   gene            complement(384942..385403)
FT                   /pseudo
FT                   /gene="tnp"
FT                   /locus_tag="Lxx03795"
FT                   /note="similar to transposase, ISlxx4"
FT   gene            complement(386201..386503)
FT                   /locus_tag="Lxx03800"
FT   CDS_pept        complement(386201..386503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03800"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88387"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGV8"
FT                   /protein_id="AAT88387.1"
FT                   /translation="MMVAIDSLVLPASPAESGTPGFWLVFLGDWDAVSESKSEIWERPQ
FT                   ADGSFAIAMDWRKSLTFSIKGAFLGAARSDVQAAKQLLKSTIRTRPISDRTRDGC"
FT   gene            complement(386503..388065)
FT                   /gene="26"
FT                   /locus_tag="Lxx03820"
FT   CDS_pept        complement(386503..388065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="26"
FT                   /locus_tag="Lxx03820"
FT                   /product="phage-related protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03820"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88388"
FT                   /db_xref="GOA:Q6AGV7"
FT                   /db_xref="InterPro:IPR007713"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGV7"
FT                   /protein_id="AAT88388.1"
FT                   /translation="MLGKIPILGDMLGGLAGPLKFLGGPIGILIGAFAGLIAVSPQLQQ
FT                   AFGVIGSQLAQTFGNLLTTLGPVIGQIGSALAVMAQTIGGVLANALLTVAPFLSQLVNI
FT                   LGGVLVAVLPSVVTLITQLSGIFSSLASALVPVVGAVLQALIPAFAGLGPIVGTIVSAL
FT                   VPLVSMLASALMPIFQAVAPIVGTLVKAIAPLIPIVLQLATSLAAQLMPIFAQLIPVLA
FT                   PIIPMIVNLVVELVGMLAPILQALAPVVSLADHRVHAVGWGAFAAVDGPVLRADADHPG
FT                   TVQCVPATTRPCVGSHPAVAAIGAVDHPAPGTGAAVPRQYHQRCSERRVRVSDPGHPVG
FT                   GADDLDVLQPIIKGITDVLGGVITFLTGVFTVNWSKAWDGIVQIFSGIWNGIVGIVKGV
FT                   INGIIDMVNGVIGGINGVAGVVKDATGGAINISVGKIPRLAEGGIVQAVPGGIMANIGE
FT                   GRYPEAVIPLKPGILSELGGQPASSREAPYMYVDKIVAPDNDPVVSGRIMGREFARVAA
FT                   GSI"
FT   gene            complement(388107..389075)
FT                   /locus_tag="Lxx03830"
FT   CDS_pept        complement(388107..389075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03830"
FT                   /product="phage-related protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03830"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88389"
FT                   /db_xref="InterPro:IPR013491"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGV6"
FT                   /protein_id="AAT88389.1"
FT                   /translation="MSEAAVAEVTIIPVSKGAQGQIEQQLGGDVVGQKVGARMGASLIS
FT                   SLGSILKGTGAAAVTTAATGIGVALTSGFARLNNIDVARAKLTGLGNDATTVDGIMANA
FT                   LASVKGTAFGLGDAATVEAGAVEAGIKPGQQLEGVLKSVANSAAASGSSLSDMGSIFNK
FT                   VASTGKAQNDVLQQVADRGIPIYSALASQLGTTADAVFDMASKGQIGFDQFQSAITAAS
FT                   GTVAQEMGKTVPGALDNFQASLSRIGAGALSGIFPQLAPLIIGITNAMGPLEGMAAKLG
FT                   DTIGARLAPAFESVAAFLNGANGGFAGLFRPSHQSPASSPH"
FT   gene            complement(389463..389849)
FT                   /locus_tag="Lxx03840"
FT   CDS_pept        complement(389463..389849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03840"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGV5"
FT                   /protein_id="AAT88390.1"
FT                   /translation="MVGGIGLRKIAELRQLWRRYQGPFVFELRRGGLTLDDIYRIPEET
FT                   AAYVSVAAAQPESPLHAAINNWEYPLSREGMLLLDLIDLQGAKSSKKNQWKPLPRPWQR
FT                   PERIGYTELSYDEAIALLKKNEGR"
FT   gene            complement(390183..390878)
FT                   /locus_tag="Lxx03850"
FT   CDS_pept        complement(390183..390878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03850"
FT                   /product="structural phage protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03850"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88391"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGV4"
FT                   /protein_id="AAT88391.1"
FT                   /translation="MVRAPLGTTGPTSASAALPASWNNLGYISKDGSTRTTDRSTNDIK
FT                   AWQNSALMRTVVTEASVSYKFVMLESRRATVALYFGTTVGGDGTFDVKPANTSGRQSFV
FT                   FDIIDGTDIRRVWIPEGEVVEVGDLTFDARDPTGYEVTIKAYASSIINGGVERVFNPGL
FT                   NDNSAAAPGMVFASDANITASDSANAAKLAGLGYAANPTSAWTTGQKITIGTYDFNWSG
FT                   TGWAAGTHA"
FT   gene            complement(391742..392080)
FT                   /locus_tag="Lxx03860"
FT   CDS_pept        complement(391742..392080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03860"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88392"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGV3"
FT                   /protein_id="AAT88392.1"
FT                   /translation="MSLTVTRTRMVDSGAKDRYLKPILKPVTSRFVAHVFAPVVTNDVT
FT                   GVDTVISSDGGTLYFRAPNTADALPNDRWTVRGTEYESEGVETVWNNIAGDPVGTVVVV
FT                   KRTEPTRG"
FT   gene            complement(392077..392511)
FT                   /locus_tag="Lxx03865"
FT   CDS_pept        complement(392077..392511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03865"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03865"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88393"
FT                   /db_xref="InterPro:IPR018963"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGV2"
FT                   /protein_id="AAT88393.1"
FT                   /translation="MPPASPTSSPPWRNRKGAVMFDLADVKDVVDRWRSLTPDEEQIAS
FT                   VLISDASDIIRVRWPDVDHRLEVGSLSTSTPVRIVANMVRRAMLNRGNEGVTQGTEVTG
FT                   PFTRSETYSNPNNNLYLSAEEVKALDPLGYGPRAKVGWLA"
FT   gene            complement(392794..393567)
FT                   /locus_tag="Lxx03880"
FT   CDS_pept        complement(392794..393567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03880"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88394"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGV1"
FT                   /protein_id="AAT88394.1"
FT                   /translation="MSGGAVQYETGEPIYTTDTPRAVTPGSEYPLTGAPTGVASIAKTV
FT                   KWGQDTIVTDESISRQKMQPVNRALTKLGNQNVKYVDSIALSAISSAVTQTTAAAAAWT
FT                   SATAAQIFKDVALAKANIVALNQGYEPDTVVVSDLAWANALSAFVASGYLSRENAAQNP
FT                   TLTGDFPVINGLRWLVTPNLPTANTALVLDSTVLGGMADENIGGPGYASTDGIGVEVKS
FT                   IREDENDQYRLRARRVTVPIVVEPAAGWKLTEIGT"
FT   gene            complement(393751..394119)
FT                   /locus_tag="Lxx03890"
FT   CDS_pept        complement(393751..394119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03890"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88395"
FT                   /db_xref="InterPro:IPR011231"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGV0"
FT                   /protein_id="AAT88395.1"
FT                   /translation="MAEYLPLQIPGKAFARQASAAITGVQLVVVSGSGTVAPAGAASAS
FT                   WLGVSGFDAASGDNVTVFSEGVQRIVASGGITAGALVEGAAGGKVAMHANGTNDYNVVG
FT                   LALSTAADGALVEVSLLR"
FT   gene            complement(394141..394698)
FT                   /locus_tag="Lxx03900"
FT   CDS_pept        complement(394141..394698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03900"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88396"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGU9"
FT                   /protein_id="AAT88396.1"
FT                   /translation="MSDPITPEVPTQQPVEAPAEVTPDPNPEAPKPTETVDFWKQKARE
FT                   QENRAKSNAEAARRLQEIEESQKSEAQKQADATAKAIRDAEEAKAETLRYKVAATHKVG
FT                   EDFFELLGSGDEETLTRRAQRLSTLLEAQQENEQLKAQIAALQAGKPIPTPSRPVATLK
FT                   PGATPQDAQTEGDLIYSSLFGE"
FT   gene            complement(394881..395309)
FT                   /locus_tag="Lxx03905"
FT   CDS_pept        complement(394881..395309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03905"
FT                   /product="phage-related protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03905"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88397"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGU8"
FT                   /protein_id="AAT88397.1"
FT                   /translation="MPQLTTKYGDIAATVSADWFDQERSLERVPGVFRADLAPVVAADA
FT                   VTKTVRYAAGGLFTENLTSTLGNLSLAAAKYALQPGRNTITHNAIRDNAGWARIPTGAK
FT                   TCAFCLVMASRGFVYGSASTAGQHDKYHGDCDCVAVPG"
FT   gene            complement(395410..396117)
FT                   /gene="5"
FT                   /locus_tag="Lxx03910"
FT   CDS_pept        complement(395410..396117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="5"
FT                   /locus_tag="Lxx03910"
FT                   /product="phage-related portal protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03910"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88398"
FT                   /db_xref="InterPro:IPR021145"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGU7"
FT                   /protein_id="AAT88398.1"
FT                   /translation="MLIQERINETTFEMLVAQYFQAFKQRYVLGWVPKDESEELKAGAA
FT                   RIWYLEEDPEEVKIDELDGGTITPYIDARNSAIRDFAAIGQVPAQALGIDGISNISDAT
FT                   LAGLEAAKNREGGEIMTSLGESHEQLMRLCALVDGNEAAADDYNSEIRWRNFEARSFSE
FT                   TVAVLVQLAGGLGIPTDALLSNIPGFTRQRIEQVEQMIRAQRSRTALDQLVALGRGGSS
FT                   NTNPAVSRATPSS"
FT   gene            complement(396180..396866)
FT                   /gene="5"
FT                   /locus_tag="Lxx03920"
FT   CDS_pept        complement(396180..396866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="5"
FT                   /locus_tag="Lxx03920"
FT                   /product="phage-related portal protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03920"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88399"
FT                   /db_xref="InterPro:IPR021145"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGU6"
FT                   /protein_id="AAT88399.1"
FT                   /translation="MALSKANALVALKTVLENQKLNEATRLERIHAALDVSPHRLFHPT
FT                   VQIPEDAPPLMRELARKSETNYLPLLVKTFSQVMKVDGYQTVTSDGADDTSDPWLWWQR
FT                   NRMDSRQTGLTRSAISYGAAYATVLPGIYGRGQQGPAISLYSPRKMTALYQDPEADEWP
FT                   MLAVAVDVAGDGSRIFSLFDEEFVYRFGDEMKSLQAVDGAELAIPYGTGSLQYIDQSEH
FT                   ELGIPR"
FT   gene            complement(397085..398182)
FT                   /pseudo
FT                   /gene="tpase2"
FT                   /locus_tag="Lxx03930"
FT                   /note="similar to transposase, ISlxx1"
FT   gene            complement(398320..399140)
FT                   /pseudo
FT                   /gene="tpase1"
FT                   /locus_tag="Lxx03950"
FT                   /note="similar to transposase, ISlxx1"
FT   gene            complement(399503..400588)
FT                   /gene="4"
FT                   /locus_tag="Lxx03960"
FT   CDS_pept        complement(399503..400588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="4"
FT                   /locus_tag="Lxx03960"
FT                   /product="phage-related terminase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03960"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88400"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGU5"
FT                   /protein_id="AAT88400.1"
FT                   /translation="MPPTSQMKRSTRKLSEVARHVVVPSGIVSTGWPAVEARIRDFGDE
FT                   FDVWQQGASKLILAKRANGDYAATIGGITLSIPRQVAKTYMVSRINIVALCTIFPNLTV
FT                   LWTAHRTRTSTKTFASLRGFVGRKSVAPFVRNVRAVNGEQEIEFTNGSVIMFGAREQGF
FT                   GRGFDEVDIEVFDEAQILTEKALEDMVAATNQSRFPAGALLFFMGTPPRPVDPGEAFKQ
FT                   RRREALLGGSDDAVYIECSADTDADPDDREQWEIANPSYPHRTPLKSMLRLRKNLPSDE
FT                   SWKREALGIWDTDQVGSRFISASRWADLEGIPDPDESPAYGVAFSQDGMRMSLGGAFKG
FT                   ESETVHVELLDRPMRAMSKAG"
FT   gene            complement(401956..402609)
FT                   /locus_tag="Lxx03970"
FT   CDS_pept        complement(401956..402609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03970"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88401"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGU4"
FT                   /protein_id="AAT88401.1"
FT                   /translation="MTDTDPLLAAVETLTKPVVGIAQKNEKTGRWERVHEVRQDPLLTQ
FT                   MREAVWPSGESNDGSALSASERMPLDSHMLIEYAKIATQITSWAATAGVKPSRNPITDL
FT                   NTWYRAVHRDRDFDPGWAIRQLNGWAHHMRRLLAKPKSFIIEAACPICGTTQWGDRIHG
FT                   GGMYPIKIEYVLDEDGRTPKDLSALCQFCKTVWDGRDSVMELHDELTEKGSLST"
FT   gene            complement(403074..403262)
FT                   /locus_tag="Lxx03980"
FT   CDS_pept        complement(403074..403262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03980"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88402"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGU3"
FT                   /protein_id="AAT88402.1"
FT                   /translation="MELKAWEANGKSRINLTVTNPTLATIIQRPKHTPEATGNPGWAAT
FT                   PTPDPWDNVPPADDTPF"
FT   gene            complement(403622..403984)
FT                   /locus_tag="Lxx03990"
FT   CDS_pept        complement(403622..403984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx03990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx03990"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88403"
FT                   /db_xref="GOA:Q6AGU2"
FT                   /db_xref="InterPro:IPR005039"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGU2"
FT                   /protein_id="AAT88403.1"
FT                   /translation="MENVRLAPRAGAWDAIVSAAGDYSVGDAAKILSRAGVPTGPQRLF
FT                   AQLEGIRWVYRGGDGKWRAYAERVEKGYLAEKAQFHHHPATGDLVLDAPQVRGTVKGVD
FT                   RLRQRLHVGALTAVTA"
FT   gene            404065..404502
FT                   /pseudo
FT                   /gene="trbB"
FT                   /locus_tag="Lxx04000"
FT                   /note="similar to type IV secretion ATPAse"
FT   gene            404648..405418
FT                   /locus_tag="Lxx04010"
FT   CDS_pept        404648..405418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx04010"
FT                   /product="integral membrane protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04010"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88404"
FT                   /db_xref="GOA:Q6AGU1"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGU1"
FT                   /protein_id="AAT88404.1"
FT                   /translation="MARAVSAGERPGDALALVSVRAGPAVRTVAAAWQVAEAAGAALSP
FT                   VLRGAGASLRDRAETAREVEAALSGPRATSRLMTALPLVGLLMAAGLGIDVLGAITGSL
FT                   IGWGLLVAGVGLTFAGRAWMSRLVRSATATGPVAGIGLDLMGAALAGGLSVPGARRLIG
FT                   EVRERAGLDTGDDHVLDRVLRIEERAGAPVADLLASASRQERRSARVEGRARAATLAVR
FT                   LLLPLGVCVLPAFLVLGVAPVILAMISSTVIGLR"
FT   gene            405500..405679
FT                   /locus_tag="Lxx04020"
FT   CDS_pept        405500..405679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx04020"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04020"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88405"
FT                   /db_xref="GOA:Q6AGU0"
FT                   /db_xref="InterPro:IPR025338"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGU0"
FT                   /protein_id="AAT88405.1"
FT                   /translation="MREFTNRLINEERGASTAEYAVTTMAAVGFAGLLLVLLRGDEVRG
FT                   ILSELVRRALTVAG"
FT   gene            405696..406004
FT                   /locus_tag="Lxx04030"
FT   CDS_pept        405696..406004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx04030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04030"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88406"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGT9"
FT                   /protein_id="AAT88406.1"
FT                   /translation="MTAEFAAALPAVIVGLGLCIAGVQAVAQQAVLTDRAAVTARLLGR
FT                   GDVPPDPPGGQTSTTEREKGMVCVRMSAPVAAIGLGGLGPAVNARACALDESAVEGP"
FT   gene            406190..406480
FT                   /locus_tag="Lxx04040"
FT   CDS_pept        406190..406480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx04040"
FT                   /product="membrane-spanning protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04040"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88407"
FT                   /db_xref="InterPro:IPR021202"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGT8"
FT                   /protein_id="AAT88407.1"
FT                   /translation="MAVVVLGLLVMAVCGALAAQRRAGVAADLAALAAPDIAIGRLPGE
FT                   PCEVARSVARANGAVVSSCAMTEAVALVTVQVGYAGITASASARAGPAGTP"
FT   gene            complement(406514..406765)
FT                   /locus_tag="Lxx04050"
FT   CDS_pept        complement(406514..406765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx04050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04050"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88408"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGT7"
FT                   /protein_id="AAT88408.1"
FT                   /translation="MAPTSTTTYTAKLLDGPLEGKTIAMTFLDEDGLRPRLELPSTTAG
FT                   KRFVYVRAASAEVEFAPGDARTPLPSAAAYRYVETVFD"
FT   gene            406905..409847
FT                   /gene="topA"
FT                   /locus_tag="Lxx04060"
FT   CDS_pept        406905..409847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topA"
FT                   /locus_tag="Lxx04060"
FT                   /product="DNA topoisomerase I"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04060"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88409"
FT                   /db_xref="GOA:Q6AGT6"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGT6"
FT                   /protein_id="AAT88409.1"
FT                   /translation="MWAALAAIEAALGGGATARSSNRSCVQILARSKVPATKKLVIVES
FT                   PNKMKSIAQYLGDGYEVMASVGHIRDLIEPKNLPPELKKGSLGKFSVDVENEFEPYYVV
FT                   SDQKKKTVADLKRALKDADELLLATDEDREGEAIAWHLVEVLKPKVPVKRMVFHEITRE
FT                   AIEKARDNTRQIDTALVDAQETRRILDRLYGYEVSPVLWRKVGPGLSAGRVQSAATRLV
FT                   VDRERERLAFVAASYWGLTAELAPEEAPSFGARLARVDGDRIATGRDFDDHGRLTSGAR
FT                   TLDEVAAQELTEAVRKPSTVVSVAKVDSKPYSRRPAAPFTTSTMQQEAARKLRFSARQT
FT                   MSVAQSLYENGYITYMRTDSASLSQQATNAARAQAAKLYGPETVPEKPRVYTSKSKNAQ
FT                   EAHEAIRPSGETFRTPAELEKSLRGPELRLYDLIWKRTVASQMADAKGQTASVTVEAAI
FT                   AEGQLEGTVAEFTESGTVITFRGFLGAYEEGRDEERNASDTGESKLPPLTAGQTLSVQE
FT                   VAADGHETTPPPRYTEASLVKSLEELGIGRPSTFASIISTIIDRGYVTQRGQALVPSWV
FT                   AFSVVRLLEDYFGDLVQYDFTAEMEDDLDRIAGGVAARVDWLNSFYFGSDKHMGLRRVI
FT                   DNLGEIDARSINSIAIEDGVTLRIGKYGPYLELTEPAATEGTSPRRVTIPPELAPDELT
FT                   PAKARELIEAPVQTDRVLGTNPANGKLVLAKDGRFGPYVTEADPEEPEADQRTGEVIEA
FT                   RKPAKKAAAPKQRTASLFKSMDLASVDLDTALRLLDLPRVVGVDPESGDEIQAQNGRYG
FT                   PYLKKGTDTRSLPGEDDIFAVDLVGALDLFAQPKYGNRRVSSALKEFDPDPVSGKPIKV
FT                   KDGRFGPYVTDGETNATIPRGETVDEVDFERAVQLLADKRVKGPAKKTASRASAAKKTT
FT                   AKPAAAKKTAAATSAAATSTAEKTTAAKKAAAAAKTTASTAAEPTAADAE"
FT   gene            409844..410476
FT                   /gene="tmk"
FT                   /locus_tag="Lxx04070"
FT   CDS_pept        409844..410476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="Lxx04070"
FT                   /product="thymidylate kinase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04070"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88410"
FT                   /db_xref="GOA:Q6AGT5"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AGT5"
FT                   /protein_id="AAT88410.1"
FT                   /translation="MSVPTNRPGLFITLEGGDGVGKSTQAALLERWLLGLGRAVVRTRE
FT                   PGGTDLGAEIREIVLHRRGDIAPRAEALLYAADRAHHVATVVRPALERGEVVLQDRYLD
FT                   SSVAYQGAGRVLDAGEVRELSLWAAEGLLPDLTILLDLDETTARARLGSARTRYDRLEA
FT                   ERSEFHARVRAAYLALAAEPQRFLVVDASRPVEEIAAEIRCRLDGRV"
FT   gene            410517..411707
FT                   /locus_tag="Lxx04080"
FT   CDS_pept        410517..411707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx04080"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04080"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88411"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGT4"
FT                   /protein_id="AAT88411.1"
FT                   /translation="MAVWDELMGQDDAIAVVRAAAESVTAPGAVEQAAPGMTHSWLITG
FT                   PPGSGRSNLAFAFATALLSPGTPEADRTARRQVEARTHPDLTVLSTERVIISIDEVRSL
FT                   VSGSQFAPSVARFRVMIIEDADRMTERTSNVLLKALEEPPERTVWILCAPSEADLLPTI
FT                   RSRVRTVRLKAPGVADVAELIRRRDGVDAETAERAARHAQSHIGMAHRLATNAEARQRR
FT                   ERTLQLALGVRSVSGAVLAAAEMLEIAGADAKAITEERDAQEREHALRSLGLEPGAAIS
FT                   PALRVQLRQLEEDQKRRAKRSLRDGIDRILTDLLSLYRDVMMVQLDGGIGLVNTELGGE
FT                   LGTLSARTTPAATLAAMDAVATARQRIDANVAPALALEAMLTAILRGQAVRKGTDQ"
FT   gene            411704..413260
FT                   /gene="slpE"
FT                   /locus_tag="Lxx04090"
FT   CDS_pept        411704..413260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slpE"
FT                   /locus_tag="Lxx04090"
FT                   /product="peptidase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04090"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88412"
FT                   /db_xref="GOA:Q6AGT3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGT3"
FT                   /protein_id="AAT88412.1"
FT                   /translation="MTTRPGRVSRRGAARTSFVAIAAVVALTLSGCVTWFLPARAPRTS
FT                   TPAAESVPAALQPFYSQRLTWSGCASGMQCSTAKAPLDWNDPGAGEVELALIRKPAKGA
FT                   KQGSLLVNPGGPGGSGYDFVKDSVDHAADSTLQELFDVVGFDPRGVGRSSAVKCYGAAQ
FT                   MDDYLYGITPGTRGSDQWIAENIALSKSFGAACEKNTGALLDHVDTVSAARDLDLLRAA
FT                   LGDKKLNYFGYSYGTYLGAVYAGLYPGKTGRLVLDGALDPAVSNFDVTKVQAEGFESAL
FT                   RAYLKDCLTQRGCPFTGTAEEGMQTVSDLLASVEKSPICNGDGRMLGANALVTAIIYPL
FT                   YNATAWSYLSKMFESVMKGSAAVAFTLADAYNNRSKDGTYSGNSTEAFSAINCLDYVYD
FT                   ADPARMRAQAAELARAAPVIGPYMSYGDIGCANWPYKPVVERGPIAAKGSAPILVVGTT
FT                   NDPATPYVWAKSLAGQLENGRLLTYKGEGHTAYNKSNSCVNDTVDSYLVNGLLPANGKT
FT                   C"
FT   gene            413324..414064
FT                   /locus_tag="Lxx04100"
FT   CDS_pept        413324..414064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx04100"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04100"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88413"
FT                   /db_xref="GOA:Q6AGT2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGT2"
FT                   /protein_id="AAT88413.1"
FT                   /translation="MTAAPEPVVEGELGLREHKRIATRRAIQLAAIQLASERGFDRVTV
FT                   DEISHAANVSPRTFFNYFPSKEPAIVGELPELPDEASIDRFVAAGPEESLLEGIGQLLI
FT                   AAITTGELGDPALPGAMSASVQELHIRRRALLKDNPELFAQRLASMHQFEDVLSVVVQR
FT                   RLSCDDLALAAGPEALNQRARLVTYVAFAGIAARLVLLDRPRWRRTAQRPAPQLFRAGA
FT                   DARDAAPLTPGRPPSLSRGPLGIG"
FT   gene            414101..414179
FT                   /gene="Thr"
FT                   /locus_tag="Lxx04110"
FT   tRNA            414101..414179
FT                   /gene="Thr"
FT                   /locus_tag="Lxx04110"
FT                   /product="tRNA-Thr"
FT   gene            414343..414510
FT                   /locus_tag="Lxx04115"
FT   CDS_pept        414343..414510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx04115"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04115"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88414"
FT                   /db_xref="InterPro:IPR021558"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGT1"
FT                   /protein_id="AAT88414.1"
FT                   /translation="MRESGYRPVQLWVPDVRTESFVNEAHRQSSVVAAADRQADDQAFI
FT                   EAVSVTWDDE"
FT   gene            complement(414958..415230)
FT                   /locus_tag="Lxx04120"
FT   CDS_pept        complement(414958..415230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx04120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04120"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88415"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGT0"
FT                   /protein_id="AAT88415.1"
FT                   /translation="MALDLLVLVRDGKVAGVKLDARVATGDLSDCYKLYFDPDGVGRPR
FT                   FRLVYRYTPDEIAAVAIEAVAVGRRANLDAYTRTMTNRSRDTDSR"
FT   gene            complement(415311..415604)
FT                   /locus_tag="Lxx04130"
FT   CDS_pept        complement(415311..415604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx04130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04130"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88416"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGS9"
FT                   /protein_id="AAT88416.1"
FT                   /translation="MAIPHASPVLPTNEARVALPKALARFRKRGALAEPVVFGAQRRPE
FT                   GVMIPFELYEELLPVIEDVEIAHLVRERAATGEAVPLADVAAAIGLNADDYR"
FT   gene            416091..417509
FT                   /gene="pbp"
FT                   /gene_synonym="dacB"
FT                   /locus_tag="Lxx04140"
FT   CDS_pept        416091..417509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbp"
FT                   /gene_synonym="dacB"
FT                   /locus_tag="Lxx04140"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /note="penicillin binding protein; identified by sequence
FT                   similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04140"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88417"
FT                   /db_xref="GOA:Q6AGS8"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGS8"
FT                   /protein_id="AAT88417.1"
FT                   /translation="MMTAIRKHPKAWMIAAAAVVFVGLGMGTVTLGATLGPAPVAAGSA
FT                   EEAGADGEKTPATPTAAPARPVPAVQPAAARLRTCSVASLAQDRRLGNLEAQVVNAKTG
FT                   EVLFDRNGSKPAPTASVLKTLTAAAALATLGPDHRVQTTVLAGSAPGQIVLVGGGDVTL
FT                   SRLPGGRGAFYTGAPSIQDLAKQTQQALGGQPVTSIVVDTSLFGGPVWQPSWDERQERV
FT                   VEGSTPYMTALMVDGDRDNPAVVESPRSTDPIARAVRYFQEYLETDAPVSSGTAPAGAQ
FT                   QLAAVQSQPVTALIEQAMKYSDNTIMEELARLVAIKTGTGNTFDAENAGVLAGLKTYGI
FT                   DTAGIHIADGSGLSADNAVPPSYLTRLFVKVLNREKGLGVVYDGLPISGQTGTLGPSYN
FT                   RFTGSSSAARGAVRAKTGWIDNGYTLSGVVDSADGTPLTFAVFALGPVSANAKQAIDAL
FT                   VTGFYRCGDNLSNS"
FT   gene            418793..421049
FT                   /pseudo
FT                   /locus_tag="Lxx04160"
FT                   /note="similar to multidrug efflux membrane protein"
FT   gene            421228..422406
FT                   /pseudo
FT                   /gene="fadA"
FT                   /locus_tag="Lxx04180"
FT                   /note="similar to 3-ketoacyl-CoA thiolase"
FT   gene            422447..423208
FT                   /gene="fadB"
FT                   /locus_tag="Lxx04210"
FT   CDS_pept        422447..423208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadB"
FT                   /locus_tag="Lxx04210"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04210"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88418"
FT                   /db_xref="GOA:Q6AGS7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGS7"
FT                   /protein_id="AAT88418.1"
FT                   /translation="MQIDGCSALVTGGASGLGAATARALTAAGARVVLLDLPRSEGEKA
FT                   ANALGPAARFVVADVADEGQVQAAVAAACALGPLRVFVNCAGIATAQKVIGRDGVLPLE
FT                   SFERVVRVNLIGTFNVIRLAAAAMAETSPLGEERGVIVKTASVAAFEGQIGQSAYSASK
FT                   GGVAALKLSLAREFARSLIRVVTIAPGLFETPMMAGLPQAAQHSLAAQVPHPSRLGRPG
FT                   EYAQLVLAILANPMLNGETIRLDGGIRMQPR"
FT   gene            423269..424231
FT                   /locus_tag="Lxx04220"
FT   CDS_pept        423269..424231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx04220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04220"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88419"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGS6"
FT                   /protein_id="AAT88419.1"
FT                   /translation="MMQREYTTGGHYVIVGGEGAVFCSADTPADIVKRLYGALVDERGA
FT                   EGVMRAILALDHSAISSLGVVVRGAETWHVLVAGVAEAVVFSAGEERSIHAPDVLTWSE
FT                   VTVARADAFRLGEVGAPFDAGDALPFEGGVVRADVLSVVLTETGSDAPAPAEMGAGKPG
FT                   AAKPVAVESAGGELAATVAAASAFAASPVASAPLPGDDPAIGPAPGAHIVLSTGRVIEL
FT                   DRPVLFGRAPRPSIRPELSGPRLVTLPRASADVSRTHLLVDVADGLVAATDLGSRNGTV
FT                   VTRPDGESVRLAGGEKAFLERGARFELGDGVYGTVEFSR"
FT   gene            complement(424253..425707)
FT                   /gene="hipB"
FT                   /locus_tag="Lxx04230"
FT   CDS_pept        complement(424253..425707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hipB"
FT                   /locus_tag="Lxx04230"
FT                   /product="transcriptional regulator"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04230"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88420"
FT                   /db_xref="GOA:Q6AGS5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGS5"
FT                   /protein_id="AAT88420.1"
FT                   /translation="MDPLAADPVADTATLGHRIRHFRTQRGLTLDELGGAASVAASQLS
FT                   LIDNGKREPRVTLLAGIAAALGVPVSDLLSAEPPDERAALEIELARAERSTLYGSLGLP
FT                   AVKPTKGTPTETLRALVGLHRELGRRASEAIATPEEARRANTELRERMRRQHNYLPEIE
FT                   ALAEERVRASGHTRGALTHREVSVMAKQLGFELIYASDLPHSTRSITDLENGRIYLPPA
FT                   SIPGGHGLRSMALQAMAHRLLGHERPAHYADFLRQRLEINYYAACCLMPREAAVAFLDQ
FT                   AKREKELAVEDFRDAFGVTHEAAALRLTNLATSHLDMTLHFLRVGDDGTLYKSYENDGL
FT                   PLPADVTGSIEGQVVCRKWGARTAFTHTNRTTELYQYTDTPAGTYWCATQVGSTADGGF
FT                   SISVGVPFDQAKWFRGRETAIRTKSRCPDESCCKRPGAELSGRWAGKAWPSARLHTHIL
FT                   SPLPSGSFLGVDDSDVYRFLEVHSAL"
FT   gene            425887..427725
FT                   /gene="pckG"
FT                   /locus_tag="Lxx04240"
FT   CDS_pept        425887..427725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pckG"
FT                   /locus_tag="Lxx04240"
FT                   /product="phosphoenolpyruvate carboxykinase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04240"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88421"
FT                   /db_xref="GOA:Q6AGS4"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AGS4"
FT                   /protein_id="AAT88421.1"
FT                   /translation="MTAPPRPTAPPGAAALTGLAALHAWVDELAALLQPDGIVWCDGSR
FT                   GQTDRLTKQLVAEGKLIRLNPEWRPNSFLSRTDPSDVARVEDRTFICSLDEADAGPTNN
FT                   WREPEGMRAELREAFAGSMRGRTLYVVPFSMGPIGGPLSQLGVQLTDSAYVAVSMGIMT
FT                   RVASAVLDLIAAGQPWVPTVHSVGAPLVDEAGVRQEDVAWPCNPVKYIVQFPETREIWS
FT                   YGSGYGGNAILAKKCFALRIASVMARDEGWLAEHMLIVKVTSPEGRVFHFAAAFPSSCG
FT                   KTNLAMLKPSIPGWTVETVCDDIAWLRPGPDGRLRAINPEAGFFGVAPGTGELTNKTAV
FT                   EALWGNTIFTNVALRDDGDVWWEGLTAEPPAHLIDWEGNDWTPASGRPAAHPNSRFTVS
FT                   AAQCPVIADEWDVVDGVPIDAILFGGRRATNVPLVAQARDWKHGVFIGATISSEQTAAA
FT                   EGTVGELRRDPFAMLPFCGYNMADYWAHWLRMGEKLGADAPAIFQVNWFRKGDDGRFLW
FT                   PGFSENARVIEWIARRVEGSAGAEETAIGRLPLADELDLDGLGLPAEDLAALFDIDTER
FT                   WLAECALTEQYFARFGPRVPPALTAELASLRDKLRA"
FT   gene            complement(427870..429792)
FT                   /locus_tag="Lxx04250"
FT   CDS_pept        complement(427870..429792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx04250"
FT                   /product="ABC transporter, NBP/MSD fusion protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04250"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88422"
FT                   /db_xref="GOA:Q6AGS3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGS3"
FT                   /protein_id="AAT88422.1"
FT                   /translation="MSSDTTSAPRRRSPFARRGKEDGPRARFSQLFPYLLEHRGALSFV
FT                   VVLSVLGAAASLAQPLLVSQVITVVGKGEPLGALVWGLVALVVAAGLISGYQHYLLQRT
FT                   GEGVVLSSRRKLVARMLRLPISEFDTRRTGDLVSRVGSDTTLLRAVLTQGLVEAIGGSL
FT                   TFVGALIAMLIIDPVLLGLTVLVVAVSVVVVTTLSGRIRVASQKAQAKVGDLAAAVERA
FT                   IGSVRTIRAANATEREIAAVDEDATGAWKMGVQVAKISALVVPIAGIAMQVSFLVVLGV
FT                   GGFRVASGEITVANLVAFILFLFMMVLPLGQAFGAIAAVNSALGALGRIQEILDLPTED
FT                   QFDRDIAPLALTVGTANVSLDPDVPAIEFAEVVFAYPSASVARAKATEPDDAEPIARSG
FT                   AEAAAGGRDVPPGPRGGVLHGVSFSAPRGKRTALVGPSGAGKSTILALIERFYDPEAGE
FT                   VRFGGRDVRTLDRESLRSQIGYVEQDAPVLAGSIRDNLVLAAPHASDERCVEVLHAVNL
FT                   TEVLERSDEGLGAPVGEDGIMLSGGERQRLAIARALLAAPPVLLLDESTSSLDGRNEKL
FT                   MREAIDAVAEDRTLLVIAHRLSTVVDSDQIVVLDHGRVAGIGTHSELVASTPLYRDLAK
FT                   HQLLV"
FT   gene            complement(429901..431506)
FT                   /pseudo
FT                   /locus_tag="Lxx04260"
FT                   /note="similar to MFS family transport protein"
FT   gene            431664..432101
FT                   /locus_tag="Lxx04275"
FT   CDS_pept        431664..432101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx04275"
FT                   /product="photopigment and puc expression activator"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04275"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88423"
FT                   /db_xref="GOA:Q6AGS2"
FT                   /db_xref="InterPro:IPR007024"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGS2"
FT                   /protein_id="AAT88423.1"
FT                   /translation="MMSIAYVSEATAPMSEQGIVSLLKRARANNDVRQRTGALLYHEGR
FT                   FVQILEGPDEAVEECFEAICADPRHRSIQKISEEQIEQRRFAEWTMAFRPSSPEVTAHL
FT                   RGWDDFFSGRRGDARLRYAGNPSQQLLEWLTDYWFTPSALR"
FT   gene            complement(432251..432490)
FT                   /locus_tag="Lxx04290"
FT   CDS_pept        complement(432251..432490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx04290"
FT                   /product="transcription regulator"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04290"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88424"
FT                   /db_xref="GOA:Q6AGS1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGS1"
FT                   /protein_id="AAT88424.1"
FT                   /translation="MPVPEPDLSQLRRILNDRRHSTGLTFEQLAERSGISRQTLLNISS
FT                   GKYNGDLRTWLRLSKAFEVSQDDLLAPVWSDKER"
FT   gene            432431..433111
FT                   /gene="tnp"
FT                   /locus_tag="Lxx04280"
FT   CDS_pept        432431..433111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnp"
FT                   /locus_tag="Lxx04280"
FT                   /product="transposase, undefined"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04280"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88425"
FT                   /db_xref="GOA:Q6AGS0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGS0"
FT                   /protein_id="AAT88425.1"
FT                   /translation="MASVVQDAPKLREVGLGNRHRTSSAEPRLYTAQHLVLSVRVLCRR
FT                   VTAETRQDADMGFLSGKLYFCAIKDVCSGRVVGYSIDSRMKSLLAVQALENAVQVRGDV
FT                   AGCVVHSDRGSQFRSRKMLRALVRHRMVGSMGRVGSSGDNAAMESFFALLQKNVLNRRT
FT                   WITREQLRIAMVTWIERIYNRRRRQARLGRLTPIEFETIMNTTVATAAWLGVMSRGVVS
FT                   AIRS"
FT   gene            433284..433649
FT                   /pseudo
FT                   /gene="tnp"
FT                   /locus_tag="Lxx04285"
FT                   /note="similar to transposase, ISlxx4"
FT   gene            434868..436079
FT                   /gene="tnp"
FT                   /locus_tag="Lxx04320"
FT   CDS_pept        434868..436079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnp"
FT                   /locus_tag="Lxx04320"
FT                   /product="transposase, ISlxx5"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04320"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88426"
FT                   /db_xref="GOA:Q6AGR9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGR9"
FT                   /protein_id="AAT88426.1"
FT                   /translation="MQGRVPGAAEQRALAPRSGGTSRNQPEHGIPLGQSNGRRIYPDGR
FT                   VVDYKDRVPVVVDPVQRASMRSLEAALHPRFLSLQERELIRDLTRAGLSLCRVAAKLGR
FT                   SVSTISREIRRNQLPGEGGYHPYVAHRKAASRRPRPKATRLVRNPQLRSYVQRKLTLRW
FT                   SPEQISRSLIREFPGDAEMRVAHETIYQAFYVQGRGQLRRELTMVLRTGRAKRKPHRSG
FT                   AARRHRFADPMVMISDRPAEIEDRAVPGHWEGDLIIGGHRNSAIGTLVERSTRFVMLIH
FT                   LPIDRTAESVRDGLISAVKTLPRELRRSITWDQGSEMAAHKSFTIATDIPVYFCDPASP
FT                   WQRGSNENTNGLLRQYFPKGKGTDLARFTATDLTNVAHELNTRPRKTLGWETPAERLAK
FT                   LLAS"
FT   gene            436310..436738
FT                   /locus_tag="Lxx04330"
FT   CDS_pept        436310..436738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx04330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04330"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88427"
FT                   /db_xref="GOA:Q6AGR8"
FT                   /db_xref="InterPro:IPR018729"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGR8"
FT                   /protein_id="AAT88427.1"
FT                   /translation="METLFAVLHVVSAVFIVGPMAILPMTAMRAVRAGNAGQVEVLAKS
FT                   TNLIALLSVLVVFFGFGVMGLADKKYDLSVTTPWILWSIVLYAVALALTLFLVVPAMRR
FT                   AAAAIRSGEQSAYPVIAAGSGVASLLLVAVVVLMVWKP"
FT   gene            complement(436851..437327)
FT                   /gene="ribH"
FT                   /locus_tag="Lxx04340"
FT   CDS_pept        complement(436851..437327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="Lxx04340"
FT                   /product="riboflavin synthase, beta chain"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04340"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88428"
FT                   /db_xref="GOA:Q6AGR7"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AGR7"
FT                   /protein_id="AAT88428.1"
FT                   /translation="MSGAGAPGAAERIDGTGLRVVIVAGAWHEEIANGLIAGAERTLEA
FT                   AGASWSIARVPGSFELPVASKAALEAGADAVVALGVIIRGGTPHFEYVSAAATDGLTRV
FT                   ALNTGKPVGFGVLTLDDEAQGLDRAGLPGSTEDKGAEAAHAALATAVALRALRG"
FT   gene            complement(437324..438601)
FT                   /gene="ribA"
FT                   /locus_tag="Lxx04350"
FT   CDS_pept        complement(437324..438601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribA"
FT                   /locus_tag="Lxx04350"
FT                   /product="GTP cyclohydrolase II"
FT                   /note="identified by sequence similarity;
FT                   3,4-dihydroxy-2-butanone-4-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04350"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88429"
FT                   /db_xref="GOA:Q6AGR6"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGR6"
FT                   /protein_id="AAT88429.1"
FT                   /translation="MSLATIPEALAELRAGRPIIVVDNESRENEGDVVLAAELASQEWI
FT                   AWTVKNSSGFLCAPMTNEIADRLELPVMVATNEDTRGTNYTVSVDAADRLSTGISAGDR
FT                   AHTLRVLAGLDSTPSSLHRPGHILPLRAAEGGVRERDGHTEATVDLLKLAGMTPVGAIA
FT                   EIVSGDGEMMRLPGLIELGEREGILVITIEALIAYLQEFHCDRRLESPTPVPESSRVIF
FT                   EVETTVPTPNGPFRMRAYRDRMTGADHVAIVAGSPDPTGTLVRVHSECLTGEAFGSLKC
FT                   ECGPQLDAALETVQREGGVVVYLRGHEGRGIGLINKLRAYKLQEDGLDTLDANLALGLP
FT                   IDARDYGAATAILQDLGMRSVRLLTNNPEKVRQLEEHGIEVEERVALVVGVGAFNEGYL
FT                   ETKRDRMGHAIGEIYQTASAAERTTQ"
FT   gene            complement(438598..439221)
FT                   /gene="ribC"
FT                   /locus_tag="Lxx04360"
FT   CDS_pept        complement(438598..439221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribC"
FT                   /locus_tag="Lxx04360"
FT                   /product="riboflavin synthase, alpha chain"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04360"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88430"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGR5"
FT                   /protein_id="AAT88430.1"
FT                   /translation="MFTGIIEELGEIAAVDRTTDAARITVRGPLAVSDANHGDSISVSG
FT                   VCLTVIGWDADGFTADVMAETLAMSTLGDVAPGRRVNLERAARVGDRLGGHIVQGHIDG
FT                   TATVLSAEEGSAWRVVRLSLDPGIASLVARKGSIAIDGVSLTVSAVGGDRDDSWFEVSL
FT                   IPETLTATTLGERVPGDRVNIETDILARHVEQMLALAPTERSAS"
FT   gene            complement(439223..440248)
FT                   /gene="ribD"
FT                   /locus_tag="Lxx04370"
FT   CDS_pept        complement(439223..440248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="Lxx04370"
FT                   /product="riboflavin-specific deaminase"
FT                   /note="bifunctional; identified by sequence similarity;
FT                   riboflavin-specific reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04370"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88431"
FT                   /db_xref="GOA:Q6AGR4"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGR4"
FT                   /protein_id="AAT88431.1"
FT                   /translation="MTWEDPMRAALRLAANGPAAGVNPRVGCVLLDADGRTIAKGFHRG
FT                   AGTPHAEADALGKLPEGGARGTTAVVTLEPCNHWGRTGPCSEALLDAGVARVVYGIADP
FT                   GERSRGGAERLRQGGVEVTGGVLAAEIEEFLDDWLTVARLGRPHITVKWASSLDGRTAA
FT                   ADGTSRWITGTAARQRVHEQREASDAIVVGTGTVLADDPSLTARGDAGELLPRQPTPVV
FT                   VGTRAVPGDAAVFRHPQPVIVEKTHDLVEVVADLHQRGFRRVYVEGGPTLSGAFVAAGL
FT                   VDEYAIYLAPSLLGGPQLALGDIGVTTIGEQRRLRLLNVERLGGDLHLRAVPVPAPDQE
FT                   G"
FT   gene            440589..441209
FT                   /locus_tag="Lxx04380"
FT   CDS_pept        440589..441209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx04380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04380"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88432"
FT                   /db_xref="GOA:Q6AGR3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGR3"
FT                   /protein_id="AAT88432.1"
FT                   /translation="MFYVCDFLKNIFGIRAVAGGGGALLGAALLLGAAPIPDPAPAPVQ
FT                   ARTIAGSPDDLSSKVCTGTAATHTQIETPDGVVPTVYALAGDTLDFYGETKACQNVITP
FT                   ADALEWGFTASEIAWTLRPAVGAAQPLGAGTVLKEGRDTVPNHQPGEPHADDGGRQRAT
FT                   VLRHPGSGGVAQWHGFLGDGDHGDPARGRPRPRTGQGGLRRRQ"
FT   gene            441929..442225
FT                   /locus_tag="Lxx04400"
FT   CDS_pept        441929..442225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx04400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04400"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88433"
FT                   /db_xref="GOA:Q6AGR2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGR2"
FT                   /protein_id="AAT88433.1"
FT                   /translation="MTTASRSGARSTPSERASASVAISAFIQAPIVTPNSPDAAGAPGS
FT                   ADGPAASLAANARGARDLAQKGLDIGLLSAATLAILAVGGSLLALFRKRRVRV"
FT   gene            442841..443617
FT                   /gene="glpF"
FT                   /locus_tag="Lxx04410"
FT   CDS_pept        442841..443617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpF"
FT                   /locus_tag="Lxx04410"
FT                   /product="glycerol uptake facilitator protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04410"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88434"
FT                   /db_xref="GOA:Q6AGR1"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGR1"
FT                   /protein_id="AAT88434.1"
FT                   /translation="MDNIGVDFLSELVGTAMLVLLGTGVVANVALIKNKGFNGGFLMVN
FT                   IGWGIAVFSGVVVAYNSGAHLNPAVTLGLVANGATEFGNKDAHTLVDVSFATIALFILA
FT                   QLIGAFIGAVFTWLAYKKHFDEEPEPANKLGVFSTGPAIRSYAWNLITEIIGTFVLVFV
FT                   VIAFGHQPGNNVGLAALGALPVALLVIGIGASLGGPTGYAINPARDLGPRLAHAVLPIK
FT                   GKGSSDWSYSWIPVVGPIVGGLLAGWLAIVLLPILM"
FT   gene            443702..445222
FT                   /gene="glpk"
FT                   /locus_tag="Lxx04420"
FT   CDS_pept        443702..445222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpk"
FT                   /locus_tag="Lxx04420"
FT                   /product="glycerol kinase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04420"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88435"
FT                   /db_xref="GOA:Q6AGR0"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AGR0"
FT                   /protein_id="AAT88435.1"
FT                   /translation="MAEYIVAIDQGTTSTRAIIFDKSGSIVSTGQLEHEQIFPKPGWVE
FT                   HNPVEIWNNTREVIGQALSKADLTRHDIAAVGITNQRETAVVWDKNTGEPVYNAIVWQD
FT                   TRTQPIVDRLAAEGGVERFKPIVGLPLATYFSGTKIVWILENVEGVRERAERGDLLFGT
FT                   TESWVLWNLTGGTDGGVHATDVTNASRTLFMDLETLSWRDDILDVFGVPKSMLPEIKSS
FT                   SEVYGAVESSSLLREVPVAGILGDQQAATFGQAAFDPGESKNTYGTGNFLIFNTGEEIV
FT                   HSKNGLLTTLGYKLGDGKPHYALEGSIAVTGSLVQWLRDNLGVISSAPEIEELAQTVED
FT                   NGGAYFVPALSGLFAPYWRADARGALVGLTRYVNKGHIARAALEATAFQTREVLDAVNA
FT                   DSGVDLTELKVDGGMIANNTLMQFQADILGVPVVRPVVAETTALGAAYAAGLATGFWEN
FT                   LDDLRKNWKEDRRWEPKMDAAERDRQLRLWKKAVTKTFDWVDDDVRNG"
FT   gene            445353..445802
FT                   /locus_tag="Lxx04430"
FT   CDS_pept        445353..445802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx04430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04430"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88436"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGQ9"
FT                   /protein_id="AAT88436.1"
FT                   /translation="MPRGTERRGRKGVVPMDINGIRIADTALLHVLAGLEPGTPVVFVS
FT                   DNATWAPAPALRWHESLESLATALARAVRISEEVPILGWLEEPMDDHAYESAFTVMSIA
FT                   AHSVNGRLRTVLLTAQEMNRALPEEALVIQAPGTGSAWTFALVTR"
FT   gene            complement(445852..446448)
FT                   /locus_tag="Lxx04440"
FT   CDS_pept        complement(445852..446448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx04440"
FT                   /product="acetyltransferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04440"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88437"
FT                   /db_xref="GOA:Q6AGQ8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGQ8"
FT                   /protein_id="AAT88437.1"
FT                   /translation="MTAAPVVLTGERVTLAAPTTDDIDRIVELCQDPEVSAWTTVPSPY
FT                   RRSDGEGFVTRMVADGWASGRVCIWGVRAEGALHGMAGLHDIHDGAAEIGFWLGREARG
FT                   RGYISEAVALVLDFAFAGAPAGLGLHRVVWHAIAGNAASAAIARSAGFRFEGTARLGIA
FT                   QGGVRRDRWQAGILADDPRAPAGDWPDATFVQLSL"
FT   gene            complement(446445..447458)
FT                   /gene="trpS"
FT                   /locus_tag="Lxx04450"
FT   CDS_pept        complement(446445..447458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="Lxx04450"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04450"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88438"
FT                   /db_xref="GOA:Q6AGQ7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AGQ7"
FT                   /protein_id="AAT88438.1"
FT                   /translation="MTDSPRLYSGMQPSADSLHLGNYVGALLQWKELQAAHDAFFSVVD
FT                   LHAITVAQDPHDLREKTRRTAAQYIAAGIDPSVSTLYVQSHVPAHAQLAWVLSTITGYG
FT                   EAARMTQFKDKSAKQGAEATSVGLFTYPVLMAADILLFDADVVPVGDDQRQHVELTRDL
FT                   AERFNSRFGETFVVPQAMILKDGARIYDLQSPESKMSKSADSGAGIVWLLDEPDIARKK
FT                   IMRAVTDTDGVVSYDRAGKPGVSNLLSIYSALSGRAIQQIELDYEGKGYGDFKKGLVEV
FT                   VVDALGPIRERTLELLADPAELDRILAGNAARAGEAAEITLAKAYEAIGFLQPTRR"
FT   gene            complement(447490..448326)
FT                   /locus_tag="Lxx04460"
FT   CDS_pept        complement(447490..448326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx04460"
FT                   /product="exodeoxyribonuclease III"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04460"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88439"
FT                   /db_xref="GOA:Q6AGQ6"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGQ6"
FT                   /protein_id="AAT88439.1"
FT                   /translation="MPSEHLRVATINVNGIRAAFRRGMGTWLDARDVDILAIQEVRAST
FT                   DDLLGLLGDEWDILHDPATAKGRAGVAIASRRRAVVHRAGLGPAGFDSAGRWLEADYEV
FT                   GGKAITVVSAYVHSGEAGTPKQADKYTFLDAVEARLPVLAAHSEHGVVLGDLNVGHRTL
FT                   DIRNWRGNVKRAGFLPEERAYFDRILGAEDEPGYNDGAGLGWVDVGRKWAGEVDGPYTW
FT                   WTWRGQAFDNDTGWRIDYQLATPALAATVTDYSVDRAASYAERWSDHTPVVVDYAL"
FT   gene            complement(448336..449516)
FT                   /pseudo
FT                   /locus_tag="Lxx04470"
FT                   /note="similar to conserved hypothetical protein"
FT   gene            complement(449594..449773)
FT                   /locus_tag="Lxx04490"
FT   CDS_pept        complement(449594..449773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx04490"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04490"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88440"
FT                   /db_xref="GOA:Q6AGQ5"
FT                   /db_xref="InterPro:IPR025241"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGQ5"
FT                   /protein_id="AAT88440.1"
FT                   /translation="MVCGHIAIGQIKRTGEGGRGLAIAGLVIGYAAIAFYTLLIIMTII
FT                   AAGIAASMDYTTSY"
FT   gene            complement(449936..450229)
FT                   /locus_tag="Lxx04500"
FT   CDS_pept        complement(449936..450229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx04500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04500"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88441"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGQ4"
FT                   /protein_id="AAT88441.1"
FT                   /translation="MTSTPSGGLLAKRGSDAATIWLGGLAGKNFQVTLTVDFMVDAEGR
FT                   LVARLNRNMAGGVLKGGAIGAAKTDAAFQETANAIAAALHTSGVLATDVAHH"
FT   gene            complement(450475..451236)
FT                   /gene="sdhB"
FT                   /locus_tag="Lxx04510"
FT   CDS_pept        complement(450475..451236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="Lxx04510"
FT                   /product="succinate dehydrogenase, iron-sulfur subunit"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04510"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88442"
FT                   /db_xref="GOA:Q6AGQ3"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGQ3"
FT                   /protein_id="AAT88442.1"
FT                   /translation="MSTAVLETPPAPEAPIPSFTVTLIIRRFDPEKDTEPRWQDFDVEL
FT                   YPTDRILDALHKIKWEQDGSLTFRRSCAHGICGSDAMRINGRNRLACKTLIKDLDISKP
FT                   IYVEAIKGLPLEKDLIVDMEPFFASYREVQPFLIANSTPPEDKERIQSVADRARFDDTT
FT                   KCILCAACTSSCPVFWTDGQYFGPAAIVNAHRFIFDSRDDNAQVRLDILNDKEGVWRCR
FT                   TTFNCTDACPRGIQVTQAIAEVKQAVMRGKP"
FT   gene            complement(451236..453038)
FT                   /gene="sdhA"
FT                   /locus_tag="Lxx04520"
FT   CDS_pept        complement(451236..453038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="Lxx04520"
FT                   /product="succinate dehydrogenase, flavoprotein subunit"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04520"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88443"
FT                   /db_xref="GOA:Q6AGQ2"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGQ2"
FT                   /protein_id="AAT88443.1"
FT                   /translation="MTTDTTESTVIDGVHYHEFDIVIVGAGGAGMRAAIEAGPHAKVAV
FT                   ISKLYPTRSHTGAAQGGMAAALANVEEDSWEWHTFDTVKGGDYLVDQDAAEILAKEAID
FT                   AVIDLENMGLPFNRTPEGKIDQRRFGGHTRDHGKAPVRRACYAADRTGHMILQTLFQNC
FT                   VKLGINFFNEFYVLDVIMNEVDGVDQPAGVVAYELATGELHVFHSKAIIFATGGFGKIF
FT                   KTTSNAHTLTGDGVGIIWRKKLPLEDMEFFQFHPTGLAGLGILLTEGARGEGAILRNAS
FT                   GERFMERYAPTIKDLAPRDIVARCMVQEVAEGRGAGPHKDYVLLDCTHLCAEVLETKLP
FT                   DITEFARTYLGVDPVVEPVPVMPTAHYAMGGIPTNVSAEVLRDNTTVVPGLYAAGECAC
FT                   VSVHGSNRLGTNSLLDINVFGKRAGTNAVEYAKTATAVPLPEDPAKNVRELIEGLRTST
FT                   GTERIAAIRKELQDEMDRNAQVFRTDESLEKVTGTIHTLRERYKNVVVQDKGKRYNTNL
FT                   LEAVELGFLLDLAEVVVYSARNRKESRGGHMRDDFPKRDDENYMKHTMAYLTGDPHSAD
FT                   AADHITLDWKPVVVTRYQPMERKY"
FT   gene            complement(453061..453504)
FT                   /gene="sdhD"
FT                   /locus_tag="Lxx04530"
FT   CDS_pept        complement(453061..453504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhD"
FT                   /locus_tag="Lxx04530"
FT                   /product="succinate dehydrogenase, membrane subunit"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04530"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88444"
FT                   /db_xref="GOA:Q6AGQ1"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGQ1"
FT                   /protein_id="AAT88444.1"
FT                   /translation="MTTIETPRTPARPARKGDNWEKWGWVYMRASGVVLVVLIFGHLLI
FT                   NLVLGDGVKQIDFAFVAGKYATPFWQVWDLLMLWLALIHGGNGMRTLVNDYTANATLNR
FT                   ILKGAIAAAVVVLIVLGTLVIFTFDPCPAGAAAGQLPSFCPAK"
FT   gene            complement(453506..453844)
FT                   /gene="sdhC"
FT                   /locus_tag="Lxx04540"
FT   CDS_pept        complement(453506..453844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhC"
FT                   /locus_tag="Lxx04540"
FT                   /product="succinate dehydrogenase, cytochrome b-556
FT                   subunit"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04540"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88445"
FT                   /db_xref="GOA:Q6AGQ0"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="InterPro:IPR039023"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGQ0"
FT                   /protein_id="AAT88445.1"
FT                   /translation="MWSWVLHRITGVAIFFFLLVHILDTSLIRVSPEAYNAVIGTYKNP
FT                   IMGLGEIALVAAIVFHALNGLRIILIDFWSKGVTYQKAMFWTVIALWVILMAGFVPVQL
FT                   THIFSEVK"
FT   gene            454092..454316
FT                   /locus_tag="Lxx04550"
FT   CDS_pept        454092..454316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx04550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04550"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88446"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGP9"
FT                   /protein_id="AAT88446.1"
FT                   /translation="MTQDEPVMDGSTEAADSAKMAGIVEQVRADLHLLPLEGSEKLLRE
FT                   RFGQAGLAVDDAEIGRIAREVQSGPSAVG"
FT   gene            complement(454351..455499)
FT                   /gene="manC"
FT                   /locus_tag="Lxx04570"
FT   CDS_pept        complement(454351..455499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manC"
FT                   /locus_tag="Lxx04570"
FT                   /product="mannose-1-phosphate guanylyltransferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04570"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88447"
FT                   /db_xref="GOA:Q6AGP8"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGP8"
FT                   /protein_id="AAT88447.1"
FT                   /translation="MSRAARYSFAMTTSPLDRFYGVIPAGGIGSRLWPLSRADAPKFLH
FT                   DLTGSGQTLLRDTWDRLAPLAGEQRIMVVTGRAHRAAVEAQLPALTDPNIVLESEPRDS
FT                   TAAIGLAAAILEQREPGVIVGSFAADHVIQNEPLFAAAVREAAAAADAGHIATIGIKPT
FT                   EAAVGFGYIQTGAALAVPGAPSALTVDSFVEKPDHATAERYLAGGRHLWNAGMFIARAS
FT                   RLLEEIGRSRPQLLAGLQELAAAWDNPATRGPAVDRIWPALEKIAIDYSVAEPAAAGGR
FT                   LAVIPGSFDWDDVGDFASLAKLNSGGRKSDLAILGEDARVLSDASSGIVVSQSKRVISL
FT                   IGVKDIVVVDTPDALLVTTSENAQRVKAVVDALKLTGSTDVL"
FT   gene            455541..456671
FT                   /pseudo
FT                   /locus_tag="Lxx04560"
FT                   /note="similar to glycosyltransferase"
FT   gene            456896..457864
FT                   /gene="corA"
FT                   /locus_tag="Lxx04580"
FT   CDS_pept        456896..457864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="corA"
FT                   /locus_tag="Lxx04580"
FT                   /product="metal ion transport protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04580"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88448"
FT                   /db_xref="GOA:Q6AGP7"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGP7"
FT                   /protein_id="AAT88448.1"
FT                   /translation="MVDSAIYADGVRVASPQTLAEIYRALDHTPGGVAWIGLYRPSEQE
FT                   LMSLAEEFNLHPLAIEDAIVAHQRPKLERYDTVLFVVLKAANYLDVPEQVDFGELHLFV
FT                   GPNFVITVRHSESPDLFTVRQRMERERDLLALGPQVVLYAIIDAVVDAYSPVVAGLAND
FT                   IDEIETQVFGGDALVSRRIYELSREVIDFQRATHPLFAVMVALERGSSKYGVTQELERR
FT                   LRDVADHLTQVNECVDGFRYLLRDILTVNSTLVSERQNEEMTRLAHYSRRQGEEVKKIS
FT                   SWAAILFAPSLIVGVYGMNFTHMPELEGRWAIRWRCSRCWG"
FT   gene            458160..459245
FT                   /locus_tag="Lxx04600"
FT   CDS_pept        458160..459245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx04600"
FT                   /product="surface lipoprotein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04600"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88449"
FT                   /db_xref="GOA:Q6AGP6"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGP6"
FT                   /protein_id="AAT88449.1"
FT                   /translation="MTITARKSALTGLVAAGVVALLAACGSAPSSSNSAGANSASLPCI
FT                   VSDQGGFNDRSFNQLGLEGVQEAAKKIGSSYKQVQSKSANDYLPNIKGLIQQGCSVIVA
FT                   SGFNLVAPVKEAAAANPKVNFVMVDDDSIKADNVKPVVFNTDEAGFLAGYAAASSSKTG
FT                   VIGTYGGQKLPSVTIFMDGIADGVKYYNQQKGADKKVIGWDLASQDGQFVNSFVDLNTS
FT                   KTIAQTMLGQNADVLAPIGGPIYQGAGAAIKDSGKDVTLIGNDADVYLTDQNGFNSLFL
FT                   TSIMKNIKPTVATVVEQAASGSAFDSSPYVGTLKNNGVGIAPFHDFASKIAPTLKSELD
FT                   KIKAGIVDGSIKVESPSAFAQ"
FT   gene            459328..460866
FT                   /gene="rbsA"
FT                   /locus_tag="Lxx04610"
FT   CDS_pept        459328..460866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsA"
FT                   /locus_tag="Lxx04610"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04610"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88450"
FT                   /db_xref="GOA:Q6AGP5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGP5"
FT                   /protein_id="AAT88450.1"
FT                   /translation="MKLELRGITKRFGALVANDRIDLTVEPGEIHCLLGENGAGKSTLM
FT                   NVLYGLYQADEGEILLDGEVQRFDGPGDAMKAGIGMVHQHFMLIPVFTVAENVMLGHEQ
FT                   TRFGGRLDLTAARAKVREISARFGFDVDPDALVEELPVGVQQRVEIVKALSRDAGVLVF
FT                   DEPTAVLTPQETDELMTIMKQLAASGTGIVFITHKLREVREVASRITVMRLGKVVGEAD
FT                   PEASNAELASLMVGRSVELSVRKGEPQLTGGVLRVRDLTVHDSAGAVLVDALNFDVRGG
FT                   EVLAIAGVQGNGQTQLTEALLGLQKRVTGSIELDGRELLGLSVRKILDSGVGFVPEDRN
FT                   VDGLVAEFSIAENLMLDRSSGPPFVKGANLQLAFRDTFAEEKVRQFDVRSQGIATRVGR
FT                   LSGGNQQKVVLARELSRELRLFVAAQPTRGLDVGSIEFVHERIVAARDAGVPVIVVSTE
FT                   LDEIIALGDRVAVMYRGGVVGIVPATTSREILGLMMAGEVPPAECLVETEGASA"
FT   gene            461103..462188
FT                   /locus_tag="Lxx04620"
FT   CDS_pept        461103..462188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx04620"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04620"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88451"
FT                   /db_xref="GOA:Q6AGP4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGP4"
FT                   /protein_id="AAT88451.1"
FT                   /translation="MQAALGYFFARPGDTFAAIGNAVGGAYSALFQGAVYNVNAPDVAT
FT                   GVQSLATTLTFATPLIAAGLGVALSFRVGLFNIGGQGQMLIAALFAGIVGFKLPMAPGV
FT                   HLLIAVAAGLVGAALWAAVAGVLKAYTGAHEVIVTIMLNYIALNLLNYLLTTSFLSAPG
FT                   ANDPRTPETLPTAVFPKLFGSGYSLDIGILFVILATVAVWWLLERSSLGFRFRAVGENP
FT                   NAARVAGMSVKSVYLWAMVISGALVGLAGATQVLGQITTGFGSDIDAGIGFSAITVALL
FT                   GRSRPFGVLIAGVLIGAFQAGGFAMQAADNVPVEVIAIIQSVTVLFIAEPPLVRAIFRL
FT                   PAPGAPSRTRRASRTKGAVAR"
FT   gene            462563..463480
FT                   /locus_tag="Lxx04630"
FT   CDS_pept        462563..463480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx04630"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04630"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88452"
FT                   /db_xref="GOA:Q6AGP3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGP3"
FT                   /protein_id="AAT88452.1"
FT                   /translation="MPVAGLLAAALGLSVPIIYGALGGVLSERVGVVNVAIEGQLLGGA
FT                   FTSAILATMTHSAVVGLIGAAVAGALVSFVLAAFSIKYLVDQVIFGIVLNVLVSGVTGF
FT                   FYTAVMANNTAAFNLPPTLPSLPIPLLSQIPVIGPVLFDQTFIVYAMYVAVAGVSFFLF
FT                   HTRWGLRVRAVGEHPKAADTVGVKVASTRFWTVLIAGAIAGFGGAYFTIGGVGGFVKDM
FT                   TSGLGYIALAAVIFGRWNPIRATLAALLFGFAAALQSLLDLLHAPIPSEFLRMLPYLVT
FT                   IVAVAGLVGISRGPAASGKPYIKS"
FT   gene            463477..463887
FT                   /gene="cdd"
FT                   /locus_tag="Lxx04640"
FT   CDS_pept        463477..463887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdd"
FT                   /locus_tag="Lxx04640"
FT                   /product="cytidine deaminase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04640"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88453"
FT                   /db_xref="GOA:Q6AGP2"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGP2"
FT                   /protein_id="AAT88453.1"
FT                   /translation="MTAVIDWEALRAAAREARAHAYVPYSRFPVGAAALVDDGRIVSGC
FT                   NVENASYGVTLCAECGLVSALAMSGGGRLIAFTCVNGDGDTLMPCGRCRQLLSEHAGEG
FT                   MMLETVSGLRTIDEVLPDAFGPRQLAEHRNND"
FT   gene            463900..465216
FT                   /gene="deoA"
FT                   /locus_tag="Lxx04650"
FT   CDS_pept        463900..465216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoA"
FT                   /locus_tag="Lxx04650"
FT                   /product="thymidine phosphorylase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04650"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88454"
FT                   /db_xref="GOA:Q6AGP1"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="InterPro:IPR018090"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="InterPro:IPR036566"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGP1"
FT                   /protein_id="AAT88454.1"
FT                   /translation="MTQTAGTVEAFDAVDLIRTKRDRGELRTAEIDWLVDAYTRGYVGD
FT                   EQMSAMAMAIFLNGMTRREIKDLTLAMIASGERMDFSGLGKPTADKHSTGGVGDKITLP
FT                   LMPLVAVFGVAVPQLSGRGLGHTGGTLDKLESIPGWRADLSNEEMFAQLRNEGGVICAA
FT                   GSGLAPADGKLYALRDITGTVEAIPLIASSIMSKKIAEGTGALVLDVKFGSGAFLKDIE
FT                   KSRELARTMVELGTDAGVATSALLTDMNVPLGLAIGNANEVRESFEVLAGGGPADVVEL
FT                   TVALAREMLALAGQPDADVEAALRDGRAMDKWREVIRAQGGDPEAALPVARETHTVLAA
FT                   EDGVLIEQQALPFGIAAWRLGAGRARRQDPLQHAAGIDLHAKPGDEIRAGQPLFTLSAD
FT                   EPARFERALEALDGAYRIAPAGTPFERGPIVAERIGRAR"
FT   gene            465218..466342
FT                   /gene="add"
FT                   /locus_tag="Lxx04660"
FT   CDS_pept        465218..466342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="add"
FT                   /locus_tag="Lxx04660"
FT                   /product="adenosine deaminase protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04660"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88455"
FT                   /db_xref="GOA:Q6AGP0"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGP0"
FT                   /protein_id="AAT88455.1"
FT                   /translation="MRGMSENETYALPDGTDIQALPKVSLHDHLDGGLRPVTVLELADA
FT                   AGVDLPAGDANSLGRWFVEKSNSGSLVEYLKTFDLTTAVMQTRESLIRVAREFVQDLGA
FT                   DGVVYGEVRWAPEQHLGRGLSLDETVEAVQEGIEQGIQDVYATGARIRVGQLVSAMRHT
FT                   DRSLEIADLAVRHRDDGVVGFDIAGPEAGFPPSNHRAAFDYLAAQFFPTSVHAGEADGL
FT                   GSIRSALFDGRALRLGHGVRLAEDITIERQDDENTYVTLGTLSQWVKDREIALETSPSS
FT                   NLQTGAIAAWGDGILDHPFDLLYQLGFRVLVNTDNRLMSGTTLTRELSVLADAFAYDRT
FT                   DLEIFQLNAAAAAFLPLEEREELAGIVTAGFEGS"
FT   gene            466367..466828
FT                   /locus_tag="Lxx04670"
FT   CDS_pept        466367..466828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx04670"
FT                   /product="phosphotransferase system
FT                   mannitol/fructose-specific IIA domain"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04670"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88456"
FT                   /db_xref="GOA:Q6AGN9"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGN9"
FT                   /protein_id="AAT88456.1"
FT                   /translation="MPLPPLPASAVTVGAHAADWREAVELAGAALARSGATQPGYTARM
FT                   VQVIEEFGAYIVIAPGLALAHARPGLDVNADGLAVVTLAEPVAFGHPHNDPVSVIIGLA
FT                   VSTPDAHVTSVAELANVFNDPDSIPALADASGVAEVQRILALSEGEATP"
FT   gene            466825..467097
FT                   /locus_tag="Lxx04680"
FT   CDS_pept        466825..467097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx04680"
FT                   /product="phosphotransferase IIB component"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04680"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88457"
FT                   /db_xref="GOA:Q6AGN8"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGN8"
FT                   /protein_id="AAT88457.1"
FT                   /translation="MKIVAICGAGVGTSGILKVNAERVLERLGIDADVAASDASNVATA
FT                   ASDAQIVLTSPELADRIGPTNADVIVVQNYFDLGELERKLSEALG"
FT   gene            complement(467194..468873)
FT                   /gene="cpsG"
FT                   /locus_tag="Lxx04690"
FT   CDS_pept        complement(467194..468873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpsG"
FT                   /locus_tag="Lxx04690"
FT                   /product="phosphomannomutase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04690"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88458"
FT                   /db_xref="GOA:Q6AGN7"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGN7"
FT                   /protein_id="AAT88458.1"
FT                   /translation="MSDTAQLLADARVWLEQDPDPETRRELEALLASAESGSAGAIADL
FT                   RSRFGARLAFGTAGLRGEIAAGPNRMNRVLVAQAAAGFARWLRENAGDGTPSVVIGYDG
FT                   RKNSAVFARDTAELMVGAGVRAVLLPRLLPTPVLAFAVRHLGTSAGVMVTASHNPRNDN
FT                   GYKVYLGGKSHGSQIVSPTDAEIAAHILDVARGSVAELPRSDRYEVAGEEVERDYIAAT
FT                   AAVASASAPRDAVSFAYTAMHGVGWRTAREVFARAGFAAPAVVTAQRDPDPAFPTVAFP
FT                   NPEEPGAMNLAFATAREAGADLVIANDPDADRLAVAIPDPASTDGYRRLSGNEVGALLG
FT                   WRAAELTAEEGGTLACSIVSSPALAAVAEAYRLGFANTLTGFKWVSRAPGLIFGYEEAL
FT                   GYLVNPQTLRDKDGISAATALLDLASSLAAEGRTIADQLDAFAERFGFFASDQISLRVS
FT                   DVSRIGEIMATLRATPPSTLGAVAVSRIDDLSDGLGDLPPNDVLRILLADGSRVMVRPS
FT                   GTEPKLKIYIDASSDEGTLAERRSTAAARVAALADAMRALTA"
FT   gene            complement(468870..469700)
FT                   /gene="deoD"
FT                   /gene_synonym="punA"
FT                   /locus_tag="Lxx04700"
FT   CDS_pept        complement(468870..469700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoD"
FT                   /gene_synonym="punA"
FT                   /locus_tag="Lxx04700"
FT                   /product="purine-nucleoside phosphorylase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04700"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88459"
FT                   /db_xref="GOA:Q6AGN6"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011268"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGN6"
FT                   /protein_id="AAT88459.1"
FT                   /translation="MPETLNPLEDPDTDPFEVAERAAEQLAEKTGVAKHDIALTLGSGW
FT                   GRAADLIGETVASVPATEIVGFGKPALEGHVGTLRSLRLGNGKHALVIGARTHCYEGHG
FT                   VRRVVHSVRTAAAAGAATMILTNGAGGIKETWKAGTPVLISDHINLTADSPLEGATFID
FT                   LTDLYSKRLRDLARTIDPSLDEGVYTQFRGPHYETPTEVQMAKTIGGHIVGMSTALEAI
FT                   AARQAGMEILGMSLITNLAAGIQKTPLSHQEVIEAGREAEPVIGALLARIVEAL"
FT   gene            469785..471221
FT                   /gene="lpdA"
FT                   /locus_tag="Lxx04710"
FT   CDS_pept        469785..471221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpdA"
FT                   /locus_tag="Lxx04710"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04710"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88460"
FT                   /db_xref="GOA:Q6AGN5"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGN5"
FT                   /protein_id="AAT88460.1"
FT                   /translation="MAYEFERKQRIAVLGGGPGGYEAAIAGAQLGADVTLIERSGVGGS
FT                   AVITDVVPSKSLIATAEATNSIAEAADLGVQFFSRDASGKPVRPEIAVNLAAVNKRLMG
FT                   LARQQSEDMRAELVRSGVRIVSGEGRLDGPGAVIVSTVRGDSGTDFDSVDADTIVVAVG
FT                   ARPRILSSAEPDGERILTWTQLYDLGAIPEHLVVVGSGVTGAEFASAYTALGSKVTLIS
FT                   SRDQVLPGEDADAASVIENVFKRNGMQVLSTSRAESVVRAGDGVVATLSDGRTVEGSHC
FT                   LMAVGSIPNTAGIGMQEAGVQLTPSGHIRVNRVARTSIPNIYAAGDCSDLLPLASVASM
FT                   QGRTAVFHAMGDAVNPIELRNVTSNIFTQPEIATVGWNQKQIEEGIAQGDIYKLPLKSN
FT                   PRAKMLGIRDGFVKLFARTGSGTVIGGVIVAPRASELIFPLALAVEHRLTVDQVARAFT
FT                   VYPSLSGSISDAARAMHIVL"
FT   gene            471229..473064
FT                   /pseudo
FT                   /locus_tag="Lxx04720"
FT                   /note="similar to Na+/H+ antiporter"
FT   gene            complement(473131..474891)
FT                   /gene="accC"
FT                   /locus_tag="Lxx04730"
FT   CDS_pept        complement(473131..474891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="Lxx04730"
FT                   /product="biotin carboxylase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04730"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88461"
FT                   /db_xref="GOA:Q6AGN4"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGN4"
FT                   /protein_id="AAT88461.1"
FT                   /translation="MPRISKVLIANRGEIAVRIIRAARDSGIGSVAVYADQDRDALHVR
FT                   LADEAYGLQGSTSAETYLVIDKLLSIARRSGADAVHPGYGFLAENADFARAVIAASLVW
FT                   IGPSPEAIERLSDKVSARHVAEKVGAPLAPGTLNPVADAAEVLDFANEHGLPVAIKAAF
FT                   GGGGRGLKVARARDEVAELFESATREAIAAFGRGECFVEKYLDQPRHVETQCLADAYGN
FT                   VVVVSTRDCSLQRRHQKLVEEAPAPFLTPEQLEKLSSASKAILKEVGYQGAGTCEFLIG
FT                   KDGTVSFLEVNTRLQVEHPVSEEVTGIDLVREQFRLAEGGELDGVDPAPRGHSFEFRIN
FT                   GEDAGRGFLPSPGPVHIFKAPSGPGVRVDSGVQAGDVISGAFDSMLAKLIVTGATREEA
FT                   LERSRRALDEFEVAGLPTVLPFHRAIVRDPAFAPQDGEPFSMYTRWIETEWAGGIEPWS
FT                   GELGDPSAAERRSNVVVEVEGKRIEVSLPARLLAGGSPEKTPPAPRRRGGGHAVDTATG
FT                   DALTAPMQATVVKVAVADGDEVVKGDLVLVLEAMKMEQPLTAHKDGTIAAINAAVGETV
FT                   SSGHPLLSIV"
FT   gene            complement(474971..475618)
FT                   /locus_tag="Lxx04750"
FT   CDS_pept        complement(474971..475618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx04750"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04750"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88462"
FT                   /db_xref="GOA:Q6AGN3"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AGN3"
FT                   /protein_id="AAT88462.1"
FT                   /translation="MRLYLASTSPARLALLRAAGIEPVVVPSQVDEPAAVAAAEAEHGP
FT                   LSPDAMVQLLARLKAEAVRGALDGEPIDGLVFGGDSAFAIDGALHGKPHRPEIARERWR
FT                   AQRGRTGRLHSGHWLIDHRGGVENAAVGATAVAAVSFADVTDAEIDAYIASGEPLEVAG
FT                   AFTIDSLGGPFIRRVEGDPSTVVGLSLSTLRDLVRQLRIEWTELWNRAGVSL"
FT   gene            475635..476183
FT                   /pseudo
FT                   /locus_tag="Lxx04740"
FT                   /note="similar to RNA methyltransferase"
FT   gene            476226..477623
FT                   /pseudo
FT                   /locus_tag="Lxx04760"
FT                   /note="similar to two-component system, regulatory protein"
FT   gene            477610..478884
FT                   /locus_tag="Lxx04770"
FT   CDS_pept        477610..478884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx04770"
FT                   /product="two-component system, sensor protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04770"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88463"
FT                   /db_xref="GOA:Q6AGN2"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGN2"
FT                   /protein_id="AAT88463.1"
FT                   /translation="MNGFSAPGPVSGAPPEGVKRRKPLSRARIERIADRTVSAFSLVFG
FT                   LQILPTALGQLGDLREPCAFVVLIIVFGGLALTVLFAIVQRFVKTAMGVLAIVYLVAIV
FT                   TWPLLVNDPAPFARDRPWVWFLCSVLTAFAAVAWPLWLATVYTFAAPVVYGFVRALPAG
FT                   GGASAELAGIDAVYAIILGGVILAIVTMMREASTAVDVAQGHALTKYSNAVRQHATEVE
FT                   RVQVDAIVHDSVLTTLLSAASARTPEAKELAARMAADAIGHLHAAEASGPQDQPPVGLD
FT                   VLHERLLAAAESSASHFVVEARDTARRTLPVAVAEAVSSAAVQAMVNSNQHAGGPEVRR
FT                   SVTIVGGAGGATVQVVVEDSGRGFVSAEVPAERLGLRVSIQERLAKVGGRATVRSAPGR
FT                   GTSVTIVWPSPEPASPPDRERETVR"
FT   gene            478881..479906
FT                   /locus_tag="Lxx04780"
FT   CDS_pept        478881..479906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx04780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04780"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88464"
FT                   /db_xref="GOA:Q6AGN1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGN1"
FT                   /protein_id="AAT88464.1"
FT                   /translation="MITLNRVLFLTLGAMFSAYHLFLGLSSLSIPDDPGPAIVAIALYA
FT                   VATAISLWPASPTRMPLWLAAFDLAVSVVVAVLVTSELDPAKDNVYATWYVAAIGTLMT
FT                   VCAVRRQRLVAWLGVAFLTVQTVIWAGVGALAGLGVIGSVVWVGVAVVISASLVRAGRD
FT                   ALRFGWAEREATEWQAAQEAHVMERQLRLRQTYRVAAPMLAEIVRRGGDLTEAERRECR
FT                   YLEGAIRDEIRGRRLLNEDVRREVMAARRRGVVVTLLDEGGIDDLDQAGLDTVLRRLAE
FT                   AIRGTTTDKLIVRTVPRSSETAITVIGLRMSGDGAANALGAESDDEVDLWLEISRPLPS
FT                   A"
FT   gene            complement(480799..481026)
FT                   /locus_tag="Lxx04790"
FT   CDS_pept        complement(480799..481026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx04790"
FT                   /product="hypotethical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04790"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88465"
FT                   /db_xref="InterPro:IPR032716"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGN0"
FT                   /protein_id="AAT88465.1"
FT                   /translation="MSEALDPSQLRFVTRRVTAEEIAAVTAVLTAAVAEQAAAARGSRL
FT                   AAGADGWQRSQRPLRTLLIPGLGQWRSFSG"
FT   gene            complement(481023..482645)
FT                   /gene="pccB"
FT                   /locus_tag="Lxx04810"
FT   CDS_pept        complement(481023..482645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pccB"
FT                   /locus_tag="Lxx04810"
FT                   /product="propionyl-CoA carboxylase beta"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04810"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88466"
FT                   /db_xref="GOA:Q6AGM9"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGM9"
FT                   /protein_id="AAT88466.1"
FT                   /translation="MTDTEARQPTGIAPAPDLATTAGKLADLKERFHEAVTASGQAAIE
FT                   KQHAKGKLTARERIDLLLDQGSFVEFDEFVRHRTQAFGMDGKRPYGDAVVTGVGTIHGR
FT                   SVAVFSQDFTIFGGSLGEVAGEKIIKVMDHALKMGVPMIGILDSGGARIQEGVVALGKY
FT                   GEIFRRNTAASGVIPQISIVMGPAAGGAVYSPALTDFVIMVDKSSHMFVTGPDVIKTVT
FT                   GEDVGFEELGGALTHNRVSGVSHYLASDEEDALDYARALLSYLPQNNLAELPVFEAEPE
FT                   LETTDADRKLNTIIPDSPNQPYDVTTIIAGIVDDGEFLEVQPLFAPNIVIGFARVEGSS
FT                   VGIVANQPSAMAGTLNIDAGEKASRFVRFCDAFSIPILTFVDVPGYLPGTDQEWTGVIR
FT                   RGAKLLYAYAEATVPLVTIITRKAYGGAYIVMGSKQLGADINLAWPTAEIAVMGGQGAV
FT                   NILYRGELKRAEDAGEDVAAVRAKLATEYTYNVASPFLAAERGELDGVIEPAATRVSVV
FT                   KALRALRTKRASLPPKKHGNIPL"
FT   gene            482683..483495
FT                   /gene="birA"
FT                   /locus_tag="Lxx04800"
FT   CDS_pept        482683..483495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="birA"
FT                   /locus_tag="Lxx04800"
FT                   /product="biotin acetyl-CoA-carboxylase synthetase"
FT                   /function="bifunctional transcriptional repressor of the
FT                   biotin operon/"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04800"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88467"
FT                   /db_xref="GOA:Q6AGM8"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGM8"
FT                   /protein_id="AAT88467.1"
FT                   /translation="MRKPYKYRASRWQTEPMETFRRSRAIVPLLDVLEEAGSTNDVMQA
FT                   RSGDLPDLAVVVTGNQTGGRGRLGRVWVAPPGKTLAISVLLKPEGLKPDAFGWFPLLAG
FT                   LAMRRALAGFVPREVEVKWPNDVLIDGAKVSGILTELLPGMRGVVVGAGVNLTVAGDEL
FT                   PVPTATSLLLAGATDPDTDAVLAAYLIELVVLYRDFLTAGGDAVRSALRGEVAAACHTI
FT                   GRAVRVELPGGGSLTGVAVALDDTGRLIVESDAGRTAVAAGDVTHLRY"
FT   gene            complement(484014..484613)
FT                   /locus_tag="Lxx04815"
FT   CDS_pept        complement(484014..484613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx04815"
FT                   /product="conserved putative integral membrane protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04815"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88468"
FT                   /db_xref="GOA:Q6AGM7"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGM7"
FT                   /protein_id="AAT88468.1"
FT                   /translation="MNAAARVLWRTHSLSFRIPGWSMTIQKTIPARTARLLPQLIKFGA
FT                   VGAVGLAVNLVVFNAMLLIVLRGVPHATVLSTVIATTAAIFANWAGNRFWAFSGQRQRN
FT                   ALREGAEFFTVSLAGMGIPLLCIGVSHYLLGLTSPIADNISANGIGLALGMLFRFAFYR
FT                   WWVFSPARGQRPPASALEPVAAAMLTRTPDRGLVGD"
FT   gene            484638..485807
FT                   /gene="purK"
FT                   /locus_tag="Lxx04830"
FT   CDS_pept        484638..485807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="Lxx04830"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04830"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88469"
FT                   /db_xref="GOA:Q6AGM6"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGM6"
FT                   /protein_id="AAT88469.1"
FT                   /translation="MRSIRGEVQAMARNRVGVIGGGQLARMMISPAVELGVDIRVLQEA
FT                   EGMSADLAASGVGDYRDLGAVLAFAETVDVVTFDHEHVPPAILRELVARGVPVHPGPDA
FT                   LLYAQDKIQMRSKLGDLGLPVPDWAAVETSGELAAFLDDHGGRAVVKTARGGYDGKGVR
FT                   LVSDANGADDWFLALAEDGLGGALLVEELVSFRRELAQLVARRPSGEVVAWPVVETVQR
FT                   DGVCAEVIAPAPGSAGRLAQAASDIARRIADGLGVTGVLAVELFETTDGRVLVNELAMR
FT                   PHNSGHWSIEGAVTSQFEQHLRAVLDLPLGAATAREDWSVMVNILGGPSEGTLQDRYPA
FT                   ALAAHPEAKFHGYGKAPRPGRKVGHVTVCGDDLDDIAYRARSAAAFFEG"
FT   gene            485874..486377
FT                   /gene="purE"
FT                   /locus_tag="Lxx04850"
FT   CDS_pept        485874..486377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="Lxx04850"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04850"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88470"
FT                   /db_xref="GOA:Q6AGM5"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGM5"
FT                   /protein_id="AAT88470.1"
FT                   /translation="MSVPPPPLVSVVMGSDSDWPVMQEASRLLAEFGVAHEVEVVSAHR
FT                   TPERMIGFGKVAASRGVRVIIAGAGGAAHLPGMLAAVTTLPVVGVPVPLARLDGLDSLL
FT                   SIVQMPAGVPVATVSIGGARNAGLLAVKILATADPRLASMLERFAAELEASVDEKNRAL
FT                   QAKL"
FT   gene            486374..486769
FT                   /locus_tag="Lxx04860"
FT   CDS_pept        486374..486769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx04860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04860"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88471"
FT                   /db_xref="GOA:Q6AGM4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGM4"
FT                   /protein_id="AAT88471.1"
FT                   /translation="MILATTPLRNPDAASAGEMTKRGWWLVALNILLPGSAQLVAGDRR
FT                   LGRVGLIATAALWFLALAALLILLVSPSTVYTLATQSGSLTFAQIVLIVYALLWVVLTL
FT                   DTLRLVRLVKARPEARAGSPLSRPSSW"
FT   gene            486885..487735
FT                   /pseudo
FT                   /locus_tag="Lxx04870"
FT                   /note="similar to transcriptional regulator, LytR family"
FT   gene            complement(487782..488915)
FT                   /locus_tag="Lxx04890"
FT   CDS_pept        complement(487782..488915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx04890"
FT                   /product="mannosyltransferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04890"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88472"
FT                   /db_xref="GOA:Q6AGM3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGM3"
FT                   /protein_id="AAT88472.1"
FT                   /translation="MVVDDLTGVAPGGLRRYTEELTRHLIATAPPGCDVQAVISNVSDD
FT                   KLNEVRLLLPGVASLIRLPLARRELALAWRSGLPVGSLTGMLHAPAVLAPLRQHGQTEA
FT                   SDQIAVTIHDTLAWSHPETIGTARALWTRSMAKRARRFADAIVVPTHAVARRLADELDF
FT                   GDRIRVIGGAPATTVQLPSDADERAARLELPETYALTLGSVMPRRGVAALIRAVARPEA
FT                   HGIPLLIVGPDRYGERSATGVAAAAGLPEDRVRALGRLSDPDLAVVLDRATVFVYPSLA
FT                   EGFGLPIMEAFTFGLPVVHSDDPALVEVAGGASLVVERPGRAEDDAAYTDRLADAIGRV
FT                   LGEPDLRTRLSVLASDRARAFSWRDSAERVWQLHADL"
FT   gene            complement(488902..489789)
FT                   /gene="strL"
FT                   /locus_tag="Lxx04900"
FT   CDS_pept        complement(488902..489789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="strL"
FT                   /locus_tag="Lxx04900"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04900"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88473"
FT                   /db_xref="GOA:Q6AGM2"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGM2"
FT                   /protein_id="AAT88473.1"
FT                   /translation="MARYLIAGAHGQLGQDLQRALAGREVTALGRADLDVTDRDTVLAA
FT                   VAGHDVVINASAYTKVDDAETHEDDAYAINATGTENLAVAAAQHGATFVTVSTDYVFDG
FT                   SGAEPYAEDAPRDPINAYGRTKAAGEELALATHPGGTYIVRTAWLYGAGGANFAKTMVR
FT                   LAESHETVSVVADQIGQPTWTGDLAERIVTLLDSDAPPGVYHGTNSGQASWFAFAKAVF
FT                   SAAGLDPDRVLPTDSAAFTRPAPRPSYSVLGHEGWRRAGLKPMRPWEEALADAAQHGVL
FT                   DQERNDDDTQGGGR"
FT   gene            complement(489801..490790)
FT                   /locus_tag="Lxx04910"
FT   CDS_pept        complement(489801..490790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx04910"
FT                   /product="thymidine diphosphoglucose 4,6-dehydratase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04910"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88474"
FT                   /db_xref="GOA:Q6AGM1"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGM1"
FT                   /protein_id="AAT88474.1"
FT                   /translation="MKILVTGGAGFIGSNFVRRTLQDAYPGLEGAEVVVLDALTYSGNL
FT                   ANLEPVSDSPRYTFAKGEIRDSGLLDELFPAVDAVVHCAAESHVDRSVRDASIFAETNV
FT                   LGTQQLLDAALRNEVKRFVHVSTDEVYGSIAEGSWDEERPLEPNSPYSASKAGSDLLAR
FT                   SYFRTHGLNLSITRCSNNYGPYHFPEKVIPLFVTNLIDDKHVPLYGEGNNIRDWLHVDD
FT                   HTRGIAMVLVNGRAGEIYNIGGGTELTNKELTQLLLDATGKDWSYVDRVADRLGHDLRY
FT                   SVDISKIRSELGYEPLVPFEQGLTDVVQWYRDNRAWWEPLKARAALDG"
FT   gene            490878..491483
FT                   /gene="rmlC"
FT                   /locus_tag="Lxx04920"
FT   CDS_pept        490878..491483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rmlC"
FT                   /locus_tag="Lxx04920"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04920"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88475"
FT                   /db_xref="GOA:Q6AGM0"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGM0"
FT                   /protein_id="AAT88475.1"
FT                   /translation="MQIRELTIPDAYEITPVQHADDRGLFFEFYRFDRLEEAVGHSLDL
FT                   KQGNTSVSRRGSVRGIHFADIPPSQAKYVMAPRGAVLDFVIDIRLGSPTFGQWDSVLLD
FT                   DKDRRALYVAEGLGHCFVALTADATVSYLVTDVYTPTREHGINPLDSDIALAFPVPEDE
FT                   LLLSPKDTDAPGLAEAQASGLLPTWDAARDFYASLDHK"
FT   gene            491500..492363
FT                   /gene="rmlA"
FT                   /locus_tag="Lxx04930"
FT   CDS_pept        491500..492363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rmlA"
FT                   /locus_tag="Lxx04930"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04930"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88476"
FT                   /db_xref="GOA:Q6AGL9"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGL9"
FT                   /protein_id="AAT88476.1"
FT                   /translation="MRGIILAGGSGTRLWPITKGISKQLMPIYDKPMIYYPLSTLMMAG
FT                   INEILIITTPEYNDQFRALFGDGSQLGIRIEYAVQPSPDGLAQAFVIGEEFIGDESVAL
FT                   VLGDNIFHGTGLGSALRQHTDIDGALIFAYQVSDPTAYGVVEFDDDFTALSIEEKPAQP
FT                   KSEYAVPGLYFYDNSVVEIAKTIEPSVRGELEISTVNERYLEAGRLQVQVLDRGTAWLD
FT                   TGTFESMMQASEYVRVIEDRQGFKVGCIEEIAWRAGWISDAQLSELSQPLVKSGYGQYL
FT                   RRLLGG"
FT   gene            complement(492370..493224)
FT                   /gene="wbbL"
FT                   /locus_tag="Lxx04940"
FT   CDS_pept        complement(492370..493224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wbbL"
FT                   /locus_tag="Lxx04940"
FT                   /product="dTDP-rhamnosyl transferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04940"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88477"
FT                   /db_xref="GOA:Q6AGL8"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGL8"
FT                   /protein_id="AAT88477.1"
FT                   /translation="MPRSAEATAVVTVSYNSSGQFASFLGSLAYEIDNGYPVVIADNGS
FT                   ADIDETRRVASAHGARVLALAENHGYGGAVNLAVRTLPESVDAILICNPDIIVSPRSIE
FT                   VLRERLDSDERIAAVGPRILNEDGTVYPSARSIPSLRTGIGHALFVRVWPTNPWTRAYH
FT                   SERRLEARDVGWLSGACVLVRRRAFERIGGFDEAYFMYFEDVDLGFRFSRSGYRNRYEP
FT                   AASVIHHGGLSTRSESKRMLIVHHDSAYRFLARKYSGPLLAPVRVALRVALSARAWLLT
FT                   RGH"
FT   gene            493413..494645
FT                   /gene="wbbX"
FT                   /locus_tag="Lxx04950"
FT   CDS_pept        493413..494645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wbbX"
FT                   /locus_tag="Lxx04950"
FT                   /product="glycosyl transferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04950"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88478"
FT                   /db_xref="GOA:Q6AGL7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGL7"
FT                   /protein_id="AAT88478.1"
FT                   /translation="MIARKTRTAYSMLKNNGLRATFGYLKFKIGSVTGPQRPRLLVDLV
FT                   DAAAVDWTELPARITDPIVVSDRPVRIAWIMSPPGRESGGHQNLFRFIRFAELAGHICD
FT                   VYLYNAGDAAIDLPVIRDMLESSEAYPRLNGELQIWDRSVGVADGTEAIFATGWETAYP
FT                   AFLDESRARRLYFVQDFEPLFYPLGSEALLAQNTYRFGFHGITAGGWLADKLRTEYGMK
FT                   TDHFDFSVDRSLYTFDNTGRRNEIFFYARPVTPRRAFEFGLMVLTEFAKMRPDVTINLA
FT                   GWDVSNWEIPFEFNNLSSLQLSELNAVYNRCAAGLVLSLSNMSLLPLELLSSGVIPVVN
FT                   DGANNRMVSGNEYIVYVPASPMAIAQKLAEIVDRPDAPAYAALASKSVADTTWEDSGRA
FT                   FVAAFERAMRG"
FT   gene            494638..495564
FT                   /gene="galE"
FT                   /locus_tag="Lxx04960"
FT   CDS_pept        494638..495564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="Lxx04960"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04960"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88479"
FT                   /db_xref="GOA:Q6AGL6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGL6"
FT                   /protein_id="AAT88479.1"
FT                   /translation="MDSAAVIGANGFLGSHLVDALVAEGLSVTAFDRFSALPSFDAGSA
FT                   RLITGDFLNRADLEQAVTGQRYVFHFLSTTTPATAAGDPTLDIRTNVAQTVELLESCAA
FT                   AGVERVFYASTGGAIYGDQGKPEYSESDRALPVSPYGIGKLTIEHYLEFFRLTHGLDYT
FT                   ILRISNPYGTRQHLNRKQGLIPIALRRIVRGEPVLQLGDGGMVRDYIYVEDLVRMILPL
FT                   VRDVGEHRLYNIGSGTGCSVAQILDVLRDVTEVDFAIDVRPAPATFVDRVVLDTSRYVH
FT                   EFGELMSATGLREGVESTYEEIRRQSD"
FT   gene            495575..496540
FT                   /locus_tag="Lxx04970"
FT   CDS_pept        495575..496540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx04970"
FT                   /product="rhamnosyltransferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04970"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88480"
FT                   /db_xref="GOA:Q6AGL5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGL5"
FT                   /protein_id="AAT88480.1"
FT                   /translation="MDVTIAILTYNGETYLGRILEMIRRQDFPGTVEVLVVDSGSTDAT
FT                   IGIVRSFPEVVLEQIPNSEFGHGRTRNLAAQLARGEFVAYLTHDAIPASESWLRELLAP
FT                   FSLDENVVAVMGKQVPRPGCFPLLKYEIRGVFAGFGPDFGTTVFYKDDFAKDEGVLGAM
FT                   SFYSDVNSAARRAFLLDVLPYRDVRYAEDQLFGRDVIEAGYKKAYAGRAAVEHSNDLTL
FT                   AEYELRIFDETVGLREIGFPILAMTKREQRRLTVRGVLGDSLRILRDGDYSWKRKLYWL
FT                   ARNPVYQIVKWRSYRDSTLVDLSDKDAVRAKSLEHSRKRA"
FT   gene            496898..497902
FT                   /locus_tag="Lxx04980"
FT   CDS_pept        496898..497902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx04980"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx04980"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88481"
FT                   /db_xref="InterPro:IPR006852"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGL4"
FT                   /protein_id="AAT88481.1"
FT                   /translation="MGRVDVVPNERGTMNPRRAVYPALLGDYEDISEQPIARETDVPFI
FT                   CLTDRDDLLSDTWTIVRAELPFPFDLVRSQRDFKIRGHQVLDEYDETLYIDNSVQLHET
FT                   PDAILDEWLADADFAVSRHSFRERVIDEFDEIVRLNYDDAGRVNEQLLHYAEAYPDVLH
FT                   ERPYWNGMLARRSTAAVAETMRIWFDHVLRYSRRDQPSANVAFSLGPAAVHSVVENNNR
FT                   SSWHRWPIDVRRRVEQSVLTGRRTGPLLAEVARLEREVLLQKSRSDELVGEVEVADRRR
FT                   QAAESETARAIAEKACVEQRLADTLSSLSWRASRPIRAVRGSLRKRTSGGPTD"
FT   gene            498039..498737
FT                   /pseudo
FT                   /gene="ytcB"
FT                   /locus_tag="Lxx04990"
FT                   /note="similar to nucleotide sugar epimerase"
FT   gene            complement(498823..500025)
FT                   /gene="rfbB"
FT                   /locus_tag="Lxx05010"
FT   CDS_pept        complement(498823..500025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbB"
FT                   /locus_tag="Lxx05010"
FT                   /product="lipopolysaccharide exporter"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05010"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88482"
FT                   /db_xref="GOA:Q6AGL3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029439"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGL3"
FT                   /protein_id="AAT88482.1"
FT                   /translation="MPSLISAVGVSKLFVLHKDKSLKERVVNFSASRQHRDDFWALRDI
FT                   DLEIPVGSTVGLVGHNGSGKSTLLKVVGGIIEPTTGTVARRGRMAALLELGAGFHPDLT
FT                   GRENVYLNAAILGMTRKETDRYFDEIVDFSGIESFIDTQVKFYSSGMYVRLAFAVAVHV
FT                   DPDLLLVDEVLAVGDEPFQRKCMDKIQEFQRDGRTIVLVSHSAEQVGRLCDRVVVLNHG
FT                   NMIFDGDPSEGLRVLRFGFEQERLEHEHTHNETAAPSARIVGIEVAGAKVAEERIIVTA
FT                   TSDLTFRYQYDLTTAQEPLVAGIAIETSTGQPVYGVNTTMLGVDLPTSAGEHTVELTFP
FT                   HHRLGSGNYIVHGSLEERAGRSLFRLNPAATFEVDAPQQGSGLIRLDVEVSVDDKSQAR
FT                   G"
FT   gene            complement(500036..500971)
FT                   /gene="rfbA"
FT                   /locus_tag="Lxx05020"
FT   CDS_pept        complement(500036..500971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbA"
FT                   /locus_tag="Lxx05020"
FT                   /product="lipopolysaccharide exporter"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05020"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88483"
FT                   /db_xref="GOA:Q6AGL2"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGL2"
FT                   /protein_id="AAT88483.1"
FT                   /translation="MTTPVDADARAAAIAKLPFERVGQRSGFVQGTQHSLSDVWAHREL
FT                   LGLLVKRELKARYKDSSLGVVWSLFRPLAQLLIYYFAIGQVLGAARATPDFAIFVFIGL
FT                   TMWGLFSEIVTGSTTSILANAGLVKKVYLPREIFPLSAIGGALFNFLVQLVVLTIAIVL
FT                   LSTVPFGWNLSLLLAPLAVVTLVVFATAIGLLLSAVNVYLRDTQHLIEIAVIILFWASP
FT                   IVYSYTYVHKLLQGGWLEQLYLANPVTVAIISMQKAFWAAGSVSEGALSQVWPPNLGIR
FT                   LLVTLLVSIVLLWLSQRTFSRLQGNFAQEL"
FT   gene            complement(501087..503402)
FT                   /locus_tag="Lxx05030"
FT   CDS_pept        complement(501087..503402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05030"
FT                   /product="lysozyme"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05030"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88484"
FT                   /db_xref="GOA:Q6AGL1"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018077"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGL1"
FT                   /protein_id="AAT88484.1"
FT                   /translation="MPAPRGSAPTTETGGTVSADPPLATMNTARNHSMGSTIAANEPAA
FT                   KSSQSQARTFSATGFPPGVPGLDVSGWQVLNASDWARIAANGARFAYVKATESTDYTSS
FT                   QFAEQYTDSFNAGLLHGAYHFATPNTSSGAAQANWFLDHGGQGTADGRTMPPLLDIEYN
FT                   PYGATCYGLSPAAMVSWIYDFSQTVQARTGRQPAIYSTTSWWKLCTGNSAAFAANPLFI
FT                   ARYPNALSDGAGALPAGWSSYTLWQFASSGVFPGDQDVFNGSERDLQSFGLISSLVRTA
FT                   NNASVYLVSGANKYPVTNTSTLSAFSALGHVGYVPQSYLDQFATQHAAVPIIRGQDGSV
FT                   YFADSGIRLPFASCGLVSDYGGSCDASGYVQLTATQTAAFALGPAATPLMTSAGGPLFY
FT                   VTGGKKHEVLDKVSLAQAGLNGSANSLSATALSFLAFGTPIVRNNVYAMTAGSGTGVLL
FT                   VGGSASPIDQSAASLIGLPQLAAGTLQPASVAQLPAGARFTGAFRSSADSSVTVISSNG
FT                   LRPWAAGVGGASFTAVTAPTAAMSAYSVTQPIQAGNAIMSPAGGTVYLVMPNDIRPVGS
FT                   WDSLVALAGGGTPNIAVVPQSIIASLPSGPVALDPATLVRSPGNATVYLVNGVTNKIPF
FT                   STFDQAIEAGFTKFSFTSDARLNAYPTSPDLLSFGLQCGSQRYVSAGGSIHALSSMTSS
FT                   LYPLAFTPLDTFTCAIAPKGIDATAFIRTPDGSIYFLSEGKKRPITSLQRFVQLSQGQP
FT                   YLNVVSAFAAAIPTGAPA"
FT   gene            504120..506528
FT                   /locus_tag="Lxx05050"
FT   CDS_pept        504120..506528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05050"
FT                   /product="hemagglutinin-related protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05050"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88485"
FT                   /db_xref="GOA:Q6AGL0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGL0"
FT                   /protein_id="AAT88485.1"
FT                   /translation="MRDGPYGRRGVRAGTVERHTRLCGSRPRLPVGPGRTGGSLMRSTS
FT                   IVAVLIGALVGGLLTVAPAAMVASAPAAAADARLFDPGNIISDALFFDGDSMTADQVQS
FT                   FLDRKVTSCRSGYTCLKDYRQQTQTRAAVDGRCAAYTSQGTESAATIIAKVGEACGVSQ
FT                   RAILVLLEKEQSLVTDTWPGAGQYRSATGYGCPDTAACDAQYYGFFNQVYNAALQFKRY
FT                   AASPTSWNHIAGRVNQIRFSPTASCGSSSVFIQNQATAGLYNYTPYQPNAVALANLYGT
FT                   GDSCSSYGNRNFWRLYTDWFGSTTGATSLARTVDNGTVYVLSGTVKYPIANIDLLTALS
FT                   PLGTVGYVSQQYLDGYRTGPIAGRTLRGNDGSVYFFDSGLKLPFGSCGLVADYGGSCSA
FT                   TGYMQLTDAQLARFVTGPLMTPVLGTTSGSRYFMTVGTKREILDAASQQAAGIPLARNV
FT                   LTESAVAALPLGAPVIADQSFAQQRGSASVSFVSGGKSYPVSSEHSGIAGRVGGTLSAA
FT                   SLARVPASGVSFTGLVSVPGSGSTSVLGSGGRFAWAAGGGVASAKATPVTQAFLDSFPV
FT                   KGTVSVGSFVKGDGATVYVVGPSDLKPISSWDSLLALLPPGATPTIMTISTAAFAALPA
FT                   GRVALTSGTLVRSPENATVYLVNGLSNKIAFSTFDVTASIGVGGLSFVSQSLLDGYPAA
FT                   GSLLGYGVTCGGVDYAGASGTLRALDATTKPLYPITFTALDDYSCARLTVGAPATKFIR
FT                   TPDSSIFLLEGGKKRPIANMNRFAELGGAVGWTSVSAGFGASIPTGPLA"
FT   gene            506614..508110
FT                   /locus_tag="Lxx05060"
FT   CDS_pept        506614..508110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05060"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88486"
FT                   /db_xref="GOA:Q6AGK9"
FT                   /db_xref="InterPro:IPR018674"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGK9"
FT                   /protein_id="AAT88486.1"
FT                   /translation="MIKAAEGTRALRIVRIVLMPVLALLVFGAWALSSPPGSSPDDDFH
FT                   QTSIWCADGIVKGTCDAGSRSGHYTVPPLVANGSCYAFKPHESASCQGSATRARTTDRG
FT                   NFHGLYPPFYYAFMHTFVTGDVAVSIVAMRLVNAIIFVALTSVLCWLLPARRRWNLVWS
FT                   LAITTIPLGLFLIPSVNPSSWVLISSGLVLLAVVGYFESTGCRRVGLGAVAVIAAFLGG
FT                   AARSDGAVFSVLATGAAVLLTMKRDRKYWLSALLALGIVLLSAALFSTSHQSGTALSGG
FT                   LASGGKGMADWSLWFPILTQLPVLWAGGLGAVFGLGWVDTHMPGGVWVVTIMVFAALVF
FT                   AGVRILGLRKGLVLLGAAAALILLPFYLQVSTGTLVGNQVQPRYILPILIMFAAVALWE
FT                   SEDRQFDLTQTQWWVLAGGLGVAQALALHANLRRYVTGVDVLNVNLSASVEWWWNIPVS
FT                   PMWLWVLASGAFVALMALIVIEFSRVSPKAGVLRQPSALT"
FT   gene            complement(508317..509441)
FT                   /gene="wbjD"
FT                   /locus_tag="Lxx05070"
FT   CDS_pept        complement(508317..509441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wbjD"
FT                   /locus_tag="Lxx05070"
FT                   /product="O-antigen biosynthesis protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05070"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88487"
FT                   /db_xref="GOA:Q6AGK8"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGK8"
FT                   /protein_id="AAT88487.1"
FT                   /translation="MTAPTVLTVVGTRPEIIRLSRIIPKLDERVDHVLVHTGQNHDRQL
FT                   NDVFFEDLGIRQPDHYLNVDTSSLGAVMADTIRKSETIFTEVKPDAVLILGDTNSAIAA
FT                   LVAKRMHIPTYHMEAGNRSFDENVPEETNRRMVDHIADFDLAYTEHARRNLLAEGLHPR
FT                   RILVTGSPMKEVIDHYLPRIEGSDALERLGVAPGEFFLVSAHRQENVDSPKRLRELLDT
FT                   LTAVRERWGLPVLVSTHPRTRNRLEALPDFQALDGVHFHPPFGFFDYCQLQRSARCVLS
FT                   DSGTISEESAILDFPAVTIRDSMERPEALDAGAIVMSGLKADEVIAAIEEVTEESDIAR
FT                   EVPAEYLVGNSSQRVIRFLLSTMGRHHEWAGIRR"
FT   gene            complement(509438..510469)
FT                   /gene="wbjB"
FT                   /locus_tag="Lxx05080"
FT   CDS_pept        complement(509438..510469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wbjB"
FT                   /locus_tag="Lxx05080"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05080"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88488"
FT                   /db_xref="GOA:Q6AGK7"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR013692"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGK7"
FT                   /protein_id="AAT88488.1"
FT                   /translation="MTERKIEGSIVTVTGGTGSFGSTMARHLLSRDVGEIRIFSRDESK
FT                   QDALRHEVNDPRMRFYIGDVRDSLSVTRAIKGSDHVFHAAALKQVPSGEFFPLEVVATN
FT                   ITGSGNVIRAAIEHQAKSVVCLSTDKAVYPINAMGMTKALMEKTAFAMARENLDTETVV
FT                   SVTRYGNVMYSRGSVIPLFIKQLTTGQNVTVTDPEMTRFLMSLAQSVDLVEYAFTQATS
FT                   GDLFVRKAPASTVAVLLEAVANVIGVPMPDVDIIGVRHGEKLYESLLGSEEMAKAEDRG
FT                   DYFRVPLNTRSLDYTPYFEEGADHGAPTESYTSHNTERLDVAGVERLLLTLPEIQQMRA
FT                   QLR"
FT   gene            complement(510466..511371)
FT                   /gene="rfbD"
FT                   /locus_tag="Lxx05090"
FT   CDS_pept        complement(510466..511371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbD"
FT                   /locus_tag="Lxx05090"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05090"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88489"
FT                   /db_xref="GOA:Q6AGK6"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGK6"
FT                   /protein_id="AAT88489.1"
FT                   /translation="MSARVLVLGATGMLGSTVASILRRSGHDVTGTVRDLALVPAGRRD
FT                   RHRLFDAFADDPSGLLEGLSSGDYVINCIGLIKHHLRDDDAGDRYNAIKINAELPYALA
FT                   RAAGERNVRVIQIATDCVYSGQTGRYDETTAHDATDVYGQSKSLGEVPGDHFLNLRCSI
FT                   IGPEQKNRDSLLEWVLAHEPGSTFNGYLDHRWNGVTTDVFAAIAAGIVQTGSTLSGTHH
FT                   LVPADSVDKDALSRLILSAYGREDVSVVPVETGTPVDRTLTTIHPDVNAALWRDAGYDE
FT                   IPTIETMVRTLASESIERDS"
FT   gene            complement(511383..512564)
FT                   /gene="bplE"
FT                   /locus_tag="Lxx05100"
FT   CDS_pept        complement(511383..512564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bplE"
FT                   /locus_tag="Lxx05100"
FT                   /product="glycosyltransferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05100"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88490"
FT                   /db_xref="GOA:Q6AGK5"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGK5"
FT                   /protein_id="AAT88490.1"
FT                   /translation="MRILFVHEVNYLDKVIYEMHEFPELLALRGHDVSFFHYPEAPATP
FT                   SRSLRTTRRRIPGRAYPEAEIELITPPTFGGRPVERYAAPLLNLPGLRREITTGRYDIV
FT                   VLYAVPTTGWQAVSIAKRAGVPVVFRALDVSHQIRTSPVSPLIRWAERHIYATADLISA
FT                   NNPAMAEYCVDLAGRTGPVSVDLPPVDLSHFADAKPGVRETLGLDADDKVIVYMGSFFG
FT                   FSDLDIVLEKAAVHLRENPGLKLLYIGGGELDGELRRRTVELGLQSQVIFTGVIPYAEL
FT                   PGYLAAGDVAINPFRPQLLTDVALPHKVLQYMAAGVPAVSTSLRGLRGVVGDAAGVTWA
FT                   EGPADVVERAISVAALPAEERAAIGARQREFVMTAFSKESAAIGFERTLESVR"
FT   gene            complement(512542..513315)
FT                   /locus_tag="Lxx05110"
FT   CDS_pept        complement(512542..513315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05110"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05110"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88491"
FT                   /db_xref="GOA:Q6AGK4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGK4"
FT                   /protein_id="AAT88491.1"
FT                   /translation="MFSHDPFLLAWAACAPIPLAVLIVGVLSRTVLGDRFQVDAGYRTL
FT                   AWNSARTVAAAAAMGVLVSGFPLLLTVTSPHASPTALGLLLLVSTLTRSPLIVVAMALQ
FT                   SYLIVFFRQSPNPRRALSALLGLALAAGGVLGVLGLLLGEAVFSLLFPGQPVPPAWLIA
FT                   VLVATSALVAAICVSAPAVLVQGNHTVFTAGWIAAAGATALALLLPGGLFERASLAVAI
FT                   GPAAGLAVHLIYLFGRRAPLSRDFQGESGADTVRP"
FT   gene            complement(513804..514172)
FT                   /locus_tag="Lxx05120"
FT   CDS_pept        complement(513804..514172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05120"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05120"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88492"
FT                   /db_xref="GOA:Q6AGK3"
FT                   /db_xref="InterPro:IPR019277"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGK3"
FT                   /protein_id="AAT88492.1"
FT                   /translation="MSLASYLLGITAAVITLAVVIEMMRQRRLRERHAIWWLVTGVLAL
FT                   IVGVFPSTLAWASSVAGVAVPTNLIFFVSVAILFLVCIQNSSELTRLEAQTRLLAERSA
FT                   LLELRIKQLEAHDESTGS"
FT   gene            complement(514172..514909)
FT                   /gene="ycbB"
FT                   /locus_tag="Lxx05130"
FT   CDS_pept        complement(514172..514909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbB"
FT                   /locus_tag="Lxx05130"
FT                   /product="dolichyl-phosphate mannose synthase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05130"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88493"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGK2"
FT                   /protein_id="AAT88493.1"
FT                   /translation="MTDPLARTLIVMPALNEEGSVAEVVREVRDKLPGVACLVVDDGST
FT                   DRTAERAEAAGAIVASLPYNLGVGGAMRLGFVYALENGFDNVVQVDSDGQHDPASVPSL
FT                   VAELESHDVVLGARFAGEGDYEVRGPRRWAMLFLASMLSRVAKTKLTDTTSGFRASGPK
FT                   AVRLFADHYPAEYLGDTIESLVIAARSGCRIAQLPVSMRQRTTGTPSHNPLKSAIYLGR
FT                   AGMALMFALIRPPVVVTEKEIAI"
FT   gene            514972..515958
FT                   /gene="rgpB"
FT                   /locus_tag="Lxx05140"
FT   CDS_pept        514972..515958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rgpB"
FT                   /locus_tag="Lxx05140"
FT                   /product="rhamnosyltransferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05140"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88494"
FT                   /db_xref="GOA:Q6AGK1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGK1"
FT                   /protein_id="AAT88494.1"
FT                   /translation="MCAKPGAAVSVALCTRNGERFVRAQVESILSQDPPISELVVSDDG
FT                   STDRTLSIVEETVRASCAAVVLRILRNAEPLGVTANFEQAIAACGGEFIALSDQDDVWH
FT                   AGRLADALPFFDDARVQLVHTDARLVDSAGEPLGGTLFGALEIAPELVAEENDGDALGV
FT                   LLRRNTVTGATTVLRASLVERARPFPDAWVHDEWLAVCAAIVGAVRSLPRTTIDYRQHG
FT                   GNQIGVKRPSIGYKVSRVFEPGGARQVRLGLQFAQLAARADTFPELSEDDRDRIVQKAE
FT                   FESARSRLPVSRLARLASLRRLVRGGRYGRYASQGRLDIVRDLLRAP"
FT   gene            complement(515955..517205)
FT                   /gene="exoQ"
FT                   /locus_tag="Lxx05150"
FT   CDS_pept        complement(515955..517205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exoQ"
FT                   /locus_tag="Lxx05150"
FT                   /product="exopolysaccharide production protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05150"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88495"
FT                   /db_xref="GOA:Q6AGK0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGK0"
FT                   /protein_id="AAT88495.1"
FT                   /translation="MVELLGSARFTSTLALLGVIVGFSTHAIRAVIGWPGLIGALSALV
FT                   ALAVLSFAAQWKLIEWHGLLPVSALMFAGWCALSLFWSQYQLATLGGVLYQLLFAFLAV
FT                   YIALVRDAIQIVRVVGDALRTLLTVSLALEVLSGLLLDMPIRFLGILGNIASGGPIQGL
FT                   FGTRNQLSIVALIAFVTFLVELRTRSVRPQLAAFSIALAALCLLFAHSPVIAAVSVVVS
FT                   LATLALYGIRKVPDGARSYAQWGLALFTVAVLVATYFSRTRVIDLLNARADFQVRYQLW
FT                   LQIWELIPVQQSVGWGWTGAWPTDLYPFGAIQAATGMYHPNGLNAYLDVYLQVGVIGLL
FT                   LFVVLVALAFVRSWLLASVRRSVVYAWAPLVLVALLVTSVFESSILVESGWMLLVICTV
FT                   KASQGMSWRWRLARSQS"
FT   gene            complement(517251..518600)
FT                   /gene="exoQ"
FT                   /locus_tag="Lxx05160"
FT   CDS_pept        complement(517251..518600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exoQ"
FT                   /locus_tag="Lxx05160"
FT                   /product="exopolysaccharide production protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05160"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88496"
FT                   /db_xref="GOA:Q6AGJ9"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGJ9"
FT                   /protein_id="AAT88496.1"
FT                   /translation="MSYPSGMGSPTTSLDTRALAARRSSETGVLVFASLLLFTLFAGDF
FT                   WRNLISWPGYFALAALLTAGSVVLLVRARAAVRWRRLPKTLGLFLALAVLSIAWSAYPG
FT                   ASALGVLAQLATTASALFLALCLGWPALLTALSNAFRWVLGLSLLFELIVAVFVRRPVL
FT                   PLTPVQPFPPGKLPSAFYWSRDLLLHGGQIQGIVGNSNLLAMIALLALIVFGVRLADRA
FT                   DRRGSAIAWIVVAALTLALTRSSTVIVATAFAAVALRLALWTRRARPERRRPVYLSAAA
FT                   LVAVGAVSLALFASRLPALLGKSDDLTGRLDIWDRVIGFAQQRPVFGWGWVSYWAPWTE
FT                   PFSDLAKRNGVVYLQAHNAWLDIWMQLGIAGLALIVPLAVGTLWRSWFHAVDRPRTSVR
FT                   DDQAHTALTLLPLLLFAALLAQSFAESRMLIEDGWALLVVLAAKTKQTAP"
FT   gene            complement(518597..519748)
FT                   /gene="manA"
FT                   /locus_tag="Lxx05180"
FT   CDS_pept        complement(518597..519748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manA"
FT                   /locus_tag="Lxx05180"
FT                   /product="mannose-6-phosphate isomerase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05180"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88497"
FT                   /db_xref="GOA:Q6AGJ8"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016305"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGJ8"
FT                   /protein_id="AAT88497.1"
FT                   /translation="MRIGNQPRDYAWGSTTAIAGLLGGEPSGGPEAELWLGAHPGSPAR
FT                   ILDPAQTGGSADLAHWPETAGRLPYLLKVLAAAGPLSLQAHPSSEQARAGFERENAEGL
FT                   APGSPERNYKDPFHKPEMIFALSDPFDALCGFREPADSRAALERLAGSALGVAAFAGTL
FT                   DDEPAAALRGATEWLLGGTPEVAALVSAVTDAAQRAEGVDADTVRTLARAFPGDPGIVL
FT                   ALLLNRVTLRPGEALYLPAGNIHAYLRGLGIELMAASDNVLRGGLTPKRVDVPELVRIL
FT                   DFAPFAATPMTAKRPAPGVEEFVPDVPDFRLCRIEIGADTPAAEVTLPGTAIVLCTAGA
FT                   AEVLGATGGLRLTRGEATVVTAEERTLSVSSGAGTLFIATPNA"
FT   gene            519741..521042
FT                   /pseudo
FT                   /gene="gcdH"
FT                   /locus_tag="Lxx05170"
FT                   /note="similar to glutaryl-CoA dehydrogenase"
FT   gene            complement(521212..521769)
FT                   /locus_tag="Lxx05200"
FT   CDS_pept        complement(521212..521769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05200"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05200"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88498"
FT                   /db_xref="GOA:Q6AGJ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGJ7"
FT                   /protein_id="AAT88498.1"
FT                   /translation="MRPLMVIRAWIVVFIAGLVVSGVTAFPLEAEVRLVSGVLHASGAP
FT                   QFAPGLVEWIDRVRDALVQTGASHPFLAYGTDWLAFAHLVIAVAFIGPLLDPVRNIWVI
FT                   RFGMIACAGVIPLALIAGSIRGIPFGWQLIDISFGVFGIIPLLIVHLLTRRLESEQEKH
FT                   PFARERQDGDPSWRSAADTAPE"
FT   gene            521864..522826
FT                   /gene="exoB"
FT                   /locus_tag="Lxx05210"
FT   CDS_pept        521864..522826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exoB"
FT                   /locus_tag="Lxx05210"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05210"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88499"
FT                   /db_xref="GOA:Q6AGJ6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGJ6"
FT                   /protein_id="AAT88499.1"
FT                   /translation="MAWLVTGGAGYIGAHVVRAFLAEGIDVVVADDLSSGHREFVPAGV
FT                   SFYRGTILDGTLLEAVFSENRISGVVHVAGYKYAGVSVQRPLHTYEQNVTATAVLLAVM
FT                   QEAGVGSIVFSSSAAVYGTPEVELVTEDTPKNPESPYGESKLIGEWLLRDQGVARGLRH
FT                   TSLRYFNVVGSGDPALRDTSPHNLFPLVFDALVAGRTPRINGDDYATPDGTCVRDYIHV
FT                   ADLAVSHVAAAKRLEAGEDIRAVYNLGSGDGVSVGEIMATVAEVTGIDFTPEMGPRRPG
FT                   DPARIVASGELAARDLGWKMSHSLAEMVRSAWEARQAAS"
FT   gene            523071..523337
FT                   /gene="whiB"
FT                   /locus_tag="Lxx05220"
FT   CDS_pept        523071..523337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="whiB"
FT                   /locus_tag="Lxx05220"
FT                   /product="regulatory protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05220"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88500"
FT                   /db_xref="GOA:Q6AGJ5"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGJ5"
FT                   /protein_id="AAT88500.1"
FT                   /translation="MRLGVPGVRAGADDDNPLAWQTDALCAQTDPEAFFPEKGGSTRDA
FT                   KRICSSCEVRAQCLEYALANDERFGIWGGLSERERRKLRKRAG"
FT   gene            523404..526601
FT                   /pseudo
FT                   /locus_tag="Lxx05230"
FT                   /note="similar to transmembrane protein"
FT   gene            526594..528024
FT                   /pseudo
FT                   /locus_tag="Lxx05240"
FT                   /note="similar to secreted protein"
FT   gene            complement(528558..528923)
FT                   /pseudo
FT                   /gene="tnp"
FT                   /locus_tag="Lxx05245"
FT                   /note="similar to transposase, ISlxx4"
FT   gene            529392..530453
FT                   /locus_tag="Lxx05260"
FT   CDS_pept        529392..530453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05260"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88501"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR024301"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGJ4"
FT                   /protein_id="AAT88501.1"
FT                   /translation="MAMRSVVGVSVAVVFSVGAVLGAAAPSVAAAEPVPNGRAISLSKT
FT                   VGDVMGGEHITIRGWNLRDTTQVCFGQGCVPVTSATFWKVEVTAPPHYGYQGGQAQAVV
FT                   PDYQEGDVAVTLKQGDKKTANCRRSYRYKALTATGREMSYLLAHWEKYDSARYGNFDPV
FT                   GGDCMNFVSAGLAEWFGRNSHRPDWYNAFADWVAKHPTANPYNDPYGKIDPANRWVTPS
FT                   WAYVPDFSTWLNDQKDSFGITRTDLSNDPATWSDIKVGDIVTMTWNNDGGNGSTEGGPG
FT                   LDPGRIPAATTAQASNDLGEDHAMVVTRIVTVDGHLDVQLAGHSNDRNYLSFSAIYSGT
FT                   PNMTGSIWHLPTA"
FT   gene            complement(530631..531080)
FT                   /locus_tag="Lxx05270"
FT   CDS_pept        complement(530631..531080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05270"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05270"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88502"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGJ3"
FT                   /protein_id="AAT88502.1"
FT                   /translation="MPRNRRANASSTPPATSRWRSRHGRGARGPVTGPHLPMLSNRIDS
FT                   FDMTVASTADYLKGIWPEELAGVRFEVAPTPTGNSGGDGVDRWHVDGSGHRIVLYRVPI
FT                   QRLTKLHRNDDLHRRMYIEGCVFRAVAELLGKDPWDLAPDRFRHF"
FT   gene            531122..531334
FT                   /locus_tag="Lxx05280"
FT   CDS_pept        531122..531334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05280"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05280"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88503"
FT                   /db_xref="InterPro:IPR021888"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGJ2"
FT                   /protein_id="AAT88503.1"
FT                   /translation="MLSRPCSRVACPRDAVATLTYVYADSMAVLGPLSLSPEPHTYDLC
FT                   ALHAERLSAPKGWQIVRHEVFGERR"
FT   gene            531360..532787
FT                   /gene="manB"
FT                   /locus_tag="Lxx05290"
FT   CDS_pept        531360..532787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manB"
FT                   /locus_tag="Lxx05290"
FT                   /product="phosphoglucomutase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05290"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88504"
FT                   /db_xref="GOA:Q6AGJ1"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGJ1"
FT                   /protein_id="AAT88504.1"
FT                   /translation="MSSADSSLPLARVVGAYDVRGLVGSGLTEEIVTAIAAGFVDEIGA
FT                   AGGPVVVGHDMRDSSPGFAAAFARGAQARGADVVAIGLCSTDESYFASGALNAPAAMFT
FT                   ASHNPAAYNGIKLSRAGAQGISRDTGLTAVRDRAAAYLAGGIEPVAPPGSYSEQDVLAD
FT                   YAVSLRKLVDLSGVRPITVVVDAGNGMGGLTVPAVLGEAAGLPALPIEIIPMYFELDGT
FT                   FPNHEANPLEPANLVDLQAAVVAHGADLGLAFDGDADRCFVVDETGAAVTPSAVATIVA
FT                   LREIQRARRDDPEAEITVIHNLITSKIVPETIEAAGAIPYRTRVGHSLIKDAMRETGAV
FT                   FGGEHSAHYYFRDFWGADNGMLAAMHLLAEFGSQDRPLSDLSARYTPYALSGEINSTVA
FT                   DVPAAYARIVEAFTGRAEFDELDGLTVTGLTSEADPFWWFSVRASNTEPLLRLNVEAAD
FT                   VATMARLRDEVLALIRA"
FT   gene            532812..533339
FT                   /pseudo
FT                   /gene="ahcY"
FT                   /locus_tag="Lxx05300"
FT                   /note="similar to adenosylhomocysteinase"
FT   gene            complement(533336..534062)
FT                   /pseudo
FT                   /gene="moxR2"
FT                   /locus_tag="Lxx05310"
FT                   /note="similar to magnesium-chelatase"
FT   gene            complement(534059..535063)
FT                   /locus_tag="Lxx05320"
FT   CDS_pept        complement(534059..535063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05320"
FT                   /product="secreted protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05320"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88505"
FT                   /db_xref="GOA:Q6AGJ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGJ0"
FT                   /protein_id="AAT88505.1"
FT                   /translation="MRAAGTLEEVREAADADSTILVFDSGGSLTGEAYAELSSLAGTIV
FT                   VVEPGFEALRTLAPGVHAAGEPTGPVSAGCPVPAARNAGRIDPRATGNTKDASLPGTFS
FT                   ANADVRRCFVRDGGGSLVQTRVEGHTVSLLGSAAILMNDGVDREGNAALALNLLGGHRT
FT                   LVWCPPGIADRPVTGPPDLAELTPGWVTPAVLLLLAVFAAAAIWRGRRFGPLVVESLPI
FT                   VVRAGETREGRARLYQRSSARLRAADALRIGAIGRLARAVGLPRTCTAGEIADAVAAVT
FT                   RSDRSGVRGILLDDIPTTDAQLLALSDTLAELERATAAAVTPGQAGPTGRMEQ"
FT   gene            complement(535269..535907)
FT                   /locus_tag="Lxx05330"
FT   CDS_pept        complement(535269..535907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05330"
FT                   /product="integral membrane protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05330"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88506"
FT                   /db_xref="GOA:Q6AGI9"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGI9"
FT                   /protein_id="AAT88506.1"
FT                   /translation="MRSDIPVDPSSPDAHDWVHQELVKPEYQAAKPTWFDLVWKAIGDG
FT                   LASLFQGPGGDAGPVLLVVIVLIVAGIVVAAFFVFGRPRVNRQAAASHHAVLGGDDART
FT                   AQELRSAAGAAAHAGDWALAIEERFRTLAVGLDERTLVSLSPGTTATEFAARATAAAPE
FT                   EAEALREASRAFDDVRYLDRPGSEPGYQLLVALDQRLQTRRAAPPAVLT"
FT   gene            complement(535912..537390)
FT                   /locus_tag="Lxx05340"
FT   CDS_pept        complement(535912..537390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05340"
FT                   /product="integral membrane protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05340"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88507"
FT                   /db_xref="GOA:Q6AGI8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGI8"
FT                   /protein_id="AAT88507.1"
FT                   /translation="MVCNSSELLSAARAAQQRDKRSRGGRMRPGSGSAYRGERQRRRRG
FT                   CAIMEASDNPGDERYCVSDNQTWWTPDAPQGANGAGGESAGNAAGQRPGPGPAHPGYAQ
FT                   QRQTPAWQHQQPAGQHQPLTGYGQQPGWAPPPKPGLVPLRPLGFGTLLGAPFQALRQNP
FT                   KITVGAALILQGVPSIFVAVLTSAIVSLLLTRVTTANAQDQSAITAGAIGGSILLGVLS
FT                   IVVSTVFSALLQGIVVTEVSRETLGEKLSFGSLWRMVRGRMAALIGWAFLFALAWLLAL
FT                   VTVIVVALASLGGPAGIIGAVLVGIAGGFGLIAVAIWINTKLAIVPSAIVIERLPIGAA
FT                   VSRSWRLTTGYFWRTLGVIVLIAVIIGTVTQIITTPFSLIGMMAGGIFAPTALSGQDQS
FT                   GVDQFLAVQLGTNILASIVGAVVGAIGSVVQTAAVALLYIDLRMRKEGLDLHLVRFVEA
FT                   RQAGQDLPDPYTQPAPTAPVWPAPAPPDAPWPGV"
FT   gene            537390..538073
FT                   /gene="mtrA"
FT                   /locus_tag="Lxx05350"
FT   CDS_pept        537390..538073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtrA"
FT                   /locus_tag="Lxx05350"
FT                   /product="two-component system, regulatory protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05350"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88508"
FT                   /db_xref="GOA:Q6AGI7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGI7"
FT                   /protein_id="AAT88508.1"
FT                   /translation="MTSRILVVDDDTALAEMIGIVLRTEGFDPVFCEDGSEAVGIFRES
FT                   KPDLVLLDLMLPGLDGIEVCSSIRAESGTPIIMLTAKSDTADVVKGLESGADDYMVKPF
FT                   NPKELVARIRTRLRPAPVAPPAEQLCIGDLLVDVAGHEVRRGEARIALTPLEFDLLLAL
FT                   AAKPQQVFTREMLLEQVWGYHYKADTRLVNVHVQRLRAKVERDPDNPKIVMTVRGVGYR
FT                   AGTAT"
FT   gene            538090..539748
FT                   /locus_tag="Lxx05360"
FT   CDS_pept        538090..539748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05360"
FT                   /product="two-component system, sensor protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05360"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88509"
FT                   /db_xref="GOA:Q6AGI6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGI6"
FT                   /protein_id="AAT88509.1"
FT                   /translation="MRFRWPDREWWRQAPLRLASLWRRSLQVRTVAITLLLTGVAILIT
FT                   GVYMVLSISNDLYQSRLSEALRDSSRATTAAQATLNASDVSAGDSGKNLLTTALQSVQG
FT                   STSSRLVAAYRVPGQDTSILAPPDRGSPALNPVISAPLRTLVQNGGTKQFYQSVALPAG
FT                   TGSTDPGIVVGTQLTLPSYGHYELYIGYNLRDSETTLIFVQNTLLFAGLALIALIGGIA
FT                   WVVVRFVVEPIRVAAHTSERLAAGDLAVRIPERGEDVLASLARSFNGMADSLQNQINQL
FT                   ATLSQLQQRFVSDVSHELRTPLTTIRLAGDVLYDQRDTFPPATERTAELLHTQVERFDR
FT                   LLSDLLEISRYDAGSVALDLGPTNLVRLAGEVMDELRTLSGQNGSVLRLDAPGGHFDVG
FT                   MDPRRIRRVVRNLLGNAIEHGEGKPVVVTVDSNETAVALTVRDDGIGMNQQDVNHVFDR
FT                   FWRADPSRKRTIGGTGLGLAISLEDVTLHSGWLQVWSAPGEGSCFRLTLPRVPGGEIAA
FT                   SPLPLPPIDADAAAGASRRAATEEPRPLPESGARA"
FT   gene            539784..541457
FT                   /gene="lpqB"
FT                   /locus_tag="Lxx05370"
FT   CDS_pept        539784..541457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpqB"
FT                   /locus_tag="Lxx05370"
FT                   /product="lipoprotein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05370"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88510"
FT                   /db_xref="GOA:Q6AGI5"
FT                   /db_xref="InterPro:IPR018910"
FT                   /db_xref="InterPro:IPR019606"
FT                   /db_xref="InterPro:IPR023959"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AGI5"
FT                   /protein_id="AAT88510.1"
FT                   /translation="MVAAALVASLVVLLAACASIPDSGPVRQGGPIAQVSDQLDLDFNP
FT                   SPPEKGASPQRIVQGFIDAASSPKNNFQIAREYLTRPMGAAWNPDESVTVDDGRNRTYD
FT                   HDGNQWSVDVSPVANVDSTGVYHPVLSKAPVGLSYELVRQDGEWRISVAPNGVVVDDPT
FT                   FRSVYSQQTLYFYSPGFGYLVPDARWFPARVAAAATRVASAVLAGPAKWLNGAVVSAFP
FT                   QGAQLAVPSVTTNGGVARVDLSSEAAQADQAQLQRMQVQLEQSLASLARSVELSIEGNV
FT                   QQIPPLNDAAAALQDPPVDSHPIVSRGDSFGLLNGSTVTALSGLSDRVAALQPTAVTVN
FT                   AARDQAAVLSAAGAFLVRRSGESLRVEARPGIIAPAFDNDGWVWTVPADSPAALQATGA
FT                   TGEPHLVKADWPGATGIVSLAVSRDGTRVVAVLRTASGYSLAVAGVLRGSGGVPTELTA
FT                   PIELAVGEGEPVSVAWTSGLAVAVLSVTNGDATGISEQTIGGTMTTTTGPALGGVIVGA
FT                   GGLSHYLVLATDGTLQAPTGTGWQTQADKVGAVAVQLGQP"
FT   gene            541647..542396
FT                   /gene="comF"
FT                   /locus_tag="Lxx05380"
FT   CDS_pept        541647..542396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comF"
FT                   /locus_tag="Lxx05380"
FT                   /product="competence protein F"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05380"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88511"
FT                   /db_xref="GOA:Q6AGI4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGI4"
FT                   /protein_id="AAT88511.1"
FT                   /translation="MTKTSLKRPVLLSLARSALLDAAGVLLPVRGAGCGAGDRSVCSVC
FT                   ERALSPEVAANAFSGLPIWSALRYDGAARRILLAFKDGDRTDAATFLARSFRPAVAEAQ
FT                   CAMAPAPTAAAGAAALLPVLIPSTRSAWRRRGYHPTGMLLARSRMLVPPLWRALRLARQ
FT                   TADQAGMPGNRRAENRAGSMRASPRLAGRRCLIVDDILTTGATVTEAARAIAEAGGEVV
FT                   GAVTLAHTPLRGGEERGSERGLRKGRS"
FT   gene            542635..543333
FT                   /locus_tag="Lxx05390"
FT   CDS_pept        542635..543333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05390"
FT                   /product="sigma-54 modulation protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05390"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88512"
FT                   /db_xref="GOA:Q6AGI3"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGI3"
FT                   /protein_id="AAT88512.1"
FT                   /translation="MDINIVGRNLGITDRFREYAAEKSEKVAHLAERAISFEIKVSRHN
FT                   EKLGTQNGDDRVELTLVGPRATVRSEATGTDKYAAFDIALGKLLERVRRAKDRRKVHRG
FT                   QHRPTSLREASTQGFSAVGLSAASVAVLEQVRTGSVPAIAADAEPVGAEEEYCPVVIRR
FT                   KVFASVPMTVDDALYYMELVGHDFYLFVDQETKRPSVVYRRKGWDYGVISLDDDAEELQ
FT                   EVATASRKLG"
FT   gene            543545..546352
FT                   /gene="secA"
FT                   /locus_tag="Lxx05400"
FT   CDS_pept        543545..546352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="Lxx05400"
FT                   /product="preprotein translocase SecA subunit"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05400"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88513"
FT                   /db_xref="GOA:Q6AGI2"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AGI2"
FT                   /protein_id="AAT88513.1"
FT                   /translation="MASVLEKVLRVGEGRVLRRLEAYAKAVSALEDDFSALADDELMHE
FT                   TVELRERYSKGESLDDLLPEAFAAVREASKRTLGMRHFDVQIMGGAALHLGNIAEMKTG
FT                   EGKTLVATTAAYLNAITSRGVHVITVNDYLASYQSELMGRVFRALGMTTGVILAGQTPE
FT                   ERREQYAADITYGTNNEFGFDYLRDNMAWQASDMVQRGHYFAIVDEVDSILIDEARTPL
FT                   IISGPSSGEANRWFNEFANLAKRLEPQVDYEVDEKKRTVGVLESGIEKVEDYLGIDNLY
FT                   ESANTPLISFLNNAIKANALFKRDKDYVVMNGEVLIVDEHTGRILVGRRYNEGIHQAIE
FT                   AKEGVEVRAENQTLATVTLQNYFRLYKKLSGMTGTAETEAAEFMSTYKLGVVPIPTNKP
FT                   MQRIDQDDLIYKNEKAKFDQVVEDIAKRHEKGQPVLVGTTSVEKSEYLSRLLAKKGVRH
FT                   EVLNAKNHAREAAIVAQAGRLGSVTVATNMAGRGTDIMLGGNAEFIAVAEMNARGLSPV
FT                   QTPEEYEAAWDQVFGVVKATVAGEAEEVIKAGGLYVLGTERHESRRIDNQLRGRSGRQG
FT                   DPGESRFYLSLTDDLMRLFNAGAAESLMGRTSVPDDMAIESKVVSRAIRSAQSQVEARN
FT                   AEIRKNVLKYDDVLNRQREAIYGDRRHILEGDDLHERVQTFLTEVVDDILDQHTGEGSG
FT                   DDWDFDALWAELKTLYPVGVSIDEVIAEAGNKGRINRDFMRREILSDARIAYKSREESL
FT                   GETAMRELERRVVLSVIDRRWRDHLYEMDYLKDGIGLRAMAQRDPLVEYQREGYAMFQQ
FT                   MMGAIREETIGFLFNLEVEVNQAPNGVESSAVAAKGLARGDSEARLSYSAPGERGEVEV
FT                   RNQRGQIEQAATARAQQHSSAAVAAPEQGATQRGAFGQRVSAADDAAPANRAERRAQKK
FT                   PTKRH"
FT   gene            546476..546916
FT                   /locus_tag="Lxx05410"
FT   CDS_pept        546476..546916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05410"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05410"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88514"
FT                   /db_xref="GOA:Q6AGI1"
FT                   /db_xref="InterPro:IPR021299"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGI1"
FT                   /protein_id="AAT88514.1"
FT                   /translation="MRSSFIAATVFLVLGVGSGMFFREFTKANHFQGATQLSLVHAHLL
FT                   VLGFVVFLLVLILDRLFGLAYGSLFAWFFWIYNAGLLLTAGAMMAHGVLTVLGEKISAG
FT                   VAGIAGIGHILLTVALVLFLVVLGRGVFAAAAHDRSAPDPQL"
FT   gene            547250..548461
FT                   /gene="tnp"
FT                   /locus_tag="Lxx05430"
FT   CDS_pept        547250..548461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnp"
FT                   /locus_tag="Lxx05430"
FT                   /product="transposase, ISlxx5"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05430"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88515"
FT                   /db_xref="GOA:Q6AGR9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGR9"
FT                   /protein_id="AAT88515.1"
FT                   /translation="MQGRVPGAAEQRALAPRSGGTSRNQPEHGIPLGQSNGRRIYPDGR
FT                   VVDYKDRVPVVVDPVQRASMRSLEAALHPRFLSLQERELIRDLTRAGLSLCRVAAKLGR
FT                   SVSTISREIRRNQLPGEGGYHPYVAHRKAASRRPRPKATRLVRNPQLRSYVQRKLTLRW
FT                   SPEQISRSLIREFPGDAEMRVAHETIYQAFYVQGRGQLRRELTMVLRTGRAKRKPHRSG
FT                   AARRHRFADPMVMISDRPAEIEDRAVPGHWEGDLIIGGHRNSAIGTLVERSTRFVMLIH
FT                   LPIDRTAESVRDGLISAVKTLPRELRRSITWDQGSEMAAHKSFTIATDIPVYFCDPASP
FT                   WQRGSNENTNGLLRQYFPKGKGTDLARFTATDLTNVAHELNTRPRKTLGWETPAERLAK
FT                   LLAS"
FT   gene            548467..549378
FT                   /locus_tag="Lxx05440"
FT   CDS_pept        548467..549378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05440"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05440"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88516"
FT                   /db_xref="GOA:Q6AGH9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGH9"
FT                   /protein_id="AAT88516.1"
FT                   /translation="MLQQPLESAQDLTPRIAVDALAWRSWLDANEDSSDGVWLLLAKKG
FT                   TTEPTSLTYAQALDEALCSGWIDGQKRSHDAAAFLQRFTPRRKASLWSERNIRLVEALI
FT                   EACRMRERGHAEIARAKADGRWERAYAGAKTAEVPEDLASARAGSAAAAERFATLNRTN
FT                   RYAVRTSTGSSRPPARRAARTGWRRGCWSGERHPIPSPSDDAGFGIVVPSSGNAASSRE
FT                   GRSMRNVLWGVVALLGWLALVAAALCVTTPGDEKPVAMVDAVIAVIAGVSALVGALLFV
FT                   RSRVAVDPRRVAVPPSPEAAER"
FT   gene            549673..552174
FT                   /gene="pon1"
FT                   /locus_tag="Lxx05450"
FT   CDS_pept        549673..552174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pon1"
FT                   /locus_tag="Lxx05450"
FT                   /product="penicillin-binding protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05450"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88517"
FT                   /db_xref="GOA:Q6AGH8"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGH8"
FT                   /protein_id="AAT88517.1"
FT                   /translation="MPTSERFPDYSHLRAINERIEPLKRFELRTPRTQRRAVLQFLGLA
FT                   VVAAVLTSLLLLPCFLVASVAAAVGIANFNQLPGDLKIQEFAQNSTLYAKQGGQDVPIA
FT                   QFYAQNRRDVGWADIAQSVKDAAVAVEDPRFYSEGAVDLFGTVRGALSTLVGGDLQGGS
FT                   SITQQYVKNVEVEKCEALTDQKKVQACYDDAAGVTVQRKLQEMRYAVGLGKKYSKKDIL
FT                   LGYLNVVGFGGQVYGIQAAAAYYFGVAAKDLTLSQAATLVAMVNNPANLRIDEPGNKDN
FT                   GAANGYELTKERRDYVLDRMYVYQKITAADRDAAQKTPIQPAITPSSSGCAAAAHYNAA
FT                   FFCDYVRDVILNDSAYGKTSDDRWGTLNRGGLKIYTTLNLDLQAVAQQSLSKYIPASRP
FT                   GIDLGASTVSVELGTGRIVTMVQNRAFNNTDQPADGTTAVNYNTDEAYGGSQGFQTGST
FT                   FKAFDLAAWLEAGHSLYESVDASKHLFPMSDFSNSCGSISGPPWPVQNDEGSANRLSVI
FT                   SATAESVNSAFAMMATKLDLCSILKAAKSLGVHTAATGGTLNSYPSMILGTNTVSPLTM
FT                   ATAYAGIANGGSFCTPVAIDKVLNTDGTEHKVSPTTCTQGLSKDIAAGVDYALQGVMKN
FT                   GTATSANPWDDTPVLGKTGTTDDSLQNWLVTSTTKVAQATWVGNVSGTTPLRSLSFHGI
FT                   GGGNVKFSIVKPIQKALDKVYGGSDFPKPADTALYGNRISVPDVSGKTFAEARDLLQGL
FT                   GLNVAPDPIPTMSYQPAGMVAGTNPAAGTLVDGGASVTIQVSSGQSLTVPPGPPTGTPT
FT                   PQPTDRGGHGGDGGGNGNGGG"
FT   gene            552594..552728
FT                   /locus_tag="Lxx05460"
FT   CDS_pept        552594..552728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05460"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88518"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGH7"
FT                   /protein_id="AAT88518.1"
FT                   /translation="MLLTLSLIGTVAIEAPAAAGAKTYPYTLNSGQLAIGFASDGSIQ"
FT   gene            552768..555526
FT                   /pseudo
FT                   /locus_tag="Lxx05470"
FT                   /note="similar to conserved hypothetical protein"
FT   gene            555976..556524
FT                   /locus_tag="Lxx05500"
FT   CDS_pept        555976..556524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05500"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05500"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88519"
FT                   /db_xref="InterPro:IPR010852"
FT                   /db_xref="InterPro:IPR021005"
FT                   /db_xref="InterPro:IPR023286"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGH6"
FT                   /protein_id="AAT88519.1"
FT                   /translation="MSIMHESTVQRVDDVELALDLANGLSQWRRGRLASSVLVHDTDVG
FT                   VLVQRLPDSMRLRRLRRELRAVFAAKTLAEACGILNGMLAGAGANPVLVIGPTGRWQLR
FT                   LRSTRPDPLSRTAVNTATALAELVGDESGWDGLRRCSAERCDDYFLDRSRNASRRYCSR
FT                   TCANRMNARSFRRRRQGDE"
FT   gene            complement(556773..557090)
FT                   /locus_tag="Lxx05505"
FT   CDS_pept        complement(556773..557090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05505"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05505"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88520"
FT                   /db_xref="InterPro:IPR015018"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGH5"
FT                   /protein_id="AAT88520.1"
FT                   /translation="MAGVRYEFEAELFRWAARRDLWVFARLPEEVSEEIRSQPHPQAGF
FT                   GSVRVEVTLGGSRWSTSVFPESAEGAYVVAIKGTVRRREGVEIGDTVRLGVETVSSASG
FT                   L"
FT   gene            557322..557684
FT                   /locus_tag="Lxx05510"
FT   CDS_pept        557322..557684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05510"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88521"
FT                   /db_xref="GOA:Q6AGH4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGH4"
FT                   /protein_id="AAT88521.1"
FT                   /translation="MLAYINGVLSIVGGAIVLFVRDSMARADDTGALAGITTSAILSIV
FT                   IGIVVLLVARGLLNGNTFSRAVVTIVMIISVLNGILQLLTHQLAGGVVEILWAFLVLSL
FT                   LFTARANAFFHARPSN"
FT   gene            557698..558378
FT                   /locus_tag="Lxx05520"
FT   CDS_pept        557698..558378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05520"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05520"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88522"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGH3"
FT                   /protein_id="AAT88522.1"
FT                   /translation="MGAGRCHRRPAIEGMWAGMRWPKWLWRGPDRTVRTRPFDEAALPK
FT                   PSAPTREQSVEEGMLLAEYATRMVMKNHIMVDTIQDGHDYVPSRHTAEAAAMLRVLAAE
FT                   QGEAAGRLDEDLSIAEGLSGDAQHPHDYRDVDVANLRLRRDSATDLATALRAKSDSEEE
FT                   LLALVERGRRDAWDEIGQAIEASLDAFSGVEALKADYERERPARLKLLIWRDLAQLREE
FT                   RTGY"
FT   gene            complement(559248..560057)
FT                   /gene="tpase2"
FT                   /locus_tag="Lxx05530"
FT   CDS_pept        complement(559248..560057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpase2"
FT                   /locus_tag="Lxx05530"
FT                   /product="transposase, ISlxx1"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05530"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88523"
FT                   /db_xref="GOA:Q6ACF5"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ACF5"
FT                   /protein_id="AAT88523.1"
FT                   /translation="MTIKNSTSDVPIPKTSKQVSSKLAYLARALKTPTIGRVWEDLAGR
FT                   ARDENWAHEEYLAAVLERQLADRESAGTTMRIRTAHFPAIKTLEDFNLDHLPSLRKDLL
FT                   AHLATSTFVVKAENVILLGPPGIGKTHLAIGLGVKATHSGHSVLFDTANNWIARLAAAH
FT                   HQGQLEAELKKIRRYKLIIIDEIGYIPFDTDSANLFFQLVASRYEQGSIMVTSNLPFSR
FT                   WGEIFGDDVVASAMIDRLVHHSEVLTLNGDSYRTHGRRDLIKQTDKN"
FT   gene            complement(560615..561312)
FT                   /pseudo
FT                   /gene="tpase1"
FT                   /locus_tag="Lxx05540"
FT                   /note="similar to transposase, ISlxx1"
FT   gene            complement(561497..561982)
FT                   /locus_tag="Lxx05560"
FT   CDS_pept        complement(561497..561982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05560"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88524"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGH1"
FT                   /protein_id="AAT88524.1"
FT                   /translation="MRDERYEILDTQVFAVNKSLHDRVLAPANERLLAALLRDRDSGER
FT                   VLVGSFHAAPLTASNSLRRKQIAAAHDGMRSLAPDTPAIMVGDFNYPWFIRGLERHLTT
FT                   SGYTLKRSDEPTYLLYKFFSGHFDFVTSTGFDVERVNVLPAGASDHRAIRLDAQRAA"
FT   gene            562189..563100
FT                   /pseudo
FT                   /locus_tag="Lxx05570"
FT                   /note="similar to conserved hypothetical protein"
FT   gene            563132..563236
FT                   /locus_tag="Lxx05580"
FT   CDS_pept        563132..563236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05580"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88525"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGH0"
FT                   /protein_id="AAT88525.1"
FT                   /translation="MLTVPERLRSVGDPWESFGESPGSIGTLLDWVAP"
FT   gene            complement(563613..564092)
FT                   /pseudo
FT                   /locus_tag="Lxx05590"
FT                   /note="similar to DNA ligase"
FT   gene            564186..564614
FT                   /locus_tag="Lxx05600"
FT   CDS_pept        564186..564614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05600"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88526"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGG9"
FT                   /protein_id="AAT88526.1"
FT                   /translation="MPHTGDTAHHDDRVQFLVVGDGTSLTELEAELALLPLCSRGRVFV
FT                   EVEDVREVIPLAAPMRMTVTWLVRTERTGRPGTSERCAHGEAAMRAVRAWAAEMLCDGP
FT                   GQTRAIVMGSWELVTEIREHLTDTVGMPVEAIAQPVPR"
FT   gene            complement(567651..568451)
FT                   /locus_tag="Lxx05610"
FT   CDS_pept        complement(567651..568451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05610"
FT                   /product="oxidoreductase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05610"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88527"
FT                   /db_xref="GOA:Q6AGG8"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGG8"
FT                   /protein_id="AAT88527.1"
FT                   /translation="MRARASAPSRPRTSLPPGIGWPSSAGTPNAREPSPNGSARPLSSP
FT                   TSTASTMSGRSPAPSSSGTRPSTSSPTTPAVLNHRRERTADGHERTIQANHFAPFLLTT
FT                   LLLPRLRHTASLGRDVRIIATASVARRFGDLRLDDLDWSRRPWRGDWPAYGTAKIATIL
FT                   FTEQLAEVLTGTGIAAYSFHPGFVVTNFGATSLIRLGSANGIAPTAGAAPLERLAAEAK
FT                   VGAPTGSYFDRFRANGKRSEQAREAQLGRDLWTVTERIVGVQQG"
FT   gene            569759..570673
FT                   /locus_tag="Lxx05620"
FT   CDS_pept        569759..570673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05620"
FT                   /product="polyphosphate/ATP-NAD kinase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05620"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88528"
FT                   /db_xref="GOA:Q6AGG7"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AGG7"
FT                   /protein_id="AAT88528.1"
FT                   /translation="MAAQRYILVVAHTGRRDSLAAGVSVCRQLLAAGVVPVLSEGERRD
FT                   LLAAEPELATVVALGAEVPPAELELVIVLGGDGTILRAAELVRGCPAPLLGVNLGHVGF
FT                   LAESERDDLETAVARGLAKDYEVEERMTLSARVKVGEEVVYESWALNEATVEKANRERV
FT                   LEVVIEADGRPMSSFGCDGVVMSTPTGSTAYSFSAGGPVVWPGVAALLLVPLSAHALFS
FT                   RPLVVDADSSLAVELLEGAGGEGVLWCDGRRAFDLPRGARVVVRRSPIPVRLARLHPGP
FT                   FTDRLVRKFTLPVTGWRGPDGRD"
FT   gene            570666..572405
FT                   /gene="recN"
FT                   /locus_tag="Lxx05640"
FT   CDS_pept        570666..572405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recN"
FT                   /locus_tag="Lxx05640"
FT                   /product="DNA repair protein RecN"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05640"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88529"
FT                   /db_xref="GOA:Q6AGG6"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGG6"
FT                   /protein_id="AAT88529.1"
FT                   /translation="MTERRRAVSGGGIEEIAIRDLGVIAGAALPIGPGFTAITGETGAG
FT                   KTMVVSALGLLLGERADTGAVRAGSAQAWVEGRWRVPPSGPVADRVHDAGGELDPLDGG
FT                   QAELVLSRSVSAEGRSRAVVGGRSAPVSVLTELGGRLVVVHGQSDQLRLRSATAQREAL
FT                   DRFAGPEFAAALDAYAQVFYRWRDDRAELDRLVADRERRSREADDLRIAMAEIEAVAPQ
FT                   PREDDELAERAERLSNLEELRLAAARARERLSAEESEAADALGLLDSARRQLERAAPHD
FT                   QELAPLAEAVAAANYAVSDIAAQLSTYLAALDTDGARELETVQERRAALATLVRKYGPS
FT                   LDDAIATLETGSLRLLELDGDAELIQRLAAEVEADGRLVAELAGDLTARRLDAAARLGA
FT                   AVSDELRALAMPDARVVVEVTDREECTATGRDQVAILLRPHPGAEPRPLGKGASGGELS
FT                   RAMLAIEVVIAGSDPVPTFIFDEIDAGVGGASAIEIGRRLARLAQSAQVIVVTHLAQVA
FT                   AFATNHLTVVKGSDGSVTASSVRRLDGEERIAEMARLLSGLPDSASGLAHARELVETAA
FT                   AAR"
FT   gene            575315..577036
FT                   /gene="pyrG"
FT                   /locus_tag="Lxx05650"
FT   CDS_pept        575315..577036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="Lxx05650"
FT                   /product="CTP synthase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05650"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88530"
FT                   /db_xref="GOA:Q6AGG5"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AGG5"
FT                   /protein_id="AAT88530.1"
FT                   /translation="MDNSDAGLSIKRAQLGGTTKHIFVTGGVVSSLGKGLTAASLGNLL
FT                   TARGLRVVMQKLDPYLNVDPGTMNPFQHGEVFVTDDGAETDLDIGHYERFLDINLGQSA
FT                   NVTTGQIYSNVIAKERRGEYLGDTVQVIPHITDEIKRRMRLQAQPGPDGDPAPDVIITE
FT                   IGGTVGDIESQPFIESARQVRHELGRKNCFFVHVSLVPFMNASGEQKTKPTQHSVAALR
FT                   SIGIQPDALVLRSDRPVSEPNKRKIALMCDVDEAAVVNAVDVPSIYDIPSMLHDQGLDA
FT                   YIIDQLGLTQAADVDWAGWSRLLEAVHDPKHTVTIGLVGKYIDLPDAYLSVTEALCSGG
FT                   FAHDAKVALKWIASDECQTADGAAAQLSDVDGICVPGGFGVRGIEGKLGALRFARENGI
FT                   PALGLCLGLQCMVIEYARNEAGLAGASSSEFDPDTAFPVIATMAEQVDIIAGGDLGGTM
FT                   RLGLYPAALAGGSIVAELYGAAEVSERHRHRYEVNKAYRAQIADAGLWFSGTSPDGHLV
FT                   ECVELPRDVHPFYVGTQAHPELRSRPNRAHPLFAGLIGAALDRQKASLLFDVAADA"
FT   gene            577036..577680
FT                   /gene="mutT"
FT                   /locus_tag="Lxx05660"
FT   CDS_pept        577036..577680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="Lxx05660"
FT                   /product="NUDIX hydrolase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05660"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88531"
FT                   /db_xref="GOA:Q6AGG4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGG4"
FT                   /protein_id="AAT88531.1"
FT                   /translation="MTEPLRDETVDPEIVASEPVFRGAVWDVRRDVFRYNGEEIAREYV
FT                   DHTGAVAVLALDEEERVLLIRQYRHPVRHLEWEIPAGLLDIAGEDPLDAAKRELAEEAD
FT                   LEADEWNVLADIFSSPGGNDEAIRIYLARGVRATAEAFAREDEEADITVRWAPLEEAVA
FT                   AVLERRVHNAPLTVAVLAAQAARTAGWSALGAADAPWPSHPKLRRAEPDRR"
FT   gene            577677..578582
FT                   /locus_tag="Lxx05670"
FT   CDS_pept        577677..578582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05670"
FT                   /product="integrase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05670"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88532"
FT                   /db_xref="GOA:Q6AGG3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGG3"
FT                   /protein_id="AAT88532.1"
FT                   /translation="MTVPADVDAYLRHVAIERGLSANTVAAYRRDLAVYAGWLAVEQVT
FT                   QTAAVTPATVSAYLQHLATRGESPLTASSLARMLSTVRSFHRFLLEEGRVTVDAAHDIR
FT                   PPKLPSRLPKAIGVDQVAALLAATDGDDLADLRDKALLELMYATGARVSEAVGLNVDDV
FT                   IDTDVVRLTGKGAKQRIVPLGSYARAAVSAYLVRARPTLSTRGRATPALFLGMRGARLS
FT                   RQNVWLIIRAAADRADLTVEVSPHILRHSFATHLLAGGADVRVVQELLGHSSVATTQLY
FT                   TLVTADTLRDVYVSAHPRAR"
FT   gene            578731..579630
FT                   /gene="parA"
FT                   /locus_tag="Lxx05680"
FT   CDS_pept        578731..579630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="Lxx05680"
FT                   /product="chromosome partitioning protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05680"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88533"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGG2"
FT                   /protein_id="AAT88533.1"
FT                   /translation="MTRNDEARTELPGMDDPALTAPLGPTGRPLRSFPAPGTLKQHGPA
FT                   KIVALCNQKGGVGKTTTSINLGAALAEYGRRVLAVDFDPQGALSAGLRAKTHDVTTIYD
FT                   LLLNRNADVREAVQATSVPGLDIVPANIDLSAAEVHLVNEVAREQILASVLRKVSEDYD
FT                   VVLIDCQPSLGILTVNALTASHGVLIPLECEYFALRGVALLIETIDKVRERLNPAIGLD
FT                   GILATMYDSRTLHSREVLERVADAFGDRVLETVISRTVKFPDASVAASPITQFAPEHAA
FT                   AESYRQLARELIFRGAVA"
FT   gene            579614..580453
FT                   /locus_tag="Lxx05690"
FT   CDS_pept        579614..580453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05690"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05690"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88534"
FT                   /db_xref="GOA:Q6AGG1"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGG1"
FT                   /protein_id="AAT88534.1"
FT                   /translation="MALSPDGGQRGDGSLAEAESAGFRVAVGAFEGPFDLLLSLIAKHE
FT                   LDITEISLSTVTDEFIAYLRELDADESLDEASEFLLVAATLLDLKVAGLLPQGELVDAE
FT                   DVALLEARDLLFARLLQYRAFKEASEWFSGRLEAESTRHARTVRLEGKYRQRTPELVWT
FT                   LSLEDFAALATVAMTPREIPAVGLVHLHAPLVSIREQAALVVGMLRRGEPMSFRQLVAG
FT                   SEQKGVVIARFLAVLELYRHAAIAFEQLEPLGELTLRWTAEHWSEESLTNLGADYDG"
FT   gene            580443..581057
FT                   /locus_tag="Lxx05700"
FT   CDS_pept        580443..581057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05700"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05700"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88535"
FT                   /db_xref="GOA:Q6AGG0"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGG0"
FT                   /protein_id="AAT88535.1"
FT                   /translation="MTVDGTETEVQPVAVEDERIERALEAILMVADEPMSLVTLATAVG
FT                   APVKRVRQAVDALAADFDGSPDAEGRPRVRRGFELREVGGGWRVYVRAEFDAVVSGYVL
FT                   QQNPPRLSQAALETLAVIAYKQPISRGAIASIRAVNVDSVVRTLLGRGLITELFADSDT
FT                   GAINYGTTDLLLTQLGVNSIEELPKISPLLADGAEGFDDVR"
FT   gene            581047..581829
FT                   /gene="rsuA"
FT                   /locus_tag="Lxx05710"
FT   CDS_pept        581047..581829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsuA"
FT                   /locus_tag="Lxx05710"
FT                   /product="RNA pseudouridine synthase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05710"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88536"
FT                   /db_xref="GOA:Q6AGF9"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGF9"
FT                   /protein_id="AAT88536.1"
FT                   /translation="MSAEPQGERLQKVMAAAGVASRRVSEELIAAGRVSVNGTVVTELG
FT                   RRVDPVVDHVAVDGAAVQLDTTLRYVMLNKPVGVVSSLRDEQGRPDLSRFVADYEERLF
FT                   NVGRLDAETSGLLILTNDGELAHVLAHPRFGVTKTYIARVRGAVTPQTIGRLTRGVELE
FT                   DGPIAADRAKLLQSDPGGGSLVEVTLHSGRNRIVRRMLAEVGHPVVELVRRQFGPLHLG
FT                   TLKAGALRDLTKAELGSLLTISREDGSQARSGGGPGAG"
FT   gene            581839..582927
FT                   /gene="tyrA"
FT                   /locus_tag="Lxx05720"
FT   CDS_pept        581839..582927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrA"
FT                   /locus_tag="Lxx05720"
FT                   /product="prephenate dehydrogenase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05720"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88537"
FT                   /db_xref="GOA:Q6AGF8"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGF8"
FT                   /protein_id="AAT88537.1"
FT                   /translation="MTETASRLSGPVRVVGTGLLGASVGLGLRARGVDVLLADASTAHL
FT                   RLATDYGAGRPDDGGAEPALVVVAVPPDLVARVVAAELAAHPGAIVTDVASVKVAPLAE
FT                   LEQGGADLSRYVGSHPLAGREKGGPSAARADLFIGRPWVVAVRPENPRAAVSLVEALIL
FT                   DLGATPIELGAAEHDAAVALVSHAPQIVSSLMAKRLSGSTDAALGLAGQGVRDVTRIAG
FT                   SEPELWVQILGANAPAIVEILRAYRDDLDRVLVALGDVDAPGSRRIIAEEIAGGNAGVS
FT                   RLPGKHGQDKRFASLTVMVEDRPGELARLLHELGELDVNLEDLRLEHSPGAPFGLAQIA
FT                   VLPEALHRTVNDLTDRGWRIAG"
FT   gene            582924..583607
FT                   /gene="cmk"
FT                   /locus_tag="Lxx05730"
FT   CDS_pept        582924..583607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmk"
FT                   /locus_tag="Lxx05730"
FT                   /product="cytidylate kinase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05730"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88538"
FT                   /db_xref="GOA:Q6AGF7"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AGF7"
FT                   /protein_id="AAT88538.1"
FT                   /translation="MTEPATPPVVLAVDGPAGSGKSSVSKAAAGRLGWAYLDTGAAYRA
FT                   LGWYVVERGLDPADPAVVIDSLPDFDYRIGTDPDTYRVFVGERDVTEAIREPRVTAVVS
FT                   AIARVPQVRASLTRLFREIIAGSGKAGIVVEGRDITTVVCPDALVRILLTADEAVRMNR
FT                   RSAELTGHSAARVGEALRKRDAADSRVVDFMNAAEGVITVDSTELDFDQTVDAVIAVVQ
FT                   KETHV"
FT   gene            583660..585105
FT                   /locus_tag="Lxx05740"
FT   CDS_pept        583660..585105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05740"
FT                   /product="GTP-binding protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05740"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88539"
FT                   /db_xref="GOA:Q6AGF6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AGF6"
FT                   /protein_id="AAT88539.1"
FT                   /translation="MDDDLALQRAVALRSGLDDYELDDADLDLLEVDGEDADAIAFLPA
FT                   LPVLAIVGRPNVGKSALVNRILGRREAVVEDTPGVTRDRVSYRAEWNGRRFTVVDTGGW
FT                   EPDARGIDASVAAQAEVAIDLADAVMFVVDAMVGATSTDEHVVRLLRKSDKPVFLAANK
FT                   VDDARQEPSATELWSLGLGEPHPVSALHGRGVADLLDKILKALPDVSAVAKQEVGGPRR
FT                   VAILGRPNVGKSSLLNKAAGEERVVVNELAGTTRDPVDEQVELGGRVWRFVDTAGIRRR
FT                   VHLQQGADFYASLRTSTALEKAEVAVVVLDVSQPISEQDVRIIDLVLESGRALVLAFNK
FT                   WDLLDDERRRYLEREIEQDLAHVSWAPRVNISARTGRHLEKLVPALERALESWETRIPT
FT                   GKFNAFLAELTSAHPHPVRGGKQPRILFGTQSTSRPPTFVVFTTGFLDPGYRRYVIRRL
FT                   REVYGFEGTPIVLNMRVREKRKH"
FT   gene            585124..585603
FT                   /locus_tag="Lxx05750"
FT   CDS_pept        585124..585603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05750"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88540"
FT                   /db_xref="GOA:Q6AGF5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGF5"
FT                   /protein_id="AAT88540.1"
FT                   /translation="MRSLTLAFPMALDSSDVTGEKDERERPLGAPLWCVAILSASVGVQ
FT                   AVAPAYPGVGTIALVAGTLGLLMAIAVIASRTQRTAAFRIGFLPTVLALIAVAAFVLSG
FT                   LGVDWLTREAAPPWASWSLGSMAALVVACCLIGANERHRRRENGAARKRRVASLL"
FT   gene            585871..585950
FT                   /gene="Pro"
FT                   /locus_tag="Lxx05760"
FT   tRNA            585871..585950
FT                   /gene="Pro"
FT                   /locus_tag="Lxx05760"
FT                   /product="tRNA-Pro"
FT   gene            complement(586105..586299)
FT                   /locus_tag="Lxx05765"
FT   CDS_pept        complement(586105..586299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05765"
FT                   /product="phage-related protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05765"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88541"
FT                   /db_xref="GOA:Q6AGF4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGF4"
FT                   /protein_id="AAT88541.1"
FT                   /translation="MADAGVPLHVLQEILGHASMETTRGYIHPDDRHLASAAEQANAFL
FT                   STDGQRKQTRHGSPSSKSL"
FT   gene            complement(586550..586888)
FT                   /locus_tag="Lxx05770"
FT   CDS_pept        complement(586550..586888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05770"
FT                   /product="phage-related integrase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05770"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88542"
FT                   /db_xref="GOA:Q6AGF3"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGF3"
FT                   /protein_id="AAT88542.1"
FT                   /translation="MRVLDEAVREGLLTITPAKNRAKRSLNRNAFRTQSAEQASPRAHA
FT                   IPDMKTLNKLAKACGRVDQSYSDFRVMLTALLAARSSEVSGLQVGDVRFDANLVVISSS
FT                   GITADFSR"
FT   gene            complement(586937..587290)
FT                   /locus_tag="Lxx05780"
FT   CDS_pept        complement(586937..587290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05780"
FT                   /product="phage-related integrase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05780"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88543"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGF2"
FT                   /protein_id="AAT88543.1"
FT                   /translation="MKVSTDMERRSYGIRARARWTDPITKHRVTRSEIVPDEAAAHNFF
FT                   NQLRNSSVKGMDTMMTLTEFVTAIGERWARGLDPTSTGETYGFGLKLRVLPALGHLPVT
FT                   QITADIIDHTIDA"
FT   gene            complement(587906..588271)
FT                   /pseudo
FT                   /gene="tnp"
FT                   /locus_tag="Lxx05785"
FT                   /note="similar to transposase, ISlxx4"
FT   gene            589031..589908
FT                   /pseudo
FT                   /locus_tag="Lxx05800"
FT                   /note="similar to sugar uptake ABC transporter, permease
FT                   protein"
FT   gene            589905..590750
FT                   /gene="malG"
FT                   /locus_tag="Lxx05820"
FT   CDS_pept        589905..590750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malG"
FT                   /locus_tag="Lxx05820"
FT                   /product="ABC transproter, permease protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05820"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88544"
FT                   /db_xref="GOA:Q6AGF1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGF1"
FT                   /protein_id="AAT88544.1"
FT                   /translation="MTATTRRGRRTPSVGTVIRFVVVLAAAGLVFLPVYVSVLSAFTEG
FT                   GTIARNGLIPSLGEVTLDNFRQAIDAVPLLPEYLVSIAVVTLQTLGNLITGSLAAYALV
FT                   FPAWPGRRIAFALVLLTLAVPGEALVIPNYEFVSGLGLRDTIIGVVLPYLAMAYPIFLL
FT                   RQAFSAVPTELWEAARLDGSGHIRTLVTIIIPACRPQVTTAIIWSAFAAWNGFFWPLLI
FT                   TDSVAVRTIQVGVSQLDASEASEPSVIFAGAVLVVIPTIALVIAAQRFLVNGLARGALR
FT                   "
FT   gene            590805..591869
FT                   /locus_tag="Lxx05830"
FT   CDS_pept        590805..591869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05830"
FT                   /product="glycerol-3-phosphate ABC transporter, receptor
FT                   protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05830"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88545"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGF0"
FT                   /protein_id="AAT88545.1"
FT                   /translation="MNRKLLSIAAAATMTVALAACTSLASGASTADTGGAHGPSALKNA
FT                   SGTTEITIWHGLGAANGIALQQEIDTFNSTNKDRIHVTVTYQGVYADLLAKYTAAIKGH
FT                   STPTIVLAGDIATGFMTDVKQSIPAAEMAKANPSDLQLADLAGAARNYYTVGGVQQAVP
FT                   LNVSTPMLWVNRSILRQAGIADSAPLNTLDQVVAAAKQIKSNTGIAGFSMPDDDWYIEQ
FT                   LTAAAAQARSVIEVVDAEGAVCAVVRPADGVDDSRVGERDVVAVLVLGAGGLPRGRAQH
FT                   CGSAGLRVSGRRVDDVVVHRGVSGVRGEAVGELVRCQDSDRNGAGEEDVAGGVLRDECP
FT                   GEALGTVGERPLAL"
FT   gene            complement(592255..592455)
FT                   /locus_tag="Lxx05840"
FT   CDS_pept        complement(592255..592455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05840"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88546"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGE9"
FT                   /protein_id="AAT88546.1"
FT                   /translation="MSRAYVPVPLPRDRDSDATVRTVSATAELTPVDAAADPIGRLHSA
FT                   SANRRSRDILQMDDVRNLRLL"
FT   gene            complement(592704..593531)
FT                   /locus_tag="Lxx05860"
FT   CDS_pept        complement(592704..593531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05860"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05860"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88547"
FT                   /db_xref="GOA:Q6AGE8"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGE8"
FT                   /protein_id="AAT88547.1"
FT                   /translation="MREEAAKKAKRRKVAVQSSVIVGIVAVLAIAGIAIYSGVSASNSV
FT                   ANPKNLLSGGLLLSAPGKAVTTPAIKQGDAATPAKQELDGKTAHIQVWVDYQCPICEQF
FT                   EAANGATIKQMLTDGTATLETHPVAILDNAPNKQYSTRSAVAVACVADEQPNKFLDVNA
FT                   ALFANQPSEQTGTGLTNAQILKLFKDAGVESKTITDCTNSQTFATFVTNQTKAAAADPQ
FT                   LRNSSGSFGTPTVFVNGQRYQGSVTNAEQFKAFIAAILPEKTSGSVTFPTAAP"
FT   gene            complement(594281..595171)
FT                   /pseudo
FT                   /locus_tag="Lxx05880"
FT                   /note="similar to secreted protein"
FT   gene            595222..599037
FT                   /locus_tag="Lxx05870"
FT   CDS_pept        595222..599037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05870"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05870"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88548"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGE7"
FT                   /protein_id="AAT88548.1"
FT                   /translation="MTRNPPRFRPVPRFGTYGVRVWRLERKSEDDETTSAAARDDALHP
FT                   AKNRTAPHKLSLGAPGLMAGNIADPEWHRWREEIAAIGGPSPLLHFEDSPRTRIELSTT
FT                   HPGGLPQFITGQSTLLSSLIRDELALRTARAAANAITAKGIELRSVRGIEAVHLAIGLA
FT                   QWRHGTQEHSAPILLRPLAIRRYGRDFELKLKGAPFLNPGLARCLAEQFQITLDADVFL
FT                   ALALDNGAFKPQPVIDRLRGLTSHLPWFNVQPRLVVSSFADVAPALRAEADDLDSVMLN
FT                   ALAGNPTALLAVESAFNPVETIKQDERPPATDSLLLDADEEQENVVAQIAAGNSLVVKT
FT                   LPGTGGTQTIVNAIGALVAQHKRVLVVGPRRSSLDDIAQRFAKVGLPGVAVTPRSLRRD
FT                   LIQTIGRNEKAEQPRVTDVDEALVRLRKVLLDYRGALTRRDPVLQVSVLDALRELSRLA
FT                   LLPAPPSTTARLGCRSIETLAGDRSAAADALIRSARLGEFRYGPGDSPWYGASFTTTEE
FT                   GKSAHDLAKKLNRSELPRLLERAKTLIGQTRMRPFETIAELGVYLRLLLDIRETLDRFT
FT                   PAVFDRSLTELIAATASRRESPGMAGANRRRLRKLALEYVRPGVHVTDLNESLRRIQQQ
FT                   RILWNRFAVAGVVPEVPVGIADVQVAYQRVAEDLARLDIPLRRTGTPHSLAALPIAELV
FT                   RQIAGLSAESEVLANLQERTTLLTRLRELELDPLLVDLSARHVPETQVSAELELAWWQS
FT                   VLEALLAADRALLSGNTSVLDRLEADFRLVDEAHASATGKQLAWLLAETWKIGIVDWPD
FT                   EAAALKRLLTAGVPTAESLNAAAPHLSRPLAPVWLISPYEAPSLGREIAFDVVVVVDAG
FT                   AASLAENVPVLRRAKQVVAFGDPVTQTPSRFDIGVHEYGSASAGADVDGLNADSALARL
FT                   SELLPVYTLSRSYRAGGEDLAELVNRRFYGGKIDSLPWAGTYLGHGSLSLHYVTGGQGM
FT                   PDSDTGAVESTDAEVARVVDLVLRHAVERPRESLMVITASERHAVRVNQAVLNAFAKRT
FT                   ELADFILGDRSEPFTVVTLDQSVGQSRDRVVFSIGYGRTPHGRLLSNFGALAEPGGERL
FT                   LAIGMTRARRGMDIVSCFRPEDIDETRMRHGIAALAQVLGEADNLQAAAPEYLSPDADP
FT                   MIADLAKRLARRGLDVQLAYRGKLTLVASNEGRAVVVETDDDVNRGSLRESLRLRPDVL
FT                   RRLGWHYLRVHNFELFADPDTVAGRIAKLIGVQEPDAVTAPVTLPV"
FT   gene            complement(599276..599713)
FT                   /gene="mscL"
FT                   /locus_tag="Lxx05890"
FT   CDS_pept        complement(599276..599713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="Lxx05890"
FT                   /product="large-conductance mechanosensitive channel"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05890"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88549"
FT                   /db_xref="GOA:Q6AGE6"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGE6"
FT                   /protein_id="AAT88549.1"
FT                   /translation="MLSEFKEFILRGNVIDLAVAVVIGAAFTTIVTAIVTNLINPLIGA
FT                   FFQANALDETMIVSLNGSDIRFGAVLGAIVTFLIIAIVVYFAFVFPLNKLKERQERLRS
FT                   KGVVEPGAPVTELDVLTEIRDLLKKQQSQPSGTGKRSDPRP"
FT   gene            complement(599746..600039)
FT                   /locus_tag="Lxx05895"
FT   CDS_pept        complement(599746..600039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05895"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05895"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88550"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGE5"
FT                   /protein_id="AAT88550.1"
FT                   /translation="MPTYSYSCRGCGHTFDIQQTFTDDALTVCPDCGGSLRKVFGAVGV
FT                   TFNGSGFYRTDSRGGKKKVSSPPGSSGPSSAAPSPSGSSSGSAGSSSAGSAA"
FT   gene            complement(600059..600643)
FT                   /locus_tag="Lxx05900"
FT   CDS_pept        complement(600059..600643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05900"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase-related
FT                   protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05900"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88551"
FT                   /db_xref="GOA:Q6AGE4"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGE4"
FT                   /protein_id="AAT88551.1"
FT                   /translation="MDSDTAAHRKRALRAELSERRQNLTSTERQAATAGFTRQLVDLAT
FT                   DLSARSIACYLSTTIEPNTRPFLNWAREHGLRVLLPISREDGLLDWTTGDGETETEGLF
FT                   GMPEAVGELLGPIAINDVDLILVPAAAVDATGMRMGWGRGYFDKILGSMEKCPPVYAVL
FT                   YDGEVVDEVPRERHDRPVDGAVTPTRIVQFT"
FT   gene            600703..601674
FT                   /gene="galU"
FT                   /locus_tag="Lxx05910"
FT   CDS_pept        600703..601674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galU"
FT                   /locus_tag="Lxx05910"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05910"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88552"
FT                   /db_xref="GOA:Q6AGE3"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGE3"
FT                   /protein_id="AAT88552.1"
FT                   /translation="MATSVTKAVIPAAGLGTRFLPATKAMPKEMLPVVDKPAIQYVVEE
FT                   AVEAGLHDVLMITGRNKNALENHFDRNAELEDTLTKKGDTDRLRKVNYSTSLADMHYVR
FT                   QGDPKGLGHAVLRAKMHVGREPFAVLLGDDIIDARDDLLRRMLRVQHEHNTTVVALMEV
FT                   DPDSIHLYGAAAVEPTGEDDVVRITGLVEKPDKEDAPSNYAIIGRYILRPEVFDVLERT
FT                   EPGRGGEIQLTDALQAMAHAPDWTGGVYGVVFRGRRYDTGDRLDYIKAIVQLAADRDDL
FT                   GPELRPWLREFAGGLADTPDEALDEMPAEPAPSLGSTTDANA"
FT   gene            601697..602359
FT                   /gene="rimJ"
FT                   /locus_tag="Lxx05920"
FT   CDS_pept        601697..602359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimJ"
FT                   /locus_tag="Lxx05920"
FT                   /product="ribosomal-protein-alanine N-acetyltransferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05920"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88553"
FT                   /db_xref="GOA:Q6AGE2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGE2"
FT                   /protein_id="AAT88553.1"
FT                   /translation="MAFVIPTISEGRVALRPIRLRDARALERSLLDNRGWLRQWEATSP
FT                   YAPTAFDTRASIRSLLVNARAGHGLPFLVEYDGELAGQLNVSSIAYGSLSSATIGYWVA
FT                   EGFAGRGITPTAVALAADYCFFQLGLHRIEICIRPENGPSLRVVEKLGFRYEGLRRRYI
FT                   HINGDWRDHFCFGLVSEELPQGALRRWLDGQVPAGAAAVTPDDRAAAAIPLPVERQR"
FT   gene            602442..603491
FT                   /locus_tag="Lxx05930"
FT   CDS_pept        602442..603491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05930"
FT                   /product="membrane protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05930"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88554"
FT                   /db_xref="GOA:Q6AGE1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGE1"
FT                   /protein_id="AAT88554.1"
FT                   /translation="MNGDVMGGGVVVALAAALWLAYLVPLWLRRREYLATERNAVRLQQ
FT                   TLRILAETAELPDEVRLEATAKTVAEQQRVLRRAEDKRAATARAEAAAIARREQALADE
FT                   RRRAAEDAERVAAEAIAVERASRAAAAQRANALAAATSRPVLSPQRRRRLRRSRALTTL
FT                   VLVAGVVGAAGGIPALFATGAWALPVLSLAIVVAALWTLGRLARPAAAHPPASPRIPVA
FT                   PATQALYDDAQHDLPVQERLRQSWTPRPLPKPLHLSPGTVAAAAMASVDAATELRRTAA
FT                   RAEFDRRSVEAPPPPVPLRPRPAEAIAAAPTVPVSAGPSRYATMGIVETDAHDALDLDA
FT                   VLRRRRAAS"
FT   gene            603549..603627
FT                   /gene="Ala"
FT                   /locus_tag="Lxx05940"
FT   tRNA            603549..603627
FT                   /gene="Ala"
FT                   /locus_tag="Lxx05940"
FT                   /product="tRNA-Ala"
FT   gene            complement(603865..605076)
FT                   /locus_tag="Lxx05935"
FT   CDS_pept        complement(603865..605076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05935"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05935"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88555"
FT                   /db_xref="GOA:Q6AGE0"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGE0"
FT                   /protein_id="AAT88555.1"
FT                   /translation="MNPSIRICGYNSPCEDSHSRHGAGGNGACYIVEPSPPGRPRDTIP
FT                   ACRACDLARGVAGEMATPERPRCKMPLISLGAITGKWDLAVATAPPTVPTIRKILAGDS
FT                   FAAIAAVTQVPSEVRELESIAGARPWGLIIPGFLAWGTDPTRYWKVGPQFTLAVTLTPP
FT                   ARSLFPRPAPTATVADVLMQAATTIPIVATLTTMDFNISAAARRTVQIAAAANEARAAV
FT                   AAAYRLPTPRSVWPPVVQTALRTLPMLAPMDLREYLRAHFGKHATQTLKLHRDWIADAQ
FT                   DHDLNPFTKTARRAQPGGAMIADTLNAVVPVFRALGEPNRARLVAALIERSGSASVGEL
FT                   QHAVGLPQSTASRHLRVLLDAGIVSATHLGTQRIYSLGIQESALSAVESLTTAVRSCQP
FT                   STTN"
FT   gene            605571..606782
FT                   /gene="tnp"
FT                   /locus_tag="Lxx05960"
FT   CDS_pept        605571..606782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnp"
FT                   /locus_tag="Lxx05960"
FT                   /product="transposase, ISlxx5"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05960"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88556"
FT                   /db_xref="GOA:Q6AGR9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGR9"
FT                   /protein_id="AAT88556.1"
FT                   /translation="MQGRVPGAAEQRALAPRSGGTSRNQPEHGIPLGQSNGRRIYPDGR
FT                   VVDYKDRVPVVVDPVQRASMRSLEAALHPRFLSLQERELIRDLTRAGLSLCRVAAKLGR
FT                   SVSTISREIRRNQLPGEGGYHPYVAHRKAASRRPRPKATRLVRNPQLRSYVQRKLTLRW
FT                   SPEQISRSLIREFPGDAEMRVAHETIYQAFYVQGRGQLRRELTMVLRTGRAKRKPHRSG
FT                   AARRHRFADPMVMISDRPAEIEDRAVPGHWEGDLIIGGHRNSAIGTLVERSTRFVMLIH
FT                   LPIDRTAESVRDGLISAVKTLPRELRRSITWDQGSEMAAHKSFTIATDIPVYFCDPASP
FT                   WQRGSNENTNGLLRQYFPKGKGTDLARFTATDLTNVAHELNTRPRKTLGWETPAERLAK
FT                   LLAS"
FT   gene            607367..608200
FT                   /locus_tag="Lxx05970"
FT   CDS_pept        607367..608200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx05970"
FT                   /product="rRNA methyltransferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05970"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88557"
FT                   /db_xref="GOA:Q6AGD8"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGD8"
FT                   /protein_id="AAT88557.1"
FT                   /translation="MSRRRYAGVMLDNPRSPRVRAVAKLTKRTARSETGLFLLEGPQAV
FT                   AEALAFRSELLVELYATPTALERHQDIAQAAAAAGTQVEFVTEQVLGTIADTVTPQGFV
FT                   AVARQFPTSVREIFAGSPALVAILEEVRDPGNAGTIIRAADSAGADAVVLTGRTVDLYN
FT                   PKVVRSTTGSLFHIPVAVGADLPEVVSCARAAGLRVLAADIAGEDLLAARTAGQLARPT
FT                   AWVFGNEARGLPDEWLGLVDRAVAVPIYGRAESMNLATAASVCLYESAFAQRSAG"
FT   gene            608282..609322
FT                   /gene="pheS"
FT                   /locus_tag="Lxx05980"
FT   CDS_pept        608282..609322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="Lxx05980"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05980"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88558"
FT                   /db_xref="GOA:Q6AGD7"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AGD7"
FT                   /protein_id="AAT88558.1"
FT                   /translation="MSESTEITESSVEAAVEAALAAIAAAGDSEALKVVRHDHTAEGSP
FT                   LAQLNAGIRSLPGDRKAAAGKLVGGARGRVSQALAAKEAGIAAAEEAAQLVAEAVDVTA
FT                   LPNRWTSGARHPLSLLQERIADVFVGMGWQVAEGPELESEWYNFDALNFDADHPARAMQ
FT                   DTFFVEPAEAHLVMRTHTSPVQLRALLGDELPVYRIASGRVFRTDEFDATHLPVFHQTE
FT                   GIAVDKGLTMAHLRGTLDHFVETLFGEGARVRLRPNYFPFTEPSAELDLWHPTFAGGAR
FT                   WIEWGGCGMVNPNVLRSAGIDPEVYSGFAFGMGVERALMFRNDVKDMRDMAEGDVRFSQ
FT                   QFGMVV"
FT   gene            609322..611865
FT                   /gene="pheT"
FT                   /locus_tag="Lxx05990"
FT   CDS_pept        609322..611865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="Lxx05990"
FT                   /product="phenylalanyl-tRNA synthetase, beta subunit"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx05990"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88559"
FT                   /db_xref="GOA:Q6AGD6"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AGD6"
FT                   /protein_id="AAT88559.1"
FT                   /translation="MRVPLSWLGEYVDLEPGTTPAEVHAALVSVGLEEEGVHTFGIEGP
FT                   VVVGEVIDFVEEPQSNGKTIRWCQVRVAAEGQKAADGGADVRGIVCGAGNFFPGDKVVV
FT                   TLPGAALPGPAPLTPFVIAARKTYGHVSDGMIASARELGLGDDHDGILRLSTLGLDPEV
FT                   GADAVSLLGLDDTAVEVNVTPDRGYAFSIRGIAREYAHATGAAFRDPAEAVASPPPHAH
FT                   GFSVAVEDRAPIRDRVGASVFVTRVVRDVDATRPTPPWMVARLKLAGIRSISLVVDITN
FT                   YVMLELGQPTHGYDLDRLSGGIVVRRAHAGETLVTLDDQTRALHAEDLLITDDSGAIGL
FT                   AGVMGGASTEIGAGTRNVLVEAANFDPVSIARTARRHKLPSEASKRFERGVDPRVAVAA
FT                   AARVVQLLEQLAGGTADGLGSLLDETADAEPIRLPDDYIPNLIGVAFTDDEVRGALAEI
FT                   GGSVSDTEGALLVVPPTWRPDLRDKSDLAEEVARIVGFDRIPSVLPVAPPGRGLSRAQT
FT                   LRRAVAQTLADNGATEVLAFPFVGAAQNDLFGSPEPGGVPAVKLANPLDATAAYLRTSL
FT                   LPGLLGIAKRNLARGLVDLSVYETGTVFLPGAALGSETLPPGAALPSRETLAGLNAGIP
FT                   DQPRHLAGVVLGHTVRKQPGQPAVAAGLADALAMVDQAAAAVGVAVEPVQSRHQALHPG
FT                   RTAQLVAGDGVRTVLGYAGELSPALAAELDLPRVVAVFELDLDALIAVAPAEIVAGTIA
FT                   GFPAATQDLSLVVGDEVPAGEVLRAVREGAGALLEDIRLVDDYRGTGLPDSSKSLTFAL
FT                   RFRADDRTLTAAEASEAKQAGAARAGQLFGAAIRE"
FT   gene            complement(611874..612443)
FT                   /locus_tag="Lxx06000"
FT   CDS_pept        complement(611874..612443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx06000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06000"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88560"
FT                   /db_xref="InterPro:IPR030476"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGD5"
FT                   /protein_id="AAT88560.1"
FT                   /translation="MAHYDDWGVIAHGILNGHPADRVAMKGNASEVARTFYGGPDGPPA
FT                   TGAAADILALIPGWAEIPFIAASIEEWHQGAAAAAAASGIALDDLFYWEHRCGSWQSQS
FT                   QLEWDIAQETFTPFSNRILLGTLLGVPAAERADHGNTLLREIIRAADPAALRVPINPRT
FT                   PYRRAVEFGERLRHRARRELRRLRTR"
FT   gene            complement(614352..614543)
FT                   /locus_tag="Lxx06010"
FT   CDS_pept        complement(614352..614543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx06010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06010"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88561"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGD4"
FT                   /protein_id="AAT88561.1"
FT                   /translation="MSPLLALPAIAHTAGAEGWAAIAIGQSLGGAAGVLVELGWGSPAP
FT                   SASPARPAATSPRPTRPD"
FT   gene            614898..615941
FT                   /gene="argC"
FT                   /locus_tag="Lxx06030"
FT   CDS_pept        614898..615941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="Lxx06030"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06030"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88562"
FT                   /db_xref="GOA:Q6AGD3"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AGD3"
FT                   /protein_id="AAT88562.1"
FT                   /translation="MTFSVAVAGASGYAGGELLRILADHPDFDIRTVTAHQNAGQPLAA
FT                   HQPHLRSLAGLTLSESTAENLAGHDVVFLALPHGKSGEIATQLPADTLVVDCGADHRLE
FT                   DPDAWAAFYGGEHFGSWAYGVPELPVGAGRQRERLAGAKRIAAPGCNASAVSLALAPGI
FT                   HAGLIEDADIVSVLAVGPSGAGKALKTMYLASEILGSANPYAVGGTHRHIPEIQQSLRK
FT                   AGALSPTISFIPVLVPMSRGILATSTARVKPGVSAAQVQAAWEETYAGEPFVQVLPAGS
FT                   VPRTSDVLGANTALIGVALDAAAGRVVAVLAIDNLYKGTAGAAIQSANIALGLAETAGL
FT                   SVNGVAP"
FT   gene            615938..617092
FT                   /gene="argJ"
FT                   /locus_tag="Lxx06040"
FT   CDS_pept        615938..617092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argJ"
FT                   /locus_tag="Lxx06040"
FT                   /product="glutamate N-acetyltransferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06040"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88563"
FT                   /db_xref="GOA:Q6AGD2"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGD2"
FT                   /protein_id="AAT88563.1"
FT                   /translation="MSVTAAQGFAAAGVAAGLKASGERDLALVQNLGPLTAAAAVFTTN
FT                   RCKANPVLWSEQVIADGVVSSIVLNSGGANCYTGAAGFQVTHATAEAVAAALDVSAGDV
FT                   LVCSTGLIGDQLDRAKLTAGVDAATAALATDAGLGAAEAIMTTDTRPKQAEQRSKAGWT
FT                   VGGMAKGAGMLAPGLATMLVVITTDAVLGSAQLDSALRAATRVTFDRLDSDGCMSTNDT
FT                   VALLGSGASGVEPDLDEFALALTEVCRNLATQLQEDAEGASHDITIEVANALTEDDAVT
FT                   VGRAVSRSNLFKAAIFGNDPNWGRVLAAVGTTDAAFDPYRIDVAINGVQVCAAGEPDQP
FT                   RDLVDLAPRAVCVRIDLHAGDEGASILTNDLTHDYVHENSAYSS"
FT   gene            617094..618002
FT                   /gene="argB"
FT                   /locus_tag="Lxx06050"
FT   CDS_pept        617094..618002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="Lxx06050"
FT                   /product="acetylglutamate kinase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06050"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88564"
FT                   /db_xref="GOA:Q6AGD1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AGD1"
FT                   /protein_id="AAT88564.1"
FT                   /translation="MTTEDTFETAERAAAIAKAAALIESLPWLKTFHDRIIVVKFGGNA
FT                   MVSEELQRTFAEDMVYLRYAGLLPVIVHGGGPQISAMLDRLGIQSEFRGGYRVTTPEAM
FT                   EVVRMVLTGQINRDIVAAINKHGPLAAGLSGEDAALFQGRKRGAVVDGEAVDLGLVGDV
FT                   IGVNPEAVLAQIDAGRIPVVSSIAPDIDEPGQSLNVNADAAAAALAVALRAAKLVILTD
FT                   VAGLYSDWPNRDSLLSKITARELRELLPGLESGMIPKMAACLAAVDGGVEKAEIIDGRI
FT                   EHSILLEVFTQSGIGTEVAPV"
FT   gene            617999..619210
FT                   /gene="argD"
FT                   /locus_tag="Lxx06060"
FT   CDS_pept        617999..619210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /locus_tag="Lxx06060"
FT                   /product="acetylornithine aminotransferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06060"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88565"
FT                   /db_xref="GOA:Q6AGD0"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGD0"
FT                   /protein_id="AAT88565.1"
FT                   /translation="MSGDPNGRIDGAEWKPRYAEVMMRTLAMPKLLLERGQGCRVWDVD
FT                   GNEYLDFLAGIAVNSLGHAHPALVEAVSSQVATLAHVSNYFSTAPQLELAERLRAITGA
FT                   GEQGRVLFANSGAEANEAAFKLARLNRGPHGVRTRVLALRGAFHGRTMGALALTGKPPM
FT                   REAFEPLPGGVEHIDSTIDALEHAIDDRVAALFVEPVKGEAGVLALPDGFLRRARELTE
FT                   QHGVLLILDEIQTGVGRTGAWFAYQHEGILPDAVTVAKGIAGGIPIGALVTFGWASDLF
FT                   TQGQHGSTFGGNPLATAAGNAVLAEIERAGLVENAARRGGELRAIIRSYDSPLIGEVRG
FT                   AGLLVGIGLTGGEANRLADAALAQGLIVNAPNESSIRLAPPLIVGGAELAEFRERFGRA
FT                   LAAL"
FT   gene            619232..620170
FT                   /gene="argF"
FT                   /locus_tag="Lxx06070"
FT   CDS_pept        619232..620170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argF"
FT                   /locus_tag="Lxx06070"
FT                   /product="ornithine carbamoyltransferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06070"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88566"
FT                   /db_xref="GOA:Q6AGC9"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AGC9"
FT                   /protein_id="AAT88566.1"
FT                   /translation="MTRHFLRDDDLSPAEQVEVLDLAAKLKRDRFSARPLAGPQTVAVM
FT                   FDKTSTRTRLSFATGIADLGGNPLIIQAGESQVGAKESLADTARVMERMLAAIVWRTFA
FT                   HSGLEELVDGTRIPVVNALSDDVHPCQTLADLQTVRERKGRTAGLTMSFFGDGASNMAH
FT                   SSLLGGVTAGMRVRIAAPAGYTPDPRFVADAEAIAARTGGSVLVTADPGEAAAGADVIV
FT                   TDTWVSMGKEDEKAERIAVFGDYAVNAGTLRLADPAAIFLHCLPAYRGLEVSAYVIDGP
FT                   QSVVWDEAENRLHAQKALLTWLLAKNREDAV"
FT   gene            620203..621630
FT                   /gene="argH"
FT                   /locus_tag="Lxx06080"
FT   CDS_pept        620203..621630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="Lxx06080"
FT                   /product="argininosuccinate lyase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06080"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88567"
FT                   /db_xref="GOA:Q6AGC8"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AGC8"
FT                   /protein_id="AAT88567.1"
FT                   /translation="MHGGVGHTDEGKLWGARFAGGPSPELAALSASTHFDWALAAYDLA
FT                   GSRAHAAALAACGYLTDDELAGMLAALDRLDEDVASGAFAAAETDEDVHGALERGLIER
FT                   AGADLGGKLRAGRSRNDQIATLVRLYLRDHAGVIAERLIALVDAIAAQAEAHPTTILPG
FT                   RTHLQHAQPVLLAHHLLAHCWPLVRDLERLADWDKRANVSPYGGGALAGSTLGLDPLLV
FT                   ARELGFAASSENSIDGTAARDVVAEFVFIAAQIGVDLSRFAEEIILWNTREFGFVTLDD
FT                   SYSTGSSIMPQKKNPDIAELARGKSGRLIGNLTGLLTTLKGLPLAYNRDLQEDKEPVFD
FT                   SVQTLEVVLPAFAGMVATLRFHTDRMAELAPQGFSLATDVAEWLVKRHVPFRVAHELTG
FT                   SLVRFAEENGLELHEVSDGQFAAISPLLTPDVRTVLTVEGSVASRAGAGGTAPERVAEQ
FT                   LAALTGRVRSLAARREL"
FT   gene            621630..621740
FT                   /locus_tag="Lxx06090"
FT   CDS_pept        621630..621740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx06090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06090"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88568"
FT                   /db_xref="GOA:Q6AGC7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGC7"
FT                   /protein_id="AAT88568.1"
FT                   /translation="MASRRPGWVIPLIVVVSAAVIVAGLVATVAVGGRVF"
FT   gene            621730..622371
FT                   /gene="alkA"
FT                   /locus_tag="Lxx06100"
FT   CDS_pept        621730..622371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alkA"
FT                   /locus_tag="Lxx06100"
FT                   /product="DNA-3-methyladenine glycosylase II"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06100"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88569"
FT                   /db_xref="GOA:Q6AGC6"
FT                   /db_xref="InterPro:IPR003180"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036995"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AGC6"
FT                   /protein_id="AAT88569.1"
FT                   /translation="MSSDVTLAQPGRDAFLASSLEVAPRLLGAVLRHESAEGPVALRIT
FT                   EVEAYTGEGLDPGSHAFRGPTRRNAAMYGEPGRLYAYFTYGMHVCANVVCSPAGEASAV
FT                   LLRGAEIVEGLALAERRRAGASGRRIPQRDLARGPARLVVAAGIGLADDGADLLAPPFG
FT                   LLLPSVQPEYATGPRTGVSGAGGGAAFPWRYWLPGEPSVSPYKRHPASHG"
FT   gene            complement(622773..623210)
FT                   /locus_tag="Lxx06110"
FT   CDS_pept        complement(622773..623210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx06110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06110"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88570"
FT                   /db_xref="GOA:Q6AGC5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGC5"
FT                   /protein_id="AAT88570.1"
FT                   /translation="MALALSVVGGGPAAQLVLALGTRPAPLGANGGIIVHDRVSGPENT
FT                   REVLRVGATIGLLERFAATGAIMAGFPEALTVLIAVKGVGRFTELETPETRERFIIGTL
FT                   VSLVWACVCAALFRFTAGWPASPPATEENTAASPAKQESEG"
FT   gene            complement(623235..623438)
FT                   /locus_tag="Lxx06120"
FT   CDS_pept        complement(623235..623438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx06120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06120"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88571"
FT                   /db_xref="GOA:Q6AGC4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGC4"
FT                   /protein_id="AAT88571.1"
FT                   /translation="MTDPPLPSILSAAAPIAAWTLALLLAIASLCCMIATLRRPRRALV
FT                   YTGAGLLALALLVITLPPHEAP"
FT   gene            complement(623435..624064)
FT                   /locus_tag="Lxx06130"
FT   CDS_pept        complement(623435..624064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx06130"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06130"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88572"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGC3"
FT                   /protein_id="AAT88572.1"
FT                   /translation="MFVITADQIDSRRRADLAAPLVEELDSRFGDRLALPADRNAGDEI
FT                   QALSAEPAAVLEIVLDLTRCGDWSVGLGIGAVRTPLPRATREATGEAFVAARTAVARAK
FT                   RAATRFAADATAAPEPAADAEALLTLLLTIREARSAAGWDLYDLVASGLTQAQAGARLG
FT                   ITPQSASDRARTAGVRVELAAHPALTRLLERVDAAQTPARRDRENG"
FT   gene            624196..625524
FT                   /gene="tyrS"
FT                   /locus_tag="Lxx06140"
FT   CDS_pept        624196..625524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="Lxx06140"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06140"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88573"
FT                   /db_xref="GOA:Q6AGC2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AGC2"
FT                   /protein_id="AAT88573.1"
FT                   /translation="MSDSPSRQQQLLRAQSNDPSFDNVWDELIWRGLVYVSTDEAALKQ
FT                   LLAGEPIAYYCGFDPTAPSLHLGNLVQLLTMRRLQLAGHRPFGLVGGSTGLIGDPKPSA
FT                   ERTLNAKETVAEWVGSLREQVTRFLSAEGDNAVRLVNNLDWTAPLSAIDFLREIGKHFR
FT                   VGAMLKKDAVAARLNSDEGISYTEFSYQILQGLDYLELYRQHGCVLQTGGSDQWGNLTS
FT                   GTELIRRVEGGHAHAVGTPLITNSDGTKFGKSEGNAVWLDPALTSPYAMYQFWLNTDDA
FT                   DVIARLKVFTFLHRDEIERLERAVAEEPFRREAQRRLALDVTSLVHGAAAAEAVIAASE
FT                   ALFGRGGDLAQQDTDTLASALRELPHTVSAPGVAIAQALVDTGLTKSLSEARRAVAQGG
FT                   VSANNATVQDADAPVGDALLPGGMLVLRRGKKTLAGVFVEEGV"
FT   gene            625562..625711
FT                   /locus_tag="Lxx06150"
FT   CDS_pept        625562..625711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx06150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06150"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88574"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGC1"
FT                   /protein_id="AAT88574.1"
FT                   /translation="MEEGLLSRLEVIEGQPLAERAEAYANLHGELSARLDAGDAPPTRG
FT                   TGNI"
FT   gene            625754..626809
FT                   /locus_tag="Lxx06160"
FT   CDS_pept        625754..626809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx06160"
FT                   /product="galactosyltransferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06160"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88575"
FT                   /db_xref="GOA:Q6AGC0"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGC0"
FT                   /protein_id="AAT88575.1"
FT                   /translation="MKIIHFCTRVGNFADGLVNVAVDLAITQSRAGHDVVLASLGGDYE
FT                   PLLNASGVRTVRLDFRARKPWEVLATRRAIKRLVAETGEEVLHSHTIAPAVLAASLGRR
FT                   TALTVSTVHNEFQRGARLLGASRLVVCVSKAIQDKMERSWLSRGKTTVIVNDVMGSPRR
FT                   VTAPPKPQLQGRAIVAIGSVTLRKGSDVLLEAFGEVARQRDDAHLYFVGNVDHPELLDR
FT                   FREEEWFPRVHLEGRAEDPTGYLAAAEVFVQASRQDPYPLAVLEAIQSGIKMVGSDADG
FT                   IPEALGHGRLGAVFPSEDAEALAARLIDAFEGRGPIPEPTEADLAANSVERMADDYVRE
FT                   YARQLTGRGAV"
FT   gene            626861..627634
FT                   /gene="tlyA"
FT                   /locus_tag="Lxx06170"
FT   CDS_pept        626861..627634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlyA"
FT                   /locus_tag="Lxx06170"
FT                   /product="hemolysin"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06170"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88576"
FT                   /db_xref="GOA:Q6AGB9"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGB9"
FT                   /protein_id="AAT88576.1"
FT                   /translation="MALAVRGLVRSRSRAAAVIAEGLVTVDGKPVIRTSARVGPGQALA
FT                   VAGADRYVSRGAHKLLAALDAFGVPVAGRTALDAGASTGGFSQVLLERGAGTVVALDVG
FT                   HGQLSPVLAGEGRLRSFEGVNVRALTPERFADLLGRPVRLGLVVADLSFISLTQVLPAL
FT                   RAVAEDDADFVLLVKPQFEVGRSGIREGVVRDAGLQEEALTGVLWSGHDVGLGVAGVIR
FT                   SPIVGSRGNAEFLVRLTVRGTDPGQWRERVRDVVR"
FT   gene            complement(627651..627947)
FT                   /locus_tag="Lxx06180"
FT   CDS_pept        complement(627651..627947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx06180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06180"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88577"
FT                   /db_xref="GOA:Q6AGB8"
FT                   /db_xref="InterPro:IPR003775"
FT                   /db_xref="InterPro:IPR024046"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGB8"
FT                   /protein_id="AAT88577.1"
FT                   /translation="MFFELTPLDGVPGCYVLRSTEDPGVRLYVLDTAVRLPGYRAALTV
FT                   AGEADVYVIVSTHYGAPTVNLIAPIVVDLPAGVAGQIIVDDPDLSRVSVPLAA"
FT   gene            complement(628007..628879)
FT                   /gene="flgL"
FT                   /locus_tag="Lxx06190"
FT   CDS_pept        complement(628007..628879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgL"
FT                   /locus_tag="Lxx06190"
FT                   /product="flagellar hook-associated protein 3"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06190"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88578"
FT                   /db_xref="GOA:Q6AGB7"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGB7"
FT                   /protein_id="AAT88578.1"
FT                   /translation="MTMRVTSTAQLLTTQRNLQAAKASMNDLYQEGTRGVKIAKPSDDP
FT                   AGVANLLTVRKQLSQNAQHTSNVDDGIGWMKTVDSALTGSADVISKIRDLVVQAANTGT
FT                   SSPANQDSIVKSIEQLKQNLLALANTQYLGRSVFAGTSDADTAFDVKSYAFNGTPGAEV
FT                   SRRVSPSATIPVSADGAAVFGTGSGSVFSLIDGIATKIAADRNVGSELAAIDSALNTIS
FT                   GAQAAIGTNFAQLQLGTDATTLEEARSRIEDADPADVVLRLNAQQVSYQTALAVAAKSI
FT                   QKTLMDYLR"
FT   gene            complement(628882..630027)
FT                   /pseudo
FT                   /gene="flgK"
FT                   /locus_tag="Lxx06200"
FT                   /note="similar to flagellar hook-associated protein 1"
FT   gene            complement(630356..630694)
FT                   /locus_tag="Lxx06210"
FT   CDS_pept        complement(630356..630694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx06210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06210"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88579"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGB6"
FT                   /protein_id="AAT88579.1"
FT                   /translation="MNRLKTAGLSLAVEMVDVAREYSLSDDVTLRDVVAAAPEGAWREI
FT                   FAAHLKALSDLTAEIRGTRDENSRRLRAGLRFTQETLNLMGEPSSTYAADGTVGSAIPA
FT                   ARLVDAAL"
FT   gene            631071..631436
FT                   /pseudo
FT                   /gene="tnp"
FT                   /locus_tag="Lxx06205"
FT                   /note="similar to transposase, ISlxx4"
FT   gene            632192..633010
FT                   /gene="fliA"
FT                   /locus_tag="Lxx06230"
FT   CDS_pept        632192..633010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliA"
FT                   /locus_tag="Lxx06230"
FT                   /product="RNA polymerase, sigma factor"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06230"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88580"
FT                   /db_xref="GOA:Q6AGB5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGB5"
FT                   /protein_id="AAT88580.1"
FT                   /translation="MLTAQGQDGPPHRIALGHTAEKDSVNTKERDRLVTDHLPLVGYIV
FT                   SDLCMKAAHLDRDELASAGNLALPRAFDPDKGVTFASYARTRISGAISDELRSKDWVSR
FT                   GMRKRIKAAQSARDDLAKTLGRTPTEDEVASLLGIGKKALAEAMHHQATGPVSFDDLAP
FT                   DEAAEITERDVFLRTAVEALPDRLRLVVTRIFCEERQVKDVAAELGITHAAVSMTKSEA
FT                   VRMLHEGWVRHFDAAAGQAPSAKMTPKRTMYLNRLADMSKTAGPVLESSV"
FT   gene            633236..634069
FT                   /gene="fliC"
FT                   /locus_tag="Lxx06240"
FT   CDS_pept        633236..634069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliC"
FT                   /locus_tag="Lxx06240"
FT                   /product="flagellin-like protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06240"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88581"
FT                   /db_xref="GOA:Q6AGB4"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGB4"
FT                   /protein_id="AAT88581.1"
FT                   /translation="MAMTIKTNVSALQTINAINKNNAALASSMQKLSIASAINTTADDA
FT                   AGSAVVIGLQSQIGGLTQAGKNTASGIALVQIASGALKSVSDILQRVRDLTVQAGTDTN
FT                   DTNSRLDIRTEVNALADQLTQISASTNYNGVKLLDSTANLTLQVGSGSVAVNDQIGIDL
FT                   TGVKIAAIVTAVKAIDLTTASGSLAGIGTLDANIQSISTTSASLGATQNRLNYVASTLA
FT                   TNIENLQEAKSTIADTDTASEMANFTKLNVLTQAGTAMLSQANQQNQQVLKLLQG"
FT   gene            634256..635617
FT                   /pseudo
FT                   /gene="fliD"
FT                   /locus_tag="Lxx06260"
FT                   /note="similar to flagellar hook-associated protein 2"
FT   gene            635643..636077
FT                   /gene="fliS"
FT                   /locus_tag="Lxx06280"
FT   CDS_pept        635643..636077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliS"
FT                   /locus_tag="Lxx06280"
FT                   /product="flagellar-like protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06280"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88582"
FT                   /db_xref="GOA:Q6AGB3"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGB3"
FT                   /protein_id="AAT88582.1"
FT                   /translation="MPANPLATYRDNAILSASPAQLLTMFYDRLLLDLTFGREALLTDD
FT                   SAEAMNRIAHAGEIIATLAGSLRTDVWDGADGLLSLYIYVATALVRANLTRNPGLLDEC
FT                   IALMQPLREAFQEASASLATRPSWQTTAEAGEESQVIAVA"
FT   gene            636106..636345
FT                   /locus_tag="Lxx06290"
FT   CDS_pept        636106..636345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx06290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06290"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88583"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGB2"
FT                   /protein_id="AAT88583.1"
FT                   /translation="MESLARSRDARLGEWQPPAGLGPIPGTLHDRARLVLARISASITA
FT                   VQEELAQLDSRKKMVSIVPALFAADEPQYLDEAL"
FT   gene            636509..636865
FT                   /locus_tag="Lxx06300"
FT   CDS_pept        636509..636865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx06300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06300"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88584"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGB1"
FT                   /protein_id="AAT88584.1"
FT                   /translation="MIRRASLRDPERYDIRAGRLRRTAARHRQKHRERGPPGYTAQEVQ
FT                   FADTLAASVAAGSGLLGSSALTPAESLEPTRLNGNNVDLASETTQQISANLKFQFASQA
FT                   AQQQFSSMRAAMEV"
FT   gene            636862..637260
FT                   /gene="flgC"
FT                   /locus_tag="Lxx06310"
FT   CDS_pept        636862..637260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /locus_tag="Lxx06310"
FT                   /product="flagellar basal-body rod protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06310"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88585"
FT                   /db_xref="GOA:Q6AGB0"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGB0"
FT                   /protein_id="AAT88585.1"
FT                   /translation="MTVQLDAIGIAGTGMNLNQKWLDAIGDNLANIDDTTNRANPAFQE
FT                   RFVLAQADSDSGGVAVAGTPFGSAAGRLVYSLRDPNADAQGYVRGTGIDLSVQMTNLIM
FT                   AQRAYQANANTVSSARYMYQSALQIGQK"
FT   gene            637260..637574
FT                   /gene="fliE"
FT                   /locus_tag="Lxx06330"
FT   CDS_pept        637260..637574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliE"
FT                   /locus_tag="Lxx06330"
FT                   /product="flagellar basal-body protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06330"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88586"
FT                   /db_xref="GOA:Q6AGA9"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGA9"
FT                   /protein_id="AAT88586.1"
FT                   /translation="MPISALAPLTATGSAGPIGPAVPVAGRSPAGDGGFAASLASAVNG
FT                   VQQSQTVSDRLNIQAVTGSLDDIQDATVAAARVSTEIQLFATVKNQAVDAFNTIMRMEA
FT                   "
FT   gene            637574..638899
FT                   /gene="fliF"
FT                   /locus_tag="Lxx06320"
FT   CDS_pept        637574..638899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /locus_tag="Lxx06320"
FT                   /product="flagellar M-ring protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06320"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88587"
FT                   /db_xref="GOA:Q6AGA8"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGA8"
FT                   /protein_id="AAT88587.1"
FT                   /translation="MPPRLTTAWKKISSAAAGFSFAQKTVSILAVLVLALGVTGLSLWM
FT                   SQPQRVPLYTGLSAADAEAITQQLKTDNVSYQLTDGGSSILVPQESVYTERLKSAAAGL
FT                   PTAANKGYSLLDNMSITTSEFQQSVTYQRAMEGELANTIEAMDGVKSSSVKLAIPEKTV
FT                   FTDQAADPTASVFIATASGHTLTRGQVQAIVHLTSAAIVGMKPADVSVIDSSGAVLSAI
FT                   GGSASVSDGTADTLQASVQSAVQGMLDKVLGSGNSTVTANASLSQATGTKTTQTYTVPT
FT                   GAPVTSSSEEKETYTGSGPAAAGVLGQPSLDVATNGTRNTTRAVGGNGSYQSAKLVKDN
FT                   ALNSVTETQSIPAGLLQRLTVSVVVNKTVAEAAGLATAQLSQMVSAAAGVETTRGDTVS
FT                   VEFVGFSKAAQQALKQAQQDQQGQQLAEWTREGLVAVALPPR"
FT   gene            639129..640169
FT                   /gene="fliG"
FT                   /locus_tag="Lxx06340"
FT   CDS_pept        639129..640169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliG"
FT                   /locus_tag="Lxx06340"
FT                   /product="flagellar motor switch protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06340"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88588"
FT                   /db_xref="GOA:Q6AGA7"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGA7"
FT                   /protein_id="AAT88588.1"
FT                   /translation="MTDQRHPENEQRVELTGIERAALVLINMDQSAASAILQHMPEGQA
FT                   EEITAAIVKLKNVDSSDVDRVLHDFHELSVRSSSRTRGGRDIAAELLEATFGSERAASV
FT                   MSRVTSSLAGRAFDFLYNADPHQVAMLLDGGLPHTSAVVLAHLRPDQASKVLTALNDSI
FT                   RTEVAHCVATMTTASPEAVRGIAETLRVRSGLVISTKDQNEASGGVQPLVEMINRAAVA
FT                   IEKTVLEELESRDPGLAAEIRSRMLTFNDIVKLEDRDVQHVLRGIDLPVLALAMEGSPQ
FT                   PVQEAIKNNLSERNRETLEDELEILGSVRVSKVEEARSEIVRAIRTLEAEGLITVQRSE
FT                   DEQYVE"
FT   gene            640159..640716
FT                   /locus_tag="Lxx06350"
FT   CDS_pept        640159..640716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx06350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06350"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88589"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGA6"
FT                   /protein_id="AAT88589.1"
FT                   /translation="MSSRSFAPAAYPQVRARAIPGAETERARGYAAGYADGTRKAQEEH
FT                   IAAEAVRQQRIGDAIERQQRQVDQAVAAIRAAIGRLNARQAPVIQDADDALVEAGLELA
FT                   EAILGREVAEGHVTAADTLRRALAAVADEQVVAVHMSPADVSLLAGANTGDAQIRMTDG
FT                   FIDARICAALDRARIVLTGTHA"
FT   gene            640713..642038
FT                   /gene="fliI"
FT                   /locus_tag="Lxx06360"
FT   CDS_pept        640713..642038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliI"
FT                   /locus_tag="Lxx06360"
FT                   /product="flagellum-like ATP synthase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06360"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88590"
FT                   /db_xref="GOA:Q6AGA5"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGA5"
FT                   /protein_id="AAT88590.1"
FT                   /translation="MTGYRPGADRYAAALRVAAPERVGAVTSAVGLSLTVAGLRGAVGD
FT                   LVEIGEPGSVTHAQIVAVGPEMTCMPMTPAAGHSTGAGARFALRPPTVPTGRGLLGRVI
FT                   NGLGHPIDGKGPLDATSCLPLDNAVPNPLDRARIDTPLPLGVRALDTLIPVGRGQRLGL
FT                   FAGSGVGKSSLLSMIARGTDADVFVLALIGERGREVREFLEDDLGADGLARSVVVVATS
FT                   DEPALMRRRAAFAATRIAESFRDNGADAMLMMDSLTRVAMAQREIGLSAGEPPATRGYP
FT                   SSTFSTLASLLERAGTAKTGSITGLYTVLVDGDDHNEPIADAARSILDGHVLLDRKLAI
FT                   NGHFPSIDVLGSISRLAGKICTPGQQAAATALRKVMAARRAAQDLLDVGAYKPGANPLV
FT                   DAGVEHEDRIAAFLQQGMGEQTTAEAAWTDLGELVTGFGGFR"
FT   gene            642427..643257
FT                   /pseudo
FT                   /locus_tag="Lxx06380"
FT                   /note="similar to conserved hypothetical protein"
FT   gene            643254..644597
FT                   /pseudo
FT                   /gene="fliK"
FT                   /locus_tag="Lxx06390"
FT                   /note="similar to flagellar hook-length control"
FT   gene            644614..644886
FT                   /gene="flgD"
FT                   /locus_tag="Lxx06400"
FT   CDS_pept        644614..644886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgD"
FT                   /locus_tag="Lxx06400"
FT                   /product="flagellar hook assembly protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06400"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88591"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGA4"
FT                   /protein_id="AAT88591.1"
FT                   /translation="MTAVNSIASANSTPSLYATQPTRQPVQTMGAEQFMHLLVVQLQNQ
FT                   DPTSPMDTAQMVQQTTQLAMMRSMQDIIRPSPATSACTRPASPRR"
FT   gene            644883..645041
FT                   /locus_tag="Lxx06410"
FT   CDS_pept        644883..645041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx06410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06410"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88592"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGA3"
FT                   /protein_id="AAT88592.1"
FT                   /translation="MIGKRLSYLAPDGKTQTGVATGVSLTSSGPLMKIGDTTVAFSQIV
FT                   GIDQTDA"
FT   gene            645064..646236
FT                   /gene="flgE"
FT                   /locus_tag="Lxx06420"
FT   CDS_pept        645064..646236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgE"
FT                   /locus_tag="Lxx06420"
FT                   /product="flagellar hook protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06420"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88593"
FT                   /db_xref="GOA:Q6AGA2"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGA2"
FT                   /protein_id="AAT88593.1"
FT                   /translation="MLRSLDSGVFGLQAQQTMLDVTANNIANVNTAGFKASSVQFEDAL
FT                   SQVTRTASAPTDVIGGTTPAAVGLGVRAAGIDTDWTQGATQTTGKATNLTLNGDGFFVI
FT                   RSAGQTQYTRAGNFTTDDSGTLVTPDGARVQGWGAAGGVVNSGVAPSTITIPLNVQSPA
FT                   VATTSATATGNLPSDAAAGAVVSSSVRVHDAAGGERTLTLTFTSSGGGSWSVNAADANG
FT                   ATASGPLAFTAGARSTGGTLAVGGISVDMTQMTVYAGATSAGITKQNGSAAGALQSFTF
FT                   DQDGTIEGSFSNGARLAIGRVAVATFSNPSGFQKAGSSAFTATADSGIPQVAADSGTGT
FT                   ITVGAYEGSNVDLGREFTNLIVSQRAFQASARVITTSDEILQELTQLKSR"
FT   gene            646319..646549
FT                   /gene="fliO"
FT                   /locus_tag="Lxx06430"
FT   CDS_pept        646319..646549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliO"
FT                   /locus_tag="Lxx06430"
FT                   /product="motility protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06430"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88594"
FT                   /db_xref="InterPro:IPR009384"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGA1"
FT                   /protein_id="AAT88594.1"
FT                   /translation="MIKVTKLNGAQFAVNPDLIERITSDPDSAVTMVDGVRYVVLEDVD
FT                   TIIDLIAAYRAKVLAVAYEHGVGPLGGGGSR"
FT   gene            646602..647489
FT                   /gene="motA"
FT                   /locus_tag="Lxx06440"
FT   CDS_pept        646602..647489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motA"
FT                   /locus_tag="Lxx06440"
FT                   /product="chemotaxis motility protein A"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06440"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88595"
FT                   /db_xref="GOA:Q6AGA0"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGA0"
FT                   /protein_id="AAT88595.1"
FT                   /translation="MVFIEQTPVVSLLLPGPMILVFGATIAIGFAGSTITDGVRGFAAI
FT                   PKALKGKKPNFPATIDSIVELADKARCNGLLALDGEGDRIGDPFFKTALQGLTDGKDSE
FT                   DLPDLLEEEIQTRTHAEKNASKYFTTMGGYAPTVGIIGPVVSLAHVLENLSSPDKLGPM
FT                   IASAFIATLWGLVSANFIWLPLGTRLYRLAELESERMHLIVEAGKSAPRVVAKGADFVA
FT                   TRIREEARSAGVPMVQDLPLARALHRDVPLGQPIPNEHFGQVAHVLAFVMMLRKRGASL
FT                   DSVLHLPPPRTPSS"
FT   gene            647533..648295
FT                   /pseudo
FT                   /gene="flhA"
FT                   /locus_tag="Lxx06450"
FT                   /note="similar to flagellar-associated protein"
FT   gene            648332..648589
FT                   /gene="csrA"
FT                   /locus_tag="Lxx06470"
FT   CDS_pept        648332..648589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csrA"
FT                   /locus_tag="Lxx06470"
FT                   /product="carbon storage regulator, CsrA family"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06470"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88596"
FT                   /db_xref="GOA:Q6AG99"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AG99"
FT                   /protein_id="AAT88596.1"
FT                   /translation="MLVLTRKQGEKILIGDDIEITVLDTRGDGIRIGISAPRGIRIQRD
FT                   EVRKAIEAENRSAAMRNPAAEFELIASLTALQNAEDPPPR"
FT   gene            648945..649385
FT                   /pseudo
FT                   /locus_tag="Lxx06480"
FT                   /note="similar to conserved hypothetical protein"
FT   gene            complement(649354..650459)
FT                   /pseudo
FT                   /gene="merA"
FT                   /locus_tag="Lxx06490"
FT                   /note="similar to mercuric reductase"
FT   gene            complement(650730..651515)
FT                   /locus_tag="Lxx06510"
FT   CDS_pept        complement(650730..651515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx06510"
FT                   /product="enoyl-CoA hydratase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06510"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88597"
FT                   /db_xref="GOA:Q6AG98"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG98"
FT                   /protein_id="AAT88597.1"
FT                   /translation="MTEPKILTERRGHILLIGFNRPEKRNAADFELLTALAEAYGELEW
FT                   NPELRVGVVHAIGDHFTAGLDLADLGPRIGSGGLSFVSGTGIDPWQVSGRSLSKPVVIA
FT                   VQGTCLTLGIELVLVADIAVAARGTVFGQIEVTRGILPFGGATIRFPRAAGWGDAMRYI
FT                   LTGDTFDAAEAHRIGLVQEIVDDGEQLAAALGIAERIASQAPLAVQAALRNAKAAVREG
FT                   DDVAEAELPAELVRLAGSEDARIWMEAFLTRTEARFMGR"
FT   gene            complement(651556..652500)
FT                   /gene="arg1"
FT                   /gene_synonym="rocF"
FT                   /locus_tag="Lxx06520"
FT   CDS_pept        complement(651556..652500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arg1"
FT                   /gene_synonym="rocF"
FT                   /locus_tag="Lxx06520"
FT                   /product="arginase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06520"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88598"
FT                   /db_xref="GOA:Q6AG97"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG97"
FT                   /protein_id="AAT88598.1"
FT                   /translation="MSGASFLVIPQWQGSGSSRAMRLIDGAEAVLGDLPVSRTHVVTVP
FT                   AAAGEALGTGVQRYSSLTAIRELAAAEIEVLAAPIVTVGGDCGADLASVQHAVSTRPGG
FT                   ALALVWFDAHGDLNDVATSPSGAFHGMVLRALLGDGPDGLASTGSAVLKPSSIVLAGTR
FT                   ALDEGESAFVAKNGIRVVEPGDFDDPDALVRAVGASGATAVYLHIDLDVLDPAVVDGIG
FT                   SPEPFGVTTEQLCDAIRALRARFELAGAAVTEFAPESAEAAVRDLPVILRVLGALTSPV
FT                   AGPRTSGTPVAPVSPDAPSSTASGPQRLSTDAP"
FT   gene            complement(652497..653219)
FT                   /pseudo
FT                   /locus_tag="Lxx06540"
FT                   /note="similar to conserved hypothetical protein"
FT   gene            653553..654020
FT                   /pseudo
FT                   /gene="guaA"
FT                   /locus_tag="Lxx06530"
FT                   /note="similar to GMP synthase"
FT   gene            complement(654210..655118)
FT                   /locus_tag="Lxx06550"
FT   CDS_pept        complement(654210..655118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx06550"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06550"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88599"
FT                   /db_xref="GOA:Q6AG96"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG96"
FT                   /protein_id="AAT88599.1"
FT                   /translation="MTVVNRGSKTQRRLPDGVEALHADIRDPESMHAVLGQRSFDVAAE
FT                   FLAFTPEHIHTDFDLFEGRVGQYMFISSASSYQTPPSRLPVTESTPLRNPFWQYSRDKI
FT                   ACEDLLVQGYRERGFPITIVRPSHTYDRTMIPTSGHWTDLERMRRGAPVVVHGDGTGRW
FT                   TITHSTDFAVAFTGLLGRPEAVGDTFHITSDEAPTWDQIYCYLAEALGVEAELVHVASE
FT                   SIAAAVPELGPGLLGDKAHSMQFDNSKVKALVPEFRARVPFARGAGEIVEWFLGDSSRQ
FT                   RLDPDLDAAFDRLVEHARAFG"
FT   gene            655454..655921
FT                   /gene="msrB"
FT                   /locus_tag="Lxx06560"
FT   CDS_pept        655454..655921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrB"
FT                   /locus_tag="Lxx06560"
FT                   /product="methionine sulfoxide reductase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06560"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88600"
FT                   /db_xref="GOA:Q6AG95"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG95"
FT                   /protein_id="AAT88600.1"
FT                   /translation="MTQEYRKDRDAIGRLTAAQFAVTQESATEPAFRNEFWNSHEAGLY
FT                   VDIVSGEPLFASVDKYDSRSGWPSFTVPVEPGNIVEKTDRSFGTLRTEVRSAHGDSHLG
FT                   HLFDDGPAEAGGLRYCVNSAALRFVPLAELDEQGYGDYKRLFENEGEGGRR"
FT   gene            655918..656427
FT                   /gene="msrA"
FT                   /locus_tag="Lxx06570"
FT   CDS_pept        655918..656427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /locus_tag="Lxx06570"
FT                   /product="methionine sulfoxide reductase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06570"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88601"
FT                   /db_xref="GOA:Q6AG94"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AG94"
FT                   /protein_id="AAT88601.1"
FT                   /translation="MTERAILAGGCFWGMQDLIRKRPGVLRTRVGYTGGDVPNATYRNH
FT                   GSHAEAIEIEFDPSRIGYRDLLEFFFQIHDPSTANRQGNDVGASYRSAIFYEDEEQRRV
FT                   AEETIAEVDASGLWSGKVVTEVSPAGPFWEAGPEHQDYLERIPWGYTCHFPRPGWTLPK
FT                   REAAGD"
FT   gene            656847..657632
FT                   /locus_tag="Lxx06590"
FT   CDS_pept        656847..657632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx06590"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06590"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88602"
FT                   /db_xref="GOA:Q6AG93"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG93"
FT                   /protein_id="AAT88602.1"
FT                   /translation="MYPLERQGLIERVLEEGGRVAVVDLAERFAVTTETVRRDLRVLEQ
FT                   AGILRRVHGGAVATERIGTAEVPVAERSGLRAATKQLIAARALDVLAADFHGSLYFDAG
FT                   TTTAAVARLLPERLAAVRGVAEVVTHSLTLAPALACAARVSLTVVGGRIRGVTAAAVGA
FT                   GTVRAIQSLRTDIVFVGANGLSAGFGMSTPDPEEAAVKEAIVRAALRVVLVADASKFCQ
FT                   ECLVSFAPLDAIDVLVTDREPEGALADALAAAGAEVWSP"
FT   gene            657629..658576
FT                   /gene="fruK"
FT                   /locus_tag="Lxx06580"
FT   CDS_pept        657629..658576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruK"
FT                   /locus_tag="Lxx06580"
FT                   /product="1-phosphofructokinase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06580"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88603"
FT                   /db_xref="GOA:Q6AG92"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR022463"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG92"
FT                   /protein_id="AAT88603.1"
FT                   /translation="MIVTLTANPSLDRAVALAGPLRPGEVQFAASSREDAGGKGITVAR
FT                   VIAAAGVSTLAVLPLAGDDPFGAVLRSSAVPTRPVAIHGHARANLTITDPAGATTKLNL
FT                   PGATLRAEEAETLGEAVVDACAGASWLVLAGSLPPGVGDDFYVTVIRAVRERWGEAAPR
FT                   VAVDTAGEALRTVVADARPDLIKPNDDELAELSGAALDPGDVERSVLRVARTLVPGRVG
FT                   AALITLGSRGSILVTPSGGYVAAAPRIRVQSTVGAGDSALAGYLLADVAGASAPQRLAG
FT                   AIRYGSAAAALPGTQAPHPADLPRDDIRVAALQP"
FT   gene            658609..660672
FT                   /locus_tag="Lxx06600"
FT   CDS_pept        658609..660672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx06600"
FT                   /product="PTS system, fructose-specific permease,
FT                   transmembrane protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06600"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88604"
FT                   /db_xref="GOA:Q6AG91"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG91"
FT                   /protein_id="AAT88604.1"
FT                   /translation="MSSKTIAPELVVLDIGAADKSAVIRVLAECLAAGGRATDADVLYA
FT                   DVWAREQKDDTGVSGGIAIPHAKSATIAVPSIAFARLTPGADFGAPDGPADLVFLIAAP
FT                   EGAEEMHLVVLSKLARSLLLDEFTARLRAAKTPEEIVALVNGAIEGDDAAPESAPPSPH
FT                   TAATHGLIVNGRPARIVAVTSCATGIAHTFMAADALSAAGKAAGIDLSVEPQGSSGYQP
FT                   LPQSAIDAADAIIFANDVDVREESRFAGKPVVRTGVKSGIERPSELIAEAVAVAGDPNG
FT                   ARVAAPGAVAGSAPAERLSWGRNLQRILLTGVSYMIPFVAGGGLLIAISFLPFLGGYGI
FT                   ALSHGDSGVNNAVYTLQHFAIWNLPPEGLGYYLGAIAFQIGALSLGFLVPALAGYIAFA
FT                   IADRPGIAPGFVAGAIAVFMNAGFLGGLIGGLLAGFAAWLICRPAVPRWLRGLMPVVVI
FT                   PLGASVIASGLMLLILGAPIALLMTQLTGFLNGLTGAGAIVLGVILGLMMCLDLGGPVN
FT                   KVAYAFAVAGLAQQTEASFQIMAAVMIAGMVPPLGMALASTVFYRRGFTRVERENGAAA
FT                   WLLGASFISEGAIPFAAADPLRVIPANLAGGAVAGGLAMALGVESRSPHGGIFVFFAID
FT                   PVGGFLLALAAGTVVTALVAVVLKRFVAPRSAAVAADPSEQTVAAVAMAWTH"
FT   gene            660701..661093
FT                   /locus_tag="Lxx06610"
FT   CDS_pept        660701..661093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx06610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06610"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88605"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG90"
FT                   /protein_id="AAT88605.1"
FT                   /translation="MSTEQGSAMNTPDWSGTVRVDQRISGPRLEELVGLDAKRWSVLGM
FT                   DIVVGDGRRELRVLAIARDRLPAGGDILARAAAAAGGSLPVREFAIEGVDPFELLERIG
FT                   HGYELRLQARCSQGLPLRIVDDTDPS"
FT   gene            661171..661854
FT                   /gene="gntR"
FT                   /locus_tag="Lxx06620"
FT   CDS_pept        661171..661854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntR"
FT                   /locus_tag="Lxx06620"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06620"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88606"
FT                   /db_xref="GOA:Q6AG89"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG89"
FT                   /protein_id="AAT88606.1"
FT                   /translation="MPIPVTKQSVAPKRVLLRDVVRDQIRDAIMDGTLKPGETLQDEAL
FT                   QEWLGTSRTPIRDALNELARVGLIEMEPNRYTRVAMLHSDSEALEALAVLGVIYGGAAA
FT                   IAIPALTAAQARELDKLLSQAIAGVKDADADRIRANVLTAYGKLVEHSKNTLLIKLFRE
FT                   TVDGLSYKIRVARLVQILDSESTVRFLNELSAAIAERDGLRGRRATDALFQLPNFRPGE
FT                   EASGR"
FT   gene            complement(662127..662414)
FT                   /pseudo
FT                   /locus_tag="Lxx06630"
FT                   /note="similar to peptidase"
FT   gene            complement(663113..664255)
FT                   /gene="pgk"
FT                   /locus_tag="Lxx06640"
FT   CDS_pept        complement(663113..664255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="Lxx06640"
FT                   /product="glycerate kinase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06640"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88607"
FT                   /db_xref="GOA:Q6AG88"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG88"
FT                   /protein_id="AAT88607.1"
FT                   /translation="MSRPLRIVVAPDSFKGTADAAAIARALAGGWLSARPQDDLALRPM
FT                   ADGGEGTVAAFAAAVPGARTRTVIVDGPDDRPVKAHWVHLPASAGRPGGTAVIEVAETS
FT                   GIGLLDPLRPHDAHTRGLGQAIAASLDAGVSQLLIGLGGSASSDGGAGALAALGAQLLT
FT                   LTGTDIPAGNRGLRELARLDLAELRALPPGGVRLLGDVRSPLLGPDGAAAVFGPQKGAT
FT                   AAEAGQLEANLRRLRDSAARSHPAAVPLSRLPGAGAAGGTGFGLLLWGASLVSGSAEIA
FT                   ERIGLDAALKDADLVITGEGRYDRQTARGKVASHVTALAAAQNTPVALVARLIEAPTTA
FT                   FAHRIELAGLAGSAQESHTRPLHWCHQAGAILAGQVGRRG"
FT   gene            complement(664278..665546)
FT                   /pseudo
FT                   /locus_tag="Lxx06650"
FT                   /note="similar to conserved hypothetical protein"
FT   gene            complement(665543..666343)
FT                   /locus_tag="Lxx06680"
FT   CDS_pept        complement(665543..666343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx06680"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06680"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88608"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG87"
FT                   /protein_id="AAT88608.1"
FT                   /translation="MTNPITIQEQQLPGETLERKFETALAWGFDGIELRSRGDLHFAGR
FT                   LPELRRARAAGVLMPTACVEMPHFIGAFDRELREDAITQLTSQLSVMAEIGGVGVMTPG
FT                   SYGMFSRRLPPFEPPRSPEEDHDILVDALGRLGQHAQTEGVELFLEPLNRYEDYLVNTL
FT                   AQAATLLDEVASPAMRIVADTYHMNIEEGDPAAALLAVAPHIGHLQASDSNRLEPGAGH
FT                   VDWALFGATVAALGYERSIAIESRLSGPADRVLPTVPPLLRRSL"
FT   gene            complement(666340..666657)
FT                   /locus_tag="Lxx06690"
FT   CDS_pept        complement(666340..666657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx06690"
FT                   /product="oxidoreductase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06690"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88609"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG86"
FT                   /protein_id="AAT88609.1"
FT                   /translation="MNRLLRFSAPRTVEIVDAPRPALEPGQVRVRTLSSGISAGTELTA
FT                   YRGTNPYLTSQWDPESRLFHETSGDGGLAYPLDGWGYSEVGEVIEVAAAGRPGILSRGV
FT                   R"
FT   gene            666786..668185
FT                   /pseudo
FT                   /locus_tag="Lxx06700"
FT                   /note="similar to binding protein dependent transport
FT                   lipoprotein"
FT   gene            668200..669117
FT                   /gene="malF"
FT                   /locus_tag="Lxx06720"
FT   CDS_pept        668200..669117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malF"
FT                   /locus_tag="Lxx06720"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06720"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88610"
FT                   /db_xref="GOA:Q6AG85"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG85"
FT                   /protein_id="AAT88610.1"
FT                   /translation="MHHLRPHRRSALASRDNRAGLTMVLPTTLIILAIVIVPVIWNLVL
FT                   AFQETDFSTIAENGLFNPLTLENFAAVFADPGFWSSLWTTIVYSVLSTVGSIAVGLVAA
FT                   LAFRSPFRGRGLARSLMLLPYVAPVVAVTFVWQIMLNAQFGIVNTIGKAWFGWEHPIDF
FT                   LGKAPYALITVIVFEIWRYFPFAFLFITARMVDLPGDVEEAALVDGVTPWQNFRHIVLP
FT                   QLLPVISLLSVLRLIMTFNKFDDVYLLTGGGAGTEVSAVRVYDQLVGSFDIGGAAANAF
FT                   VLSAILGVFLFVYVKFFAGKGEDE"
FT   gene            669114..669977
FT                   /gene="malG"
FT                   /locus_tag="Lxx06730"
FT   CDS_pept        669114..669977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malG"
FT                   /locus_tag="Lxx06730"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06730"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88611"
FT                   /db_xref="GOA:Q6AG84"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG84"
FT                   /protein_id="AAT88611.1"
FT                   /translation="MSRILVQRRTFGTLRWVVIAVLVVATVFPFYYMAELSLVPIEQVL
FT                   LHPDRLWVPLQNLTLRTYADVMTSQDDGGQGFGGFMLNSALVALATVAVMLLVSIPGSY
FT                   AVSRLNFFGRRQISALFLAVYLFPVIIAIPLFVGFSALGIRESLFGLVIVYIAQTIPMS
FT                   IHMLRSYLRSIPASVEEEAMVDGDGRGRILWQITVPLAMPSIVSTGLYVFMIAWNEFLF
FT                   ALLFLAADRDLWTVSLGLSQLSNGIEVSKTVLMAGSVLLTIPIIVLYGLAERSLTEGLT
FT                   SGADKG"
FT   gene            670004..671191
FT                   /locus_tag="Lxx06740"
FT   CDS_pept        670004..671191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx06740"
FT                   /product="transcriptional regulator, ROK family"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06740"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88612"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG83"
FT                   /protein_id="AAT88612.1"
FT                   /translation="MDRGRWAPPEERRRMSSGPGDVLQLIRRSEASTRGEVQQLTGLSR
FT                   MTVAQRIDALMDAGLIVEHAGAGEATGGRRPDRLAFHVERSVLAVAAVDTERSRTALTD
FT                   LSGRVLATDTVEVAITDGPTTLLDALTASMRGLIDRAAHGRDVVGSGVSVPGPVDPRTR
FT                   RPSQPPIMPGWDGFPIAEHLAQSLPVPTFVENDADAMAFGEQSTNFPDDPAVCLVKVST
FT                   GIGAGLVINGSVYHGIDGGAGDIGHIRLADEDAICQCGSRGCLAAVASGRAVAMQLTGS
FT                   GVPAASGHDIGRLLRDGNIDALRLTHRAGMRIGEVMATVISMINPGTLIVSGDLASAAL
FT                   LGGLRETLYPHSLPRATRNLDIRLGELGADAGLIGMARIVTDSLYSADAINHQLA"
FT   gene            complement(671695..671838)
FT                   /pseudo
FT                   /gene="metG"
FT                   /locus_tag="Lxx06750"
FT                   /note="similar to methionyl-tRNA synthetase"
FT   gene            complement(672127..672423)
FT                   /pseudo
FT                   /locus_tag="Lxx06760"
FT                   /note="similar to hypothetical protein"
FT   gene            672631..674400
FT                   /gene="metG"
FT                   /locus_tag="Lxx06770"
FT   CDS_pept        672631..674400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metG"
FT                   /locus_tag="Lxx06770"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06770"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88613"
FT                   /db_xref="GOA:Q6AG82"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG82"
FT                   /protein_id="AAT88613.1"
FT                   /translation="MDSVILRNASSFYITTPIFYVNDVPHIGHAYTEVAADVLVRWHRQ
FT                   AGEDVWLLAGTDEHGQKILRTAAAQRLSPAEWTDRLVHDSWRPLLEALRISADDFIRTT
FT                   EDRHKVVVIAFLTLLREKGLVYEGTYEGFYCVGCEEYKQESDIIAGTGAFAGQVLCPVH
FT                   ARSVDVVNEKNYFFKMSAFQDRLLEMLADEEFLRPAAVRNEILAFVGSGLKDISITRSS
FT                   FDWGVEVPWEPGHVVYVWFDALLNYISGIGWGSDVEEFDRRWPDVHIIGKDIARLHAVL
FT                   WPAMLMAADLPVPKRIVAHGWLLVNGEKMSKSNATGIGPEQIVKAFGIDAFRYYFVRSI
FT                   VFGQDGSFSWDDIHRRYNADLANGLGNLVSRTIAMITKYRAGIVPEAAAPTAAEDEVRH
FT                   TITQARANASAAIDRFALSEALGQVWTIVERLNSYITEQTPWSLARDEAQAHRLDTVLN
FT                   TVAEGLRELAVLLRPFLPDTAQAIWAGLGAEAVCGDLRRSDGGEGRGRRQPPEGCRHRR
FT                   RAAALPPHRAGGGDRHRGGTDARLSLTAEEMIEVARTTAARSARRWTNSSTLSQQRRRA
FT                   RTDAQKDALLAQD"
FT   gene            complement(675490..675568)
FT                   /gene="Arg"
FT                   /locus_tag="Lxx06790"
FT   tRNA            complement(675490..675568)
FT                   /gene="Arg"
FT                   /locus_tag="Lxx06790"
FT                   /product="tRNA-Arg"
FT   gene            676318..678006
FT                   /gene="argS"
FT                   /locus_tag="Lxx06800"
FT   CDS_pept        676318..678006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="Lxx06800"
FT                   /product="arginyl-tRNA synthetase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06800"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88614"
FT                   /db_xref="GOA:Q6AG81"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AG81"
FT                   /protein_id="AAT88614.1"
FT                   /translation="MTPADLSAALFAIVTTAMDRRRATGADIAGLELTVEDVPLERPKN
FT                   RGHGDWSSNVAMRLAKKAGANPRELAAEIAEAAAGIDGVASAEVAGPGFINFRLEAAAA
FT                   GQLARTILEAGAAYGTGDLYDGLLVNLEFVSANPTGPIHLGGARWAAVGDSLARILQAE
FT                   GADVTREYYFNDHGSQIDRFARSLLAAHRGEATPEDGYGGGYIGEIAAKVAAGYDGDLA
FT                   ALSRDDQQEVFRSAGTALMFQEIKDRLHSFGVDFDVYFHEDSLHASGAVERAIRRLDEL
FT                   GHIFEEDGAVWLRTTAFGDDRDRVIVRSNGEPAYISGDLGYYLDKRERGFEQNIIMLGA
FT                   DHHGYIGRLMAMVEAFGDIPNVNLQILIGQMVNLVRDGEPVKMSKRAGTIVTLDDLVDA
FT                   VGVDAARYALVRSSTDSQLDVDLDLLAKRSNENPVYYVQYAHARTRSVAANAERAGVDR
FT                   SAFKPELLTHETESALLGGLQEFPRVVAQAAELSEPHRVARSIEELAGLYHAWYAVRDG
FT                   STRVIPLGEEPVTDAHRTRLWLNDATGQVLRNGLRLVGVSAPERM"
FT   gene            678099..678797
FT                   /locus_tag="Lxx06820"
FT   CDS_pept        678099..678797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx06820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06820"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88615"
FT                   /db_xref="InterPro:IPR021373"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG80"
FT                   /protein_id="AAT88615.1"
FT                   /translation="MWTLVPLAALAILLVATDAIARSVLEQRVAAEIEKSLPETVKADV
FT                   DVRIGGLSVLQQLLAGQFESVDLLAPRATVAGAPLSFRVHATGVPTDLGVPIASATGTL
FT                   SVSQDSLNKLVTVPGVTGDLTLQQGAVGYDGRLDLLGLPVGYTVSAKPEAAGKEVLLHP
FT                   EKDQHLDGDGRCERHTAAPVADRERAFPGVRGAVPAGWRSGARHHGDAGPCDGGAERLA
FT                   LRDGRGVPSQ"
FT   gene            complement(679374..680156)
FT                   /locus_tag="Lxx06832"
FT   CDS_pept        complement(679374..680156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx06832"
FT                   /product="glycosyltransferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06832"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88616"
FT                   /db_xref="GOA:Q6AG79"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG79"
FT                   /protein_id="AAT88616.1"
FT                   /translation="MRVLAFSFTRSSLGHVRRMAAAAEALIARGHEVAIASHEAGREEV
FT                   TRAGARWLGIREIAPDLRWHEISEPDAFRDFVRTRQASRSYVESSLEDEFGTIEAVRPD
FT                   LVLADMRNTAGVAAALHGIPSITVHNLRLFAHPLHVILPELLRTLDDIGIDSNARNKIL
FT                   GDVLAIPSLGALDPWNELAPEISGMVMDLVLEARHIGPLFSAADRRDLLDLPPTRDRKI
FT                   VVTLGGSGAGGDDVRHFLDSTARLDIETKVIIGPDAAQ"
FT   gene            complement(680157..681380)
FT                   /locus_tag="Lxx06835"
FT   CDS_pept        complement(680157..681380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx06835"
FT                   /product="H+ antiporter-3 of the major facilitator
FT                   superfamily (MFS)"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06835"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88617"
FT                   /db_xref="GOA:Q6AG78"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG78"
FT                   /protein_id="AAT88617.1"
FT                   /translation="MNTTAPEPDAGASLASTDFRVLLASRIFSAMASGLTWVLLSLWVF
FT                   AQTESPFLTGLMSATNVVPYIVFGILAGATVDRGTPSAVIAAMEFVNCAALAVVPILTL
FT                   TGTTAIWPLFLVAAVSSTAYVWFDVSSSAIVPRIVPGRDLALANSRLWLISTLVSVAAA
FT                   PLAFTMLNTFGLGTSFGILAALYAISGFVLTRLKALNPVAPSVGSRLQQLVEGLRFSVV
FT                   EPTIRFFMTTSIGMGISGGAVYGMLIVFSSDALGLASTDLHISLIVGASGLGALIGALA
FT                   TPRLERWSTLRMVRVLLLANVALMFLFTRSPNWLIAGVAVLAWNATQTSLMVLSIAARQ
FT                   RVTPLHLQGRVNSAGRTVAWGSVLVGTFVCGSLASGLGVRTALLVLVVPVTASFVIALI
FT                   LRFPRLAA"
FT   gene            complement(681377..682000)
FT                   /locus_tag="Lxx06840"
FT   CDS_pept        complement(681377..682000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx06840"
FT                   /product="iron-sulfur flavoprotein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06840"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88618"
FT                   /db_xref="GOA:Q6AG77"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG77"
FT                   /protein_id="AAT88618.1"
FT                   /translation="MRILAINDSERVDGWTSKVTAFALDRASSRGCETQQIGLADYRVS
FT                   QCNCGQRNSRATPCPVDDDVPLIVEAMERSDAVMLAAPVHGFGLAARMQLFIERAGVGV
FT                   MRFHRPLTNKLGAAIVIGRRYSLKGTHAQLVNNLLLNRLIVVGSGFPALVHTVGVGGAL
FT                   DDEEGLDSVRRTFDRIVDVGQLFESVGLEISAPHDVEIRLGRTG"
FT   gene            682365..682730
FT                   /pseudo
FT                   /gene="tnp"
FT                   /locus_tag="Lxx06845"
FT                   /note="similar to transposase, ISlxx4"
FT   gene            683559..685037
FT                   /pseudo
FT                   /gene="trpE"
FT                   /locus_tag="Lxx06847"
FT                   /note="similar to anthranilate synthase component I"
FT   gene            685037..685360
FT                   /pseudo
FT                   /gene="pabA"
FT                   /locus_tag="Lxx06853"
FT                   /note="similar to glutamine amidotransferase, class I"
FT   gene            685906..687321
FT                   /gene="lysA"
FT                   /locus_tag="Lxx06860"
FT   CDS_pept        685906..687321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysA"
FT                   /locus_tag="Lxx06860"
FT                   /product="diaminopimelate decarboxylase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06860"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88619"
FT                   /db_xref="GOA:Q6AG76"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG76"
FT                   /protein_id="AAT88619.1"
FT                   /translation="MAPNPLAPSWLKVPEDPNALVPGLWSRTVVREAGDGVLSVGGVPV
FT                   TALAERFGTPLYVVDEAEVRERAADVRAAFQEAFAGVGTAAKVYYAGKAFLSIEVARWM
FT                   AGAGLNIDVCSGGELAVALAAGVAADRLGFHGNNKSEAEIEAAVSAGVGAIVIDSVQEI
FT                   DRVAAAASRHGVVQPVRLRVNSGVHAHTHAFLATAHDDQKFGIALPDAAAAVARIREHG
FT                   SLAFLGLHGHIGSQIFGADGFAESASRLLAVHRELLAGGDVPELNLGGGFGIAYTAADD
FT                   PAPIAELAHRIAETVAASCTRLGIPLPVVAFEPGRSIIGRAGLTLYTVGTTKEVLAAAQ
FT                   DGGETAVRRYVSVDGGMSDNARPALYEADYSARIAGRVSAAPPVLVRVAGKHCESGDIV
FT                   VHAEYLPADTAPGDLLAVPATGAYCWTLASNYNYLGRPAVVAVRDGEARVIVKGESIED
FT                   LLARDAAYEGANG"
FT   gene            687318..688673
FT                   /gene="thrA"
FT                   /gene_synonym="metL"
FT                   /locus_tag="Lxx06870"
FT   CDS_pept        687318..688673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrA"
FT                   /gene_synonym="metL"
FT                   /locus_tag="Lxx06870"
FT                   /product="homoserine dehydrogenase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06870"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88620"
FT                   /db_xref="GOA:Q6AG75"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016204"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG75"
FT                   /protein_id="AAT88620.1"
FT                   /translation="MIEYRNLRVALLGAGSVGSQVARLLLDQGDEFAARVGAKLELVGI
FT                   AVRDLHAKRNADLPRDLYTTEASALILGADIVVELMGGIEPARGYVHEALTSGADVITA
FT                   NKALMATHGPELFEVAEQVGAQLYYEAAVAGAIPIIRPLRDSLAGDRVNRILGIVNGTT
FT                   NFILDRMDTTGETLADALATATARGYAEADPTADIGGYDAAQKAAILASLAFHTTVPLD
FT                   RVYREGITSVTKEQVDAAREAGAVIKLLAICERLIDPETGEEGVSARVHPALIGRDHPL
FT                   AAVHGAHNAVFVQAAAAGDLMFYGAGAGGVETASAVLGDVVSAARRHVVGGPGVAESTH
FT                   ADIPVLDIGRVITRYQITLDVPDQPGVLAAVTRILSDGGVSVETMRQSAPTGTGVVVLP
FT                   GTAPIHGAGAPTATLVIGTHEAEEAALAATVEALAASDAVFAISSVLRVEGY"
FT   gene            688675..689787
FT                   /gene="thrC"
FT                   /locus_tag="Lxx06880"
FT   CDS_pept        688675..689787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /locus_tag="Lxx06880"
FT                   /product="threonine synthase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06880"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88621"
FT                   /db_xref="GOA:Q6AG74"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR026260"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG74"
FT                   /protein_id="AAT88621.1"
FT                   /translation="MLPSPKPHSRQWRGVLHEYADRLSVSASTPIVTFGEGGTPLIPAP
FT                   ALSARTGATVYVKFEGMNPTGSFKDRGMTMAISKAVEHGAKAVICASTGNTSASAAAYA
FT                   ARAGVQAVVLVPEGKIAKGKLSQAIAHNGRLLQVQGTFDDCLDIARDLAASYPVHLVNS
FT                   VNPDRIEGQKTAAFEIVEALGDAPDFHVVPIGNAGNYTAHHRGYTEELQRGEATKLPRM
FT                   FGFQAAGSAPIVLGHPVKDPDTIATAIRIGNPASWELALNARDDSGGYFGAIADAKILE
FT                   AHRILSAEAGVFVEPASAISVAGLLERSEAGVIPAGATVVLTVTGHGLKDPQWALRTAD
FT                   GSEVQPTFVPVDTAAVAETLGLTSNTGVSA"
FT   gene            689787..690758
FT                   /gene="thrB"
FT                   /locus_tag="Lxx06890"
FT   CDS_pept        689787..690758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="Lxx06890"
FT                   /product="homoserine kinase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06890"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88622"
FT                   /db_xref="GOA:Q6AG73"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AG73"
FT                   /protein_id="AAT88622.1"
FT                   /translation="MLRTVDLSGRSVAVKVPATSANLGPGFDTLGLALAQYDELRVSVR
FT                   PEPGATVVVRGIGEGEVPTDETNLVVRAIAHTFESVGVELPGLSLVARNSIPHGRGMGS
FT                   SGAAIVSGIMAAKGLLQGVADIDAQGLLALANDMEGHPDNVAPALFGGLTIAWVTPDGP
FT                   RFKKLIVHRGVSPLVLVPERVMSTALARSLQPASVPHEDAVFNVSRSALLVAALIQSPE
FT                   LLHAATEDKLHQSYRASAMPETDRLITLLRTNGFAAVVSGAGPSILVLCSDPGQRLAAA
FT                   RLVATQGAAAWQPLMLAVDFKGATVPRIAEDAVSGEGDTTAV"
FT   gene            690967..693105
FT                   /gene="rho"
FT                   /locus_tag="Lxx06900"
FT   CDS_pept        690967..693105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="Lxx06900"
FT                   /product="transcription termination factor"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06900"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88623"
FT                   /db_xref="GOA:Q6AG72"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG72"
FT                   /protein_id="AAT88623.1"
FT                   /translation="MLIAARMERAGGKEPSSVTDVELHAGGVDTSDLTSLKVAELQALA
FT                   TQLGLQGASKLRKGELVAAIAAARSAVEGAPAPAAAGQQEPASAASQVLIEPLIAAPVE
FT                   DEPAAATLLPQTGGRRRGSRRASSPDGTRITAATHVNTGETGVESLIPDVDALLDSALA
FT                   SREQAQRDGQGQNGSRRGLGQSGQQEQNSPQTAPTAGADSAEADAPRPAGQPGDQQDAQ
FT                   TSGGRRRGRNRNKGAGGQNGEQGQNQGPQNQNQNQNHQSQPKDLQQGGEQGEKQGQQNR
FT                   SGQQQAEGERSGRYRDRNRKRRSGVAGDELEPEIDEDDVLVPVAGILDVLDNYAFVRTT
FT                   GYLPGASDVYVSLGQVKKYSLRKGDAVVGAIRQPREGENNSRQKYNALVKVDSINGQTV
FT                   EEAAARVEFGKLTPLYPQERLRLETEPTKITQRIIDLVAPIGKGQRGLIVAPPKAGKTI
FT                   VMQQIANAITTNNPEVHLMIVLVDERPEEVTDMQRTVKGEVIASTFDRLAEDHTTVAEL
FT                   AIERAKRLVELGHDVVVLLDSITRLGRAYNLTAPASGRILSGGVDASALYPPKRFFGAA
FT                   RNIEHGGSLTILASALVETGSKMDEVIFEEFKGTGNMELRLSRQLADKRIFPAVDVNVS
FT                   GTRREEMLMGQDEVKITWKLRRALAGLDQQQALEMVLGRLKETSSNVEFLMQMQKSMPQ
FT                   PAAGHGAAHSHGHENDHC"
FT   gene            693192..694268
FT                   /gene="prfA"
FT                   /locus_tag="Lxx06910"
FT   CDS_pept        693192..694268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="Lxx06910"
FT                   /product="peptide chain release factor 1"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06910"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88624"
FT                   /db_xref="GOA:Q6AG71"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AG71"
FT                   /protein_id="AAT88624.1"
FT                   /translation="MFDSVTGLIAEHDDLQQQLSDPELHSDPVRSKKVNRRYAELSRIV
FT                   AAYTEWKQLTDDLEAARELAAEDDAFAAEIPGLEQGLEESEEKLRRLLIPRDPNDSRDA
FT                   IMEIKMGEGGAESALFAGDLLSMYLHYADSRRWKAEIIEQTSSDLGGIKDVQVAFKGSS
FT                   SDPAEGVWAHLKYEGGVHRVQRVPATESQGRIHTSAAGVLVFPEVDEPEEVEINPNDLK
FT                   IDVFRSSGPGGQSVNTTDSAVRITHAPTGIVVSMQNEKSQLQNREAAMRVLRARLLAKQ
FT                   QEEADAEAAEFRKGQIRTMERSERIRTYNFPENRIADHRTGYKAYNLDAVMNGALGPVI
FT                   ESCILADEETRLANLSTD"
FT   gene            complement(694435..694998)
FT                   /gene="cysE"
FT                   /locus_tag="Lxx06920"
FT   CDS_pept        complement(694435..694998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="Lxx06920"
FT                   /product="serine O-acetyltransferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06920"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88625"
FT                   /db_xref="GOA:Q6AG70"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG70"
FT                   /protein_id="AAT88625.1"
FT                   /translation="MFRVCEDLGNARKHDPAARGPVEVAIVYSGLHAVWAYRVAHRLWR
FT                   AGLRTPARMLSQFARFLTGIEIHPGARIGRRFFIDHGMGVVIGETAWIGDDVLLYHGVT
FT                   LGGRGSEHGKRHPTVHDGVVVGAGAKVLGAITIGARTVIGANAVVVHDAPPDSVLTGVP
FT                   ARPRPHLGREQIAGDDWLDPALYI"
FT   gene            complement(695008..695700)
FT                   /pseudo
FT                   /gene="cysK"
FT                   /locus_tag="Lxx06930"
FT                   /note="similar to cysteine synthase"
FT   gene            695952..696830
FT                   /gene="hemK"
FT                   /locus_tag="Lxx06940"
FT   CDS_pept        695952..696830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemK"
FT                   /locus_tag="Lxx06940"
FT                   /product="methyltransferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06940"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88626"
FT                   /db_xref="GOA:Q6AG69"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG69"
FT                   /protein_id="AAT88626.1"
FT                   /translation="MSDELPAATVRSLREEMAALLARAGVPDPDVDAELLIGHVLGVSR
FT                   GRVQALTVLEATLGPVDAARLRDLAQRRAAREPVQHITGRAPFRSLELAVGPGVFVPRP
FT                   ETEQVAQFAIDALRAVPSPEPIVADLGTGSGAIALALATEVPHARVFAVENSPEAFVWS
FT                   RRNIDAAGAPNVRAVFADLADALPDLDGAVDVVISNPPYVPDAAVPRDPEVRLFDPHVA
FT                   LYGGEDGLDVVRTISRVAWRLLRSGGALVLEHGERQGAAVRDLLTADGWRAAATHRDLT
FT                   ARDRATTATRA"
FT   gene            complement(696849..697481)
FT                   /locus_tag="Lxx06960"
FT   CDS_pept        complement(696849..697481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx06960"
FT                   /product="hydrolase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06960"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88627"
FT                   /db_xref="GOA:Q6AG68"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG68"
FT                   /protein_id="AAT88627.1"
FT                   /translation="MDVYFFDCDKTLYGYDFRKRLPRLAELCGVSQYRLASTWWAGGHE
FT                   SAAESGEYATSEEYLDAFAEVTGARLSLTQWQEARKAAMTPIPGAIAALKEAAALGTVS
FT                   LLSNNPIPFKDSLPVLMPEAAGTLGDNDLISAVLGSRKPERRAYTRALGRFGIRAEDAI
FT                   LFDGSPANVEGAREAGMHAHRAVTREDGSFESGGLLAAMYAFAERER"
FT   gene            697560..698258
FT                   /locus_tag="Lxx06950"
FT   CDS_pept        697560..698258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx06950"
FT                   /product="translation factor"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06950"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88628"
FT                   /db_xref="GOA:Q6AG67"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG67"
FT                   /protein_id="AAT88628.1"
FT                   /translation="MATIYDCSVESDLLTGMRLARGAIGRGELVVIPTDTVYGVAADAF
FT                   SPAAVQRLLDAKGRGRQSPPPVLVPGLAALAALAERVPAEVEALVEAFWPGGLTIVLPA
FT                   APLLVWGLGETSGTVALRMPQDRIALELLAETGPLAVSSANLSGRPAARTAVEAEGMLG
FT                   DAVAVYLDGGEAGSAYDRVEGRDSSSTILDATALASGSGGLRILRHGVVTAERLRAVAG
FT                   DALAGEPTDT"
FT   gene            698263..699531
FT                   /gene="rfe"
FT                   /locus_tag="Lxx06970"
FT   CDS_pept        698263..699531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfe"
FT                   /locus_tag="Lxx06970"
FT                   /product="undecaprenyl-phosphate
FT                   alpha-N-acetylglucosaminyltransferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06970"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88629"
FT                   /db_xref="GOA:Q6AG66"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG66"
FT                   /protein_id="AAT88629.1"
FT                   /translation="MILLIALALISAVITFGMSFVVYKLAMRYRLYPKIRARDVHSRPT
FT                   PRLGGAAIFLGILFAFGVAWLLSSRFGVLTLIFSDSGPILAILGAALLIVVIGVADDLW
FT                   DLDWTTKLAGQLVAAGLIAWLGVQIYSLPIGGLTVGSPLMSIVITLFAIVLVMNAINFI
FT                   DGLDGLVAGVALIANGTFLVYTYLLQREISPQNYFSLAGVIAAILVGACVGFLPLNWHP
FT                   AKMFMGDAGALLIGLLMATSAISVTGTINPQDLQTLGKSSLVPAFIPIILPFAVLVIPL
FT                   LDFGLAVIRRLRAGKSPFSADRKHLHHRLLDMGHKHLHAVLIFYAWTAVLSIGCLLFFF
FT                   DPYWMAVVFVAIGLVVCTAFTLAPLSRRKADEAVAELAPAGSKEAEETARFDQLDAASE
FT                   PREPATVPPAASPDLSTPPEENR"
FT   gene            699528..700034
FT                   /locus_tag="Lxx06980"
FT   CDS_pept        699528..700034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx06980"
FT                   /product="membrane protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06980"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88630"
FT                   /db_xref="GOA:Q6AG65"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG65"
FT                   /protein_id="AAT88630.1"
FT                   /translation="MTDHQAGAAVPELAPRLDQPPAQPTSTPVLRTILRYGLVLAAIIA
FT                   VLGMVLGGIGAGWIGVTSALIGTTMAAVFLSVTALSILIANRFIASDLFVGLFFGIVLG
FT                   GWIVKFVLFLVLAIVLRDQPWIDPVVLFLSLIAGVIGSLVIDVVVVARSRIPYVSDALL
FT                   PGEKR"
FT   gene            700205..701002
FT                   /gene="atpB"
FT                   /locus_tag="Lxx06990"
FT   CDS_pept        700205..701002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="Lxx06990"
FT                   /product="ATP synthase, A chain"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx06990"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88631"
FT                   /db_xref="GOA:Q6AG64"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG64"
FT                   /protein_id="AAT88631.1"
FT                   /translation="MNLLVQAASSDDGSFQGPSINEFFPPTLFTIDGLEFNRIIVVRLI
FT                   ALVALILVFWLGTRRMKVVPGRFQSVVEMGLDFVRVNIAEDLLGRKDGRRFLPLLTTIF
FT                   FMVLFFNLTGIVPFLNIAGTSVVALPMLLAIVAYIAFIYAGIRKSPKNFFKNALFPPGV
FT                   PLALYIIVTPIEFVSTFVLRPITLTLRLLMNMVVGHLLLVLFFTATSWFLLDAGGWWSL
FT                   FGVGTFAFGFAFTLFEILVAVLQAYVFALLTGVYIQLAVAEEH"
FT   gene            701054..701275
FT                   /gene="atpE"
FT                   /locus_tag="Lxx07000"
FT   CDS_pept        701054..701275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="Lxx07000"
FT                   /product="ATP synthase, C chain"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07000"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88632"
FT                   /db_xref="GOA:Q6AG63"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG63"
FT                   /protein_id="AAT88632.1"
FT                   /translation="MDIAAINGNIATVGYGLAAIGPAIGVGIVVGKTIESVARQPELAG
FT                   RLQVLMYIGIAFTEALAFIGIATYFIFQ"
FT   gene            701308..701880
FT                   /gene="atpF"
FT                   /locus_tag="Lxx07010"
FT   CDS_pept        701308..701880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="Lxx07010"
FT                   /product="ATP synthase, B chain"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07010"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88633"
FT                   /db_xref="GOA:Q6AG62"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AG62"
FT                   /protein_id="AAT88633.1"
FT                   /translation="MLSSVVIAASEEQHNPLIPEPADIVGSLICFVVILFFFWKLVLPR
FT                   VKKLLDERAEAIEGNIAKADEAQHKAEALLEEYTAQLAEARADAAKIREQARTDGQKIV
FT                   AEAKDTATAEAARVTASAQAQIEAERQTALVSLRGEVGSLAIDIASGVVGEVLTEDKKA
FT                   QAIVDRFLADLEASEKATSNEKAGTAN"
FT   gene            701880..702671
FT                   /gene="atpH"
FT                   /locus_tag="Lxx07020"
FT   CDS_pept        701880..702671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="Lxx07020"
FT                   /product="ATP synthetase, delta chain"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07020"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88634"
FT                   /db_xref="GOA:Q6AG61"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AG61"
FT                   /protein_id="AAT88634.1"
FT                   /translation="MGSATREARARSVSALAGLGSKADLATAEDLFAAGRVVADSVQLR
FT                   AVLSDPAADRSGKDVLVKRVFGALSAPAVELLGVIAGERWSGQDDVLDAIEELGIRSIA
FT                   ASAPRTVDIPAELLAFGGAVTSDAELELALRSKLADPSAKAALVERLLVGKAAGQTVAI
FT                   TRQLVLQPRGRSVRQALREAARIVAAQDGQTIATVVTATPLPAAQAERLRASLAAKYGD
FT                   LKLNQVVDPSILGGMRVQIGGDVIDGSVSSRLSKLRLQLAG"
FT   gene            702698..704335
FT                   /gene="atpA"
FT                   /locus_tag="Lxx07030"
FT   CDS_pept        702698..704335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="Lxx07030"
FT                   /product="ATP synthase, alpha chain"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07030"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88635"
FT                   /db_xref="GOA:Q6AG60"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AG60"
FT                   /protein_id="AAT88635.1"
FT                   /translation="MADISISPDEIRDALKDFVSKYEPAKAATAEVGHVLDASDGIAHV
FT                   EGLPGVMANELIRFADGTLGLAQNLDENEIGVVVLGEFEGIVEGMEVTRTGEVLSVPVG
FT                   DGYLGRVVDPLGNPIDGLGEIATEGRRELELQAPGVMHRKSVHEPLQTGIKAIDAMIPV
FT                   GRGQRQLIIGDRQTGKTAIAIDTIINQKANWESGDVTKQVRCIYVAVGQKGSTIAAVKG
FT                   ALEDAGAMEYTTIVAAPASDPAGFKYLAPYTGSAIGQHWMYGGKHVLIIFDDLSKQAEA
FT                   YRAVSLLLRRPPGREAYPGDVFYLHSRLLERCAKLSDELGAGSMTGLPIIETKANDVSA
FT                   YIPTNVISITDGQIFLQSDLFNANQRPAVDVGISVSRVGGDAQVKSIKKVSGTLKLELA
FT                   QYRSLEAFAMFASDLDAASRRQLARGARLTELLKQPQYSPYPVEEQVVSIWAGINGKLD
FT                   EVAVEDVLRFESELLDHLRRNTGILTTLRDTNVLDDETVEKLSSEVDAFKLEFQTGEGK
FT                   PLAAVGREDFDAIAEEDVNQERIVKAKR"
FT   gene            704379..705278
FT                   /gene="atpG"
FT                   /locus_tag="Lxx07040"
FT   CDS_pept        704379..705278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="Lxx07040"
FT                   /product="ATP synthase, gamma chain"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07040"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88636"
FT                   /db_xref="GOA:Q6AG59"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AG59"
FT                   /protein_id="AAT88636.1"
FT                   /translation="MGAQLRVYRQKIKSAHRTKKITRAMELISASRIQKEQARVAASSP
FT                   YARAITRAVSAVATYSNVGHVLTTEPEKIERAVIVIFSSDRGLAGAFNSNVLKESEKLA
FT                   ELLRSQGKEVVYFLIGRKAQGYFSFRRRAFERVWTGNTDAPEFEQAKEVADAILESFLR
FT                   DSADGGVDEIHVIYNRFVSMLTQEPQVVRLLPMEVVEGVEEPDRTQVLPLYEFEPDVNT
FT                   VLDSLLPVYIESRIFNAMLQSAASKHAATQKAMKAASDNADKLITDYTRLANNARQAEI
FT                   TQQISEIVGGADALSSAN"
FT   gene            705304..706767
FT                   /gene="atpD"
FT                   /locus_tag="Lxx07050"
FT   CDS_pept        705304..706767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="Lxx07050"
FT                   /product="ATP synthase, beta chain"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07050"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88637"
FT                   /db_xref="GOA:Q6AG58"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AG58"
FT                   /protein_id="AAT88637.1"
FT                   /translation="MTTATAEAQASTAQPAGVGRIARVTGPVVDIEFPHDSIPGIYNAL
FT                   KTTITIGDRSTEITLEVAQHLGDDLVRAISLKPTDGLVRGGEVRDTGSLITVPVGDVTK
FT                   GKVFDVTGEILNAEPGEKIEIAERWPIHRQPPSFDHLESKTQLFETGIKVIDLLTPYVQ
FT                   GGKIGLFGGAGVGKTVLIQEMVQRVAQDHGGVSVFAGVGERTREGNDLIHEMEEAGVFD
FT                   KTALVFGQMDEPPGTRLRVALSALTMAEYFRDVQKQDVLLFIDNIFRFTQAGSEVSTLL
FT                   GRMPSAVGYQPNLADEMGLLQERITSTRGHSITSLQAIYVPADDYTDPAPATTFAHLDA
FT                   TTELSREIASKGLYPAVDPLTSTSRILDPRYLGADHYRVATTVKQILQKNKELQEIIAI
FT                   LGVDELSEEDKITVSRARRIQQFLSQNTYMAKKFTGVEGSTVPLKETIESFDAIAKGEF
FT                   DHVAEQAFFNVGALSDVEEKWAQIQKENG"
FT   gene            706770..707030
FT                   /gene="atpC"
FT                   /locus_tag="Lxx07060"
FT   CDS_pept        706770..707030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="Lxx07060"
FT                   /product="ATP synthase, epsilon chain"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07060"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88638"
FT                   /db_xref="GOA:Q6AG57"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG57"
FT                   /protein_id="AAT88638.1"
FT                   /translation="MAVLTVSVVAADHEVWSGEASMVVARTVEGQIGILPGHEPLLAIL
FT                   ASGEVRVTLNGGESIAAQADDGFLSVENNVVTVVARQAELV"
FT   gene            707053..707589
FT                   /locus_tag="Lxx07070"
FT   CDS_pept        707053..707589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07070"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07070"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88639"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG56"
FT                   /protein_id="AAT88639.1"
FT                   /translation="MERHFGDMRVPVLVVTAGLPGSGKSTIAGIVAARLGAAVISVDPI
FT                   EAAILRAGIDDDQPTGLAAYLVAETMSEQVLLTGYSVIVDAVNAVEPARLQWKALAERC
FT                   DVKLRVIETVCSDEKLHDERLSDRTGVTAAFAVEQSIDDYAEWTGPCASLPRVTLDTSL
FT                   PLGENVNAAHAFLEG"
FT   gene            707591..708385
FT                   /locus_tag="Lxx07080"
FT   CDS_pept        707591..708385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07080"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07080"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88640"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG55"
FT                   /protein_id="AAT88640.1"
FT                   /translation="MLVLLPPSETKRDGGAPVPLVLDRLGFGALAPIRAAVLADLISLS
FT                   VDRDTAVKVLKLGPKQAVEVDRNRALESAPTMPALLRYTGVLYDALEADGFTEEQWRFA
FT                   ASAVAIQSALFGVVGAADPIPAYRLSFDSRLSPSLKKRWAEPCAAVLGSHPGLILDLRS
FT                   EGYAALAPLPLREGAHYVRVLARDESGTVRALNHFNKQAKGLLTRALVEAVADLATTDD
FT                   LLTWASDEGYTLTRAADGSRDLELIVPDVAGSPGRLRAMLRP"
FT   gene            complement(708405..709022)
FT                   /gene="tagI"
FT                   /locus_tag="Lxx07090"
FT   CDS_pept        complement(708405..709022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tagI"
FT                   /locus_tag="Lxx07090"
FT                   /product="DNA-3-methyladenine glycosydase I"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07090"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88641"
FT                   /db_xref="GOA:Q6AG54"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG54"
FT                   /protein_id="AAT88641.1"
FT                   /translation="MSESPAAAPAAASNRPAVVIGDDGVQRCSWPANDAKYTRYHDEEW
FT                   GGPQHDPKALYEKICLEGFQAGLSWITILRRRPAFREVFLGFQPERVAAMTEADVLRLL
FT                   QDERIIRHRGKIEATIANANAVLKLDVPLDDLLWSFAPRKPPPPPPQAWSEVPAVTPES
FT                   TALSAELRRRGFRFVGPTTMYALMQATGMVDDHVEGCFRAAE"
FT   gene            complement(709019..709516)
FT                   /gene="ada"
FT                   /locus_tag="Lxx07100"
FT   CDS_pept        complement(709019..709516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ada"
FT                   /locus_tag="Lxx07100"
FT                   /product="methylated-DNA-protein-cysteine
FT                   S-methyltransferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07100"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88642"
FT                   /db_xref="GOA:Q6AG53"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG53"
FT                   /protein_id="AAT88642.1"
FT                   /translation="MSSSSRYLLSVPSPIGRIELTGDGEAVTSLSIARGGILPHGERPE
FT                   YTSAVLDDAAEQLAQYFAGDRRDFDLPLRLEGTPFRRAVWERLAGLGFGTLTTYGELGL
FT                   ALGHSGYGRAVGGAVGANPVPIIVGCHRVLSSSGKVTGYSGGEGIPTKLWLLEHEGMTL
FT                   AT"
FT   gene            complement(709668..711713)
FT                   /pseudo
FT                   /locus_tag="Lxx07110"
FT                   /note="similar to cell wall surface anchor family protein"
FT   gene            complement(711710..713461)
FT                   /locus_tag="Lxx07120"
FT   CDS_pept        complement(711710..713461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07120"
FT                   /product="peptidase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07120"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88643"
FT                   /db_xref="GOA:Q6AG52"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="InterPro:IPR030400"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG52"
FT                   /protein_id="AAT88643.1"
FT                   /translation="MPSHVLVRAAAGAAAALTIGGLALAASPDPSRTPLTGSVPVWTAT
FT                   TTSSPAPDADTTLAVVLRDGSSAADARAVAEWLDSHGLDASGWDHRTGTLRVNGTRSHV
FT                   AEAFDTAFAVYSLSSGSTVAPTTALSVPASLPQIVGVSGAVTGDGYRPTASAAEPSIDS
FT                   PDCAAYWGEKLSSQWPASLTVEHRSNSLCGYTPKQLRAVQQVPDGYRGAGTKVAIVAAF
FT                   DDPAVAANTDTYSRQMGEPVLTDDQYAHHAPAHPAVSRCGGPSSWTEEQHLDVQAVHAM
FT                   APDAKIEYWGADDCTTAPMFLRILDAVNAGPDVISLSFGSPENLDTADDRTLLNRVLVD
FT                   AASRNISVFASSGNDGDYSAQGDHNTGTSVSSPASSPYLTAVGGTSTGIAKDGTIAVEA
FT                   GWEIQSRFARNGGLIPPGFAFGSGGGESTVYDRPSWQRTALASHSGAGRLVRDVASLAD
FT                   PNTGFVVYGPHDGTTAAVSHGGDSLATPMVASMVALAKATTGVKIGLASPALYALAGTP
FT                   ALRDVTPASAATWSPKGQKGAIYPETIFVWDTKPQSLQSSKEWDDVTGLGVPTGIDFIK
FT                   NFGKKTQ"
FT   gene            714416..715414
FT                   /gene="nusA"
FT                   /locus_tag="Lxx07130"
FT   CDS_pept        714416..715414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="Lxx07130"
FT                   /product="transcription termination/antitermination factor"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07130"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88644"
FT                   /db_xref="GOA:Q6AG51"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG51"
FT                   /protein_id="AAT88644.1"
FT                   /translation="MDIDLSVLRLMEREREIPFEELVQIIEQAILTAYLKHTDQADHRH
FT                   GEPPAARVHLDRKTGHVTVYVPERDDDGNVIGEAEDSPSDFGRIAAFAAKQVINQRLRD
FT                   LADDAVLGEFRGCEGDIVAGVIQQGPNPRMVHIDLGSVEAILPPEEQVHGEEYPHGSRI
FT                   RVYVTSVAKGPKGPSITVSRTHPTLVRKLFALEVPEIASGVVEIVSIAREAGHRTKIAV
FT                   RATEPGVNAKGACIGELGQRVRAVTAELNSEKIDIVDYSPDLATFVSSALSPAKVTSAF
FT                   VIDESLKAVRALVPDYQLSLAIGKEGQNARLAAKLTGAKIDIQPDSILDRE"
FT   gene            715468..715728
FT                   /locus_tag="Lxx07140"
FT   CDS_pept        715468..715728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07140"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07140"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88645"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="InterPro:IPR037465"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG50"
FT                   /protein_id="AAT88645.1"
FT                   /translation="MESVRTCVGCRSRAPRLSLLRVVVRNSELVVDPSAAFPGRGAWLH
FT                   PVDGCLDLALKRRAFGRALRVDGTLDPTALRAYYENRLKNQ"
FT   gene            715801..718551
FT                   /gene="infB"
FT                   /locus_tag="Lxx07150"
FT   CDS_pept        715801..718551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="Lxx07150"
FT                   /product="translation initiation factor IF-2"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07150"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88646"
FT                   /db_xref="GOA:Q6AG49"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AG49"
FT                   /protein_id="AAT88646.1"
FT                   /translation="MGPDRRIVAAKPRVHEVASELGVDSKIALAKLKEMGEFVKGPSSS
FT                   IEPPVARKLRAALEAEGHLPGAGGDKTAAQASPAPRPPRPATADGSGAPKPQAPMSVAE
FT                   RQAAAEKAASEKAAAEKVAASEAADAKPAAGAPADTAKPSSPPRPSGVSAPRPGNNPFA
FT                   SNQGMGQRPSAPRPGNNPFSSSQGMGQRPSPSNIPRPAPPRPGSPRIGAPRPGGGQRQG
FT                   GGGRPGFQQRPGSAGGGAGGGLQRPGGAGAGGFSGPRTGGGGGRGRGPGGGTAGAFGRG
FT                   GGKSKARKSKRAKRQEFEMREAPSLGGVTVPRGDGGTAIRLRRGASISDFADKIDANPA
FT                   SLVTVLFHLGEMATATESLDEATFQILGEELGYKVQVVSPEDEDKELLEGFDIDLDAEL
FT                   EGESDEDLEIRPPVVTVMGHVDHGKTRLLDAIRSANVVEGEAGGITQHIGAYQVWTEHE
FT                   GIERAITFIDTPGHEAFTAMRARGAQVTDIAILVVAADDGIMPQTIEALNHAQAANVPI
FT                   VVAVNKVDKPEANPAKVRQQLTEFSLVAEEYGGDVMFVDVSARNNIGIQELLDAVLLTA
FT                   DAGLDLRANPNKDARGVAIEAKLDKGRGAVATVLIQSGTLRVGDAIVAGTAYGRVRAMA
FT                   DENGDPVLEAAPSRPVQVQGLSSVPRAGDTFIVTEEDRTARQIAEKREAAERNAQLAKA
FT                   RKRISLEDFTRALEEGKVEALNLIIKGDVSGAVEALEESLMKIEVDDSVSLRILHRGVG
FT                   AITESDIDLATIDNAIVIGFNVRPDVKARERAAREGVDVRFYSVIYNAIDDIESSLKGM
FT                   LKPEFEEVQSGVADIREVFRSSKFGNIAGVIVRSGTITRNAKARVIRDGVVIADNLAIE
FT                   SLRRFKDDVTEVRTDFECGIGLGKYNDIQVGDEIETIEMREKPRV"
FT   gene            718628..719056
FT                   /gene="rbfA"
FT                   /locus_tag="Lxx07160"
FT   CDS_pept        718628..719056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="Lxx07160"
FT                   /product="ribosome-binding factor A"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07160"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88647"
FT                   /db_xref="GOA:Q6AG48"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AG48"
FT                   /protein_id="AAT88647.1"
FT                   /translation="MADPARARKLADRIKVIVAERLDRGLRDPRLGFVTITDVQVTGDL
FT                   QHATVFYTVYGTDQERADTAAALTAATGMLRSEVGKNITARLTPTLQFQLDAIPENAAH
FT                   IEDLLRQARDHDTEVAGLAEGAAYAGEQDPYVKPREAN"
FT   gene            719127..721231
FT                   /pseudo
FT                   /locus_tag="Lxx07170"
FT                   /note="similar to lipopolysaccharide modification
FT                   acyltransferase"
FT   gene            complement(721323..722192)
FT                   /gene="nth"
FT                   /locus_tag="Lxx07190"
FT   CDS_pept        complement(721323..722192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nth"
FT                   /locus_tag="Lxx07190"
FT                   /product="adenine glycosylase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07190"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88648"
FT                   /db_xref="GOA:Q6AG47"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG47"
FT                   /protein_id="AAT88648.1"
FT                   /translation="MREPFASAVVDWYHANRRDLPWRRAGFIAWGTLVSEFMLQQTPVS
FT                   RVIPRLEEWLARWPTPADLAAVPPGEAVRAWRSLGYPRRALWLHSAAVAIAEQHGGVVP
FT                   DDVDALLALPGVGDYTARAVAVFAYGNRHPVVDTNIRRVIARAVEGQGEPGPPSAKRDL
FT                   AAMEALLPRDRPAAAAFNAGMMELGALVCVARTPRCDVCPLAAACVWRAAGFPPYAGPR
FT                   KAVQKKYEGSDRQVRGRILAELRAAHLPVTAAELESVWPDAAQRDRALAGLLSDGLAIA
FT                   DEGGYTLP"
FT   gene            complement(722246..723304)
FT                   /gene="panE"
FT                   /locus_tag="Lxx07200"
FT   CDS_pept        complement(722246..723304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panE"
FT                   /locus_tag="Lxx07200"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07200"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88649"
FT                   /db_xref="GOA:Q6AG46"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG46"
FT                   /protein_id="AAT88649.1"
FT                   /translation="MRIGVIGAGAIGGTIAALLDRVGHLVEVTARGEHLAAIRTEGLRL
FT                   DGGWGAHTARVAAAETLQTRPELAFLCTKAQDAAYALRDNTSLLDGIPVVVVQNGLTGL
FT                   RLATGLLPGSECVGALALFAAGFLSPGRIVVTTTANTYLGAGDGRAPAAAAATARILDA
FT                   ALPSVAVDDFTGCQWTKLIVNQVNALPAITGLSVQETLGDRRLRRVMTASLQEAVRVGY
FT                   AHGVRYGSIQGLSDGLLRFAAHAPRWAAQAVPLLMRRRMGATPNPGSTLQSVRRGQPSE
FT                   IDYLNGAVVAKARAAGGEAPVNAALTALVHEVERSVAFLPAETVAERMRPLLTAGRPPA
FT                   APRAPANGGRAA"
FT   gene            complement(723391..723900)
FT                   /locus_tag="Lxx07210"
FT   CDS_pept        complement(723391..723900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07210"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07210"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88650"
FT                   /db_xref="GOA:Q6AG45"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG45"
FT                   /protein_id="AAT88650.1"
FT                   /translation="MDPAGPGPIIASRPDQTRTGQHRGVVRDGETYGYRWADGEIAACA
FT                   RLALREAGPDVSFVSLGETDEAGHLYGGSSAEYAVAVGPVDAHIGRLLAEIEARVARAG
FT                   AEEEWLVALTTDHGHLDEGGHGGGEAVLSRSFLALRRYGSEDPLPAGTSIHPWEVVSLL
FT                   LTDLTR"
FT   gene            complement(724280..724969)
FT                   /locus_tag="Lxx07220"
FT   CDS_pept        complement(724280..724969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07220"
FT                   /product="phosphonoacetaldehyde hydrolase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07220"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88651"
FT                   /db_xref="GOA:Q6AG44"
FT                   /db_xref="InterPro:IPR022468"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG44"
FT                   /protein_id="AAT88651.1"
FT                   /translation="MTISLVSLDLAGTTIDEGGIVYDVLRQSVTEAVGAPVPAEVLDGW
FT                   TGTDKREAVEGLLTALGADPAKTAAVHAAFAERLDAAYAAATPRLFPGVREAVASLRAS
FT                   GVKVGLHTGYERVVAERLLEKVEWAVGADVDALATSEDVAASRPAPYLVFRTMESTATR
FT                   SVQEMLVAGDTPNDLRAGIASGARLVVGVLSGASSAETLGRHPHTHLLASVAALPELLA
FT                   AAGELPR"
FT   gene            complement(724966..725730)
FT                   /gene="yhfR"
FT                   /locus_tag="Lxx07230"
FT   CDS_pept        complement(724966..725730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhfR"
FT                   /locus_tag="Lxx07230"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07230"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88652"
FT                   /db_xref="GOA:Q6AG43"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG43"
FT                   /protein_id="AAT88652.1"
FT                   /translation="MKVPLHETVRTALRERILNGGLPAGAALPSEAELCAQFGASRGPV
FT                   RQALTALNTEGLIETSQGRVPVVARAPLAHAIDDFFSFSAWVRALGRTPGQRTIEIALR
FT                   RPRAQIALALGLADGEQAVELVRVRSIDGEPVMIERTAFAERVGRLLFEFDPDAGSLFD
FT                   ALLTRGAQLDRGEHTIDAVAADELAAAELSVALGAPLLRVRHVTTSDDGDILEVSDDRY
FT                   RPDRATLIIHNSRSRSMPRPLVARSITPEGTA"
FT   gene            726016..726636
FT                   /pseudo
FT                   /locus_tag="Lxx07240"
FT                   /note="similar to ABC transporter, receptor protein"
FT   gene            complement(726627..727325)
FT                   /pseudo
FT                   /locus_tag="Lxx07245"
FT                   /note="similar to beta-ketoacyl synthase"
FT   gene            complement(727347..727646)
FT                   /locus_tag="Lxx07247"
FT   CDS_pept        complement(727347..727646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07247"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07247"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88653"
FT                   /db_xref="GOA:Q6AG42"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG42"
FT                   /protein_id="AAT88653.1"
FT                   /translation="MNEPRSRRGGAVKVPLTRQCIVDTALGIIAKRDFDGLTMRALAQE
FT                   LDTGPAALCIYFGNRKSMQPTPIERDRWAIRTLIARIAANQSVDEPGFKSIPEK"
FT   gene            728021..728929
FT                   /gene="truB"
FT                   /locus_tag="Lxx07250"
FT   CDS_pept        728021..728929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="Lxx07250"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07250"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88654"
FT                   /db_xref="GOA:Q6AG41"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015225"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AG41"
FT                   /protein_id="AAT88654.1"
FT                   /translation="MGMIGSGLLLIDKPGGWTSHDVVARVRRLAGTRKVGHAGTLDPMA
FT                   TGLLVLGLNSSTRLLTYIVGAEKEYVGTIRLGAATTTDDIEGEILERAEPAALAAVAES
FT                   SIAEGIAALTGEIEQVPSAVSAVKVDGKRAYARVRAGEEVVLPARAVTVSAFRLLSERR
FT                   EQDAIDLEVRVVCSSGTYIRSLARDLGARLGVGGHLAALRRTRVGGYDVRRAHELATLE
FT                   PAAALIPATEAASSLFERLRLTEQQATDLAHGKRLHLAGWEGPRGEPVAAIAPSGSLVG
FT                   LIEFRGKEARTLVNFPADEIA"
FT   gene            729374..729856
FT                   /locus_tag="Lxx07270"
FT   CDS_pept        729374..729856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07270"
FT                   /product="integral membrane protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07270"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88655"
FT                   /db_xref="GOA:Q6AG40"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG40"
FT                   /protein_id="AAT88655.1"
FT                   /translation="MSHHTLPARNRDRAASRRPLSGAGRLLVFVYGVLALAATGRSVFQ
FT                   ILDRYHEAPVAFTLSAVAAVVYIVATVALVAPGRVWYQVAWITIGFELAGVLASGTLSL
FT                   VAPAALGLHDIDPFGRDATVWSVYGMGYLFVPLALPVLGMFWLAKRRPRDAAGAAS"
FT   gene            729853..730797
FT                   /gene="ribF"
FT                   /locus_tag="Lxx07280"
FT   CDS_pept        729853..730797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="Lxx07280"
FT                   /product="riboflavin kinase/ FMN adenyltransferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07280"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88656"
FT                   /db_xref="GOA:Q6AG39"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG39"
FT                   /protein_id="AAT88656.1"
FT                   /translation="MKVFTAVADVPAGYGPSAVTIGKFDGVHTGHRAVIARLRQVADER
FT                   GLAATVITFDRNPLEVIAPEKCPPALVSNRQKLDLLAGTGIDATLMVPFDRALAELSPD
FT                   EFVRRILVDRLRAAVVLVGSDFRYGRGGAGDVAFLRERGEQYGFAVELIDDVRPERGRR
FT                   VSSTWIRELLAEGDVAHAALLLGQVPTVRGVVVHGAVRGRELGFPTANLSPELEGLIPA
FT                   DGVYAGFLTDDGQRWPSAISVGNNPTFEGVPHKQVEAYALDRELDLYGHTVELAFHERI
FT                   RGMVAYAGVEPLIAQIRDDVERARRILAPGAAE"
FT   gene            730794..732005
FT                   /locus_tag="Lxx07290"
FT   CDS_pept        730794..732005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07290"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07290"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88657"
FT                   /db_xref="GOA:Q6AG38"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG38"
FT                   /protein_id="AAT88657.1"
FT                   /translation="MSAETPARSLWRPGGSAPRHPPRRWQSAHGRRRPFPDLRGDPRRV
FT                   PGLQRRRRAARDDAAGLLRAVRPDRPRLTRRASLEAVLLIALGLMLAGHLVRAASGSFV
FT                   QLAIGSAVAFAGMGVGNVLLPPLVKRYFPDRIGLVTALYATVMSVSTLRPPLVAVPVAD
FT                   ASSWHVSLGMWALVSVLAIVLWLRIMLTRTPAHPDHDVEVEQADHSAVARVWRSGLGWA
FT                   MAIVFATSSLNAYAMFGWLPQILHDVAGTPPAEAGTLLSVYTAMGVPAGLLVPLLAARM
FT                   RNVALLVYAGVAFFVIGYLGLIFAPTTATVLWVAIAGLGPLLFPLSLVLINTRTRTHAG
FT                   SVALSGFAQGIGYVIGSFGPLAVGLLHEVTGAWTLALALLTATALAAAAAGAVVARPVP
FT                   LEDR"
FT   gene            732087..733307
FT                   /gene="sorC"
FT                   /locus_tag="Lxx07300"
FT   CDS_pept        732087..733307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sorC"
FT                   /locus_tag="Lxx07300"
FT                   /product="transcriptional regulator, sugar-binding family"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07300"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88658"
FT                   /db_xref="GOA:Q6AG37"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG37"
FT                   /protein_id="AAT88658.1"
FT                   /translation="MALNDTDEILAVKAAELYYEAGKTQDEIGAALSVFRWKAGRLLAS
FT                   ARQQGVVRIEIVHPSARKFSLERELCGFFGLADAVVVPSAESDAEAQARVVQAAADYLT
FT                   TLRPVPRTLGVSWGRTLHAVASRLRPGWATGVDPVQINGSVSRNRQATAAADTPVVIAR
FT                   KAQGTATLLPSPAIFEHAATRRAIEADRSVQSVLELARTASAFLFSAGVVDISSVHVDS
FT                   GYLSPQDVRAFAEKGAVGDVVGRFITAEGRVAAPVLDSRTLGLGLDDLRNARVSIAVIA
FT                   GEAKHRIAHAVVASGLCTTLITDEATASDMLGRAPDDRTPTPAQRPPTESRPHCDHRDF
FT                   PARPRPRVGGPRRRDPRRRPHRGFAAPLPERDSGRGRGRPRTAPPHSERAPSRPPAKPG
FT                   RSTRSSS"
FT   gene            733168..733825
FT                   /pseudo
FT                   /locus_tag="Lxx07310"
FT                   /note="similar to deoxyribose-phosphate aldolase"
FT   gene            733774..735218
FT                   /pseudo
FT                   /gene="ald5"
FT                   /locus_tag="Lxx07320"
FT                   /note="similar to aldehyde dehydrogenase"
FT   gene            735478..736443
FT                   /locus_tag="Lxx07340"
FT   CDS_pept        735478..736443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07340"
FT                   /product="ABC transporter, ferrichrome-binding protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07340"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88659"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG36"
FT                   /protein_id="AAT88659.1"
FT                   /translation="MRLPASRLLSVAALALLAGLTACSVPADTGSTTVPSATPLAGGVD
FT                   PAALAKALRQFPAEPPSNVVSASVPLAEILHELGVPVAGVPSTTTQQLPESLADVPRIG
FT                   SSMAPDVEKIVELAPGLVIAAESARSTVEASLADTGTPSAFLKTDTLADAKLAVKTLGA
FT                   AFDREEQASAVLDRLGAAEAKLRALRPATAGKPTKALLLIGAADSFMVMSDGSYAGSLV
FT                   ALTGADNIADSQLGATGAFTAVDLEKVIAAAPDVVLVLSSGGTDAAQRAIDAEFAARPA
FT                   WRSFPAVVDGRVHVLDYGRFGYTSLAVLPAAADELSGFLR"
FT   gene            736622..737449
FT                   /pseudo
FT                   /gene="cbrB"
FT                   /locus_tag="Lxx07360"
FT                   /note="similar to ABC transporter, ferrichrome permease"
FT   gene            737446..738288
FT                   /pseudo
FT                   /locus_tag="Lxx07370"
FT                   /note="similar to ABC transporter, ATP-binding protein"
FT   gene            738285..738791
FT                   /locus_tag="Lxx07390"
FT   CDS_pept        738285..738791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07390"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07390"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88660"
FT                   /db_xref="GOA:Q6AG35"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR014419"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG35"
FT                   /protein_id="AAT88660.1"
FT                   /translation="MTSTTAVEHADERERYRTFLAERATLTLGVADRDGVPMVAVTPFA
FT                   AVDDALYLYVSALADHHDALAAADEVAVLFRADEAGAPNLFALERARFRCAVRVVHDEG
FT                   DEAVFDRFVEVTSPALVRLLRALDFRLYRLEPLAGRYVVGFGKAYDVDWAGDRFDHVVI
FT                   DKTQS"
FT   gene            738831..739445
FT                   /locus_tag="Lxx07400"
FT   CDS_pept        738831..739445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07400"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07400"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88661"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG34"
FT                   /protein_id="AAT88661.1"
FT                   /translation="MAENARGRTGMTHGAGGALALVGDSLTQGGDWAVLLPGEDVRNFG
FT                   VAGDTTDDLLARLDTVIESRPDTLALLIGTNDLAWRRSAEHVVRNAETILVMLRKELPE
FT                   ARILMQSVLPRGREFAEQIRDANRHLWQFAPTVHAGWLDLWPVLALADGELNPAFTEDR
FT                   LHLNDEGYRAWAGELIPGLERVRQLPPSSRAIALPDLGGPA"
FT   gene            complement(739510..740037)
FT                   /locus_tag="Lxx07410"
FT   CDS_pept        complement(739510..740037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07410"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07410"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88662"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG33"
FT                   /protein_id="AAT88662.1"
FT                   /translation="MTDPIELVRGDLTEQSADAIVNAANASLLGGGGVDGAIHRRGGPA
FT                   FLAACRELRATVLPDVLATGRAVATTAGDLDAHWVIHTVGPVWTASEDRAPLLQNAYRS
FT                   SLRVARELGAATVAFPAISAGAYGWPMDDAARLAVSTVRAVLSSGVGSVERVRFVLVRD
FT                   AAFAAFRAAAGG"
FT   gene            complement(740039..740317)
FT                   /locus_tag="Lxx07420"
FT   CDS_pept        complement(740039..740317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07420"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07420"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88663"
FT                   /db_xref="GOA:Q6AG32"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG32"
FT                   /protein_id="AAT88663.1"
FT                   /translation="MIADIKKRALHRTRILSGQLRGLEKMIENEDYCIDIITQSLAIQN
FT                   SLGSLNKLLVENHLKTHVSEMFEEGGEQRDKAILELLKIYELSNNRG"
FT   gene            740376..740600
FT                   /locus_tag="Lxx07430"
FT   CDS_pept        740376..740600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07430"
FT                   /product="heavy-metal-associated protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07430"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88664"
FT                   /db_xref="GOA:Q6AG31"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG31"
FT                   /protein_id="AAT88664.1"
FT                   /translation="MKTTYDILGMTCAHCARAVSDELSALGGVTGVDVDVAEGRATVTS
FT                   SVALDPVAVAVAVGEAGYTLGRPDRLRLP"
FT   gene            740597..742729
FT                   /gene="ctpA"
FT                   /locus_tag="Lxx07440"
FT   CDS_pept        740597..742729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctpA"
FT                   /locus_tag="Lxx07440"
FT                   /product="cation-transporting P-type ATPase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07440"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88665"
FT                   /db_xref="GOA:Q6AG30"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG30"
FT                   /protein_id="AAT88665.1"
FT                   /translation="MTEPALTRIDLAIEGMTCASCVARVERRLGRLDGVEAVVSLATER
FT                   ASVLAPAGVEAEALVAEVKRAGYGARVLTGSRDITREQRPDAQRLRLRLLAAAALSVPI
FT                   ALLAMVPAFRFPGWELVSLVLAAPVVLWAGWPFHRSAAVNLRHGATTMDTLVSLGTLVA
FT                   FAWSVAVLALGAGGHIYVEVAAVVTTFLLLGRFAEERSRRRAGAALRDLIAAGAREVSR
FT                   VDDAGRERRIPVDLLGAGERFAVRPGERIAADGIVLEGAAAIDASAVTGESVPVEVAVG
FT                   DEVTAGTIAAGGSFIVRATRVGPDTRVARLVAGVEAAQLAKTRAQRLADRVSSVFVPVV
FT                   LGLAVLTFLTWVVVAGDPAVALSPAVAVLIVACPCALGLATPTALLVGTARAAQRGIQL
FT                   SGPDALERAGRIDTVVFDKTGTLTTGRMTLLETVAGTGWAADEALRLAAAAERGSEHPL
FT                   GRAIAAEVPAVGPVTGFRALPGVGVTACVAGREVSVGKPGEPLPADLAAAASRIRSAGG
FT                   TAIAVSVDGVPAAVLGVGDPLRPYAAEAVARVRVAGAEPIVLSGDHPATVAAVTARLGI
FT                   ARTLGGVSPEGKADAVASLRAEGRRVAMVGDGVNDAAALAGSDLGIALGSGTDAAMAAA
FT                   DITLLRPEPVIVGDVLSLSRRMAAVIRGNLFWAFAYNVAALLVAAFGLLAPMVAAAAMG
FT                   FSSVFVVLNSLRLRRF"
FT   gene            742878..743441
FT                   /locus_tag="Lxx07450"
FT   CDS_pept        742878..743441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07450"
FT                   /product="phage-related integrase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07450"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88666"
FT                   /db_xref="GOA:Q6AG29"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG29"
FT                   /protein_id="AAT88666.1"
FT                   /translation="MMFEGGKRAVVYVRISDDPEGLERGVDRQEEDFRAVAAAEGLEVV
FT                   AVFRENDTSAFKQRTIVLPSGEKVRRVIRPKFRAMLQLMANDGGDVLIAYDLDRAVRDP
FT                   RDLEDLIDVRTLHGFRVRSVTGSLRLDADADVAMARVMVAMAHKSSADTARRVARAAKA
FT                   RAEAGGWNGGLPPFGYAPTGGLSE"
FT   gene            complement(743797..745311)
FT                   /locus_tag="Lxx07470"
FT   CDS_pept        complement(743797..745311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07470"
FT                   /product="hemagglutinin/hemolysin-related protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07470"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88667"
FT                   /db_xref="GOA:Q6AG28"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG28"
FT                   /protein_id="AAT88667.1"
FT                   /translation="MARAADAPTATVAAIDGLQARYSNVVERVSATAQPFATTDVVGGA
FT                   GYMIDTANGLAACSLGFSAWTPGGGPAVITAGHCAEEATGSPLRTLPSAEPAAGGPRFA
FT                   RMSALGNVGFAQFGDAGGSAGFTGDPDSIDIADIDVTEPSLTLLPAVTNWTTAASDDLS
FT                   AAAISVKAVANPALGSHVSKSGRTTGFTTGGTVVEEGWAMIGGRWVRGFKADGLTAGPG
FT                   DSGGAVIQNNTAVGLVSGGVEGDFTWVADIVDALALTSGYTLRLVLDAAAISVAPGASV
FT                   TRGSRITGTTAAGATVTVSGDNDFTATATAAADGSWSFAAPMTEDPFSFTTQAQDSFNV
FT                   SADHTTSVTLVAAPLTAPVVTSPAPGARDTPVTAITGTANPGYTVTVSGDAAGTAVATP
FT                   DGTWTIHTTLNAGTHRITVTQSFDGDTSAETVVTFQIAETAAPVTPPEGTPGSAASPVR
FT                   TATASVRLADAGSDTLPTANGAVALLLTGLTSGHPPTTRCGLIGFL"
FT   gene            complement(745658..745906)
FT                   /gene="grx"
FT                   /locus_tag="Lxx07480"
FT   CDS_pept        complement(745658..745906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grx"
FT                   /locus_tag="Lxx07480"
FT                   /product="glutaredoxin"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07480"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88668"
FT                   /db_xref="GOA:Q6AG27"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG27"
FT                   /protein_id="AAT88668.1"
FT                   /translation="MTDRFDKVTVFGADWCRDCIRSKALLDRVGADYEYIDLVARPEEA
FT                   DRAQAISGRTSIPVIVFPDGRHLVEPTDPELLAALKG"
FT   gene            746450..747508
FT                   /locus_tag="Lxx07485"
FT   CDS_pept        746450..747508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07485"
FT                   /product="secreted protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07485"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88669"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG26"
FT                   /protein_id="AAT88669.1"
FT                   /translation="MTEAVTGMSGMAKTWTVASTTTYDAVGRPVAVTDVLGRVTKTAYT
FT                   PPAMTGPTTKVETMNPVGWTSSTVLDPAWGSELSVTDENGKVTSATYDALVRRTAVWLP
FT                   NRSQAENASSPSSAFAYGVSQTQASTVTTKRPIPGGTKTTIEVVDGLGRVVQSQAPAVG
FT                   SGGVMTDTVYDSQGRTVSTTKPYWASEAPSGKLFIPTSMAQVPSRTDTVFNAVGRVTAS
FT                   VLYTYGDETSRTGYVYPGADRTDMVPPAGAPRPRRSPIVEGRRRSWSSIRRRRSPVLGW
FT                   LRRWVLARPVVSWVGLLVRSRGKLSARSQPKPPATQQQRWPKQARPLPQVKLQYRKGIP
FT                   SKSTLAMLPISA"
FT   gene            748683..750848
FT                   /locus_tag="Lxx07490"
FT   CDS_pept        748683..750848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07490"
FT                   /product="ATP-dependent RNA helicase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07490"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88670"
FT                   /db_xref="GOA:Q6AG25"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG25"
FT                   /protein_id="AAT88670.1"
FT                   /translation="MSRSGQHTSGQRTASRPQQRRNKHPNNDGLIPILARKVREVEAKA
FT                   ADGKKLGPTNRTKFQVIAFLMREERARVKSDAELIDAQRAEQLKRLDGIATILAKTAAR
FT                   DTSLLSLLESEAPPTATAQKMRRDWLLESGTELSPDELIITVERPVRPETVLPPELAQK
FT                   QVVPQSVKARQLSNPFLAPDFSRAAATPAPRRRLDSWELLGPLFKSFEYGSGGQAASME
FT                   LPPAPRTDRYSPHGLELMHYQSRFIESVRQGHRTFLLADEPGLGKTAQSVLAASVAGAY
FT                   PLLAVVPNVVKMNWAREVERWTPHRRATVIHGDGERLDAFADVVIVNYEVLDRHLSWLS
FT                   TLGFKGMVVDEAHFIKNLHSQRSRLVLGLAEAIREKTPDPLLIALTGTPLINDIDDFKA
FT                   IWQFLGWIDGDRPAAELMESLEETGMTPADLGFYAAARASVIDLGIVRRRKIDVAADLP
FT                   SRCVVDLPVELDGDLGRSLLQAEKELADRLVARFHRAAAAGRPDSFDGDDAAHRKHLIR
FT                   LVAQSELEESKSAKTGDNVFTMVRKIGQAKAGLSSDYTAQLARSVGKVVFFAKHIDVMD
FT                   AAEAAFAARDLTTVSIRGDQRAAVRQKEIDAFNTDPGVSVAVCSLTAAGVGLNLQAASN
FT                   VVLAELSWTAAEQTQAIDRVHRIGQEEPVTAWRIIAAQTIDSKIAELIDAKQGLAARAL
FT                   DGSDVEMGSTDSVQLEALIHLLEEALG"
FT   gene            complement(751191..751829)
FT                   /locus_tag="Lxx07500"
FT   CDS_pept        complement(751191..751829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07500"
FT                   /product="two-component system, regulatory protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07500"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88671"
FT                   /db_xref="GOA:Q6AG24"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG24"
FT                   /protein_id="AAT88671.1"
FT                   /translation="MTAAIRLVLADDHPVVRAGLRALFATEPDIEVLAEAGTPDEAVSL
FT                   GERLTPDVVLMDLQFGAGANGDGTIATRRLRGLPQPPRVLVLTNYDTDADILGAVEAGA
FT                   SGYLLKDAPPAELIAAVRAAATGESALAPAVSARLGSRREKHSSRLSGREIEVLGLVAG
FT                   GQTNAGIGRELFLSEATVKSHLVHIFAKLGVSSRTAAVARARALGLIRV"
FT   gene            complement(751826..753016)
FT                   /locus_tag="Lxx07510"
FT   CDS_pept        complement(751826..753016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07510"
FT                   /product="two-component system, sensor protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07510"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88672"
FT                   /db_xref="GOA:Q6AG23"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR017205"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG23"
FT                   /protein_id="AAT88672.1"
FT                   /translation="MNHSALTPVFTALRIGLHALVVGLSASVLVRACVETASGDARQAG
FT                   AVIAVALLFVFTYAAGGPLRARMRGGLRWLWLGALTAEWMLLAALTQDATLLVFPLFFL
FT                   FLHLLPSPWSVVAVGASTVAAILLFAAHSGWTAGGVLGPAIGAGVAVAIGLGYRALFQE
FT                   AQEREQLIRDLVATREQLAASERSAGTLAERSRLARELHDTVAQGLSSIQLLLHAAERF
FT                   TTEPAALDAVRLARETAAADLAETRRFIHALTPPALEDKTLPGALRRLAGQTERTSGLR
FT                   VTVSVSGEPSPLPMPVETALLRSAQGSLANVVQHAEATAARLTLTYDDDAVTLDIVDDG
FT                   RGFDTATAGGGERHPGSFGLRAMRERAAGLGGEVAIESATGRGTAVAVTVPTGSAR"
FT   gene            753159..753785
FT                   /pseudo
FT                   /locus_tag="Lxx07520"
FT                   /note="similar to conserved hypothetical protein"
FT   gene            753935..755011
FT                   /gene="pfkA"
FT                   /locus_tag="Lxx07530"
FT   CDS_pept        753935..755011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfkA"
FT                   /locus_tag="Lxx07530"
FT                   /product="6-phosphofructokinase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07530"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88673"
FT                   /db_xref="GOA:Q6AG22"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012829"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG22"
FT                   /protein_id="AAT88673.1"
FT                   /translation="MLRGGDKAGGDEKRSSMKIGILTSGGDCPGLNAVIRGAVLKGDRV
FT                   LDAEFAGFRYGWRGVVEGDIMPLDRHSVRGLSRQGGTILGSSRTNPFEGEKGGPENIQR
FT                   MMDENGIDAIIAIGGEGTLTAARRLTDAGLRIVGVPKTIDNDLAATDYSFGFDTAVEIA
FT                   TEAIDRLRTTAESHQRCMVLEVMGRHVGWIALHSGMAGGAHAILIPELPQSVDRICEWV
FT                   ESVRDRGRAPVIVVSEGFHLDTMEEAHSHKGLDAFNRPRLGGIGEMLAPLIQERTGIES
FT                   RATVLGHMQRGGVPSAYDRVLATRLGMAAVDAAYEGRWGSMVALRGTDVVNVSIADATG
FT                   GLKTVPQARYDEAALLFG"
FT   gene            755048..756013
FT                   /locus_tag="Lxx07540"
FT   CDS_pept        755048..756013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07540"
FT                   /product="zinc-binding dehydrogenase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07540"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88674"
FT                   /db_xref="GOA:Q6AG21"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG21"
FT                   /protein_id="AAT88674.1"
FT                   /translation="MGVPRFVQFEEFGSRDFLQLVERDLPWPGPGQILVRVLVSGLNPM
FT                   DVKAYRSEQVAGRMGVTLPSGIGQDFAGVVEELGAGVTAFSAGDAVLGTAPFAAIADFV
FT                   VVPADGQVIGKPEALRFPVAGALGIVGRTAMASTASLGLGEHDTVLVSAAAGGVGVLAA
FT                   QLAIRSGATVIGTASEENHEFLETLGVIPVRYGDGLADRVRAAMDDGDRRQRHRRVTAV
FT                   LDNHGPDTIAAALELGVPPGRINTIAAFGPEAQGAATVGARAAGNAELAEAARLLAGSE
FT                   LVLPIDSVYPIERVVEAYGRLEAGHVRGKIVVVTDEKGLP"
FT   gene            756104..756415
FT                   /locus_tag="Lxx07550"
FT   CDS_pept        756104..756415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07550"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88675"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG20"
FT                   /protein_id="AAT88675.1"
FT                   /translation="MGGERFTVSEMTIEPHHVDTGTILGFNGTTEWALDSLAVEDALWM
FT                   PREDQLRELLGGSFRHLSRTPGGYRVTILIGGEERPFEEDAATAYAQTLLSLIGASAL"
FT   gene            756709..757074
FT                   /pseudo
FT                   /gene="tnp"
FT                   /locus_tag="Lxx07545"
FT                   /note="similar to transposase, ISlxx4"
FT   gene            complement(757483..758238)
FT                   /locus_tag="Lxx07580"
FT   CDS_pept        complement(757483..758238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07580"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07580"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88676"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG19"
FT                   /protein_id="AAT88676.1"
FT                   /translation="MPPSRFTLAFPPGVTIGKWTRAFAERQPQVDLVVVPSADPLAVLT
FT                   SGEADIVFARDAEAGPERHLIPLYTEDIVAVIHHEHLLTLAEKWHLADLTNEPRIAGEP
FT                   GEATMRSVAAGDGVALLPASVAKAFRRKDVVALRLEDGPASAIGLIWPRKGQHPLVDEF
FT                   IGIVRGRTAHSSRNPEVAERERTGKQRASKQRTGRGAPKPRRGRRWLGVMSREVVVDSA
FT                   NGWGSDGGVVLVMIVEVGPAGECFSSFGL"
FT   gene            758273..758656
FT                   /locus_tag="Lxx07570"
FT   CDS_pept        758273..758656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07570"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07570"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88677"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG18"
FT                   /protein_id="AAT88677.1"
FT                   /translation="MKPQTMEAATAARKLGIHLPAAPEEFRDRDISRTELDELTANPPE
FT                   WLRTLRADGPHPRDVVSRKLGVSNSGLARGGVTEALTTAEIKALLVSTPQWLVVERATQ
FT                   AAVRAENARVKRRDADRAARARD"
FT   gene            complement(758876..759088)
FT                   /locus_tag="Lxx07610"
FT   CDS_pept        complement(758876..759088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07610"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88678"
FT                   /db_xref="GOA:Q6AG17"
FT                   /db_xref="InterPro:IPR012427"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG17"
FT                   /protein_id="AAT88678.1"
FT                   /translation="MDAHPAFETIGTAFEVAGVAALAIGFLLALTLAAVAWRRTGSGAA
FT                   AFRTLRESFGGVILLGLEILVPRTS"
FT   gene            complement(759116..761089)
FT                   /locus_tag="Lxx07620"
FT   CDS_pept        complement(759116..761089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07620"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07620"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88679"
FT                   /db_xref="GOA:Q6AG16"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG16"
FT                   /protein_id="AAT88679.1"
FT                   /translation="MQIPVPGQAQPLRATAKPVSAFRHWLLSGMVDERGTQQGPHGHEP
FT                   ERQHSWWKVMCLTGVDYFSTLGYQPAIAALAAGLISPFATLVLVALTLLGALPVYRRVA
FT                   RESFRGSGSIAMLERLLPWWAGKLFVLVLLGFAATDFTITITLSAADAAAHAIENPYAP
FT                   EWFRGNNVLITLFLLALLGAVFLKGFGEAIRIAVVLVVVYLALNVVVITTSIVEVFGHP
FT                   TVFGDWWDALFRTNGNPWLIGGIALLVFPKLALGLSGFETGVAVMPQIKGKPEDNPDNP
FT                   RGRIRGAGRLLTTAALIMSAFLITSSFTTTLLIPQKEFQSGGSANGRALAYLAHEYLGN
FT                   TFGTVYDISTILILWFAGASAMAGLLNLVPRYLPRYGMAPQWARAVRPLVLLFTAIAVL
FT                   ITIVFQADVDAQGGAYATGVLVLITSASLAVTLSAWRNKQKKHTVAFALITTIFVYTTI
FT                   DNTIERPDGLRIAALFILGILVVSIVSRIGRSFELRATSVTLDVTALDFVLEDAEEGEI
FT                   RIIAHEPDVDTTREYEEKNKDERKYSHIPQRSRTIFIEVLRSDSSDFEEDLVVNGIVKY
FT                   GYRVLQVRSGNVPNTIAAVLLEIRDLTGVVPTVYFEWTEGNPISNVFRYLITGVGEVAP
FT                   VTREVLREAEKDPKRRPAVHVA"
FT   gene            complement(761272..762042)
FT                   /pseudo
FT                   /locus_tag="Lxx07630"
FT                   /note="similar to oxidoreductase"
FT   gene            complement(762245..762373)
FT                   /locus_tag="Lxx07640"
FT   CDS_pept        complement(762245..762373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07640"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88680"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG15"
FT                   /protein_id="AAT88680.1"
FT                   /translation="MTNGDINTTKTDEPAPGANLQNIGGYAVPIDPMEDLHCDSCQ"
FT   gene            complement(762862..763218)
FT                   /locus_tag="Lxx07650"
FT   CDS_pept        complement(762862..763218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07650"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88681"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG14"
FT                   /protein_id="AAT88681.1"
FT                   /translation="MQNAPHLRDALKDQLLPSDGKDSKPLGYQLPEAYKDTPGDIRLAH
FT                   INLQRALASTENSIKRRRKAGGQEDIIESFFEPTATTLRGDLAALEEIVYTAAADAFAR
FT                   RRAIGEQRSSEVTP"
FT   gene            complement(763248..763502)
FT                   /locus_tag="Lxx07660"
FT   CDS_pept        complement(763248..763502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07660"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88682"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG13"
FT                   /protein_id="AAT88682.1"
FT                   /translation="MSGPDTVQTTARISEPIPLNPSTPELTAREREILTAWDAQVAEIE
FT                   AAGWVIEYANTMNNPPTNTYRKYYSFTRTQPSHGKGNDA"
FT   gene            764461..764760
FT                   /locus_tag="Lxx07670"
FT   CDS_pept        764461..764760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07670"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88683"
FT                   /db_xref="GOA:Q6AG12"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG12"
FT                   /protein_id="AAT88683.1"
FT                   /translation="MRSHHCRSRSSATNEDTKQIGIGYLKRFAVAALAGTVMVLAVKLY
FT                   QALLGGWLGGMASYQGDPWGYIIGNYGSFFVAPAVLVFLVLGANGLAKTLVGEG"
FT   gene            765081..767606
FT                   /gene="trsE"
FT                   /locus_tag="Lxx07680"
FT   CDS_pept        765081..767606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trsE"
FT                   /locus_tag="Lxx07680"
FT                   /product="transfer complex protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07680"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88684"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG11"
FT                   /protein_id="AAT88684.1"
FT                   /translation="MSTPTHSAAPDSSAILPDGQAAAAAPSNGRKRGRGERLRSTKKAA
FT                   LPVPGERRGRSGRTGADSSAAGGVFRSAPKATRDVLGYKTMLPGGIAWLGADEWSMTMR
FT                   ISDINYVAASEAHQESIIDRWARFINGFSAGTRIQETVTNRVLADADVAEMVQKRLQSD
FT                   PYDTYRDDFNRIVRDKLAYASGNTVTEKYVTVTVQEPDVEKAEATLTRIAHEIEASLQS
FT                   MDECQAVRLNRTERLEALARVLRPHELFGFTEHGFAGTRRQATADYAAPWGIEVLDKAG
FT                   PLQFHNGTADTFHQVLWVRDYPVWLSDRLITELTEIKCDLTVSLHLEPYDQVEGMSLVE
FT                   RQIAELEMQTITERKKARKQGIGEDMIPRKLVDALEEGRQLRQELSTSNQKMFSTVMVI
FT                   GVSADRRATLDQNVKRAMTVIRKQSVKAEILKWMQLGGLTTELPIGRRAIPMRRTLTTA
FT                   SAAILVPFTTQELLVPGGIWYGVNAQSSNAVVADRTATVNGNGFLLGTSGSGKSQFGKN
FT                   EITQIILDRPEDDVIIIDPEREYEPCVQAFNGATARIHAGSPHSVNPMDIELDIAVSDG
FT                   DPILAKSNFVLAALDHLIGRASGLTAAQRSVADRVTVGLYRKYAAERGAMPTFVELREG
FT                   LLATGDPIGHQLAASLEIYTVGSLGGFAQRTNVDLNSRVVSWDISQLGSELKSFGMMVV
FT                   LDQIWSRVARNRAAGRRTWLYIDEFHLLLVDRFISEYFRALWARARKWGLIATGITQNI
FT                   EAVLAHEDARLMLAKSDFLALLSQNPVDAETLVDLLRFSAEQRRRFTNVLPGQGLLRSG
FT                   GRVIPFDGRIPEDALLYRLFSTKFGEANG"
FT   gene            767879..769723
FT                   /gene="trsK"
FT                   /locus_tag="Lxx07690"
FT   CDS_pept        767879..769723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trsK"
FT                   /locus_tag="Lxx07690"
FT                   /product="conjugal plasmid transfer, ATPase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07690"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88685"
FT                   /db_xref="GOA:Q6AG10"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG10"
FT                   /protein_id="AAT88685.1"
FT                   /translation="MIPKTSETKKSLVAGARDGRASIRTQRHGAGAVRGALTAGRKQAK
FT                   TAQFVRSAGATASRTAVVAGRAAAAAGNTARAVAAAAASVIGSTPILAAATVVIVAAMV
FT                   ALVAVAWLLPAAQQAQGTGEDSGSFAMADDYPYKGMYSEDDMSPLGYAYGNCTDFVAWR
FT                   INRDAGGGAAPWKLTWKDLTPQGGNGADWGNIGNLPGWTYTRRPVPGDVISIRRAGVLG
FT                   SSTSAVGHVGYVGAVDGSGTVTIENYGHGRYFLTAAFLAQLDDPETGLAQLTETIIANT
FT                   TGEKDNGGDGFWERAERALLTALTAYVWATTAHTGSTEPNLPGVLDLQKGMQGSEENKD
FT                   EMTSETDLRFAAAREIVAEWHSNPNPDDDPAVMKVLDFACRQYRIYEQGPAETRMSVVI
FT                   SLGVRLALLDMHDVRTILTTDDLAIDRIGYERTALFLQIPDTHHIFKFISAMFWQTLFS
FT                   LTVYQADHEKTGHLPELLHMFLDEFANIGKIPAFEQVMATIRSRGISASIIMQSRSQGK
FT                   TLFGDAWAGVENNCDTKLFLGGDEEQTTKWVSQLLGYQTIVTSEYSESRGSHGSWSKSM
FT                   RVTKRELMMPDEIGRLPDDEAILKIRGMNPFRSKKLAV"
FT   gene            770514..771087
FT                   /pseudo
FT                   /locus_tag="Lxx07695"
FT                   /note="similar to conserved hypothetical protein"
FT   gene            complement(771331..772905)
FT                   /gene="rlx"
FT                   /locus_tag="Lxx07700"
FT   CDS_pept        complement(771331..772905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlx"
FT                   /locus_tag="Lxx07700"
FT                   /product="mobilization protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07700"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88686"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG09"
FT                   /protein_id="AAT88686.1"
FT                   /translation="MAVVKMGQIKSTVEKALAYISRPDATSDGLWVSTSAAVINPSDFK
FT                   AVAREFERTARRKAITAPRKGSVLAHHVIQSFPPGEAISANRAHQLGVQLAEQVTGGEH
FT                   EYMIATHLDKGHVHNHIIFNAINFETGRKFHTDKHTIGKIRDLSDALCKAEGLSVLPPL
FT                   QKPAAGRSFADIYRVMKGDRGKEYLRTEIDKAACRATSWNDFEAILARAGIEISVRGGR
FT                   NGTVSFREISMSRPVRDFRLGAAYTEQSIMTLMSKSVVNMVGVDVSMVVKESLDTITVT
FT                   VPGTQRELQLTVAKRQVVRHGRTLRMYVPAEEPQRLAYKNGNLTRTVTTAELYEFFSEP
FT                   DLAAAFDGGKRKNTDTSLLAGCTPAIAALRELEERVNAKARWMRPDMLDATTALAQARE
FT                   HLKEQRMTYQTVMVAAAEAMADPNGNPYQLEGLKAELRIIERDMATVSTDIRALTVLTT
FT                   DEAKASIAERIGTTLTTSTAAAEPTAAAVTLERTDRAEHTEQQAAEESPVAGRRSAGAA
FT                   SVPAGTH"
FT   gene            complement(773428..773811)
FT                   /locus_tag="Lxx07715"
FT   CDS_pept        complement(773428..773811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07715"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07715"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88687"
FT                   /db_xref="InterPro:IPR008687"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG08"
FT                   /protein_id="AAT88687.1"
FT                   /translation="MGFQPNPGRRNIVEAVNRSRPVRKILSFSAAEWERVERRIRLVGA
FT                   RSFEAFARQVVLEGEVRVTAIAFDPAEMRVALSRIGNNVNQIAALANTEENATFEQVQA
FT                   VRKLLVELQGVVTHAVDTVEARS"
FT   gene            774076..774579
FT                   /pseudo
FT                   /locus_tag="Lxx07720"
FT                   /note="similar to transposase"
FT   gene            774572..774997
FT                   /pseudo
FT                   /locus_tag="Lxx07730"
FT                   /note="similar to transposase, undefined"
FT   gene            775252..776277
FT                   /locus_tag="Lxx07740"
FT   CDS_pept        775252..776277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07740"
FT                   /product="secreted protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07740"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88688"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG07"
FT                   /protein_id="AAT88688.1"
FT                   /translation="MKIPHRAVRTGATAFVLLSGLVAGVSVPSAARAATEPVSSGDIIH
FT                   SAPGHRLPRNAPANGDVIDTLGHWTPERMRSAIPIEDSLVERGASTRSHTTTTKSANGR
FT                   SPIVVNPVEPTESATSNEPPQAMSSVGKLFFDGPDGNSYVCSGAVVTSRSGNLVHTAGH
FT                   CVYEAKKGWMKNFFFVPSYTDGTGPHGGWNGDIASTFTAWADDEDYSHDQAFISFYPHT
FT                   EGISMQQYFGGNGLMFNGGTSRTGVTIYGYPAADPYHGNIQYYCSGETSWVWFTSDTRM
FT                   GCPMTGGSSGGPWYASLTDDHVGMIYAVTSRGGKNIFGTPYLITTPDGNDVYDLYNSAN
FT                   T"
FT   gene            complement(776222..777522)
FT                   /pseudo
FT                   /locus_tag="Lxx07745"
FT                   /note="similar to conserved hypothetical protein"
FT   gene            778148..779638
FT                   /gene="pglA"
FT                   /locus_tag="Lxx07750"
FT   CDS_pept        778148..779638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pglA"
FT                   /locus_tag="Lxx07750"
FT                   /product="endopolygalacturonase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07750"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88689"
FT                   /db_xref="GOA:Q6AG06"
FT                   /db_xref="InterPro:IPR000743"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG06"
FT                   /protein_id="AAT88689.1"
FT                   /translation="MRTRLPAFLNALLAGLILMGSMAPTASPPASPVLAATPTTSTVAA
FT                   GDRRDVTEPSAPDTVCATVTARLSMPGGKASDAGEASPPDTARIQHALDACAQKGTDVV
FT                   AVRLSPTPDAAAFLSGPLTVREGEVLLVDAGVVLYASRNPADYQVDDHPACGTISKKGG
FT                   GCAPFVTLAGAHSGIESVPAADRSQGRIDGRGGSTMLGAARSWWGLAAAAKGHGTQNVP
FT                   RLIQARGVDDVVLHDVDLVDAPGFHVSYQNGDGLTVWGVRIQTPAAARNTDGIDPAGAQ
FT                   DVTIADSWIMDGDDGIAIKALSAPSAHISVIRDHFFGTHGISIGSETEAGVSDVFVSDV
FT                   TVSGTDAFGNVSASSAGIRIKSSPKAGGLVQQVTYRNVCVDAVKAPIQFDPNYANRTGS
FT                   TVPWFTDIVIDGFRSSNSPTNAESMLKGLDEAHPLALTMSNAVVDARHVTVALATISAS
FT                   GVTFGGLPLAVNRPGVDVTITPGQPNAPTCTLPTYPAP"
FT   gene            780192..780614
FT                   /locus_tag="Lxx07755"
FT   CDS_pept        780192..780614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07755"
FT                   /product="18 Kd antigen-like protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07755"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88690"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ACF4"
FT                   /protein_id="AAT88690.1"
FT                   /translation="MSNSFDVLSQLDRFASSVFDTARSPRVMPVDLFREGDQYVLSADL
FT                   PGIDPDSVDLDVDGQLLTIRAERLAPSSENVKWLVHERPYGSYMRQFTLGDGVDVEKIT
FT                   ANYEHGVLSVIVPMAERAKPRKIQIGSARGRKEVGA"
FT   gene            781177..782388
FT                   /gene="tnp"
FT                   /locus_tag="Lxx07770"
FT   CDS_pept        781177..782388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnp"
FT                   /locus_tag="Lxx07770"
FT                   /product="transposase, ISlxx5"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07770"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88691"
FT                   /db_xref="GOA:Q6AGR9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AGR9"
FT                   /protein_id="AAT88691.1"
FT                   /translation="MQGRVPGAAEQRALAPRSGGTSRNQPEHGIPLGQSNGRRIYPDGR
FT                   VVDYKDRVPVVVDPVQRASMRSLEAALHPRFLSLQERELIRDLTRAGLSLCRVAAKLGR
FT                   SVSTISREIRRNQLPGEGGYHPYVAHRKAASRRPRPKATRLVRNPQLRSYVQRKLTLRW
FT                   SPEQISRSLIREFPGDAEMRVAHETIYQAFYVQGRGQLRRELTMVLRTGRAKRKPHRSG
FT                   AARRHRFADPMVMISDRPAEIEDRAVPGHWEGDLIIGGHRNSAIGTLVERSTRFVMLIH
FT                   LPIDRTAESVRDGLISAVKTLPRELRRSITWDQGSEMAAHKSFTIATDIPVYFCDPASP
FT                   WQRGSNENTNGLLRQYFPKGKGTDLARFTATDLTNVAHELNTRPRKTLGWETPAERLAK
FT                   LLAS"
FT   gene            783238..783435
FT                   /locus_tag="Lxx07780"
FT   CDS_pept        783238..783435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07780"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88692"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG03"
FT                   /protein_id="AAT88692.1"
FT                   /translation="MRGWQIAVVALTGTLVAVGAGLAAIVPSQGFHCWYLCHAVFLLPV
FT                   FGDGRSVIVGARAWSARIVL"
FT   gene            complement(786215..787171)
FT                   /locus_tag="Lxx07795"
FT   CDS_pept        complement(786215..787171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07795"
FT                   /product="lysozyme"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07795"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88693"
FT                   /db_xref="GOA:Q6AG02"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018077"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG02"
FT                   /protein_id="AAT88693.1"
FT                   /translation="MNVQKMMRGRRAHSVRVGMVSAVIAAILAVGLGGSLSASATEPDR
FT                   GAGDPTQDHAGSTLAHDDSMLARDGSSQELRQRPRPIPPLDYVPGDDVSGWQTDVNWSD
FT                   AASKGARFVYIKATEDDDYVSPQYETQWKGAQDAGLYRGSYHFARPFESSGHVQAEHFM
FT                   NTIHNWKPTQRILPPMIDLEHRCSDLKKRWAVRKCEKITPKVMVQWIQDFVSTVERRTG
FT                   GVKPVIYTTLAWWIEYTGNTTKFSSYPLFIANWRWDVSTGPGALPGGWTGTGWTLWQHG
FT                   DDTTRYTYLKDLLPGDQDFFHGNMQALERFSNLPPLT"
FT   gene            complement(789913..790989)
FT                   /locus_tag="Lxx07798"
FT   CDS_pept        complement(789913..790989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07798"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07798"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88694"
FT                   /db_xref="GOA:Q6AG01"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AG01"
FT                   /protein_id="AAT88694.1"
FT                   /translation="MTDVAETARPSPKKPWFKRWWVWAIAVFLVIGVIGSVASGGSDGK
FT                   SPAASKTAWAQSTDLDEPLDPSAVVISSSRPTVAISNKSLTTGTAVDVLAGLPVKREAS
FT                   ATGYSRTADFGAAWLDVDGNNCDTRNDILHRDLTDAVQRGGCKILSGTLNDKYSGESIH
FT                   FVRGAKTSALVQVDHIVALKNAWVTGAQQLTQAQRVSFANDPLNLIAVDAHSNEQKSSG
FT                   DAATWLPANKSSRCEYVARQISVKATYGLWVTPAEKSAMMDILADCSGQMAESSTFTPP
FT                   APTPTPIEAPPAPAPPAPAPPAPLPAAPCPSRSPREMVPPHCATMARTLMPPTIRGRAH
FT                   TMVASRISTSNEGSLESW"
FT   gene            complement(791145..791218)
FT                   /gene="Gly"
FT                   /locus_tag="Lxx07810"
FT   tRNA            complement(791145..791218)
FT                   /gene="Gly"
FT                   /locus_tag="Lxx07810"
FT                   /product="tRNA-Gly"
FT   gene            791319..791399
FT                   /gene="Pro"
FT                   /locus_tag="Lxx07820"
FT   tRNA            791319..791399
FT                   /gene="Pro"
FT                   /locus_tag="Lxx07820"
FT                   /product="tRNA-Pro"
FT   gene            791454..792854
FT                   /gene="tig"
FT                   /locus_tag="Lxx07830"
FT   CDS_pept        791454..792854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="Lxx07830"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07830"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88695"
FT                   /db_xref="GOA:Q6AG00"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AG00"
FT                   /protein_id="AAT88695.1"
FT                   /translation="MKTTVEKLSPTRTKLTISVTPEELQPSIKHAYEHIAGQVNIPGFR
FT                   KGKVPPAIIDQRVGKEAVLEHAVNEGLDGFYRLAVEENEVRPLGRPEADISEWPNEKDF
FT                   SGDLLLTIEVDVRPEITLPAFDGITLTVEAAQVTPDDVEEELDRLRSRFCTLVTVDRPA
FT                   KKGDFAQIDLVAEIGGEEVDTAANISYEIGSGELIEGIDEALDTLTAGETTTFEAPLMG
FT                   GDHEGENAQITVTLNAVKERELPEADDDFAQISSEFDTIGELRESLRGQVERAKSFGQG
FT                   TAARDQLVEKLLELVEIPVPAQLVEDEVSRHLEQESRLEDDEHRAEVTESSEKTFRTQI
FT                   LLDEIAQRENVKVSQDELTQYLVQGAAQYNMDPNEFVKILGENGQISSMVGEIARNKAL
FT                   AIVLGKAEVVDTNGKQVDLTEFVALPDDGEAVDEDATPEDTDAPAEEAPAAEKPKKKAA
FT                   AKKKAADK"
FT   gene            792928..793413
FT                   /locus_tag="Lxx07840"
FT   CDS_pept        792928..793413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07840"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07840"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88696"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR041656"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFZ9"
FT                   /protein_id="AAT88696.1"
FT                   /translation="MDDWQRRVDAVWLAASERPEAETLAAIDALVAERPEDEPHALFEA
FT                   AGARDFVGDEAAAEPLYRRALANGLPEPQRGQATIQLASTLRVLGRPEDALILLRELLT
FT                   GHPGHELRDAVCAFAALALFDAGLPAEAVREALGALAAHLPLYRRAVTAYPAELIGQ"
FT   gene            793536..794129
FT                   /gene="clpP"
FT                   /locus_tag="Lxx07850"
FT   CDS_pept        793536..794129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="Lxx07850"
FT                   /product="ATP-dependent Clp protease proteolytic subunit"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07850"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88697"
FT                   /db_xref="GOA:Q6AFZ8"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AFZ8"
FT                   /protein_id="AAT88697.1"
FT                   /translation="MADMGIQPSVFDRLLKDRIIWLGSEVRDENANEIAAKLLLLAAED
FT                   SKRDIYLYINSPGGSITAGMAIYDTMQFVPNDIVTVGIGMAASMGQLLLTAGTKGKRYI
FT                   TPNARVLLHQPHGGFGGTASDIRTQAQLILHMKKRLAEITSEATGKTVDQVNADGDRDR
FT                   WFTAQEALDYGFVDHIRESALLVAGGGGTAPAGK"
FT   gene            794171..794842
FT                   /gene="clpP"
FT                   /locus_tag="Lxx07860"
FT   CDS_pept        794171..794842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="Lxx07860"
FT                   /product="ATP-dependent Clp protease proteolytic subunit"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07860"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88698"
FT                   /db_xref="GOA:Q6AFZ7"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AFZ7"
FT                   /protein_id="AAT88698.1"
FT                   /translation="MLGGSAHGGPVFGGVQAPGARYILPSFEERTAYGYKRQDPYAKLF
FT                   EDRIIFLGVQVDDASADDIMAQLLVLESQDPDRDIVMYINSPGGSFTAMTAIYDTMQYV
FT                   RPQIQTVVLGQAASAAAVLTAAGAPGKRLALPNARILIHQPAVGEAGHGQASDILIQSN
FT                   EINRMRAWLEETLVKHSSRTLEQVNKDIERDNILSATEALKYGLIDQVLTSRKTLPALV
FT                   K"
FT   gene            795003..796277
FT                   /gene="clpX"
FT                   /locus_tag="Lxx07870"
FT   CDS_pept        795003..796277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="Lxx07870"
FT                   /product="ATP-dependent Clp protease ATP binding subunit"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07870"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88699"
FT                   /db_xref="GOA:Q6AFZ6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AFZ6"
FT                   /protein_id="AAT88699.1"
FT                   /translation="MARIGESADLLKCSFCGKSQKQVQQLIAGPGVYICDECVELCNEI
FT                   IEERLAEAGEEASSEFDLPKPKEIFGFLEEYVIGQEQAKRSLAVAVYNHYKRVRARQAI
FT                   TAADAIDDVEIAKSNILLIGPTGCGKTYLAQTLARRLNVPFAVADATALTEAGYVGEDV
FT                   ENILLKLIQAADYDVKRAETGIIYIDEVDKIARKAENPSITRDVSGEGVQQALLKILEG
FT                   TVASVPPQGGRKHPHQEFIQIDTTNVLFIVAGAFAGLEDIISNRAGKKGIGFGAPLHSK
FT                   GDDINLFSEVLPEDLHKFGLIPEFIGRLPVVTTVTQLDQDALMQILTEPKNALVRQYQR
FT                   MFELDGVQLEFDHAALEAIADLAVLRKTGARGLRAIMEEVLGPIMFEVPSSSEVARVVV
FT                   TKEAVLENAAPTIVPHRPRREEKSA"
FT   gene            complement(796377..798398)
FT                   /pseudo
FT                   /gene="dcp"
FT                   /locus_tag="Lxx07880"
FT                   /note="similar to peptidyl-dipeptidase"
FT   gene            complement(798555..798821)
FT                   /locus_tag="Lxx07900"
FT   CDS_pept        complement(798555..798821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07900"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88700"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFZ5"
FT                   /protein_id="AAT88700.1"
FT                   /translation="MQLGTRWAVGEQASASLPAAVSDAVTAVERELAATGVETDGWRWT
FT                   LTWLEGRPIVELDDGTVIHYDPAEESAAIAQPAETDPGDAEER"
FT   gene            complement(798821..799291)
FT                   /locus_tag="Lxx07910"
FT   CDS_pept        complement(798821..799291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07910"
FT                   /product="acetyltransferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07910"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88701"
FT                   /db_xref="GOA:Q6AFZ4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032962"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFZ4"
FT                   /protein_id="AAT88701.1"
FT                   /translation="MSIDVRPIREGDFFAWLDLYAKYAEFCESELTDQKALTLWSWLTD
FT                   AQHEESGYLAVDDGRIVGLAHVREFARPLEGDRGLFLDDLFVLDTERGHGVGHDLIQAI
FT                   RSLAEESCLGVVQWIADHDNAHAQRVYDSVASRTSWVTYEIDLVAPEKGEKT"
FT   gene            complement(799331..799756)
FT                   /locus_tag="Lxx07920"
FT   CDS_pept        complement(799331..799756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07920"
FT                   /product="acetyltransferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07920"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88702"
FT                   /db_xref="GOA:Q6AFZ3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032962"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFZ3"
FT                   /protein_id="AAT88702.1"
FT                   /translation="MEDSEFFAWLDLYTGYGEFYETPVTDEKALLVWSWITDAGNPLEA
FT                   YFAVDEKDTPIGLAHAREFVRPLDGNRGLYLDDLFVRPGARGAGAGAALLERLRETARE
FT                   RGLSVVRWITAKDNETARELYDRVAEKTKWVTYDLVP"
FT   gene            complement(799774..802362)
FT                   /gene="valS"
FT                   /locus_tag="Lxx07930"
FT   CDS_pept        complement(799774..802362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="Lxx07930"
FT                   /product="valyl-tRNA synthetase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07930"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88703"
FT                   /db_xref="GOA:Q6AFZ2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022874"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AFZ2"
FT                   /protein_id="AAT88703.1"
FT                   /translation="MPEKPALEGLEGKWGSRWQEDGTYLFDRAAAIAAGRDAVYSIDTP
FT                   PPTASGSLHIGHVFSYTHTDVVARFQRMLGKRVFYPMGWDDNGLPTERRVQNYYGVRCD
FT                   PTLPYEPGLTPPFEGGDNKSSKAADQKPISRRNFIELCERLTVEDEKQFEALWRSLGLS
FT                   VDWSQTYRTIGEESLRTSQLAFLRNVKRGEAYQALAPTLWDITFRTAVAQAELEDRDQP
FT                   SAYHRVAFHGEAGPVFIETTRPELLPACVALVAHPDDERYQPLLGTTVRTPVFGVEVPV
FT                   VAHHLAQPDKGSGIAMICTFGDITDVTWWRELDLPNRAIIGFDGRIVSDAPEAIDTEAG
FT                   REAYAQLAGKTVFSAKQTVVELLRASGDLVGEPKPIQHPVKFFEKGDKPLEIVSTRQWY
FT                   VKNGARDEELRERLIELGRGIDWHPDFMRVRYENWVNGLTGDWLISRQRFFGVPIPVWY
FT                   PLDAGGNPVFDAPILPLEESLPIDPSSAAAPGYTEQQRGQAGGFVGEHDVMDTWMTSSL
FT                   TPQLAGGWHRDDELFAAVSPYDLRPQGQDIIRTWLFSTLLRSQLEDGVAPWTHAALSGF
FT                   IVDPDRKKMSKSKGNVVTPADVLERHGSDAVRYWAASSRLGTDAAFDPQNPTQIKIGRR
FT                   LAIKLLNAAKFILGFDAPASLDLAQVTVPLDRSMLQQLTDVITDATAALDAYDHARALE
FT                   TTETFFWTFCDDYLELVKERAYGEASTGQVSAVVALRMALSAFLRLFAPVLPFAAEEAW
FT                   RWWNEGSVHLAAWPAAAETSVGGNDARAVLNVLGRALTGIRGAKTAAKASQRTPVDSAV
FT                   IAGPAGDLAVIESAADDLRSVGRIVELRFTAGADLAVADIVLTQAPEEER"
FT   gene            complement(802487..803807)
FT                   /pseudo
FT                   /gene="proP"
FT                   /locus_tag="Lxx07940"
FT                   /note="similar to sugar-proton symporter transmembrane
FT                   protein"
FT   gene            803870..804619
FT                   /locus_tag="Lxx07960"
FT   CDS_pept        803870..804619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07960"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07960"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88704"
FT                   /db_xref="GOA:Q6AFZ1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041347"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFZ1"
FT                   /protein_id="AAT88704.1"
FT                   /translation="MNSRNSGSGRPRASSRETLAEAAAELFLEQTYAGTTVDDIARRAG
FT                   VSRATFFNYLASKSDLLWLEVDEALKGFPELLVAPGAGILPMDAVLIAVLRLAEGFGPG
FT                   RLPLAVTQVELMETDAELQASALPRFLAVVRQIAAAIAARTGDDAEGPLPRGAAAAVVG
FT                   AGVAAVGVWARAGVGRGPLKPLVREAVEPVCRGYTTALLSATAGPAERARMDGTDIDPA
FT                   ITGESSEEQWGGPLSRTERVRPVTAGE"
FT   gene            804660..808019
FT                   /gene="ileS"
FT                   /locus_tag="Lxx07970"
FT   CDS_pept        804660..808019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="Lxx07970"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07970"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88705"
FT                   /db_xref="GOA:Q6AFZ0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AFZ0"
FT                   /protein_id="AAT88705.1"
FT                   /translation="MVPRRSRQRPASSCRTAKTARREMPYPLPAPDGQEPEAQPVTPSP
FT                   VFPEIEEDVLAFWDRDGTFHASIDNRDGAPEWVFYDGPPFANGLPHYGHLMTGYAKDVF
FT                   PRYQTMRGKKVERRFGWDTHGLPAELEAERQLGITDKSQIEEMGLAAFNQAAKDSVLKY
FT                   TREWQQYVTRQARWVDFDNGYKTLDTTYMESVIWAFKQLHEKGLAYEGYRVLPYCWRDQ
FT                   TPLSNHELRMDDDVYKMRQDQTVTVTFPLTGAKAESLGLTGVRVLAWTTTPWTLPTNLA
FT                   LVVGPDIQYAVVPAGPNGAADAHGRPDDEVLSGEYLLAIDLVGNYAKDLGYGSPEAARA
FT                   AVTRTIPGRELEGVTYDRLWDYYADAATWGTQNAWQILVDGYVTTEDGTGIVHQAPAYG
FT                   EDDQRVCEAAGIPVIISVDDGARFLPAVQDVAGLQVFEAGKPLIKLLREEGRLLRQASY
FT                   EHSYPHCWRCRNPLIYKAVSSWFVRVTDFRDRMVALNQEITWVPENVKDGQFGKWLAGA
FT                   RDWSISRNRYFGSPIPVWKSDDPDYPRVDVYGSLAELERDFGRLPLNAAGEPDLHRPFV
FT                   DDLTRPNPDDPTGRSTMRRIPDVLDVWFDSGSMPFAQVHYPFENSDWFDSHNPADFIVE
FT                   YIGQARGWFYLLHALSTALFDRPAFTNVISHGIVLGNDGQKVSKSLRNYPDVNDVFDRD
FT                   GSDAMRWFLMSSPVLRGGNLVVTEEGVREGVRQVLLPLWNTWYFFSLYANATGYEAKRS
FT                   TASAAVLDRYLLAKTRDLVEAVTADLDALDSTLASAKLRDFADLLTNWYVRRSRDRFWA
FT                   GVDGEGAGAEAFDTLYTVLETLTRVAAPLLPLVTERIWKDLTGGRSVHLTDWPDAAELP
FT                   ADDALVAAMDRVRAISSTALSLRKQAGLRVRLPLASLTVVAEGAAALAPFEAILRDELN
FT                   VKAVCLVEGEHSGVDRALTVKARQLGPRIGKRVQEVIRAAKSGDWSEADGVVTAGGVEL
FT                   EPGEYELAVVISAPTARFENGVYIELDTALTPELEAEGLARDIIRAVQDTRKAAGLGVS
FT                   DRIALTLAFENGGDARVLGLATEVDIASETLARTVQVAAAAGAFVKTFGAGQFANVGDF
FT                   TVGITKIEEADE"
FT   gene            808016..809383
FT                   /gene="folC"
FT                   /locus_tag="Lxx07980"
FT   CDS_pept        808016..809383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /locus_tag="Lxx07980"
FT                   /product="folylpolyglutamate synthase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07980"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88706"
FT                   /db_xref="GOA:Q6AFY9"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFY9"
FT                   /protein_id="AAT88706.1"
FT                   /translation="MSDDERLRDEAEAVYQALLGRIGEAAPERRLDATRRAMELLGDPQ
FT                   RAYPIIHITGTNGKTSTGRVTESILRAYGLRTGLMTSPHLVRFNERIVIDGEPIGDGAL
FT                   VRTWEDIHPFLELVDAELEQQGKAPLTFFEALSALAFAAFADAPVDVAIIEVGMGGEWD
FT                   STNVGDGQVAVFTPISLEHTKQLGSTVREIARTKSGIIKPTADVVTSAQPPEALFELEE
FT                   TARLTESSLMRQPRDFDVVRTRVAVGGQLVTVRGRAATYEDVFLPLYGDHQAQNAAVAV
FT                   VAVETFLGRGVPPLKAELVEEGFATATSPGRLQLIGIEPSVLVDAAHNPAGAEALAEAL
FT                   GRYFDFEEIAFVVGSLGDKDARGVIHALAPRATQYFVTEPASDRALPAEELGDIVRDEA
FT                   GEEAALVFSDALDALETAREWAGERARRAVVVTGSILLVGAAMAYAEERGWKEAAS"
FT   gene            809380..809793
FT                   /locus_tag="Lxx07990"
FT   CDS_pept        809380..809793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx07990"
FT                   /product="membrane protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx07990"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88707"
FT                   /db_xref="GOA:Q6AFY8"
FT                   /db_xref="InterPro:IPR025327"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFY8"
FT                   /protein_id="AAT88707.1"
FT                   /translation="MSPAGEQERPERQRPESPAGRPSRRRSLRESLGSIVLGFELIIVF
FT                   LGALVVSGLGALSPAVALGGGAGVVLLTIVAIGLLRASVGVWLGWVVQLIVIAAGFLVP
FT                   AFFIVGAIFTAMWTYCMIVSARLDRSPTETETP"
FT   gene            809790..810212
FT                   /gene="ndk"
FT                   /locus_tag="Lxx08000"
FT   CDS_pept        809790..810212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="Lxx08000"
FT                   /product="nucleoside diphosphate kinase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08000"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88708"
FT                   /db_xref="GOA:Q6AFY7"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFY7"
FT                   /protein_id="AAT88708.1"
FT                   /translation="MTTAVEETLVLVKPDGVARNLTGEILRRIEAKGYSLVDIRMVQAD
FT                   RVLLAKHYAEHEGKPFYEPLVEFMESGPLVAIRLAGNRVIEGFRSLAGATDPTTALPGT
FT                   IRGDLARDWGLKVQQNLVHGSDSPTSAARELALWFG"
FT   gene            complement(810360..810977)
FT                   /locus_tag="Lxx08010"
FT   CDS_pept        complement(810360..810977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx08010"
FT                   /product="integral membrane protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08010"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88709"
FT                   /db_xref="GOA:Q6AFY6"
FT                   /db_xref="InterPro:IPR012932"
FT                   /db_xref="InterPro:IPR038354"
FT                   /db_xref="InterPro:IPR041714"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFY6"
FT                   /protein_id="AAT88709.1"
FT                   /translation="MSDSTAPAAYRRPNALAILLVAAGAIGLWGAFMLMLDKVHLMENP
FT                   DAHLSCNFNVLIGCSKNLNSWQGSLLGFPNPIIGLGGWTAVIAVGIGLLAVKSRFARWY
FT                   WLAFNAGMALALALVVFLITESLTTLNVLCPWCMVTWAVTIPIFWSVTLYNLKEGTIPL
FT                   PERGRRIFEILYGWVPLITVLSYALVAILAQIQLDWINRAFV"
FT   gene            811262..813805
FT                   /gene="rng"
FT                   /locus_tag="Lxx08020"
FT   CDS_pept        811262..813805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rng"
FT                   /locus_tag="Lxx08020"
FT                   /product="ribonuclease G"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08020"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88710"
FT                   /db_xref="GOA:Q6AFY5"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFY5"
FT                   /protein_id="AAT88710.1"
FT                   /translation="MGDRRRSRSASAMVENENIDNTNATSTEGEGTGRKRRGIFGTRRA
FT                   GRSALSTGAAEPAAITAEPVETAAVAVDRRAETLPAPGDGAGPAAERATTEKVAAEPGS
FT                   APSAPVAAHEPPALPEPHGEQPDADATLFPAVPGLPPTALLFQAPEIIPLPPLPDGEEE
FT                   PSATVRRRLRRRAGEPGRSDTNDPASTVVKVRAPREPELITEPQKVKGSTRLEAKKQRR
FT                   RDGRAAGRRRPVITEAEFLARRESVDRQMVVRSKGGRIQIGVLEDKVLVEHYVARSQEA
FT                   SLIGNVYLGRVQNVLPSMEAAFVDIGRGRGRNAVLYSGEVDWDAVETGNQPRRIELALK
FT                   PGDRVLVQVTKDPVGHKGARLTSQISLPGHYLVYVPNGSMNGISRKLPDTERSRLKKIL
FT                   KEVLPESAGVIVRTAAEGATEEQLTLDVTRLTAQWADISRQNETQQAPALLHSEPDLLI
FT                   KIIRDVFNEDFQKLVIAGDDARQTIESYLRQVAPDLLDRVEAYTGERDAFDEHRITEQI
FT                   EKALERKVWLPSGGSLVIDRTEAMTVVDVNTGKFVGSGGNLEETVTKNNLEAAEEIVRQ
FT                   LRLRDIGGIIVVDFIDMVLESNRDLVLRRLIECLSRDRTKHQVAEVTSLGLVQMTRKKL
FT                   SLGLLETFSEACEVCAGRGVIVHHDPVVKSRQPQQPQNERRRGRGGNGSGSSAPAHSGS
FT                   GTHAITDDAKNALAQIAASTIHAHAVDEGAKPVEGAASVAEAQETPAPKKRRRKGKSAQ
FT                   RDEQKTAAAGTSGEDVPAAAGPDRVVLPVVDLLDAAPAPTAKTSTVETELLLDSVLDSL
FT                   PQPKAPDAGRKRSRRESTAVIAGGELAPADGDQQP"
FT   gene            complement(813833..814102)
FT                   /locus_tag="Lxx08030"
FT   CDS_pept        complement(813833..814102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx08030"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08030"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88711"
FT                   /db_xref="InterPro:IPR025109"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFY4"
FT                   /protein_id="AAT88711.1"
FT                   /translation="MTVLIDPPAWHAHGMLWSHLVSDSSIDELHAFAAAGVPARAFDLD
FT                   HYDIPDKRYDELIAAGARPVPGRELVARLIASGLRVRARGLRGH"
FT   gene            814361..814675
FT                   /gene="rplU"
FT                   /locus_tag="Lxx08040"
FT   CDS_pept        814361..814675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="Lxx08040"
FT                   /product="50S ribosomal protein L21"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08040"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88712"
FT                   /db_xref="GOA:Q6AFY3"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AFY3"
FT                   /protein_id="AAT88712.1"
FT                   /translation="MKVVYAVVRAGGRQEKVEVGTIVTMDRVKDGENGTIELAAVLLVD
FT                   GDKITSDAKSLSKVTVTATVLEDLRGPKIVIQKFKNKTGYKKRQGHRQELTRVKIIGIK
FT                   "
FT   gene            814705..814962
FT                   /gene="rpmA"
FT                   /locus_tag="Lxx08050"
FT   CDS_pept        814705..814962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="Lxx08050"
FT                   /product="50S ribosomal protein L27"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08050"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88713"
FT                   /db_xref="GOA:Q6AFY2"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AFY2"
FT                   /protein_id="AAT88713.1"
FT                   /translation="MAHKKGASSTRNGRDSNAQRLGVKRFGGQTVNAGEILVRQRGTHF
FT                   HPGANVGRGGDDTLFALAAGSVEFGAKGGRKVVNIVAVEA"
FT   gene            815050..816594
FT                   /gene="obg"
FT                   /locus_tag="Lxx08060"
FT   CDS_pept        815050..816594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="obg"
FT                   /locus_tag="Lxx08060"
FT                   /product="GTP-binding protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08060"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88714"
FT                   /db_xref="GOA:Q6AFY1"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR015349"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR036346"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AFY1"
FT                   /protein_id="AAT88714.1"
FT                   /translation="MATFVDRVTVHLRAGNGGNGCVSVRREKFKPLAGPDGGNGGNGGD
FT                   IVLVADPQVTTLLGYHRRPHRSSGNGGFGMGDHRSGHTGEDLELPVPVGTVVKSSEGAE
FT                   LADLTEPGMRIVAAPGGIGGLGNAALSNPKRKAPGFALLGTPGWEGDILLELKTVADIA
FT                   LVGYPSAGKSSLIAALSAAKPKIADYPFTTLHPNLGVVQVGDVRYTVADVPGLIEGASE
FT                   GRGLGFEFLRHVERCSALLHVLDCATLEPGRDPLSDLDVILAELAAYPVPEGQLPLLER
FT                   PQLIALNKIDVPDARELADFLRPDLEARGYRVFEISTVSHEGLRPLSFALAELVERARK
FT                   EQAVLDETRPRIIVRPKTVDDSGFVVKVEGGSEGPVYRVLGAKPERWVAQTDFQNDEAI
FT                   GYLAARLAKLGVEDQLVRVGAVAGSTVVIGRENGVVFDWEPTLTSAAELISSPRGTDAR
FT                   IGVNARPTRAQRREDYFDRMDAKAEARAELLREREAGLWKDDDAAVQGGSEETGRE"
FT   gene            816591..817403
FT                   /gene="proB"
FT                   /locus_tag="Lxx08070"
FT   CDS_pept        816591..817403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="Lxx08070"
FT                   /product="gamma-glutamate kinase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08070"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88715"
FT                   /db_xref="GOA:Q6AFY0"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AFY0"
FT                   /protein_id="AAT88715.1"
FT                   /translation="MTIDDRGQIRSARRIVVKVGSSSISGENAGQIGPLVDALAEAHGR
FT                   GSQVVLVSSGAIATGIPYLALTERPKDLATQQAAAAVGQNVLIYRYQDSLDRYGIVAGQ
FT                   VLLTARDVENPTHRSNAKRAMERLLDLRILPIVNENDTVATHEIRFGDNDRLAALVAKL
FT                   VEADLLVLLSDVDALYTKPPQESGAERIAHVGWNDQLEGVEIGSAGPSGVGTGGALTKV
FT                   SAARQAAEHGTAVVLTATSLVVDALRGEPVGTWFAPAQETAVESAPAS"
FT   gene            817414..818679
FT                   /gene="proA"
FT                   /locus_tag="Lxx08080"
FT   CDS_pept        817414..818679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="Lxx08080"
FT                   /product="gamma-glutamylphosphate reductase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08080"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88716"
FT                   /db_xref="GOA:Q6AFX9"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AFX9"
FT                   /protein_id="AAT88716.1"
FT                   /translation="MSPTSTATSLTDRFSAAKRASIALAIASNAEKDAALRGIAEGVLA
FT                   AADSILAANAVDLATGRENGLSTGLLDRLTLTPARLQGLADAVLEIVALTDPVGQTVRG
FT                   SALPNGVKITQIRVPFGVVGAIYEARPNVTIDIAALALKSGNAAVLRGGSAAIATNGVL
FT                   VGVIQEALAAAGLPADAVQTIDDFGREGANGLMQARGFVDVLIPRGSAGLIQIVVTQSA
FT                   VPVIETGAGVVHIVLDESAREDWAVDIVRNAKAQRPSACNAVETVLVLRAAAERLLSPV
FT                   LGALTEAGVTIHADEIALPHSPGAIAVTAEDYATEHMSLDVSVRVVDDLDAAIEHIRTH
FT                   STQHTEAIVTNDLANAERFLNEVDSAVVMVNASTRFTDGGEFGFGAEVGISTQKLHARG
FT                   PMGLPELTSTKWIVRGAGQVRS"
FT   gene            818738..818974
FT                   /locus_tag="Lxx08090"
FT   CDS_pept        818738..818974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx08090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08090"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88717"
FT                   /db_xref="GOA:Q6AFX8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFX8"
FT                   /protein_id="AAT88717.1"
FT                   /translation="MSHLTTVLAAAEAHIELPMPAWAYGAIAAVIFAALLIVTLSYRDV
FT                   ANRHSHRSDPDAAAHAGAPGAAHHGSGHPTQGH"
FT   gene            818986..819588
FT                   /gene="nadD"
FT                   /locus_tag="Lxx08100"
FT   CDS_pept        818986..819588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadD"
FT                   /locus_tag="Lxx08100"
FT                   /product="nicotinate-nucleotide adenyltransferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08100"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88718"
FT                   /db_xref="GOA:Q6AFX7"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AFX7"
FT                   /protein_id="AAT88718.1"
FT                   /translation="MELTEKSRPRIGVMGGTFDPIHHGHLVAASEVAQSFDLDEVVFVP
FT                   TGRPWQKGAVTPAEHRYLMTVIATASNPRFTVSRVDVDRIGPTYTIDTLRDLHEERPEA
FT                   ELFFITGADAIAQILSWRDVEELWKLAHFVAVSRPGHDLSISGLPQQDVSLLEVPALAI
FT                   SSTDCRDRVNRGMPVWYLVPDGVVQYISKHHLYRSVA"
FT   gene            819585..820877
FT                   /locus_tag="Lxx08110"
FT   CDS_pept        819585..820877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx08110"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08110"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88719"
FT                   /db_xref="GOA:Q6AFX6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFX6"
FT                   /protein_id="AAT88719.1"
FT                   /translation="MTLWPDHQADADTPPRTRRQVRENERTATHRAGASTPAGESAAAA
FT                   RSQSRDTGAGAAEAPFAADEQPTIPPTAFAAGGFESLLFRAEAAAESEKPVENSFGLFR
FT                   QASAPEESASSTRPVPVMPPANEGGSSGERRLTRRELRAMLQAQEANQHTTGVAPSVAP
FT                   AFPVTFTPDLDAVRPIEPAAGVPPSAPAASGGAMPSGQKAAWPFAAPEAETSVTASPVS
FT                   PFTAFGAQVDPGASRPVAPAAPAQTFPSPGKLTAPESGDGGPAAAEERRPFTPPTGHWS
FT                   AGTEFDEKNEPVTTRNVAHSAAATTTNALILPSLPKPDATLPLTSTGEILVTGSIDLPR
FT                   ALGATGAMPDRIDSSDIDRLLDGEENEFNTSDSAPILASRAISSHTSTRSVIPPPKKRG
FT                   NALPVVLMITAGVLAVGVLGLLITAYALNMF"
FT   gene            820927..821298
FT                   /locus_tag="Lxx08120"
FT   CDS_pept        820927..821298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx08120"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08120"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88720"
FT                   /db_xref="GOA:Q6AFX5"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFX5"
FT                   /protein_id="AAT88720.1"
FT                   /translation="MTATQHARDILLIAAAAADARSGTDIVALDVSGPLPLTDVFLLVS
FT                   GRVERTVIAIASEVEDRLNEAGIRTLRREGTSEGRWVLLDFGDLVVHVFHEEDRMYYSL
FT                   ERLWKDCPALPLPVPERAE"
FT   gene            821360..821605
FT                   /locus_tag="Lxx08130"
FT   CDS_pept        821360..821605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx08130"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08130"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88721"
FT                   /db_xref="InterPro:IPR027392"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFX4"
FT                   /protein_id="AAT88721.1"
FT                   /translation="MKCPTDNSTLIMSERTGIEIDYCPECRGVWLDRGELDKIIERSAA
FT                   PAAEPIPARYDERRLHPHNPYPQKKRRENWLSELFD"
FT   gene            821712..821790
FT                   /gene="Ala"
FT                   /locus_tag="Lxx08140"
FT   tRNA            821712..821790
FT                   /gene="Ala"
FT                   /locus_tag="Lxx08140"
FT                   /product="tRNA-Ala"
FT   gene            821921..823222
FT                   /gene="lytR"
FT                   /locus_tag="Lxx08150"
FT   CDS_pept        821921..823222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lytR"
FT                   /locus_tag="Lxx08150"
FT                   /product="transcriptional regulator, LytR family"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08150"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88722"
FT                   /db_xref="GOA:Q6AFX3"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFX3"
FT                   /protein_id="AAT88722.1"
FT                   /translation="MRISMIDLPHRHVRVTRGPTVVRHGRLPRRRTAISALKLVSGVIV
FT                   VALISTTFVSAYAVWDVSRSVKKGVQLSALPGHTAAPQDIPDVGAIDGGVNLLLVGTDS
FT                   RSGLGGVYNNPAEQDASTGQGNNDVTMLLHIAQDHKSMMVVSFPRDLMVSIPECPGLKG
FT                   GGTSGSSFAMFNTALSRGGLPCVVLTVEKLTGVQIPFAATVNFNGVSAMSNAVGGVEVC
FT                   LATPVSDGYTNPPLHLPAGKNTLVGDQALSFLRSRHGVGDGSDLGRISNQQVFLSALAR
FT                   KIVSGGVLSNPVQLYTLAKAVVANVTPSQTLTNPMTLVQIALALKDTGLENMVFLQYPT
FT                   VADPDNANRVVPQSSAAKAVNQALVQDQPVKLTGTTGRGAEDPNPTPTPAPAATGAATQ
FT                   QPATSTPTGGGSVELPSNVTGQTAAQQTCTRGNN"
FT   gene            823465..824838
FT                   /locus_tag="Lxx08160"
FT   CDS_pept        823465..824838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx08160"
FT                   /product="transmembrane efflux pump"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08160"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88723"
FT                   /db_xref="GOA:Q6AFX2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFX2"
FT                   /protein_id="AAT88723.1"
FT                   /translation="MTPVQVRVLLGAIFASFVTFLDGAVITVTLPAIDREFGGGLPLQQ
FT                   WVVDAYLVTLGSLILIAGSLSDVLGRKRVLYMGLIGFGVTSLLCAFAPDGVFLVVSRAL
FT                   QGVAGALLVPSPLAIIVFRFDGQAQAKAIGRWTAWTGIAMIAGPVLGGVFVDTLSWRWV
FT                   FVITVIPIAVTLILMPTLGETSRGTGVRVDALGAVLGSAGLAGTVFALIVQGSYGSGSP
FT                   RVWVPFVVGVLALAGFFIAETRAKQPMLPLGLFAVHNFWVGNLATAFVYGALSFGPLMV
FT                   TLYLQQTAGFSATAAGLVFIPSTVCMLLLSGYFGSLAGRYGPRFFMAAGPLLASTGFLW
FT                   LLLRGDSVASGLNLLLGVLLFGVGLSMTVAPLTSAILGSVHPGQAGIGSAVNNAVARIA
FT                   GLVAVAMAGIVIGQRLDTAGMQRAMIVTAGLLIVGGVVSAIGVRNHEPAAEPIQATTD"
FT   gene            complement(824820..825659)
FT                   /gene="menA"
FT                   /locus_tag="Lxx08170"
FT   CDS_pept        complement(824820..825659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menA"
FT                   /locus_tag="Lxx08170"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08170"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88724"
FT                   /db_xref="GOA:Q6AFX1"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFX1"
FT                   /protein_id="AAT88724.1"
FT                   /translation="MPARSAPLSLLLSSHPGPSLVVTVVATGLGLALGYPPGRLALLAL
FT                   AVLLGQLSIGWSNDWMDAAREREVARRDKPAARGDIPIPVVRTAAFAALALALATTALL
FT                   GPGALLVHTIAIAGGWSYNAGLKRSAISFLPFAVSFGLLPAIAALGRAAPVWPASWVIA
FT                   AGALLGVAAHLTNVLPDLADDARTGIRGFAHRIGPLVSGVIAFVCLIAATALIALGPGL
FT                   PVPPLLIAGLALGLAAAVAGIVLLLRRSPTRLLMQLIMTCAVVDAGMLVLAGQSVVA"
FT   gene            825804..826355
FT                   /locus_tag="Lxx08180"
FT   CDS_pept        825804..826355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx08180"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08180"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88725"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFX0"
FT                   /protein_id="AAT88725.1"
FT                   /translation="MTIEIPGYKVGTWTIDPAHSEVGFSIRHLMISKVKGIFEEFDATF
FT                   VTAENPLESSVSAQVRVASVNTKNADRDAHLRTGDFFLAEEHPTIDFVSTGVRQEDGEF
FT                   LVDGDLTIKGVTKPVTFEFDFGGFVHDLYGNDKAGATAKTTINREDFGLTYNAALEMGG
FT                   MLLGDDVTITLEFQAVLQKG"
FT   gene            complement(826537..827373)
FT                   /locus_tag="Lxx08190"
FT   CDS_pept        complement(826537..827373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx08190"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08190"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88726"
FT                   /db_xref="InterPro:IPR021447"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFW9"
FT                   /protein_id="AAT88726.1"
FT                   /translation="MDDRYGTDVLAGDWRKAGRRPVPEAEAVRDLVVEEAASGFCGAIT
FT                   RLEAQTVELEDYFGKRRVFPLRGSFLIDGAPVRLVAPKRAAGGRARTASGSFPAGEAKA
FT                   RVARASRIFVEGRHDAELVERVWGDDLRVEGVVVEHLDGVDDLDAIVRDFAPGRSRRIG
FT                   VLVDHLVPGSKESRIAEQVARGQHGEHVLIAGHPYIDIWQAVKPERMGLTAWPSVPRSI
FT                   PWKQGICQTLGMPHATQADIARAWKRILGRVRTYADLEPDLLGPVERLIDFVTEPA"
FT   gene            complement(827625..828701)
FT                   /locus_tag="Lxx08200"
FT   CDS_pept        complement(827625..828701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx08200"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08200"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88727"
FT                   /db_xref="GOA:Q6AFW8"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR039376"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFW8"
FT                   /protein_id="AAT88727.1"
FT                   /translation="MVTTSHTPSDIKRWRRYLANERAEAAVYRDLAGRREGKEREILLA
FT                   LAEAEGRHEQHWLDLLGDQAGRALRGDIRTRALSVLARRFGSVFVLALAQRAEARSPYA
FT                   TDADATAQMVADEQVHEEVVRALAARGRQRLSGTFRAAVFGANDGLVSNLAFVLGVSAS
FT                   GVATEIVLLTGVSGLLAGALSMGAGEYVSVRSQRELLEASTPNPATRSALPDLDVDANE
FT                   LTLVYRARGMSPEEATAHAHQVLSTLGAHSSPLPGPGVRDEEHEEIGTGWNAALSSFCF
FT                   FASGALIPILPYLFGLTGTTAVIVASALVGLVLLGTGAIVGLLSGGSPWKGALRQLGIG
FT                   FGAAAATYFLGLLFGATG"
FT   gene            complement(828968..829058)
FT                   /gene="Leu"
FT                   /locus_tag="Lxx08210"
FT   tRNA            complement(828968..829058)
FT                   /gene="Leu"
FT                   /locus_tag="Lxx08210"
FT                   /product="tRNA-Leu"
FT   gene            829179..830511
FT                   /pseudo
FT                   /gene="argE"
FT                   /locus_tag="Lxx08220"
FT                   /note="similar to acetylornithine deacetylase"
FT   gene            830520..831377
FT                   /pseudo
FT                   /gene="bacA"
FT                   /gene_synonym="upk2"
FT                   /locus_tag="Lxx08240"
FT                   /note="similar to undecaprenol kinase"
FT   gene            complement(831612..832508)
FT                   /locus_tag="Lxx08270"
FT   CDS_pept        complement(831612..832508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx08270"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08270"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88728"
FT                   /db_xref="InterPro:IPR008492"
FT                   /db_xref="InterPro:IPR019151"
FT                   /db_xref="InterPro:IPR038389"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFW7"
FT                   /protein_id="AAT88728.1"
FT                   /translation="MTDANSILGGRILVVAFEGWNDAGEAASGAVKTLKDQLDVVPVAE
FT                   VDPELYFDFQFNRPVVADDDGRRRLIWPSAEILGPARPGDTGDARLDATGANAGNIFLL
FT                   LGTEPSRSWRSFTAEIMDAALASDIGAIVFLGAMLADVPHTRPISIFASSENAAVRAEL
FT                   GIERSSYEGPVGILSALAEGAEDVGIPTISIWASVPHYVHNAPSPKAVLALIDKLEELV
FT                   NVTIPRGSLVEEATAWEAGIDALALDDDEMATYIQQLEQARDTVDSPEASGEAIAQEFE
FT                   RYLRRRDGRAGDDPRRG"
FT   gene            832597..833283
FT                   /locus_tag="Lxx08260"
FT   CDS_pept        832597..833283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx08260"
FT                   /product="hydrolase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08260"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88729"
FT                   /db_xref="GOA:Q6AFW6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFW6"
FT                   /protein_id="AAT88729.1"
FT                   /translation="MTELTPHAMPAAVFWDMDGTLVDTEPYWMDAERELVASFGGVWTH
FT                   DDALLMVGLGLWNSAEILRSRGVHMEADAIVAWLTGRVRERLADDGVPWRPGARELLAS
FT                   LRERHVPTALVTMSLRSMAEQIVDRIPFAAFDAIVSGDEVDEPKPHPEPYLRAARLLGV
FT                   EVREAVAIEDSLVGLASAVASGAVAIGVPHIVPLPESEEHTLWPTLDGRSAEDVAAVAA
FT                   ARRAAL"
FT   gene            833280..834299
FT                   /gene="gcd14"
FT                   /locus_tag="Lxx08280"
FT   CDS_pept        833280..834299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcd14"
FT                   /locus_tag="Lxx08280"
FT                   /product="SAM-dependent methyltransferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08280"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88730"
FT                   /db_xref="GOA:Q6AFW5"
FT                   /db_xref="InterPro:IPR014816"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFW5"
FT                   /protein_id="AAT88730.1"
FT                   /translation="MTGVRPERAPRSSGPFRAGDRVQLTGPKGRMNTITLVPGALFHSH
FT                   RGVLEHDVVIGQHDGSVVVNNAGVEHLALRPLLNDFVMSMPRGAAIVYPKDAAQILALA
FT                   DIFPGATVVEAGVGSGALSLWLLRAIGPEGRLLSFERREEFAEVARDNAASFLGRDPEN
FT                   WTVAVGDVQEALPAAVEPGSVDRVVLDMLAPWETLEAVSAALKPGGVVLCYIATVTQLS
FT                   RVAEAIRSTGHYAHPQSSETMVRGWHVEGLAVRPDHRMIAHTGFLLTARRLAPGTVLPE
FT                   LKRRLSKSDYSDADVEAWTPGALGERQSSPKSLRKRMREAAASAGLARDRDGDAPGVD"
FT   gene            834362..835279
FT                   /gene="aceF"
FT                   /locus_tag="Lxx08290"
FT   CDS_pept        834362..835279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceF"
FT                   /locus_tag="Lxx08290"
FT                   /product="peptidylprolyl isomerase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08290"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88731"
FT                   /db_xref="GOA:Q6AFW4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFW4"
FT                   /protein_id="AAT88731.1"
FT                   /translation="MRRATALGRTSAVVLAAAVVAAALSGCSSDRNADCGTELTAGKAS
FT                   GLVSATGAFGSQPTVTAPSPIYTTASQRSVLTAGSGDRVHKGDSIELTYTVVNGSTGQV
FT                   AGQSRGKQWFPLGSDPISKGLQCAAVGSRVAIVLSPSDAGAQDNSTSPIYVIDIVKSYP
FT                   SAANGAVRPAASGFPTVVLAPTGQPGITIPSSGSAPQSVRSELLKAGDGATVKKDSEIV
FT                   LNYTAVGWENKNIVTSSWATGAPDLASLATGQSTIQSRNQSVLPQSMLKELVGQKTGSQ
FT                   LVIETPESGGFPASAWVVDILGIR"
FT   gene            835324..836352
FT                   /locus_tag="Lxx08300"
FT   CDS_pept        835324..836352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx08300"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08300"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88732"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFW3"
FT                   /protein_id="AAT88732.1"
FT                   /translation="MPRSSSSPPRVPVEERLFSLVLALLATENGLTKSEILSTVQGYRQ
FT                   RFDARGGNASLERQFERDKDDIRELGVPLETVESPEAAGNNQLLRYRIPKGAYDLPQDV
FT                   VFSPEEITLLGLAATVWREGSLSGESRRALLKLRSLGVEADDPVVGYAPRLRARESAFE
FT                   PLGQALERHVLVQFPYLKPGESASRVRTVAPLALVQHQGRWHMRGMDQEAGEARTFLLS
FT                   RIVGPVKLTALGFRQEERDFAAQALAELDAIWAANVAEIEVTAGTDAATRLGKRSGDAV
FT                   PIAGDGEALRLAVNFSDINILADQLASFGPEVLVIAPEELREKVLGRLRTTAAAHEGSV
FT                   HG"
FT   gene            836366..837319
FT                   /locus_tag="Lxx08310"
FT   CDS_pept        836366..837319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx08310"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08310"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88733"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFW2"
FT                   /protein_id="AAT88733.1"
FT                   /translation="MQAQDKLAFLLALVPYLMDRDRVSVAEAAQHFGVDQESVRDAVRL
FT                   IAVSGIPGETTAYQPGDLFDIAWDDFEDNDQIVLTHQVAIDDSPRFSSREAAALIAGLQ
FT                   YLTALPENADRDVVGSLMAKLARGASAAPSQVAVARSESDEALATIRDAVVAGAQLQFA
FT                   YRNSRGERERRRVDPLRVESIDQDWYLRGWDHLRTAIRTFRLDRIDDLVVTDEPIAYRP
FT                   GDVTLPESLFEGAPDDLLVTIEVSASAVPLIEDYIPKNAFREERDGRLRTSMRVAHFHG
FT                   LKRLVAGLSGVLTVLDPPEARRVVAEWGRAGARRYR"
FT   gene            837682..837912
FT                   /gene="tatE"
FT                   /locus_tag="Lxx08320"
FT   CDS_pept        837682..837912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatE"
FT                   /locus_tag="Lxx08320"
FT                   /product="Sec-independent protein translocase protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08320"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88734"
FT                   /db_xref="GOA:Q6AFW1"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AFW1"
FT                   /protein_id="AAT88734.1"
FT                   /translation="MLGGLTGWHLLIILAVILLLFGAPKLPALAKSVGQSMRIFKGEVN
FT                   EMKKDGDKDKGEGGSTAPATDTGASSEQNSK"
FT   gene            837956..838708
FT                   /gene="tatC"
FT                   /locus_tag="Lxx08330"
FT   CDS_pept        837956..838708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatC"
FT                   /locus_tag="Lxx08330"
FT                   /product="sec-independent protein translocase protein TatC"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08330"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88735"
FT                   /db_xref="GOA:Q6AFW0"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFW0"
FT                   /protein_id="AAT88735.1"
FT                   /translation="MSLAEHFIELRKRLFRSAIALFAGAIIGWFLASPVMNAMRGPVTD
FT                   IAAQQGREAMLNYDSITGAFDLKMQMAITIGAIISSPVWLWQIWAFFVPALTRRELKYA
FT                   FGFFFTAVPLFIAGGFVGWLLVPHIVSLLTSFAPEQDSAIIGAKTYFDFIMKLVIAVGV
FT                   AFVLPVFLVLLNFVGVLSAKTIIASWRWAMIAIVLFTAIATPAADVLSMFLLAIPMVVL
FT                   YFGAYGVSWLHDRRAVKAAERLEANLPV"
FT   gene            838765..841200
FT                   /locus_tag="Lxx08340"
FT   CDS_pept        838765..841200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx08340"
FT                   /product="ATP-dependent RNA helicase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08340"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88736"
FT                   /db_xref="GOA:Q6AFV9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012961"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFV9"
FT                   /protein_id="AAT88736.1"
FT                   /translation="MTDQQQLSPAERFAASHQRARQPLLETFLTGLGFDLDPFQREACT
FT                   CLENGRSVLVAAPTGAGKTIVAEFAVFLAMRQANAKVFYTTPMKALSNQKFQEFQDTYG
FT                   PESVGLLTGDTNINSHARIVVMTTEVLRNMLYADSDLLGDLAYVVMDEVHYLADRFRGA
FT                   VWEEVIIHLPPAVRMVSLSATVSNAEEFGDWLQAVRGDTDVVVSEERPVPLEQHILMRS
FT                   KLIDLFDSSGLAAANRVNPELVQMARSGGRVLSSRQRRDIGRYHSRGGRPDSFRMNRAE
FT                   IVRLLDEHNLLPAIFFLFSRNGCDAAVRQTLRAGVRLTEQRERDDIRSIVEERCRTLMD
FT                   EDLAVLGYWEWLEGLEHGVAAHHAGMLPAFKEVVEELFRRKLVKVVFATETLALGINMP
FT                   ARTVVLEKLEKFNGESRVPITPGEYTQLTGRAGRRGIDVEGNSVIQWEDGLDPQSVASL
FT                   ASRRSYPLNSSFRPTYNMAVNLIDQFGRQRTREILESSFAQFQADRAVVDLARKVRQQE
FT                   ESLAGYEKAMTCHLGDFREYSGVRRELTDLERKGQRLDSASRADRDRRQRQLTELRKRM
FT                   REHPCHRCSDREQHARWAERWWKLKRETDLLSAQIQSRTGAVAKVFDRVSDVLDELGYL
FT                   VVEDGVTKLTVHGRTLKRIYGERDLLVAECLRRGTWKELDAPSLAAMACALVFEPRRDD
FT                   GLGHDRALPRGAFLPALDKTTDLWARLDDRERENRLPGSEPPSTALALAMHQWARGSGL
FT                   DAVLREADMAAGDFVRWTKQTIDLLDQLSLVAQGNLGRTARQALEAIRRGIVAYSSVA"
FT   gene            841193..842791
FT                   /gene="lnt"
FT                   /locus_tag="Lxx08350"
FT   CDS_pept        841193..842791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lnt"
FT                   /locus_tag="Lxx08350"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08350"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88737"
FT                   /db_xref="GOA:Q6AFV8"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFV8"
FT                   /protein_id="AAT88737.1"
FT                   /translation="MPERRTERDALGSRLVTRSPRAPLPLWLAILLAATAGPVLDAGFP
FT                   DRDWWPLTFAGIAMALLALPGRRAGSAFLIGWLTGETFYLVHVSWSALYLGPVPWVALS
FT                   TLEALLWGVGGILIALALRWVPRAFPTRWGRLGLVPVVVSGLWVLREYATGNWPYGGFS
FT                   WGRVAESQSESPLAPLVAWLGISGLGFAMVWLVALLIELRFAAEVRRVQRAALAGTAVA
FT                   LVLAIPAWPMPTHGTIRIAAVQGNGPAGYFDTAPAGAVLATQIEETQRISPAERVDLVV
FT                   WPEGSALPDPTRDPDAATVLDALSRRYGAPFLVGTITDRDGEYFNSSLKWEAGKGAVDH
FT                   YDKKHPIPFGEYVPDRAFWRLFAPSLIELIARDYTPGTRANTIDIDGVRVGVSICFDIV
FT                   DDQLLTDMMRDGAQVILAQSNNADFGQTDENQQQLAIARLRAIESGRSLVNISTVGSSQ
FT                   IIGPDGRTISEIPPFTAGHMVADVPLGTTTTPAALLSRGIEFLAAGLGLFGLLVAFGGR
FT                   NNTAPEARRPLPPMR"
FT   gene            complement(842816..843187)
FT                   /locus_tag="Lxx08360"
FT   CDS_pept        complement(842816..843187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx08360"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08360"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88738"
FT                   /db_xref="GOA:Q6AFV7"
FT                   /db_xref="InterPro:IPR025182"
FT                   /db_xref="InterPro:IPR038638"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFV7"
FT                   /protein_id="AAT88738.1"
FT                   /translation="MADRSLRGMRLGAQSLQSEAGVVYSPRSRYTYQCPSCGKETEVVF
FT                   AAEAEAPDAWECRHCGHEALRLVDDKPVEIDHADVKVPRSHWDMLLERRTRAELEELLE
FT                   ERLHYLRSRRGTGEHKHSA"
FT   gene            complement(843959..844750)
FT                   /locus_tag="Lxx08370"
FT   CDS_pept        complement(843959..844750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx08370"
FT                   /product="secreted protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08370"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88739"
FT                   /db_xref="GOA:Q6AFV6"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR018080"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFV6"
FT                   /protein_id="AAT88739.1"
FT                   /translation="MTVVISVIVVVITIFVLVTLFRAIRIIPQARAGVVERLGRYHKTL
FT                   TPGLNVVVPFIDKVRPLIDMREQVVSFPPQPVITEDNLVVSIDTVVYFQVNDARAATYE
FT                   IANYLGAVEKLTTTTLRNVVGGLNLEEALTSRDNINGQLRVMLDEATGKWGIRVARVEL
FT                   KAIEPPLSIQDSMEKQMRAEGEAKAIETVFGAIHEGNPDNLLAYQYLQTLPKLAEGQAN
FT                   KLWIIPSELTEALKGIGTAFAPKPGGEVSTGAATPPETPVP"
FT   gene            complement(845049..845210)
FT                   /locus_tag="Lxx08380"
FT   CDS_pept        complement(845049..845210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx08380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08380"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88740"
FT                   /db_xref="GOA:Q6AFV5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFV5"
FT                   /protein_id="AAT88740.1"
FT                   /translation="MLTLDFVFLMIAIGSLGGLVSGLCGAPWLLQLIVTATISVLLIFS
FT                   CAHRCCTV"
FT   gene            845383..846153
FT                   /gene="fabG"
FT                   /locus_tag="Lxx08390"
FT   CDS_pept        845383..846153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="Lxx08390"
FT                   /product="dehydrogenase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08390"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88741"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFV4"
FT                   /protein_id="AAT88741.1"
FT                   /translation="MSNPLADGSLAGKRALVTGSSRGIGAETVQYLAEAGASVAINYRN
FT                   KEARAVKLAEALRERGASALTVGADLTDPASIAAMFSAVAGEWGGLDILVLNASGGMES
FT                   GMAEDYAMRLNRDAQVSVLNAALPLLGPGSRVVFVTSHQAHFIRTTPTMPEYEAVALSK
FT                   RAGEDALRALLPELTAKGVEFVVVSGDMIEGTITATLLNRLNPGAIDARKEAAGKLYNV
FT                   SEFAAEVAEAVVEPVPADHTRLVGDVSSFEPIAG"
FT   gene            846150..848177
FT                   /gene="yuxL"
FT                   /locus_tag="Lxx08400"
FT   CDS_pept        846150..848177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yuxL"
FT                   /locus_tag="Lxx08400"
FT                   /product="acylaminoacyl-peptidase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08400"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88742"
FT                   /db_xref="GOA:Q6AFV3"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFV3"
FT                   /protein_id="AAT88742.1"
FT                   /translation="MRPADLGLLTSVSAPAVHPGGERAVVSVTHPSLEADAEVGQLWTI
FT                   PLAGHAAPRRLTRGFRDSVPRFSPAGRLLAFLRAGPNAPPQLHVVDAAGGEPVAVTDRR
FT                   LGVSEFVWAPDGRTLAFVSRQPEQGRYGTVEGIGPDAEPARRIVTQNYQANGLGYTNDR
FT                   RAHVFVAEVPDVWAEPGVQPAPEPDGSAGPPLAVPEAWQLTDGDGDDTTIAFSPDGATL
FT                   AFVSARHGTARHARSRPALECLPRPGGRLGRACRRDRNTRGLLGRGGRVRAERHPLLLG
FT                   AGGGGERPRLRRSQHRPVRRGCAGDAAPPPRRLTDSETVDLTESDIVAFRDDCVLVRDR
FT                   RRGALVLTAVSAAGKAERLTDEFAVVGGVGTAGETIVVSVSDARTAGEVAVLGVDGPRQ
FT                   LTDFSRELRAAGVIVPRELTVTGRDGYPIHGWVVVPEGVGPHPVLLSIHGGPFASYGPA
FT                   LFDEAQVYASAGYAVAMCNPRGSAGYGQGNGRVIRQRMGTVDRSDVLDFLDGAVAAVPG
FT                   LDAGRVGVMDGVLWRLPQRPDDRTRPPLRRGDRGAGYLDPEGFVGTRDIGSFFSDEYIG
FT                   ADPDRIRSQSPQAAVARVKTPTLVMHSAADLRCPLGQAERYYAALKRNGVDAELVIFPA
FT                   RTTNSAVAAGRGTGASASRSSWSGGGGTCPWGSTAEGYAR"
FT   gene            complement(848112..849617)
FT                   /locus_tag="Lxx08430"
FT   CDS_pept        complement(848112..849617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx08430"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08430"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88743"
FT                   /db_xref="GOA:Q6AFV2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFV2"
FT                   /protein_id="AAT88743.1"
FT                   /translation="MHGERTPPDIAALSAALASAPAHRCRPRLNAPVTLALLSWTQGAQ
FT                   EHARERSKEATVSSAENTPTTVDRNDIPQREAGTQRPARPPRTARLVGVDLARFLAVVG
FT                   MVFAVLCGVSVTLAYRKYLEAGDILAAQIALLTRGALLVLIGLVLTIPLQLAAIVLVYL
FT                   GVAMWLSVPFLRVRGWVVALVAGLLTMIVPPVNWLVRQQLQLAGPQPMEQGTAVDLSRG
FT                   TMSLFDVAAHPVEAVRDVLLTGTYPVSTWLVYLLVGILIGRALLSAVATGRGKRFAAIL
FT                   AGGGAALAAFSIAVSWCVYYGFARAQQIQALGSETFSATGLTVDEIILGSSQGGPSGAW
FT                   SSLLLDAPHSGTVLDVTRGVGIAGAIIGLCLLACWALPRIPWALRPVLAAGAAVDRVLH
FT                   PHPPQRRPVPPGRRCHRPDFRQRAGTPQSVAGVGRAEHSSRCHPRGRDTAGSAPEERTV
FT                   GSARRRQRDSCRSPGTAPRRPASAGIALSRAPPRAGAAPTTPG"
FT   gene            850162..853473
FT                   /pseudo
FT                   /gene="rsaA"
FT                   /locus_tag="Lxx08450"
FT                   /note="similar to hemagglutinin-related protein"
FT   gene            complement(853644..853982)
FT                   /locus_tag="Lxx08452"
FT   CDS_pept        complement(853644..853982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx08452"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08452"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88744"
FT                   /db_xref="GOA:Q6AFV1"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFV1"
FT                   /protein_id="AAT88744.1"
FT                   /translation="MTAHAATVTHAAAMARFGHALSDTTRVGVLLTLREAPAFPSDLAE
FT                   ALGVSRQVMSNQLACLRGCGLVEAIPEGRRTWYRLADSHISPALDELLRVTLFIEPGCC
FT                   AGEECHCA"
FT   gene            complement(855421..855786)
FT                   /gene="tnp"
FT                   /locus_tag="Lxx08457"
FT   CDS_pept        complement(855421..855786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnp"
FT                   /locus_tag="Lxx08457"
FT                   /product="transposase, ISlxx4"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08457"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88745"
FT                   /db_xref="GOA:Q6AEV8"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AEV8"
FT                   /protein_id="AAT88745.1"
FT                   /translation="MFMVSPVTARKWAARFRAEGTGGMTDRSSRPRSMPTRTPLPVLKR
FT                   IVRARWRRRLGPVQIAGELGLPASTVHAVLVCCRINRLCTIDRVTGEPIRRYEHDHPGS
FT                   LIHVDVTKFGNIPNGGG"
FT   gene            856114..856395
FT                   /pseudo
FT                   /locus_tag="Lxx08460"
FT                   /note="similar to transposase"
FT   gene            856609..857295
FT                   /pseudo
FT                   /gene="frnE"
FT                   /locus_tag="Lxx08470"
FT                   /note="similar to dithiol-disulfide isomerase"
FT   gene            857561..858787
FT                   /gene="nifR3"
FT                   /locus_tag="Lxx08490"
FT   CDS_pept        857561..858787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifR3"
FT                   /locus_tag="Lxx08490"
FT                   /product="transcriptional regulator, NifR3/Smm1 family"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08490"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88746"
FT                   /db_xref="GOA:Q6AFU9"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFU9"
FT                   /protein_id="AAT88746.1"
FT                   /translation="MLTTTLTPRATLRGDTPSAGTAAKLAIGPLALDVPVVLAPMAGIT
FT                   NTAFRRLCREFGAGLYVSEMITSRALVERTPESLRLIAHHESETPRSIQLYGVDPKTVR
FT                   EAVTLLVAEDRADHIDLNFGCPVPKVTRKGGGAALPWKLGLFREIVEGAVAAAGDIPLT
FT                   VKMRKGIDSDHLTYLEAARAAEGAGVASIALHARTAAEFYSGHADWPAIRTLKETITGT
FT                   PVIGNGDIWSAADAVRMVEETGCDGVVVGRGCLGRPWLFGDLAAAFKARAGELSADEAA
FT                   AAQAHPALGEVAATFRRHAELLVEFFDSEERGCRDIRKHVAWYFKGYPVGGDLRASLAT
FT                   VETLAHLDDLLATLDADQEYPGAAAEGQRGRAGSPKRPALPECWLKSRELDVEGRFELS
FT                   EAEAHNSGG"
FT   gene            858777..860039
FT                   /gene="dgt"
FT                   /locus_tag="Lxx08500"
FT   CDS_pept        858777..860039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgt"
FT                   /locus_tag="Lxx08500"
FT                   /product="deoxyguanosinetriphosphate triphosphohydrolase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08500"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88747"
FT                   /db_xref="GOA:Q6AFU8"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR023023"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFU8"
FT                   /protein_id="AAT88747.1"
FT                   /translation="MVDSRKAMAGYREHDRERWLPEQHSSRRSDFARDRARLLHSSALR
FT                   RLAAKTQVLSPTAGLDFARNRLTHSLEVAQVGRELATSLGLDPDIVDTACLAHDIGHPP
FT                   FGHNGERALNAWAADIGGFEGNAQTLRLLTRLEPKTFGRDGHPFGLNLTRASLDASCKY
FT                   PWPATSSVADPSGRAKFGFYTDDRAVFAWLRDGAPDRQRCIEAQVMDLSDDIAYSVHDF
FT                   EDAVVNGYIDVAALGSRVDHDDLVRSMYEWIGGEFSHDELIDAFDRLDNLDIWLDSWDG
FT                   SRRSQARLKNLTSQLIGRFAHAAVHATRATAGSADLLRFGADVVVPRDICAEIAVLKGI
FT                   VATFVMSHNTRQPIYAQQREILSTLADLLYARGLTALDSGFQEDWRLATTDAEQKRVVV
FT                   DQVASLTDQSALSWFDRLAQR"
FT   gene            860119..860928
FT                   /locus_tag="Lxx08510"
FT   CDS_pept        860119..860928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx08510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08510"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88748"
FT                   /db_xref="GOA:Q6AFU7"
FT                   /db_xref="InterPro:IPR025557"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFU7"
FT                   /protein_id="AAT88748.1"
FT                   /translation="MSTPQPPSDDDHQPSPATDAAEADETVTPAPEKHTAGTPDKEPAA
FT                   KAGAPAGKPAAVVPAKRTPAPRKRPPRTTPSEKARNTDGEAPEILDAMLATAAPPADST
FT                   AVAGTATAAEDRSAASETAVFTADAPGLPSGAGAARADPPQAAPGQPGYGRTVNDFAER
FT                   LDDSRFFSSLFDFTFTSYVTRKLAGPVYVVGLMLIGLGIVVGFANSLGIAIATSSPVGA
FT                   FVFLLGVLVTLVAAVLSVLLLRVTIEVFCAIIEIAQNTRPRHRPPRE"
FT   gene            860957..862819
FT                   /gene="dnaG"
FT                   /locus_tag="Lxx08520"
FT   CDS_pept        860957..862819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaG"
FT                   /locus_tag="Lxx08520"
FT                   /product="DNA primase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08520"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88749"
FT                   /db_xref="GOA:Q6AFU6"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFU6"
FT                   /protein_id="AAT88749.1"
FT                   /translation="MAGRIRQSDIEEVKARTNIADIIGDYVSLKPGGVGSLKGLCPFHD
FT                   ERSPSFNVRPGVGRYHCFGCGEGGDVYEFLVKLDHVSFAEAVERLAARIGFQLHYEEGS
FT                   GGPRESSGNRARILAANTAAEEFFAGTLGVPEADPGRRFLGERGFDAIAAQRFGVGYAP
FT                   KSWDELTNHLRGKGFTPDELLAAGLVSQRDRGVYDRFRGRLVWPIRDVTGQTIGFGARR
FT                   LLEDDNGPKYLNTPETPVYKKTQVLYGLDLAKRDIARDDQVVVVEGYTDVMACHLAGIT
FT                   TAVATCGTAFGVDHIKTIRRVMVDDSSSGSVIFTFDPDAAGQKAAARAFGEERRFSAQT
FT                   YVAVGPDGLDPCDLRLAKGDDAVRRMIDGKKPMFEFMIRQVVERYDLDSVEGRTAALRA
FT                   GAPIVATIRDPASQNGYARELARLSGAELEDALRAVRSAQLSGRGEQQSDQSAGMTAVR
FT                   ESAPAAPIVVAGTAPADPTQRTERESLMVLLQLPGEVGSERAARALQVPFANPTHAVIR
FT                   DAMASQLATLGQPGWVDRVQAEVPTAYAPTVNALAVGVLHAGSDPGRYARSVLDGLIDR
FT                   DLLREKAVLTARLARTDAQDAEHRRSLQIALASIDSERMRLRSD"
FT   gene            863022..864638
FT                   /gene="oppA"
FT                   /locus_tag="Lxx08530"
FT   CDS_pept        863022..864638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppA"
FT                   /locus_tag="Lxx08530"
FT                   /product="ABC transporter, solute-binding protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08530"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88750"
FT                   /db_xref="GOA:Q6AFU5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFU5"
FT                   /protein_id="AAT88750.1"
FT                   /translation="MRSAHNGGRRLFAASAAFAATVLLLAGCSGSGSGGGTLTVGTTDK
FT                   VTSIDPAGSYDNGSFAVMNQVYPFLVNTPYGSPDVKPDIAESASFTSPTQYTVKLKPNL
FT                   RFANGHDLTSSDVKFTFDRQLKINDPNGPASLLGNLDSVSAPDKTTVVFTLKVANDQTF
FT                   PQVLSSPAGPIVDEQVFSADKVTPDSTIVKGHAFAGQYDIANYDFNNLIAYTANPDYQG
FT                   LLGKPVTSKVNVKYYAESSNLKLDIQKDAIDVAFRSLSATDIDSLSSNKSVKVVKGPGG
FT                   ETRYIVWNINTMPYGATQPAADAAKALAVRQAAADLIDRPTIAKQVYKNTYTPLYSFVP
FT                   EGLTGATTVLKDRYGDGNGGPSLDKAKATLQAAGVTTPITLNLQYNPDHYGPSSGDEYA
FT                   LVKEQLENGGLFTVNLQSTEWVQYSKDRVKDLYPAYQLGWFPDYSDADNYLSPFFTKDN
FT                   FLANHYDSPEIQQLITQQVGTADKVERTKLIEEIQAKAGADLPTLPLLQGAQVAVVGKD
FT                   VKGTDKTLDASFKFRYAVLSK"
FT   gene            864732..865829
FT                   /gene="dppB"
FT                   /locus_tag="Lxx08540"
FT   CDS_pept        864732..865829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppB"
FT                   /locus_tag="Lxx08540"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08540"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88751"
FT                   /db_xref="GOA:Q6AFU4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFU4"
FT                   /protein_id="AAT88751.1"
FT                   /translation="MTTTVRGPAAPTAPGPERTRRRRRPGGGLGRYILIRALLIVPTIF
FT                   ILVTVVFFLMRSTGDPLTAALGGKLPPAQLQERIHQAGYDRPLLIQYVEYLGQLLRGDF
FT                   GTTFTDHLPVTQVLLTYSAATLELAFYALIVAFVVGIPLGLLSAAFRDRWGDASLRVFA
FT                   ILCYATPVFFAGLVMKLVFSIWLDWLPVAGRASTGSEIEMQTLDSKTGIYLIDALQTGD
FT                   PAVVGDVLLHAVLPAVTLGLLTAGIFLRLVRTNVIGTLSTDYVDAARSRGVGEYRLVRK
FT                   HAYRPALIPIITVIGLQIALLLGGAILTETTFEWKGLGFQLSHYLQARDFVAVQGLVVL
FT                   LAVIVAVTNFIVDIIAALIDPRVRY"
FT   gene            865912..866886
FT                   /gene="dppC"
FT                   /locus_tag="Lxx08550"
FT   CDS_pept        865912..866886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppC"
FT                   /locus_tag="Lxx08550"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08550"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88752"
FT                   /db_xref="GOA:Q6AFU3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFU3"
FT                   /protein_id="AAT88752.1"
FT                   /translation="MLVAGLVLTGLFLVIAAFAPVIAPYGFAQLKGADGRQFGSQEPPS
FT                   VAHIWGTTVGGYDVFSRVVWGAQTAVVVIVIAVLLSIFAGVILGLVSGYFGGWVDRVLV
FT                   VIADAIYAFPSLLLAIVMAIVISGGQSSLWGGILAAAISITVVYIPQYFRVIRAEAVRI
FT                   KAEAYVESARVIGASDVRIMFRHVLRNSTRTLPLIFTLNSSEAILTLAALGFLGFGIEP
FT                   TAAAEWGYDLNKAVADVTSGIWWTAVFPGLAIVLVVLGITLVGESLNDLADPRLRGRRR
FT                   AAEASGEVAETSVVPGGPLSAPGGIEGLDGRESIDRHGIEVKP"
FT   gene            866883..868571
FT                   /gene="dppD"
FT                   /locus_tag="Lxx08560"
FT   CDS_pept        866883..868571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppD"
FT                   /locus_tag="Lxx08560"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08560"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88753"
FT                   /db_xref="GOA:Q6AFU2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFU2"
FT                   /protein_id="AAT88753.1"
FT                   /translation="MNDVVQLDNLQVTFATDAGPVKAVDGVSLSVSPGEVLAIVGESGS
FT                   GKTVTAKTILGLLPATATASGAVILRSKDRQSEAAILSLSKRELREIRGTDVAMVFQEP
FT                   STALNPVYTVGWQIAEGLRAHGKLSKKAAREKAVDILRRVGIPDPEKRVKHYPHQFSGG
FT                   QKQRIVIAMAMVLNPGLIVADEPTTALDVTVQAEILDLLRRCRDEFGVAIVLITHSMGV
FT                   VADLADRVAVMYQGKLVEEADVYTLFSAPQADYTRRLLAAVPTIGQGRIATQERARARA
FT                   EQPGVAPVVQARDLRVRYPGRLGRPGYVAVDGVSFDIRPGEVLGLVGESGSGKTTIGRA
FT                   IGGLNRVTGGSLQVLGIEMNGVREREFRRVRSEIGFVFQDPASSFNPLLSIADCVAEPL
FT                   VVHGKASSPADARARVDDLLEAVQLPRGYGDRFPHELSGGQRQRASLARALALEPALLI
FT                   ADEPTSALDVSVQARVLELFAELQREFGFASLFISHDLAVVDLLADRIAVLHRGTLVEE
FT                   GTGDQVLGSPREEYTQRLLASLPVPDPAEQVDRRAALQALRGGSA"
FT   gene            868581..869426
FT                   /gene="oppF"
FT                   /locus_tag="Lxx08570"
FT   CDS_pept        868581..869426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppF"
FT                   /locus_tag="Lxx08570"
FT                   /product="oligopeptide porter"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08570"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88754"
FT                   /db_xref="GOA:Q6AFU1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFU1"
FT                   /protein_id="AAT88754.1"
FT                   /translation="MSSEPAIVVSDLSVEYPARGASASCVALRGVDFRLESGQSLGVLG
FT                   ETGSGKSTLAAVLSGHGLPLKSCDPGPRIAGGQATVLGRPLRKAKKRDIAEVTFHVGYL
FT                   PQDAGNTLEPSLTVQDNVSLPILERDRHFSRRAAGERAATTLDTVHLPLSVLSKYPYEL
FT                   SSGQRQRVALARALVLGPRILVADEPTAGIDATVRDAVIDLLGQLREQAEFTAVIVSHD
FT                   LAVLRRATDVSLVLQGGRPVGYGPIEGVLADPAHPFVQRLARALGRTQRRTERRPQRAS
FT                   "
FT   gene            869554..870462
FT                   /gene="serA"
FT                   /locus_tag="Lxx08580"
FT   CDS_pept        869554..870462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA"
FT                   /locus_tag="Lxx08580"
FT                   /product="phosphoglycerate dehydrogenase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08580"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88755"
FT                   /db_xref="GOA:Q6AFU0"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFU0"
FT                   /protein_id="AAT88755.1"
FT                   /translation="MLPTAEPAFVAAVEAGGGTVEPLSDRTRGVVWLSNRDAKDFPPVL
FT                   EAHPGIGWVQLPFAGVDAFGDILAKEDRSRLIWTSAKGAYAQPVAEHALALTLVLLRVL
FT                   PQRVRAMSWGTVQEGTSLYGLDVAIVGAGGIARELLRLLEPFGVRATIVRRSAEPVPGS
FT                   AVTTTAERLVEVLPSADVVVLAAALTGGTRRLIGAREFAAMKSTAVLVNIARGGLVDSD
FT                   ALVTALRTGAIAGAGVDVTDPEPLPDGHPLWAEKNCIVTPHQADTAEMVAPLLAERIRL
FT                   NVQAFLGSGRFVGLVDPGAGY"
FT   gene            870541..870619
FT                   /gene="Asn"
FT                   /locus_tag="Lxx08590"
FT   tRNA            870541..870619
FT                   /gene="Asn"
FT                   /locus_tag="Lxx08590"
FT                   /product="tRNA-Asn"
FT   gene            870880..871746
FT                   /pseudo
FT                   /locus_tag="Lxx08600"
FT                   /note="similar to two-component system, sensor protein"
FT   gene            complement(871765..872331)
FT                   /gene="def"
FT                   /locus_tag="Lxx08610"
FT   CDS_pept        complement(871765..872331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="Lxx08610"
FT                   /product="polypeptide deformylase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08610"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88756"
FT                   /db_xref="GOA:Q6AFT9"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFT9"
FT                   /protein_id="AAT88756.1"
FT                   /translation="MAVLPIRITGDRVLHTRADEVTAFDRELRTLVAEMFDTMDEAPGV
FT                   GLAGPQVGVPLRLFVYGWTDDDEVLHRGVAINPVLWQSPLETGPLDEDAECEGCLSFPG
FT                   ERFPLRRAERVILQAVDLEGAPFEVRTEGWLARIFQHECDHLEGVLYVDRLGHPFGKQA
FT                   LKTQRKNSWGVPGLSWLPGRDHLED"
FT   gene            872403..873338
FT                   /locus_tag="Lxx08620"
FT   CDS_pept        872403..873338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx08620"
FT                   /product="Integral membrane protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08620"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88757"
FT                   /db_xref="GOA:Q6AFT8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFT8"
FT                   /protein_id="AAT88757.1"
FT                   /translation="MAYQPSQLLGIPVALIGACFLSVGAQLQHHGVAKVEAQTQNAGDG
FT                   LTLKQIGLLLARPSWVIGTLLLGLAIVFQLVSLKLSPLILVQPLGVVGLVITSVLNARV
FT                   SGVKLNKQSIIAVGLCVGGVGAFVLIAAVFAKDLPVTGQALIVILIILAVVLLLFGFAF
FT                   WFLRYRFKAIMYIVGAGVLYGFVATLAKVAIDRISNREWDWLLVACIVALLAAAGLGAY
FT                   FVQNAYSSGPPDLVIAGLTVIDPMIAVTIGIVVLNETAGAPWWAMLGFAITGAVAIFGV
FT                   FQLARHHPQSGGEAPIPDAAAAGVGESRLE"
FT   gene            873429..874685
FT                   /locus_tag="Lxx08630"
FT   CDS_pept        873429..874685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx08630"
FT                   /product="glucosyltransferase"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08630"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88758"
FT                   /db_xref="GOA:Q6AFT7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFT7"
FT                   /protein_id="AAT88758.1"
FT                   /translation="MPEPSGPPPQPLTIVMGCDTFSPDVNGAARFAERLAAGLVERGHD
FT                   VHIVAPAASRRHGTWVEEHVGRKLTAHRLRSWRWYPHDWLRFALPWTSKANARRVLDEV
FT                   KPDVVHLQSHIVIGRGLAYEAQKRGIRIVATNHVMPENIIEFTRLPTFLHHTFVSLAWK
FT                   DARKSFDRAESITTPTRRAAEFLEKATGLRGVHAISCGIDAHNYTPDFAPRTANRILFV
FT                   GRVTGEKQIDVLLKAVKLLPDALDTKLEIVGGGDQFKNLQALAETLGIADRVAFLGYVT
FT                   DEELRAAYTRATVFAMPSIAELQSIATMEAMASGLPVVAADAMALPHLVHDGENGHLFR
FT                   PGDAQDLADKLASVLTLPQEELDELKNASLRIVASHDVQTTISTFESLYRGEPVADPVT
FT                   ETASEPAARSDPKAAGTGR"
FT   gene            874676..874755
FT                   /gene="Met"
FT                   /locus_tag="Lxx08640"
FT   tRNA            874676..874755
FT                   /gene="Met"
FT                   /locus_tag="Lxx08640"
FT                   /product="tRNA-Met"
FT   gene            complement(874916..875401)
FT                   /locus_tag="Lxx08650"
FT   CDS_pept        complement(874916..875401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx08650"
FT                   /product="MutT-like domain protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08650"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88759"
FT                   /db_xref="GOA:Q6AFT6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFT6"
FT                   /protein_id="AAT88759.1"
FT                   /translation="MAVRSAGILLYRRGETSVEVWIAHMGGPFWAQKDEGGWTIPKGLV
FT                   EDGEDDLAAARREFAEEMGSPAPEADYERLGEFKTSGKTIVVFAAEAAFDPVEIHSDTF
FT                   ELEWPPRSGRVQRFAEVDAAGWHPVEDARLKLARGQRPVLDALLRTGGDADRLTPSS"
FT   gene            875457..875936
FT                   /gene="mutT3"
FT                   /locus_tag="Lxx08660"
FT   CDS_pept        875457..875936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT3"
FT                   /locus_tag="Lxx08660"
FT                   /product="MutT/nudix family protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08660"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88760"
FT                   /db_xref="GOA:Q6AFT5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFT5"
FT                   /protein_id="AAT88760.1"
FT                   /translation="MPTNVGKVNFGDGWVEGPNGERFWGRFGAAGLLVHDARRGVLLQH
FT                   RAEWSHFGGTWGLPGGARHEGESAVEGALREAAEETAVPADALELLFTCVLDLGFWSYT
FT                   TVVAEVVRPFEARIADVESIELRWAPLAEVAELPLHPRFGAAWPELHARLMALTG"
FT   gene            876002..877714
FT                   /locus_tag="Lxx08670"
FT   CDS_pept        876002..877714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx08670"
FT                   /product="DNA polymerase I"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08670"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88761"
FT                   /db_xref="GOA:Q6AFT4"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFT4"
FT                   /protein_id="AAT88761.1"
FT                   /translation="MNVGGPADVGGTRENERMHIILDRSSDGLVAAMPEDGPAERLDTG
FT                   GLREFVRLHERGDDHPRWVWSETRAWYPALLAAGVRVERCADLRLSHVILRHSALSAAS
FT                   AIATAPPGPWDATIEAEEPPSAAHTALFELDQPTPREPPSAAEFAAQQDAVAASANPGR
FT                   LRLLLAAESVGALIAAEMRFAGLPYSAERHDALLTDLLGPRPAYGGPVVLEDLAAQIRA
FT                   ALDSPDLNPDSPPALLRALQRAGLRVSSTSSWELRELDHPVIEPLLHYKKLARLLTANG
FT                   WSWLESWVQDGRFRPDYVPGGVVTGRWATRGGSALQLPKQLRGAVVADPGWKLVVADAA
FT                   QLEPRILTGLAQDQRMAAAGRGQDLYTGIVSAGAVTERAQAKVAMLGAMYGATTGESGR
FT                   LMPRLARAFPRAVRLVEEAARAGERGEAVTSHLGRSSPRPGGSWQETQSAASTAESTPA
FT                   DERRARAQARDWGRFTRNFVVQASAAEWALCWMAELRNRLTALAPGRPLTEAPHLVYFL
FT                   HDEVIVHTPDALAEAVGEAVSAAAARAGTLLFGGFPVEFPVTAAVVDSYAEAK"
FT   gene            877773..878624
FT                   /locus_tag="Lxx08680"
FT   CDS_pept        877773..878624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx08680"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08680"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88762"
FT                   /db_xref="InterPro:IPR012467"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFT3"
FT                   /protein_id="AAT88762.1"
FT                   /translation="METMTDTAPASDPRDTLARYRRRREQAVVAPKGNLALVNTQWITG
FT                   APGGEQTIWGVPGRWAPLPAGHSGLRVTAAAADGITVDGALVDGSAIVRGKDDPNPSEI
FT                   VFSDTVTGFVIASETGEYALRVWDANSEAIRDFGSIDAFPFNTEWIVQAAFRPIEGGKI
FT                   VGFEHLKDDGATRDMVIPGEIAFAKYGVDYSLAAFQAGRALQLVFADSTNGDSTYAVGR
FT                   FLFVAPNSDGTVTLDFNLAVLPPCAFSYNFNCPLPPAQNRFAVPIEAGEKNVLNKAGGL
FT                   LH"
FT   gene            complement(878637..879224)
FT                   /locus_tag="Lxx08700"
FT   CDS_pept        complement(878637..879224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx08700"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08700"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88763"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFT2"
FT                   /protein_id="AAT88763.1"
FT                   /translation="MQFGFLAILTQGPAYGSQLQSEFLLRAAHRRQLNAGQVYSTLERM
FT                   VRQGLVRPDGKTEDGLPLYALTDAGSAQAHTWLTGGSLNARPDWEEMQDQVLIASSIAG
FT                   AKPAAVVGGYRAVLAERIRGLSHDADSRALLTANRAAELGAKAALAWLDEVAATLAAHP
FT                   DALVQPRSPERPRRGRRPSAATAERSFPAALR"
FT   gene            879393..879896
FT                   /locus_tag="Lxx08690"
FT   CDS_pept        879393..879896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lxx08690"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08690"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88764"
FT                   /db_xref="InterPro:IPR021491"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFT1"
FT                   /protein_id="AAT88764.1"
FT                   /translation="MTARASRGILYVHSSPSALCPHIEWAVGRSLGRAVNFTWEQQPVL
FT                   KGSQRTEFFWDGPSGTGALLATALRGWEHLRYEVTEDAGLGADGGRWMHTPDLGVFFAQ
FT                   TDTAGNTVVPEDRVRSAMEIAGSNPLELHRELRLALGQAWDDELEPFRHAHDDTSVIWL
FT                   HKVG"
FT   gene            complement(880341..880748)
FT                   /gene="glbO"
FT                   /locus_tag="Lxx08710"
FT   CDS_pept        complement(880341..880748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glbO"
FT                   /locus_tag="Lxx08710"
FT                   /product="globin-like protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08710"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88765"
FT                   /db_xref="GOA:Q6AFT0"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR019795"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFT0"
FT                   /protein_id="AAT88765.1"
FT                   /translation="MTGIPVGPPAGPTFFEQAGGHDTFRRLVDAFYRGVAADPVLRPMY
FT                   PEEDLEPAAERLTLFLEQYWGGPAAYSEQRGHPRLRMRHLPFRVNPDARDRWLMNMRAA
FT                   VLELALPPLQEETLWSYLERAAFAMVNTFEE"
FT   gene            complement(880750..881922)
FT                   /gene="mscS"
FT                   /locus_tag="Lxx08720"
FT   CDS_pept        complement(880750..881922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscS"
FT                   /locus_tag="Lxx08720"
FT                   /product="small-conductance mechanosensitive channel"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08720"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88766"
FT                   /db_xref="GOA:Q6AFS9"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AFS9"
FT                   /protein_id="AAT88766.1"
FT                   /translation="MSENLWTELGNWAAAAGGNILHAVLIVVGAFLLSWVLRVVIRRVV
FT                   KQIVSGVKKGQNVTDTQALVASPLATVRLVQRTRTLGSVLSNIVNVTIGIVTIILVVQV
FT                   FASEILTSFALLTAAIGAGLGFGAQNIVKDVLNGLFMVMEDQLGVGDVVDLGSATGVVE
FT                   AVGVRITQVRDVNGTLWFVRNGEILRVGNMSQGWSRVIVDVAVPYDTDIEAVQSKLMEA
FT                   ATALTASPRWRSRVLDKPELWGLESISADAMVVRIVLKTRTTAKDDVSRELRSRLKRAV
FT                   DELGVKLPSLSAVVLSGFDGAGSVDGAKPPRTRPTPTVQPPPLKGRKSRAAAKRGAGSV
FT                   PDPGAIRIRPAAENPPAAKPATPKPADKPAIPPRAPQAPPSGPGTDHPTE"
FT   gene            complement(881967..882644)
FT                   /gene="chiR"
FT                   /locus_tag="Lxx08730"
FT   CDS_pept        complement(881967..882644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chiR"
FT                   /locus_tag="Lxx08730"
FT                   /product="two-component system, regulatory protein"
FT                   /note="identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Lxx08730"
FT                   /db_xref="EnsemblGenomes-Tr:AAT88767"
FT                   /db_xref="GOA:Q6AFS8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT