(data stored in ACNUC7421 zone)

EMBL: AE016853

ID   AE016853; SV 1; circular; genomic DNA; STD; PRO; 6397126 BP.
XX
AC   AE016853; AE016856-AE016876;
XX
PR   Project:PRJNA359;
XX
DT   04-MAR-2005 (Rel. 83, Created)
DT   12-JUN-2019 (Rel. 141, Last updated, Version 35)
XX
DE   Pseudomonas syringae pv. tomato str. DC3000, complete genome.
XX
KW   .
XX
OS   Pseudomonas syringae pv. tomato str. DC3000
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
OC   Pseudomonadaceae; Pseudomonas.
XX
RN   [1]
RP   1-6397126
RX   DOI; 10.1073/pnas.1731982100.
RX   PUBMED; 12928499.
RA   Buell C.R., Joardar V., Lindeberg M., Selengut J., Paulsen I.T.,
RA   Gwinn M.L., Dodson R.J., Deboy R.T., Durkin A.S., Kolonay J.F., Madupu R.,
RA   Daugherty S., Brinkac L., Beanan M.J., Haft D.H., Nelson W.C., Davidsen T.,
RA   Zafar N., Zhou L., Liu J., Yuan Q., Khouri H., Fedorova N., Tran B.,
RA   Russell D., Berry K., Utterback T., Van Aken S.E., Feldblyum T.V.,
RA   D'Ascenzo M., Deng W.L., Ramos A.R., Alfano J.R., Cartinhour S.,
RA   Chatterjee A.K., Delaney T.P., Lazarowitz S.G., Martin G.B.,
RA   Schneider D.J., Tang X., Bender C.L., White O., Fraser C.M., Collmer A.;
RT   "The complete genome sequence of the Arabidopsis and tomato pathogen
RT   Pseudomonas syringae pv. tomato DC3000";
RL   Proc. Natl. Acad. Sci. U.S.A. 100(18):10181-10186(2003).
XX
RN   [2]
RP   1-6397126
RA   Buell R., Joardar V., Khouri H., Fedorova N., Tran B., Russell D.,
RA   Berry K., Utterback T., Van Aken S., Feldblyum T., Gwinn M., Dodson R.,
RA   DeBoy R., Durkin A., Kolonay J., Madupu R., Daugherty S., Brinkac L.,
RA   Beanan M., Haft D., Selengut J., Nelson W., Davidsen T., White O.,
RA   Fraser C., Collmer A.;
RT   ;
RL   Submitted (03-MAR-2003) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
RN   [3]
RC   Amino acid sequence updated by submitter
RP   1-6397126
RA   Lindeberg M.;
RT   ;
RL   Submitted (22-NOV-2006) to the INSDC.
RL   Dept of Plant Pathology, Plant Science Building, Cornell University,
RL   Ithaca, NY 14853, USA
XX
RN   [4]
RC   Amino acid sequence updated by submitter
RP   1-6397126
RA   Lindeberg M.;
RT   ;
RL   Submitted (14-DEC-2006) to the INSDC.
RL   Dept of Plant Pathology, Plant Science Building, Cornell University,
RL   Ithaca, NY 14853, USA
XX
RN   [5]
RC   Amino acid sequence update by submitter
RP   1-6397126
RA   Lindeberg M.;
RT   ;
RL   Submitted (07-SEP-2007) to the INSDC.
RL   Dept of Plant Pathology, Plant Science Building, Cornell University,
RL   Ithaca, NY 14853, USA
XX
RN   [6]
RC   Amino acid sequence update by submitter
RP   1-6397126
RA   Lindeberg M.;
RT   ;
RL   Submitted (27-NOV-2007) to the INSDC.
RL   Dept of Plant Pathology, Plant Science Building, Cornell University,
RL   Ithaca, NY 14853, USA
XX
RN   [7]
RC   Amino acid sequence update by submitter
RP   1-6397126
RA   Lindeberg M.;
RT   ;
RL   Submitted (21-MAR-2008) to the INSDC.
RL   Dept of Plant Pathology, Plant Science Building, Cornell University,
RL   Ithaca, NY 14853, USA
XX
RN   [8]
RC   Amino acid sequence update by submitter
RP   1-6397126
RA   Lindeberg M.;
RT   ;
RL   Submitted (19-DEC-2008) to the INSDC.
RL   Dept of Plant Pathology, Plant Science Building, Cornell University,
RL   Ithaca, NY 14853, USA
XX
RN   [9]
RC   Protein update by submitter
RP   1-6397126
RA   Lindeberg M.;
RT   ;
RL   Submitted (08-MAR-2010) to the INSDC.
RL   Dept of Plant Pathology, Plant Science Building, Cornell University,
RL   Ithaca, NY 14853, USA
XX
DR   MD5; d55afb48da4fa68dce8431b7f6acf90d.
DR   BioSample; SAMN02604017.
DR   EnsemblGenomes-Gn; EBG00001440937.
DR   EnsemblGenomes-Gn; EBG00001440938.
DR   EnsemblGenomes-Gn; EBG00001440939.
DR   EnsemblGenomes-Gn; EBG00001440940.
DR   EnsemblGenomes-Gn; EBG00001440941.
DR   EnsemblGenomes-Gn; EBG00001440942.
DR   EnsemblGenomes-Gn; EBG00001440943.
DR   EnsemblGenomes-Gn; EBG00001440944.
DR   EnsemblGenomes-Gn; EBG00001440945.
DR   EnsemblGenomes-Gn; EBG00001440946.
DR   EnsemblGenomes-Gn; EBG00001440947.
DR   EnsemblGenomes-Gn; EBG00001440948.
DR   EnsemblGenomes-Gn; EBG00001440949.
DR   EnsemblGenomes-Gn; EBG00001440950.
DR   EnsemblGenomes-Gn; EBG00001440951.
DR   EnsemblGenomes-Gn; EBG00001440952.
DR   EnsemblGenomes-Gn; EBG00001440953.
DR   EnsemblGenomes-Gn; EBG00001440954.
DR   EnsemblGenomes-Gn; EBG00001440955.
DR   EnsemblGenomes-Gn; EBG00001440956.
DR   EnsemblGenomes-Gn; EBG00001440957.
DR   EnsemblGenomes-Gn; EBG00001440958.
DR   EnsemblGenomes-Gn; EBG00001440959.
DR   EnsemblGenomes-Gn; EBG00001440960.
DR   EnsemblGenomes-Gn; EBG00001440961.
DR   EnsemblGenomes-Gn; EBG00001440962.
DR   EnsemblGenomes-Gn; EBG00001440963.
DR   EnsemblGenomes-Gn; EBG00001440964.
DR   EnsemblGenomes-Gn; EBG00001440965.
DR   EnsemblGenomes-Gn; EBG00001440966.
DR   EnsemblGenomes-Gn; EBG00001440967.
DR   EnsemblGenomes-Gn; EBG00001440968.
DR   EnsemblGenomes-Gn; EBG00001440969.
DR   EnsemblGenomes-Gn; EBG00001440970.
DR   EnsemblGenomes-Gn; EBG00001440971.
DR   EnsemblGenomes-Gn; EBG00001440972.
DR   EnsemblGenomes-Gn; EBG00001440973.
DR   EnsemblGenomes-Gn; EBG00001440974.
DR   EnsemblGenomes-Gn; EBG00001440975.
DR   EnsemblGenomes-Gn; EBG00001440976.
DR   EnsemblGenomes-Gn; EBG00001440977.
DR   EnsemblGenomes-Gn; EBG00001440978.
DR   EnsemblGenomes-Gn; EBG00001440979.
DR   EnsemblGenomes-Gn; EBG00001440980.
DR   EnsemblGenomes-Gn; EBG00001440981.
DR   EnsemblGenomes-Gn; EBG00001440982.
DR   EnsemblGenomes-Gn; EBG00001440983.
DR   EnsemblGenomes-Gn; EBG00001440984.
DR   EnsemblGenomes-Gn; EBG00001440985.
DR   EnsemblGenomes-Gn; EBG00001440986.
DR   EnsemblGenomes-Gn; EBG00001440987.
DR   EnsemblGenomes-Gn; EBG00001440988.
DR   EnsemblGenomes-Gn; EBG00001440989.
DR   EnsemblGenomes-Gn; EBG00001440990.
DR   EnsemblGenomes-Gn; EBG00001440991.
DR   EnsemblGenomes-Gn; EBG00001440992.
DR   EnsemblGenomes-Gn; EBG00001440993.
DR   EnsemblGenomes-Gn; EBG00001440994.
DR   EnsemblGenomes-Gn; EBG00001440995.
DR   EnsemblGenomes-Gn; EBG00001440996.
DR   EnsemblGenomes-Gn; EBG00001440997.
DR   EnsemblGenomes-Gn; EBG00001440998.
DR   EnsemblGenomes-Gn; EBG00001440999.
DR   EnsemblGenomes-Gn; EBG00001441000.
DR   EnsemblGenomes-Gn; EBG00001441001.
DR   EnsemblGenomes-Gn; EBG00001441002.
DR   EnsemblGenomes-Gn; EBG00001441003.
DR   EnsemblGenomes-Gn; EBG00001441004.
DR   EnsemblGenomes-Gn; EBG00001441005.
DR   EnsemblGenomes-Gn; EBG00001441006.
DR   EnsemblGenomes-Gn; EBG00001441007.
DR   EnsemblGenomes-Gn; EBG00001441008.
DR   EnsemblGenomes-Gn; EBG00001441009.
DR   EnsemblGenomes-Gn; EBG00001441010.
DR   EnsemblGenomes-Gn; EBG00001441011.
DR   EnsemblGenomes-Gn; EBG00001441012.
DR   EnsemblGenomes-Gn; EBG00001441013.
DR   EnsemblGenomes-Gn; EBG00001441014.
DR   EnsemblGenomes-Gn; EBG00001441015.
DR   EnsemblGenomes-Gn; EBG00001441016.
DR   EnsemblGenomes-Gn; EBG00001441017.
DR   EnsemblGenomes-Gn; EBG00001441018.
DR   EnsemblGenomes-Gn; EBG00001441019.
DR   EnsemblGenomes-Gn; EBG00001441020.
DR   EnsemblGenomes-Gn; EBG00001441021.
DR   EnsemblGenomes-Gn; EBG00001441022.
DR   EnsemblGenomes-Gn; EBG00001441023.
DR   EnsemblGenomes-Gn; EBG00001441024.
DR   EnsemblGenomes-Gn; EBG00001441025.
DR   EnsemblGenomes-Gn; EBG00001441026.
DR   EnsemblGenomes-Gn; EBG00001441027.
DR   EnsemblGenomes-Gn; EBG00001441028.
DR   EnsemblGenomes-Gn; EBG00001441029.
DR   EnsemblGenomes-Gn; EBG00001441030.
DR   EnsemblGenomes-Gn; EBG00001441031.
DR   EnsemblGenomes-Gn; EBG00001441032.
DR   EnsemblGenomes-Gn; EBG00001441033.
DR   EnsemblGenomes-Gn; EBG00001441034.
DR   EnsemblGenomes-Gn; EBG00001441035.
DR   EnsemblGenomes-Gn; EBG00001441036.
DR   EnsemblGenomes-Gn; EBG00001441037.
DR   EnsemblGenomes-Gn; EBG00001441038.
DR   EnsemblGenomes-Gn; EBG00001441039.
DR   EnsemblGenomes-Gn; EBG00001441040.
DR   EnsemblGenomes-Gn; EBG00001441041.
DR   EnsemblGenomes-Gn; EBG00001441042.
DR   EnsemblGenomes-Gn; EBG00001441043.
DR   EnsemblGenomes-Gn; EBG00001441044.
DR   EnsemblGenomes-Gn; EBG00001441045.
DR   EnsemblGenomes-Gn; EBG00001441046.
DR   EnsemblGenomes-Gn; EBG00001441047.
DR   EnsemblGenomes-Gn; EBG00001441048.
DR   EnsemblGenomes-Gn; EBG00001441049.
DR   EnsemblGenomes-Gn; EBG00001441050.
DR   EnsemblGenomes-Gn; EBG00001441051.
DR   EnsemblGenomes-Gn; EBG00001441052.
DR   EnsemblGenomes-Gn; EBG00001441053.
DR   EnsemblGenomes-Gn; EBG00001441054.
DR   EnsemblGenomes-Gn; EBG00001441055.
DR   EnsemblGenomes-Gn; EBG00001441056.
DR   EnsemblGenomes-Gn; EBG00001441057.
DR   EnsemblGenomes-Gn; EBG00001441058.
DR   EnsemblGenomes-Gn; EBG00001441059.
DR   EnsemblGenomes-Gn; EBG00001441060.
DR   EnsemblGenomes-Gn; EBG00001441061.
DR   EnsemblGenomes-Gn; EBG00001441062.
DR   EnsemblGenomes-Gn; EBG00001441063.
DR   EnsemblGenomes-Gn; EBG00001441064.
DR   EnsemblGenomes-Gn; EBG00001441065.
DR   EnsemblGenomes-Gn; EBG00001441066.
DR   EnsemblGenomes-Gn; PSPTO_5647.
DR   EnsemblGenomes-Gn; PSPTO_5648.
DR   EnsemblGenomes-Gn; PSPTO_5649.
DR   EnsemblGenomes-Gn; PSPTO_5650.
DR   EnsemblGenomes-Gn; PSPTO_5651.
DR   EnsemblGenomes-Gn; PSPTO_5652.
DR   EnsemblGenomes-Gn; PSPTO_5653.
DR   EnsemblGenomes-Gn; PSPTO_5654.
DR   EnsemblGenomes-Gn; PSPTO_5655.
DR   EnsemblGenomes-Gn; PSPTO_5656.
DR   EnsemblGenomes-Gn; PSPTO_5657.
DR   EnsemblGenomes-Gn; PSPTO_5658.
DR   EnsemblGenomes-Gn; PSPTO_5659.
DR   EnsemblGenomes-Gn; PSPTO_5660.
DR   EnsemblGenomes-Gn; PSPTO_5661.
DR   EnsemblGenomes-Gn; PSPTO_5662.
DR   EnsemblGenomes-Gn; PSPTO_5663.
DR   EnsemblGenomes-Gn; PSPTO_5664.
DR   EnsemblGenomes-Gn; PSPTO_5665.
DR   EnsemblGenomes-Gn; PSPTO_5666.
DR   EnsemblGenomes-Gn; PSPTO_5667.
DR   EnsemblGenomes-Gn; PSPTO_5668.
DR   EnsemblGenomes-Gn; PSPTO_5669.
DR   EnsemblGenomes-Gn; PSPTO_5670.
DR   EnsemblGenomes-Gn; PSPTO_5671.
DR   EnsemblGenomes-Gn; PSPTO_5672.
DR   EnsemblGenomes-Gn; PSPTO_5673.
DR   EnsemblGenomes-Gn; PSPTO_5674.
DR   EnsemblGenomes-Gn; PSPTO_5675.
DR   EnsemblGenomes-Gn; PSPTO_r01.
DR   EnsemblGenomes-Gn; PSPTO_r02.
DR   EnsemblGenomes-Gn; PSPTO_r03.
DR   EnsemblGenomes-Gn; PSPTO_r04.
DR   EnsemblGenomes-Gn; PSPTO_r05.
DR   EnsemblGenomes-Gn; PSPTO_r06.
DR   EnsemblGenomes-Gn; PSPTO_r07.
DR   EnsemblGenomes-Gn; PSPTO_r08.
DR   EnsemblGenomes-Gn; PSPTO_r09.
DR   EnsemblGenomes-Gn; PSPTO_r10.
DR   EnsemblGenomes-Gn; PSPTO_r11.
DR   EnsemblGenomes-Gn; PSPTO_r12.
DR   EnsemblGenomes-Gn; PSPTO_r13.
DR   EnsemblGenomes-Gn; PSPTO_r14.
DR   EnsemblGenomes-Gn; PSPTO_r15.
DR   EnsemblGenomes-Gn; PSPTO_t01.
DR   EnsemblGenomes-Gn; PSPTO_t02.
DR   EnsemblGenomes-Gn; PSPTO_t03.
DR   EnsemblGenomes-Gn; PSPTO_t04.
DR   EnsemblGenomes-Gn; PSPTO_t05.
DR   EnsemblGenomes-Gn; PSPTO_t06.
DR   EnsemblGenomes-Gn; PSPTO_t07.
DR   EnsemblGenomes-Gn; PSPTO_t08.
DR   EnsemblGenomes-Gn; PSPTO_t09.
DR   EnsemblGenomes-Gn; PSPTO_t10.
DR   EnsemblGenomes-Gn; PSPTO_t11.
DR   EnsemblGenomes-Gn; PSPTO_t12.
DR   EnsemblGenomes-Gn; PSPTO_t13.
DR   EnsemblGenomes-Gn; PSPTO_t14.
DR   EnsemblGenomes-Gn; PSPTO_t15.
DR   EnsemblGenomes-Gn; PSPTO_t16.
DR   EnsemblGenomes-Gn; PSPTO_t17.
DR   EnsemblGenomes-Gn; PSPTO_t18.
DR   EnsemblGenomes-Gn; PSPTO_t19.
DR   EnsemblGenomes-Gn; PSPTO_t20.
DR   EnsemblGenomes-Gn; PSPTO_t21.
DR   EnsemblGenomes-Gn; PSPTO_t22.
DR   EnsemblGenomes-Gn; PSPTO_t23.
DR   EnsemblGenomes-Gn; PSPTO_t24.
DR   EnsemblGenomes-Gn; PSPTO_t25.
DR   EnsemblGenomes-Gn; PSPTO_t26.
DR   EnsemblGenomes-Gn; PSPTO_t27.
DR   EnsemblGenomes-Gn; PSPTO_t28.
DR   EnsemblGenomes-Gn; PSPTO_t29.
DR   EnsemblGenomes-Gn; PSPTO_t30.
DR   EnsemblGenomes-Gn; PSPTO_t31.
DR   EnsemblGenomes-Gn; PSPTO_t32.
DR   EnsemblGenomes-Gn; PSPTO_t33.
DR   EnsemblGenomes-Gn; PSPTO_t34.
DR   EnsemblGenomes-Gn; PSPTO_t35.
DR   EnsemblGenomes-Gn; PSPTO_t36.
DR   EnsemblGenomes-Gn; PSPTO_t37.
DR   EnsemblGenomes-Gn; PSPTO_t38.
DR   EnsemblGenomes-Gn; PSPTO_t39.
DR   EnsemblGenomes-Gn; PSPTO_t40.
DR   EnsemblGenomes-Gn; PSPTO_t41.
DR   EnsemblGenomes-Gn; PSPTO_t42.
DR   EnsemblGenomes-Gn; PSPTO_t43.
DR   EnsemblGenomes-Gn; PSPTO_t44.
DR   EnsemblGenomes-Gn; PSPTO_t45.
DR   EnsemblGenomes-Gn; PSPTO_t46.
DR   EnsemblGenomes-Gn; PSPTO_t47.
DR   EnsemblGenomes-Gn; PSPTO_t48.
DR   EnsemblGenomes-Gn; PSPTO_t49.
DR   EnsemblGenomes-Gn; PSPTO_t50.
DR   EnsemblGenomes-Gn; PSPTO_t51.
DR   EnsemblGenomes-Gn; PSPTO_t52.
DR   EnsemblGenomes-Gn; PSPTO_t53.
DR   EnsemblGenomes-Gn; PSPTO_t54.
DR   EnsemblGenomes-Gn; PSPTO_t55.
DR   EnsemblGenomes-Gn; PSPTO_t56.
DR   EnsemblGenomes-Gn; PSPTO_t57.
DR   EnsemblGenomes-Gn; PSPTO_t58.
DR   EnsemblGenomes-Gn; PSPTO_t59.
DR   EnsemblGenomes-Gn; PSPTO_t60.
DR   EnsemblGenomes-Gn; PSPTO_t61.
DR   EnsemblGenomes-Gn; PSPTO_t62.
DR   EnsemblGenomes-Gn; PSPTO_t63.
DR   EnsemblGenomes-Tr; EBT00001818770.
DR   EnsemblGenomes-Tr; EBT00001818771.
DR   EnsemblGenomes-Tr; EBT00001818772.
DR   EnsemblGenomes-Tr; EBT00001818773.
DR   EnsemblGenomes-Tr; EBT00001818774.
DR   EnsemblGenomes-Tr; EBT00001818775.
DR   EnsemblGenomes-Tr; EBT00001818776.
DR   EnsemblGenomes-Tr; EBT00001818777.
DR   EnsemblGenomes-Tr; EBT00001818778.
DR   EnsemblGenomes-Tr; EBT00001818779.
DR   EnsemblGenomes-Tr; EBT00001818780.
DR   EnsemblGenomes-Tr; EBT00001818781.
DR   EnsemblGenomes-Tr; EBT00001818782.
DR   EnsemblGenomes-Tr; EBT00001818783.
DR   EnsemblGenomes-Tr; EBT00001818784.
DR   EnsemblGenomes-Tr; EBT00001818785.
DR   EnsemblGenomes-Tr; EBT00001818786.
DR   EnsemblGenomes-Tr; EBT00001818787.
DR   EnsemblGenomes-Tr; EBT00001818788.
DR   EnsemblGenomes-Tr; EBT00001818789.
DR   EnsemblGenomes-Tr; EBT00001818790.
DR   EnsemblGenomes-Tr; EBT00001818791.
DR   EnsemblGenomes-Tr; EBT00001818792.
DR   EnsemblGenomes-Tr; EBT00001818793.
DR   EnsemblGenomes-Tr; EBT00001818794.
DR   EnsemblGenomes-Tr; EBT00001818795.
DR   EnsemblGenomes-Tr; EBT00001818796.
DR   EnsemblGenomes-Tr; EBT00001818797.
DR   EnsemblGenomes-Tr; EBT00001818798.
DR   EnsemblGenomes-Tr; EBT00001818799.
DR   EnsemblGenomes-Tr; EBT00001818800.
DR   EnsemblGenomes-Tr; EBT00001818801.
DR   EnsemblGenomes-Tr; EBT00001818802.
DR   EnsemblGenomes-Tr; EBT00001818803.
DR   EnsemblGenomes-Tr; EBT00001818804.
DR   EnsemblGenomes-Tr; EBT00001818805.
DR   EnsemblGenomes-Tr; EBT00001818806.
DR   EnsemblGenomes-Tr; EBT00001818807.
DR   EnsemblGenomes-Tr; EBT00001818808.
DR   EnsemblGenomes-Tr; EBT00001818809.
DR   EnsemblGenomes-Tr; EBT00001818810.
DR   EnsemblGenomes-Tr; EBT00001818811.
DR   EnsemblGenomes-Tr; EBT00001818812.
DR   EnsemblGenomes-Tr; EBT00001818813.
DR   EnsemblGenomes-Tr; EBT00001818814.
DR   EnsemblGenomes-Tr; EBT00001818815.
DR   EnsemblGenomes-Tr; EBT00001818816.
DR   EnsemblGenomes-Tr; EBT00001818817.
DR   EnsemblGenomes-Tr; EBT00001818818.
DR   EnsemblGenomes-Tr; EBT00001818819.
DR   EnsemblGenomes-Tr; EBT00001818820.
DR   EnsemblGenomes-Tr; EBT00001818821.
DR   EnsemblGenomes-Tr; EBT00001818822.
DR   EnsemblGenomes-Tr; EBT00001818824.
DR   EnsemblGenomes-Tr; EBT00001818827.
DR   EnsemblGenomes-Tr; EBT00001818831.
DR   EnsemblGenomes-Tr; EBT00001818832.
DR   EnsemblGenomes-Tr; EBT00001818834.
DR   EnsemblGenomes-Tr; EBT00001818835.
DR   EnsemblGenomes-Tr; EBT00001818837.
DR   EnsemblGenomes-Tr; EBT00001818839.
DR   EnsemblGenomes-Tr; EBT00001818841.
DR   EnsemblGenomes-Tr; EBT00001818843.
DR   EnsemblGenomes-Tr; EBT00001818845.
DR   EnsemblGenomes-Tr; EBT00001818847.
DR   EnsemblGenomes-Tr; EBT00001818849.
DR   EnsemblGenomes-Tr; EBT00001818851.
DR   EnsemblGenomes-Tr; EBT00001818853.
DR   EnsemblGenomes-Tr; EBT00001818855.
DR   EnsemblGenomes-Tr; EBT00001818856.
DR   EnsemblGenomes-Tr; EBT00001818858.
DR   EnsemblGenomes-Tr; EBT00001818860.
DR   EnsemblGenomes-Tr; EBT00001818862.
DR   EnsemblGenomes-Tr; EBT00001818865.
DR   EnsemblGenomes-Tr; EBT00001818867.
DR   EnsemblGenomes-Tr; EBT00001818869.
DR   EnsemblGenomes-Tr; EBT00001818870.
DR   EnsemblGenomes-Tr; EBT00001818871.
DR   EnsemblGenomes-Tr; EBT00001818873.
DR   EnsemblGenomes-Tr; EBT00001818876.
DR   EnsemblGenomes-Tr; EBT00001818878.
DR   EnsemblGenomes-Tr; EBT00001818880.
DR   EnsemblGenomes-Tr; EBT00001818882.
DR   EnsemblGenomes-Tr; EBT00001818884.
DR   EnsemblGenomes-Tr; EBT00001818886.
DR   EnsemblGenomes-Tr; EBT00001818889.
DR   EnsemblGenomes-Tr; EBT00001818891.
DR   EnsemblGenomes-Tr; EBT00001818892.
DR   EnsemblGenomes-Tr; EBT00001818895.
DR   EnsemblGenomes-Tr; EBT00001818896.
DR   EnsemblGenomes-Tr; EBT00001818898.
DR   EnsemblGenomes-Tr; EBT00001818901.
DR   EnsemblGenomes-Tr; EBT00001818903.
DR   EnsemblGenomes-Tr; EBT00001818905.
DR   EnsemblGenomes-Tr; EBT00001818907.
DR   EnsemblGenomes-Tr; EBT00001818909.
DR   EnsemblGenomes-Tr; EBT00001818910.
DR   EnsemblGenomes-Tr; EBT00001818912.
DR   EnsemblGenomes-Tr; EBT00001818913.
DR   EnsemblGenomes-Tr; EBT00001818914.
DR   EnsemblGenomes-Tr; EBT00001818916.
DR   EnsemblGenomes-Tr; EBT00001818918.
DR   EnsemblGenomes-Tr; EBT00001818920.
DR   EnsemblGenomes-Tr; EBT00001818923.
DR   EnsemblGenomes-Tr; EBT00001818925.
DR   EnsemblGenomes-Tr; EBT00001818927.
DR   EnsemblGenomes-Tr; EBT00001818929.
DR   EnsemblGenomes-Tr; EBT00001818932.
DR   EnsemblGenomes-Tr; EBT00001818933.
DR   EnsemblGenomes-Tr; EBT00001818934.
DR   EnsemblGenomes-Tr; EBT00001818935.
DR   EnsemblGenomes-Tr; EBT00001818936.
DR   EnsemblGenomes-Tr; EBT00001818937.
DR   EnsemblGenomes-Tr; EBT00001818938.
DR   EnsemblGenomes-Tr; EBT00001818939.
DR   EnsemblGenomes-Tr; EBT00001818940.
DR   EnsemblGenomes-Tr; EBT00001818941.
DR   EnsemblGenomes-Tr; EBT00001818942.
DR   EnsemblGenomes-Tr; EBT00001818943.
DR   EnsemblGenomes-Tr; EBT00001818944.
DR   EnsemblGenomes-Tr; EBT00001818945.
DR   EnsemblGenomes-Tr; EBT00001818946.
DR   EnsemblGenomes-Tr; EBT00001818947.
DR   EnsemblGenomes-Tr; EBT00001818948.
DR   EnsemblGenomes-Tr; EBT00001818949.
DR   EnsemblGenomes-Tr; EBT00001818950.
DR   EnsemblGenomes-Tr; EBT00001818951.
DR   EnsemblGenomes-Tr; EBT00001818952.
DR   EnsemblGenomes-Tr; EBT00001818953.
DR   EnsemblGenomes-Tr; EBT00001818954.
DR   EnsemblGenomes-Tr; PSPTO_5647-1.
DR   EnsemblGenomes-Tr; PSPTO_5648-1.
DR   EnsemblGenomes-Tr; PSPTO_5649-1.
DR   EnsemblGenomes-Tr; PSPTO_5650-1.
DR   EnsemblGenomes-Tr; PSPTO_5651-1.
DR   EnsemblGenomes-Tr; PSPTO_5652-1.
DR   EnsemblGenomes-Tr; PSPTO_5653-1.
DR   EnsemblGenomes-Tr; PSPTO_5654-1.
DR   EnsemblGenomes-Tr; PSPTO_5655-1.
DR   EnsemblGenomes-Tr; PSPTO_5656-1.
DR   EnsemblGenomes-Tr; PSPTO_5657-1.
DR   EnsemblGenomes-Tr; PSPTO_5658-1.
DR   EnsemblGenomes-Tr; PSPTO_5659-1.
DR   EnsemblGenomes-Tr; PSPTO_5660-1.
DR   EnsemblGenomes-Tr; PSPTO_5661-1.
DR   EnsemblGenomes-Tr; PSPTO_5662-1.
DR   EnsemblGenomes-Tr; PSPTO_5663-1.
DR   EnsemblGenomes-Tr; PSPTO_5664-1.
DR   EnsemblGenomes-Tr; PSPTO_5665-1.
DR   EnsemblGenomes-Tr; PSPTO_5666-1.
DR   EnsemblGenomes-Tr; PSPTO_5667-1.
DR   EnsemblGenomes-Tr; PSPTO_5668-1.
DR   EnsemblGenomes-Tr; PSPTO_5669-1.
DR   EnsemblGenomes-Tr; PSPTO_5670-1.
DR   EnsemblGenomes-Tr; PSPTO_5671-1.
DR   EnsemblGenomes-Tr; PSPTO_5672-1.
DR   EnsemblGenomes-Tr; PSPTO_5673-1.
DR   EnsemblGenomes-Tr; PSPTO_5674-1.
DR   EnsemblGenomes-Tr; PSPTO_5675-1.
DR   EnsemblGenomes-Tr; PSPTO_r01-1.
DR   EnsemblGenomes-Tr; PSPTO_r02-1.
DR   EnsemblGenomes-Tr; PSPTO_r03-1.
DR   EnsemblGenomes-Tr; PSPTO_r04-1.
DR   EnsemblGenomes-Tr; PSPTO_r05-1.
DR   EnsemblGenomes-Tr; PSPTO_r06-1.
DR   EnsemblGenomes-Tr; PSPTO_r07-1.
DR   EnsemblGenomes-Tr; PSPTO_r08-1.
DR   EnsemblGenomes-Tr; PSPTO_r09-1.
DR   EnsemblGenomes-Tr; PSPTO_r10-1.
DR   EnsemblGenomes-Tr; PSPTO_r11-1.
DR   EnsemblGenomes-Tr; PSPTO_r12-1.
DR   EnsemblGenomes-Tr; PSPTO_r13-1.
DR   EnsemblGenomes-Tr; PSPTO_r14-1.
DR   EnsemblGenomes-Tr; PSPTO_r15-1.
DR   EnsemblGenomes-Tr; PSPTO_t01-1.
DR   EnsemblGenomes-Tr; PSPTO_t02-1.
DR   EnsemblGenomes-Tr; PSPTO_t03-1.
DR   EnsemblGenomes-Tr; PSPTO_t04-1.
DR   EnsemblGenomes-Tr; PSPTO_t05-1.
DR   EnsemblGenomes-Tr; PSPTO_t06-1.
DR   EnsemblGenomes-Tr; PSPTO_t07-1.
DR   EnsemblGenomes-Tr; PSPTO_t08-1.
DR   EnsemblGenomes-Tr; PSPTO_t09-1.
DR   EnsemblGenomes-Tr; PSPTO_t10-1.
DR   EnsemblGenomes-Tr; PSPTO_t11-1.
DR   EnsemblGenomes-Tr; PSPTO_t12-1.
DR   EnsemblGenomes-Tr; PSPTO_t13-1.
DR   EnsemblGenomes-Tr; PSPTO_t14-1.
DR   EnsemblGenomes-Tr; PSPTO_t15-1.
DR   EnsemblGenomes-Tr; PSPTO_t16-1.
DR   EnsemblGenomes-Tr; PSPTO_t17-1.
DR   EnsemblGenomes-Tr; PSPTO_t18-1.
DR   EnsemblGenomes-Tr; PSPTO_t19-1.
DR   EnsemblGenomes-Tr; PSPTO_t20-1.
DR   EnsemblGenomes-Tr; PSPTO_t21-1.
DR   EnsemblGenomes-Tr; PSPTO_t22-1.
DR   EnsemblGenomes-Tr; PSPTO_t23-1.
DR   EnsemblGenomes-Tr; PSPTO_t24-1.
DR   EnsemblGenomes-Tr; PSPTO_t25-1.
DR   EnsemblGenomes-Tr; PSPTO_t26-1.
DR   EnsemblGenomes-Tr; PSPTO_t27-1.
DR   EnsemblGenomes-Tr; PSPTO_t28-1.
DR   EnsemblGenomes-Tr; PSPTO_t29-1.
DR   EnsemblGenomes-Tr; PSPTO_t30-1.
DR   EnsemblGenomes-Tr; PSPTO_t31-1.
DR   EnsemblGenomes-Tr; PSPTO_t32-1.
DR   EnsemblGenomes-Tr; PSPTO_t33-1.
DR   EnsemblGenomes-Tr; PSPTO_t34-1.
DR   EnsemblGenomes-Tr; PSPTO_t35-1.
DR   EnsemblGenomes-Tr; PSPTO_t36-1.
DR   EnsemblGenomes-Tr; PSPTO_t37-1.
DR   EnsemblGenomes-Tr; PSPTO_t38-1.
DR   EnsemblGenomes-Tr; PSPTO_t39-1.
DR   EnsemblGenomes-Tr; PSPTO_t40-1.
DR   EnsemblGenomes-Tr; PSPTO_t41-1.
DR   EnsemblGenomes-Tr; PSPTO_t42-1.
DR   EnsemblGenomes-Tr; PSPTO_t43-1.
DR   EnsemblGenomes-Tr; PSPTO_t44-1.
DR   EnsemblGenomes-Tr; PSPTO_t45-1.
DR   EnsemblGenomes-Tr; PSPTO_t46-1.
DR   EnsemblGenomes-Tr; PSPTO_t47-1.
DR   EnsemblGenomes-Tr; PSPTO_t48-1.
DR   EnsemblGenomes-Tr; PSPTO_t49-1.
DR   EnsemblGenomes-Tr; PSPTO_t50-1.
DR   EnsemblGenomes-Tr; PSPTO_t51-1.
DR   EnsemblGenomes-Tr; PSPTO_t52-1.
DR   EnsemblGenomes-Tr; PSPTO_t53-1.
DR   EnsemblGenomes-Tr; PSPTO_t54-1.
DR   EnsemblGenomes-Tr; PSPTO_t55-1.
DR   EnsemblGenomes-Tr; PSPTO_t56-1.
DR   EnsemblGenomes-Tr; PSPTO_t57-1.
DR   EnsemblGenomes-Tr; PSPTO_t58-1.
DR   EnsemblGenomes-Tr; PSPTO_t59-1.
DR   EnsemblGenomes-Tr; PSPTO_t60-1.
DR   EnsemblGenomes-Tr; PSPTO_t61-1.
DR   EnsemblGenomes-Tr; PSPTO_t62-1.
DR   EnsemblGenomes-Tr; PSPTO_t63-1.
DR   EuropePMC; PMC1236638; 16159782.
DR   EuropePMC; PMC1272972; 16237009.
DR   EuropePMC; PMC1855702; 17158677.
DR   EuropePMC; PMC193536; 12928499.
DR   EuropePMC; PMC2519523; 18606739.
DR   EuropePMC; PMC2681681; 19286791.
DR   EuropePMC; PMC3001079; 20716518.
DR   EuropePMC; PMC305754; 14702323.
DR   EuropePMC; PMC309951; 14660376.
DR   EuropePMC; PMC3189936; 22016774.
DR   EuropePMC; PMC3191145; 22022435.
DR   EuropePMC; PMC3194850; 21856827.
DR   EuropePMC; PMC3247240; 22216251.
DR   EuropePMC; PMC3592358; 17381274.
DR   EuropePMC; PMC3815246; 21261859.
DR   EuropePMC; PMC3879358; 24391493.
DR   EuropePMC; PMC4010983; 24659774.
DR   EuropePMC; PMC4149516; 25170934.
DR   EuropePMC; PMC434426; 15184545.
DR   EuropePMC; PMC4592877; 26296726.
DR   EuropePMC; PMC4759546; 26891997.
DR   EuropePMC; PMC4807269; 26823466.
DR   EuropePMC; PMC4888284; 27257541.
DR   EuropePMC; PMC5263251; 28119474.
DR   EuropePMC; PMC5725424; 29229911.
DR   EuropePMC; PMC6113925; 30186252.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00166; PrrB_RsmZ.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00195; RsmY.
DR   RFAM; RF00373; RNaseP_arch.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00444; PrrF.
DR   RFAM; RF00623; P1.
DR   RFAM; RF00624; P9.
DR   RFAM; RF00625; P11.
DR   RFAM; RF00627; P15.
DR   RFAM; RF00628; P16.
DR   RFAM; RF00629; P24.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01668; P10.
DR   RFAM; RF01669; P14.
DR   RFAM; RF01673; P20.
DR   RFAM; RF01674; P27.
DR   RFAM; RF01675; CrcZ.
DR   RFAM; RF01676; P31.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01719; Pseudomon-1.
DR   RFAM; RF01720; Pseudomon-Rho.
DR   RFAM; RF01721; Pseudomon-groES.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01738; gabT.
DR   RFAM; RF01740; gyrA.
DR   RFAM; RF01744; livK.
DR   RFAM; RF01755; rmf.
DR   RFAM; RF01756; rne-II.
DR   RFAM; RF01758; sucA-II.
DR   RFAM; RF01759; sucC.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01772; rnk_pseudo.
DR   RFAM; RF01773; rpsL_psuedo.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   RFAM; RF02144; rsmX.
DR   RFAM; RF02243; Xoo8.
DR   SILVA-LSU; AE016853.
DR   SILVA-SSU; AE016853.
DR   StrainInfo; 493307; 0.
XX
CC   On or before Mar 3, 2005 this sequence version replaced AE016856.1,
CC   AE016857.1, AE016858.1, AE016859.1, AE016860.1, AE016861.1,
CC   AE016862.1, AE016863.1, AE016864.1, AE016865.1, AE016866.1,
CC   AE016867.1, AE016868.1, AE016869.1, AE016870.1, AE016871.1,
CC   AE016872.1, AE016873.1, AE016874.1, AE016875.1, AE016876.1.
CC   This represents the most recent version of the continually updated
CC   genome annotations for Pseudomonas syringae pv. tomato strain
CC   DC3000 by the Pseudomonas-Plant Interaction project. See
CC   http://www.pseudomonas-syringae.org for the latest updates and
CC   expanded annotations. We welcome submission through
CC   www.pseudomonas-syringae.org of any proposed changes. Note that
CC   locus tags with values greater than PSPTO_5615 represent features
CC   added subsequent to the initial annotation (06-MAR-2003) and are
CC   not in sequential order relative to other locus tags.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6397126
FT                   /organism="Pseudomonas syringae pv. tomato str. DC3000"
FT                   /strain="DC3000"
FT                   /mol_type="genomic DNA"
FT                   /note="pathovar: tomato"
FT                   /db_xref="taxon:223283"
FT                   /type_material="reference strain of Pseudomonas syringae
FT                   group genomosp. 3"
FT   gene            339..1874
FT                   /gene="dnaA"
FT                   /locus_tag="PSPTO_0001"
FT                   /old_locus_tag="PSPTO0001"
FT   CDS_pept        339..1874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="PSPTO_0001"
FT                   /old_locus_tag="PSPTO0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53558"
FT                   /db_xref="GOA:Q88BK3"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88BK3"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53558.1"
FT                   /translation="MSVELWQQCVELLRDELPAQQFNTWIRPLQVEAEGDELRVYAPNR
FT                   FVLDWVNEKYLGRLLELLGERGQGMAPALSLLIGSKRSSAPRAAPNAPLAAAASQALSG
FT                   NSVSSVSASAPAMAVPAPMVAAPVPVHNVATHDEPSRDSFDPMAGASSQQAPARAEQRT
FT                   VQVEGALKHTSYLNRTFTFENFVEGKSNQLARAAAWQVADNPKHGYNPLFLYGGVGLGK
FT                   THLMHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNAINEFKRFYRSVDALLIDDI
FT                   QFFARKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIEGLEERLKSRFGWGLTVAVEP
FT                   PELETRVAILMKKADQAKVDLPHDAAFFIAQRIRSNVRELEGALKRVIAHSHFMGRDIT
FT                   IELIRESLKDLLALQDKLVSVDNIQRTVAEYYKIKISDLLSKRRSRSVARPRQVAMALS
FT                   KELTNHSLPEIGDVFGGRDHTTVLHACRKINELKESDADIREDYKNLLRTLTT"
FT   gene            1913..3016
FT                   /gene="dnaN"
FT                   /locus_tag="PSPTO_0002"
FT                   /old_locus_tag="PSPTO0002"
FT   CDS_pept        1913..3016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="PSPTO_0002"
FT                   /old_locus_tag="PSPTO0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53559"
FT                   /db_xref="GOA:Q88BK2"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BK2"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53559.1"
FT                   /translation="MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVQGQQLSLT
FT                   GTDLEVELVGRVQLEEPAEPGEITVPARKLMDICKSLPNDALIDIKLDDSKLIVKAGRS
FT                   RFTLSTLPANDFPTVEEGPGSLTFNLVQSKLRRLIERTSFAMAQQDVRYYLNGMLLEVS
FT                   AGILRAVATDGHRLAMCSMSADIEHADRHQVIVPRKGILEMARLLTEQDGMVSIVLGQH
FT                   HIRATTGEFTFTSKLVDGKFPDYERVLPKGGDKLVLGDRQSLREAFSRTAILSNEKYRG
FT                   IRLQLANGQLKIQANNPEQEEAEEEIGVEYNGEALEIGFNVSYLLDVLSVMTTEQVRLI
FT                   LSDSNSSALVQESDNDDSAYVVMPMRL"
FT   gene            3039..4142
FT                   /gene="recF"
FT                   /locus_tag="PSPTO_0003"
FT                   /old_locus_tag="PSPTO0003"
FT   CDS_pept        3039..4142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="PSPTO_0003"
FT                   /old_locus_tag="PSPTO0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53560"
FT                   /db_xref="GOA:Q88BK1"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88BK1"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53560.1"
FT                   /translation="MSLSRVSVTGVRNLHPVTLSPSPRINILYGANGSGKTSVLEAIHL
FT                   LGIARSFRSSRLLPVIQYEQPSCTVFGQVDLAQGGHSNLGVSRDRQGEFQIRIDGQNAR
FT                   SAAQLAEILPLQLINPDSFRLLEGAPKIRRQFLDWGVFHVEPRFMSTWQRLQKALKQRN
FT                   SWLRHGTLDAASQAAWDRELCLASDEIDEFRRAYIKALKPVFEKTLSELVELEGLTLSY
FT                   YRGWDKEKELSTVLASSLNRDQQMGHTQAGPQRADLRLRLGAHNAADILSRGQQKLVVC
FT                   ALRIAQGHLVSQVRRGQCIYLVDDLPSELDDNHRRALCRLLEELRCQVFITCVDQEFLR
FT                   EGWQTDTPVALFHVEQGRITQTHDHRE"
FT   gene            4147..6564
FT                   /gene="gyrB"
FT                   /locus_tag="PSPTO_0004"
FT                   /old_locus_tag="PSPTO0004"
FT   CDS_pept        4147..6564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="PSPTO_0004"
FT                   /old_locus_tag="PSPTO0004"
FT                   /product="DNA gyrase, subunit B"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53561"
FT                   /db_xref="GOA:Q88BK0"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BK0"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53561.1"
FT                   /translation="MSENQTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGSGLHHMVFEV
FT                   VDNSIDEALAGHCDDISIIIHPDESITVRDNGRGIPVDVHKEEGVSAAEVIMTVLHAGG
FT                   KFDDNSYKVSGGLHGVGVSVVNALSELLLLTVRRSGKIWEQTYIHGVPQEPMKIVGESD
FT                   STGTQIHFKPSAETFKNIHFSWDILAKRIRELSFLNSGVGIVLKDERSGKEELFKYEGG
FT                   LRAFVEYLNTNKTPVNEVFHFNVQRDDGIGVEIALQWNDSFNENLLCFTNNIPQRDGGT
FT                   HLVGFRSALTRNLNNYIEQEGLAKKHKVATTGDDAREGLTAIISVKVPDPKFSSQTKDK
FT                   LVSSEVKTAVEQEMGKYFSDFLLENPNEAKAVVGKMIDAARAREAARKAREMTRRKGAL
FT                   DIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRNRRTQAILPLKGKILNVEKAR
FT                   FDKMISSQEVGTLITALGCGIGREEYNIDKLRYHNIIIMTDADVDGSHIRTLLLTFFFR
FT                   QLPELIERGYIYIAQPPLYKVKKGKQEQYIKDDEAMEEYMTQSALEDASLHLSESAPGI
FT                   SGTALEKLVHDFRMVMKTLKRLSRLYPQELTEHFVYLPPITLEQLSDHEGMQAWLALFD
FT                   VRLRTGEKSGLVYKASLREDRERNVWLPEVELISHGLSNYITFNRDFFGSNDYKTVTAL
FT                   GAQISTLLEEGAYVQRGERKKPVTEFKQALAWLMAESTKRHTIQRYKGLGEMNPDQLWE
FT                   TTMDPSVRRMLKVTIEDAIGADQIFNTLMGDAVEPRRDFIESNALAVSNLDF"
FT   gene            7092..8798
FT                   /locus_tag="PSPTO_0005"
FT                   /old_locus_tag="PSPTO0005"
FT   CDS_pept        7092..8798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0005"
FT                   /old_locus_tag="PSPTO0005"
FT                   /product="type I restriction-modification system, M
FT                   subunit, putative"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53562"
FT                   /db_xref="GOA:Q88BJ9"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BJ9"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53562.1"
FT                   /translation="MYNQAHFFLICPCWMAVVTGVGLRAFIGIDLPMADKLSLETLESW
FT                   LWESANILRGSIDSSDFKNYIFGLLFLKRYNDVFDERVTKLREEENLSYGEAQEEIEDK
FT                   WGKYPISARWFDLISRTENIGEALDKAFATIEANNPELQHVLTATQYGDKRVLADATLQ
FT                   RLLRHFNQYKLGNDDLYKADMLGDAYEYLIKQFADDAGKKGGEFYTPKAVVQLVVELID
FT                   PRPGHSVYDPTCGSGGMLVESAHHVSGLPDGTLMGKPNVLLYGQEKNLGTWAIAKLNLY
FT                   LHNMHASIERGDTLVEPKHLDGDYLKTFDRVIANPPFSAKSWWTPLELSNENEQENGKK
FT                   VKAPNYKQVSDPYGRLVYGVPPRGYADLAFAQHMLASLKADGRMGVILPHGVLFRSGEE
FT                   GKIREGLLFGTGAASGNQPGDVIEAIVGLPSALFYNTGIPACVLILNKQKPSALKDKVI
FT                   IIDGSRDYLEGKAQNSLHAEDILRIVSTHKAAFEQQVEVENYCRLVTLDEIRSNDGNLN
FT                   IVRYIDNGESDEVVNVAATLAHMATLAKEEAQIDQRLNRYLMELGLLETGV"
FT   gene            8861..10168
FT                   /locus_tag="PSPTO_0006"
FT                   /old_locus_tag="PSPTO0006"
FT   CDS_pept        8861..10168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0006"
FT                   /old_locus_tag="PSPTO0006"
FT                   /product="type I restriction-modification system, S
FT                   subunit, EcoA family"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53563"
FT                   /db_xref="GOA:Q88BJ8"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BJ8"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53563.1"
FT                   /translation="MGVIGDFVTALQAGVSVNAFETDSGCTEGELGVLKTSAVLRGRFF
FT                   AEQYKVVVAEDMGRVATSVVGDRIIISRMNTPALVGESGYVTKDEPNLFLPDRLWQTEP
FT                   SDRPHSQRWLSYWLQHPGVRRLIAASATGTSNSMKNISKETVLSLPVPRTPLPEQQKIA
FT                   AILTAVDDKLDVIFRQIKATQALKQGLMQALFSRGVGTQDTTGRWIQHTEFKDSELGTI
FT                   PALWDVGVIADYVSALRSGVSVNAEDRMHGDDEIGVLKVSCVLRGGFYPNCHKTVVPEE
FT                   RERVAEPVLQGRIIVSRANTPALVGESAYVNSAWPNLFLPDKLWQIEPSESPHSIKWLS
FT                   FYLQSPFVRQEISKAATGTSGSMKNISKPAFLSIRMPLVPLAEQEHIAAILSDVTSKIE
FT                   ALNSKQNHFQTLKRGLMQKLLTGEWRVKIDSPTGTV"
FT   gene            10179..11063
FT                   /locus_tag="PSPTO_0007"
FT                   /old_locus_tag="PSPTO0007"
FT   CDS_pept        10179..11063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0007"
FT                   /old_locus_tag="PSPTO0007"
FT                   /product="protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53564"
FT                   /db_xref="GOA:Q88BJ7"
FT                   /db_xref="InterPro:IPR025605"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BJ7"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53564.1"
FT                   /translation="MDEIIPLPSDPLPDLQRTVQRKLGRCILQSQQYERLLKAMVAHGE
FT                   LSGPPERLQAIRDEKVACADKKTLGTLVGMLTESYLKLPDLSDEPEQAEPIDRVWVSFR
FT                   CQMELTEERYAETKAALKELVDLRNELVHHFLQRFDLWGVDGCIAAESYLDESYETIDG
FT                   HYLTLRDWAKSMDEARQLMVSFMQTQEYRDAVINGIWLDGIVHWPSSGITACLREAETK
FT                   LAHAGWTPLFEAIRWIAKTYPELTPKRYGCGSWRHVIHESQQFEIRKQSQADNGPTVVW
FT                   YRSRPRETSKEQE"
FT   gene            11067..14366
FT                   /locus_tag="PSPTO_0008"
FT                   /old_locus_tag="PSPTO0008"
FT   CDS_pept        11067..14366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0008"
FT                   /old_locus_tag="PSPTO0008"
FT                   /product="type I site-specific deoxyribonuclease, HsdR
FT                   family"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to TIGR protein family HMM TIGR00348"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53565"
FT                   /db_xref="GOA:Q88BJ6"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BJ6"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53565.1"
FT                   /translation="MSQSPEKVGVELPAINWLVKLGYTHLSSNQVQVEYRHLAPVLDDV
FT                   LQARLLILNPWLESVPGGIPTALIELRKRLNDELLPANKAFWEQVVHRSDIQVKDVEGR
FT                   PRSVRFFDASDAANNDFHVVDQYVGRNADGDFFRPDLLLFVNGLPLAIIECKASHHRLD
FT                   EALGQLDGYQNCFPTQFVFNQVCVGLNRREGAYGAILTKPAYYARYRLQAQESAAVAAL
FT                   LGDVPSEQESLLWALFEPSRFLQLITHFALFETRDGKTMKKLPRYQQWRAVRKTLDRLC
FT                   APKPMGGVVWHTQGSGKSLTMALLARMLRADSTGLNNPTVLVLTDRKDLDKQIFDTFHA
FT                   VGISAIQAVSVEGLLKMLSNDYGSVFTSTVQKFQENEQPGEQPAVTPDEEDNALQATRH
FT                   RRIREEKDFFILHERNVRHRQVDENGVLVKAKWEEISREKVHFRVLSTKSNFYVLVDEA
FT                   HRSQYDFLAAFMRASLPNAKFIAFTGTPLLQEDKHTLGEFGGGEYIDEYRLHEAVADGA
FT                   TLSIKYQDAWVALSANAELDAAFKEQFSGQSEARQHELKRELLRRWRQAGNRMEQVAEH
FT                   LVEHFLSNVKAKGLKAMLVCDGRDMAVGYKDLLDAIMAERVQKGLPTFDSKVVISLASI
FT                   TASRTGASAMEEASEYEVDLDKIQSIEERVKAEVKAGNTPVAMPSEQIGNFVSKLFPLP
FT                   YGEESSGLDGKPQANNVGLIIVSDMLLTGWDAPIVGTMYLDKPLKEHTLLQAIARVNRT
FT                   LPGKNAGYIVDYHGVVEHLDHALKIYGGEVKPSQVWEGVETELPKLQATLDRILKLLPK
FT                   KHDPVAQREGYKTDAERFLDPATRLDMVEEFLDLVKQFNRSVDIILPDVRGVPFKPYFT
FT                   LLGEIRLMLRDKLPGNTYKERITKLESVLLQQLLDEYVAASPAKSLLGHEVSILDASDM
FT                   ARLKQLASPGSRALVMKNQLKHTIVTGKDKDPAFFDKLAEELQKLLEEEKAGRITQAKF
FT                   LEQLELFGQRIQDKDNTGFIKPAHSAVYHYLTALLAEDTARVATTKLFEDGELSRTVAT
FT                   DNWKKMPDLHPDIRDHLRGLLMPLAGWERSVAREHAKRILMYRNFNNSYTG"
FT   gene            complement(14512..15741)
FT                   /locus_tag="PSPTO_0009"
FT                   /old_locus_tag="PSPTO0009"
FT   CDS_pept        complement(14512..15741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0009"
FT                   /old_locus_tag="PSPTO0009"
FT                   /product="ISPsy3, transposase"
FT                   /note="similar to GP:14488264, GB:J03507, GB:X77354,
FT                   GB:X77344, GB:X77353, GB:X77355, GB:X77356, GB:X77357,
FT                   GB:X77358, GB:X77359, GB:X77360, GB:X77345, GB:X77346,
FT                   GB:X77347, GB:X77348, GB:X77349, GB:X77350, GB:X77351,
FT                   GB:X77352, GB:X86328, GB:X86338, GB:X86339, GB:X86340,
FT                   GB:X86341, GB:X86342, GB:X86343, GB:X86344, GB:X86329,
FT                   GB:X86330, GB:X86331, GB:X86332, GB:X86333, GB:X86334,
FT                   GB:X86335, GB:X86336, GB:X86337, SP:P10643, PID:179716, and
FT                   PID:899271; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53566"
FT                   /db_xref="GOA:Q877Q5"
FT                   /db_xref="InterPro:IPR007069"
FT                   /db_xref="InterPro:IPR026889"
FT                   /db_xref="UniProtKB/TrEMBL:Q877Q5"
FT                   /protein_id="AAO53566.1"
FT                   /translation="MKPAYPPLLLQMSPAYTPRPLKNLFTANQCWAHLIEEGGLRDIEV
FT                   ESVTKMLACGTSILGVKHYTCGNHSCPHVKYLCNTCSCRACPSCGKKATDQWIANQQHR
FT                   LPECTWQHLVFTLPDTLWPLFFHNRHWLDALCRLAVDNLLYAGRRRGVEVGVFCAIHTY
FT                   GRRLNWHPHIHVSVTLGGIDDAGVWKDLSFHPSALRRRWMWNVRQYLLSQWEHTTVPPE
FT                   NAHLQSENDWRHLVLNAGGQHWHIHLSKKTKNGKKTVNYLGRYLKKPPISGSRLAHYTS
FT                   GATLSFTYLDHRTKTYQQETLSQTDMLRRVVQHIPEKHFRMIRYFGFLANRVCGRQLPR
FT                   VYEAIRMERRGKAPKLYFAQMSKAFLHRDPFSCVLCGARMVYTAAIAGLTVQGLINNAQ
FT                   SIAQLRYVPA"
FT   gene            15948..16421
FT                   /locus_tag="PSPTO_5633"
FT   CDS_pept        15948..16421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_5633"
FT                   /product="conserved protein of unknown function"
FT                   /note="PMID:20190049"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_5633"
FT                   /db_xref="EnsemblGenomes-Tr:ADD52988"
FT                   /db_xref="InterPro:IPR022231"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BW6"
FT                   /inference="ab initio prediction:Easygene1.2"
FT                   /experiment="peptide sequencing"
FT                   /protein_id="ADD52988.1"
FT                   /translation="MNRLHKTSLLAAILTASPCIMAANAHAMSCPVPQSVKYVNGIYIA
FT                   PETFAGWEGNWVSQPHKKHSIKEFSTALYLSVDKSQKGGTLTNCSYSLSGDNGVIDLEY
FT                   RKSGNENRLKTLIVSIEGQHNWIKERGAVGIQGYECTKSASECQFVPLRLNED"
FT   gene            16743..17453
FT                   /locus_tag="PSPTO_0011"
FT                   /old_locus_tag="PSPTO0011"
FT   CDS_pept        16743..17453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0011"
FT                   /old_locus_tag="PSPTO0011"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:19917556; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53567"
FT                   /db_xref="GOA:Q88BJ5"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BJ5"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53567.1"
FT                   /translation="MPVLHYGQTTIEWYFQLDTNLKRHYVTVERGRPVLLRGPQVDDPE
FT                   QEALVLRRARWIREKLAQVNLPLANEAIVTGSRLRYAGRTYFTEVRHTPDILKPRLTFT
FT                   ASRFIVDNPDSASIQPDALIPLLERFYRERAQDKLLVRVRHWQRETGLQATGARIRHFQ
FT                   SRWASCDANNTLEFHPRVMELPASVQDYVIIHELCHTVEKNHTKAFWGLVASYMPEWQK
FT                   QHQVLERATFGDAV"
FT   gene            17514..18017
FT                   /locus_tag="PSPTO_0012"
FT                   /old_locus_tag="PSPTO0012"
FT   CDS_pept        17514..18017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0012"
FT                   /old_locus_tag="PSPTO0012"
FT                   /product="protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53568"
FT                   /db_xref="GOA:Q88BJ4"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BJ4"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53568.1"
FT                   /translation="MKLLRDARTLKTKAVSSLRTGMQAFNSFDDDGRITTVLLHLQHAC
FT                   EMLLKAVLVQNKAKVFDKETGRSITFDKSLGLCMAHYGLTAEEAGVMRAVDSLRDAAQH
FT                   WFIVVAEDLLYLNTRALITAFDAYLQRALEDALIEHIPARVLPVSTIPARRLRVSGGSR
FT                   ISLG"
FT   gene            17992..18561
FT                   /locus_tag="PSPTO_0013"
FT                   /old_locus_tag="PSPTO0013"
FT   CDS_pept        17992..18561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0013"
FT                   /old_locus_tag="PSPTO0013"
FT                   /product="protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53569"
FT                   /db_xref="GOA:Q88BJ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BJ3"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53569.1"
FT                   /translation="MDREYHLVRELLEPGRRQRDEARARIRSMLAMESIAVEEVEVSER
FT                   DIDRIEKAVRAGQGIKEVFPRLSTVGTRTDGEGVNLLVHFTKKEGAPIRYIGGDDPAEA
FT                   AAVRELDLQKKFYLGAADLAQKVGLTLPKASALRAHLGVDEDVACRDVFEFGSTRIPRF
FT                   SDNAFRRMREALATVDIEDVWRARQR"
FT   gene            complement(18573..18863)
FT                   /locus_tag="PSPTO_0014"
FT                   /old_locus_tag="PSPTO0014"
FT   CDS_pept        complement(18573..18863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0014"
FT                   /old_locus_tag="PSPTO0014"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53570"
FT                   /db_xref="GOA:Q88BJ2"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BJ2"
FT                   /protein_id="AAO53570.1"
FT                   /translation="MVALYQQGGAWLDSGAEEQSMKRAIEQETLAALVETGAAREFRVL
FT                   REGETWRLELRLGAKWLPIRSRREPVRYWRSLTAVGRFCEGVGIKVLTVQF"
FT   gene            19321..19932
FT                   /locus_tag="PSPTO_0015"
FT                   /old_locus_tag="PSPTO0015"
FT   CDS_pept        19321..19932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0015"
FT                   /old_locus_tag="PSPTO0015"
FT                   /product="protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53571"
FT                   /db_xref="GOA:Q88BJ1"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BJ1"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53571.1"
FT                   /translation="MNAREANLIAHRYQARAQAFNDLHALLAPFFRRTPLAASMNEISE
FT                   CVSEALHANTLCGWLPDFGDFDELEALVGEIRRDGGRKRFTSLNDIPTHLREHFDDTDE
FT                   AFTEFANEIREECRDGYDSLLEQQEILNEHLESVRFDQVFAFDEDSLEVETTRLINQVF
FT                   DHLHTEWLAYEKLARSLVGMAHLIDEPDPDKGLTEALLFD"
FT   gene            19968..20435
FT                   /locus_tag="PSPTO_0016"
FT                   /old_locus_tag="PSPTO0016"
FT   CDS_pept        19968..20435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0016"
FT                   /old_locus_tag="PSPTO0016"
FT                   /product="protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53572"
FT                   /db_xref="GOA:Q88BJ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BJ0"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53572.1"
FT                   /translation="MKERAMNNSRTVSTTKELKKAIDDKIGDIIITDAKLATCVKVASN
FT                   IPYKTLAAIIAVAGASAAVFWNPVGWFGAAAGSAAGVGVVASAAAAAGITTGTAAIIGG
FT                   VLVLLAALSVSALAMVKDYDFDAGISASSSGLEGGIPKGKTSAHLKIKRNV"
FT   gene            complement(20738..23143)
FT                   /locus_tag="PSPTO_0017"
FT                   /old_locus_tag="PSPTO0017"
FT   CDS_pept        complement(20738..23143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0017"
FT                   /old_locus_tag="PSPTO0017"
FT                   /product="helicase/SNF2 family domain protein"
FT                   /note="similar to GB:M65060, SP:P26921, PID:149749, and
FT                   GB:AE000666; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53573"
FT                   /db_xref="GOA:Q88BI9"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BI9"
FT                   /protein_id="AAO53573.1"
FT                   /translation="MRMLAHAIKVWNENTGALSHLEIEPLPHQIHLVHHILASGNFNWL
FT                   IADDVGLGKTIETGMLLHALQQRDLAKRILLITPAGLTKQWQEELYHKFKLEDFEIYGE
FT                   DFFINEPRQWKMHDCVIGSMDRLKQVDHLESLLQAEPWDLVIFDEGHRLSRRQYGQKLD
FT                   SSERYDLAKNLRSQTKHMLLLSATPHQGMQDKFVALLELLRPERRTELMMLNLNPEILH
FT                   DMVFRNHKADVTDAEGNFIFQGKITSALQVPSSHESIEFDKTLQAYLRKGYDAGEALGR
FT                   TGNAIGFVMTVYRKLAASSAAAIHRALSNRLQRLLDDEAKGTSKDEPSDERYLGEWEEQ
FT                   FTSDAREFFAGEVQLLKDLIDEAAALKANDLKLKRFIDEIIGKIHTANPDEKVLIFTEY
FT                   RTTQNYLRDALANHYGSDQVDLINGSMQHAERREAIKRFEEQGRFLISTEAGGEGINLQ
FT                   SKCHVMVNYDLPWNPMRLVQRIGRLYRYGQKKKVVVFNIQQADSLDQNIVDLMYERIDS
FT                   VVNDLAEVQQHEFNDGLKDEILGQVAELIDVEDILQQATKLGIDRTRERIDEALKQART
FT                   AAAKQRELFAHAATSDPNELRDELEITVDHLYSFVLGMFDQLGIEVTERSHKERLLRIR
FT                   LSDQVMREMGLSPKASQRMDVTLDRLLASNRPDTHMLDLNSKLMQYLLGKACEYDFGGL
FT                   AAMLQAPELGEGALLGAMLRWQGPQGKRMRQEFVAIQVDDGKAKLNHAKVSQWLMRPAE
FT                   YSVLSPDGQTSKLLFKAAEEMANQRLADASNRYLIPENLDWAAAGWTH"
FT   gene            complement(23290..24099)
FT                   /locus_tag="PSPTO_0018"
FT                   /old_locus_tag="PSPTO0018"
FT   CDS_pept        complement(23290..24099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0018"
FT                   /old_locus_tag="PSPTO0018"
FT                   /product="ISPsy4, transposition helper protein"
FT                   /note="The annotation of this multicopy IS21 family element
FT                   is based in part on an HMM match, the ISFinder database,
FT                   and on positional information.; similar to GP:6009454, and
FT                   GP:17865161; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53574"
FT                   /db_xref="GOA:Q877S2"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q877S2"
FT                   /protein_id="AAO53574.1"
FT                   /translation="MNLQHARLTELCKGLKLERVGVDWPHLAQQAASGEDSFADFLEKL
FT                   LAAETDARSERSRQALLKTAALPAVKTLEQYDFAFATGVPRAQLQELAALSFVGRAENI
FT                   VFLGPSGVGKSHLAIALAYRAVMAGIKTRFVTAADLMLQLTAAHRQERLKEYFSRVVMA
FT                   PGLLVIDEIGYLPFGRDEANLFFNVVAKRYEQGSLILTSNLPFTQWAGTFADDQTLTAA
FT                   MLDRLLHHAHIVQMTGESYRLKDKRKAGTKSSRAEPARKYEPEGGQN"
FT   gene            complement(24096..25118)
FT                   /locus_tag="PSPTO_0019"
FT                   /old_locus_tag="PSPTO0019"
FT   CDS_pept        complement(24096..25118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0019"
FT                   /old_locus_tag="PSPTO0019"
FT                   /product="ISPsy4, transposase"
FT                   /note="The annotation of this multicopy IS21 family element
FT                   is based in part on an HMM match, the ISFinder database,
FT                   and on positional information.; similar to GP:11527916, and
FT                   GP:17865160; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53575"
FT                   /db_xref="GOA:Q877U4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q877U4"
FT                   /protein_id="AAO53575.1"
FT                   /translation="MLTQEQSVEIKVLARQGHGIKFIARELGISRNTVRKYLRKARSLP
FT                   SDKVRPARPCKIDPFKDYLHERIEAARPHWIPATVLLREITALGYSGGVSRLKAYIRPF
FT                   KRKAEEPVVRFETLPGKQIQVDFTTIRRGRQPLKAFVATLGFSRASFVRFSEREDSEAW
FT                   LTGLREAFAYFGGVPEQALFDNAGTIITERDAFGEGQHRWHPRLAALADEFGFIPKVCR
FT                   PYRAQTKGKVERFNGYLKGSFITPLAATLKSAGLTLDVVTANAHIGQWLDEVAHQRIHG
FT                   TTGVQPAVRLAQEQQVLLPLPTQSLRPQPAQGLRLGRVLPYESLQHPLSVYEQLLEVRA
FT                   "
FT   gene            complement(25187..25537)
FT                   /locus_tag="PSPTO_0020"
FT                   /old_locus_tag="PSPTO0020"
FT   CDS_pept        complement(25187..25537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0020"
FT                   /old_locus_tag="PSPTO0020"
FT                   /product="protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53576"
FT                   /db_xref="GOA:Q88BI8"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BI8"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53576.1"
FT                   /translation="MKPLRLTHVPGCWVSQKLPSGQEERRGIVKMAIAKESEDQLQVHW
FT                   FSPEKKLAYVDASAVHSGFQNGMDVVDETPGSGVLSLGQGVIMQQRTLAGSEQVLVDFP
FT                   ERGERHWLSPPL"
FT   gene            complement(25556..27796)
FT                   /locus_tag="PSPTO_0021"
FT                   /old_locus_tag="PSPTO0021"
FT   CDS_pept        complement(25556..27796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0021"
FT                   /old_locus_tag="PSPTO0021"
FT                   /product="protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53577"
FT                   /db_xref="GOA:Q88BI7"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BI7"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53577.1"
FT                   /translation="MEMDWESLLDELWSYAASDPMELETKIRSSLKGHSSEGLLQAISL
FT                   LITQGQHATARTLLSEFLKNHQAAEDIRRRLELILRFKKHRAQQTLSIKSKQRSKELLL
FT                   KDVNSLVASGKLQAAESLLLEAIATFEEPDYLNLLSRVYMRQRRPIDGAKAMQRALVLR
FT                   RQQQAFVEIATEESTDDLPTASDLAFLNDSAESLTTLESPPPPINKALTETADDSLNFI
FT                   QHTASKYPSLKTDGWWEGQLTPSEAPMCLGKPEAGDAPDMASAARADSTEEHAAEDETA
FT                   PSAPIKNILKLTHPRKETEAGEGLTKVKVFNKSGRSLTSIQPTRLDTPEPLDSDGPPSH
FT                   VIPSLVMKASAPTPPIQDQISDENDEDEDEDEDEDGEDLALTDLELDLPTTPQPNLGLE
FT                   ALEDDLDLDHDLYDLTIIELGTGLEEEIRTDLDDFRDIDDDYAAYAFDPDEVFDGEEAV
FT                   AAEPNDWLADKLSREERALQKAAELIGKANWPLSTLSLVQQIFVMSGWGQTRLALEREI
FT                   EKGLVPQELILAAHIKVIWSENDIYWIAFDKNGSSSLSYYALSWPTALLIVRSFESLPQ
FT                   VEEIEVFLESLFASWYENTVLRRAFKAFSRYLWFRFANLEGCLPANQPFDFCDPHELPA
FT                   EEYSDLGLWDVLEIEKTEILRAYGVFKTKHPQEPGCYLSDKPLVEEKPPLNAEKRNKKQ
FT                   HPEDTNTPQETEGEDETLDDCAYEAPSQWSAESLTSALHAQRTDLTLPNIEP"
FT   gene            28478..29323
FT                   /locus_tag="PSPTO_0022"
FT                   /old_locus_tag="PSPTO0022"
FT   CDS_pept        28478..29323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0022"
FT                   /old_locus_tag="PSPTO0022"
FT                   /product="DNA-binding protein"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to PFAM protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53578"
FT                   /db_xref="GOA:Q88BI6"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BI6"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53578.1"
FT                   /translation="MGIGGLLKPLVDFLPKLPTLRTKISSPSISYARLQSDASQVRSKL
FT                   GLGERSVLGYEALIAEFKACGAVLVPVLWGQKQQHKNALHILLPASDVTFVFVNLDTKL
FT                   EDFKFWMAHELAHVYTPELAGSDEGEDFADAFAGALLFPEACVQLAYAEAAQAPSAAGE
FT                   VSVLQQHARHHQISLNTVFQQAQGYAAENNLPSLRVPERTIHAVRNSSTPQLVSTILFD
FT                   PTPPKPAQYIAAASNVFQSEFFLALKRMIREHGTGPSYVQQIMDVSLSDASALYGELAR
FT                   "
FT   gene            29320..29919
FT                   /locus_tag="PSPTO_0023"
FT                   /old_locus_tag="PSPTO0023"
FT   CDS_pept        29320..29919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0023"
FT                   /old_locus_tag="PSPTO0023"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53579"
FT                   /db_xref="GOA:Q88BI5"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BI5"
FT                   /protein_id="AAO53579.1"
FT                   /translation="MSAASTLVLLDTNAYLRLAKRVRPMLGVGFGQKNYVLTILKDVEE
FT                   EVHRSGALKFKFPWFDGEDLAAERVAKQVRLSADEKGQLEAAQSVLRGWVLTNPTVYTT
FT                   AGRSPPSSTDCRVLAFGQIRDAIVVTDDLGMHKLAQDFGIAVWHGHELLKKMLTAKLIT
FT                   NEQVKSIFEALELNGDLTETWRQAKHIAFLKLFGRG"
FT   gene            30850..30987
FT                   /locus_tag="PSPTO_0024"
FT                   /old_locus_tag="PSPTO0024"
FT   CDS_pept        30850..30987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0024"
FT                   /old_locus_tag="PSPTO0024"
FT                   /product="protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53580"
FT                   /db_xref="GOA:Q88BI4"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BI4"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53580.1"
FT                   /translation="MTLTSLTFAKAKTKTKTKTKVRVASARSIASSVSSVHAGRWPGVG
FT                   "
FT   gene            31338..31967
FT                   /locus_tag="PSPTO_0025"
FT                   /old_locus_tag="PSPTO0025"
FT   CDS_pept        31338..31967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0025"
FT                   /old_locus_tag="PSPTO0025"
FT                   /product="hydrolase, haloacid dehalogenase-like family"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:8894803; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53581"
FT                   /db_xref="GOA:Q88BI3"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BI3"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53581.1"
FT                   /translation="MSHVQAVIFDAFGTITRIENARHPFRQLLKLGIAQGRRPKPDDAS
FT                   MLMRHPWGLAQAADHFGIDVTPAELARIQAELDAEVASIQPFADALACIEALQAHGLKV
FT                   AVCSNLARPYGAAVKRIFPGLESYGFSYEIGTLKPDRRIYEAALTELAVDACKVWMIGD
FT                   SQRCDRDGPIALGIKGHYLNRTGAGSPSDFRDLMAFKHSVFESRSP"
FT   gene            complement(32022..33068)
FT                   /locus_tag="PSPTO_0026"
FT                   /old_locus_tag="PSPTO0026"
FT   CDS_pept        complement(32022..33068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0026"
FT                   /old_locus_tag="PSPTO0026"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53582"
FT                   /db_xref="GOA:Q88BI2"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BI2"
FT                   /protein_id="AAO53582.1"
FT                   /translation="MGRKVDTTWYGIYLEAIAFENLSGDKSVGTPELADHLGVKPKTLA
FT                   RIRSAGRFIHEVLPGVKPEQIQCGYASLELLSKLWGADPSGAQSRLESVLANRTKLPEL
FT                   EEAIRRLKLGENKSSTESNLVGPSQLGFMARMDVWIASSDLVHFDSYRGTAFRLKPCLG
FT                   SCPGYLINTENGQPSALVLCKQGSGWRDPAGVARELYEHAIARRHTAPAIWYVFEKDSA
FT                   VLQHLAELSIWWGGSPTSDDPWLLLAYLTESGKLEVLFEEYFYNLIGSMTKGEGALRPN
FT                   DLIATGEAMDGSKACITIPLRNIQPISAATKHRPYSEVLRERLLAIAGQGHATSDQIDR
FT                   LAAIDLGL"
FT   gene            33254..33976
FT                   /locus_tag="PSPTO_0027"
FT                   /old_locus_tag="PSPTO0027"
FT   CDS_pept        33254..33976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0027"
FT                   /old_locus_tag="PSPTO0027"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53583"
FT                   /db_xref="GOA:Q88BI1"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BI1"
FT                   /protein_id="AAO53583.1"
FT                   /translation="MPVRNKGVKPVRDVAKRTKRGRRAYIVPTDRNANGIVAGESFLER
FT                   NHLLLLSLMPGFTRISDQSICVDLENENLLISRQDLPKKDGKKAVAYTADSEIERHDGQ
FT                   IFICESKPSAFLEKHADKHARAERILATYGKQFITFTEEKFSPVFISNLENLKKALSPA
FT                   QKERAAGACEKVGIALKNRKRWPTLELKESGALSNADIFFGLAYGVLSADLSENVFSGD
FT                   GWVNAAHGSLDHLKLMDI"
FT   gene            33978..35933
FT                   /locus_tag="PSPTO_0028"
FT                   /old_locus_tag="PSPTO0028"
FT   CDS_pept        33978..35933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0028"
FT                   /old_locus_tag="PSPTO0028"
FT                   /product="transposase"
FT                   /note="This gene is adjacent to the gene for the
FT                   transposition helper protein.; similar to SP:P13989;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53584"
FT                   /db_xref="GOA:Q88BI0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BI0"
FT                   /protein_id="AAO53584.1"
FT                   /translation="MAAVNEGLISSRRYRVGAALIGADGRSYVIGTINTKARQVVLIGQ
FT                   LGESHVYQDDDFRNTVASGDLRSVVRIETPCGVEEVFEPRFLSPTEIKSRDERQEYIRV
FT                   VEQLIEDFTWKDIYIEIQRRYGSHRTVPSRRSIERYWRIYKESYSPNCLAAHFSDRGVH
FT                   HSLSMEPEVQEIILNVIESKYCSSSRFSIQDIVHAINIRCSEKSAEIGVELGGVSRRTV
FT                   GRFIARLNLKNIKGRLNPRTFRLIMRNACSYLDVKEPYARVEGDSTVLDIFIVDASGNV
FT                   IGCPTFYALIDTATMTIVGIHLTIQAASQVGLMQSLQFAFSPKGEPFKTQWSCMHEWPA
FT                   PADIRTLVLDNGSDCHGPMIVKASQHLGMMLEYCVAGAPYQKPFIERFFGTLNTMLIKK
FT                   LPGAKKSHDKRETHGLEDAQKSATLTIEKLNEVIIRWITDSYHIKKSDRLSEKFGQEFT
FT                   PLQALTRLSQQYVVFPAPSAEELMEACRHYLEVKLSITREGINYQRQFYQNEYVSALFK
FT                   TNSTVKVDVCINPLDCRSVHIYDLGLKEWVTVQNKNPNMPAISFEQAKEIRKAHYKSDF
FT                   ELSGEDYVINHINIIEDANAQKRPKGKIRENQRAQRTVDKANAAAITPEQQLPIAETVL
FT                   AAAPTEIVVAPHRRKK"
FT   gene            35933..36868
FT                   /locus_tag="PSPTO_0029"
FT                   /old_locus_tag="PSPTO0029"
FT   CDS_pept        35933..36868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0029"
FT                   /old_locus_tag="PSPTO0029"
FT                   /product="transposition helper protein"
FT                   /note="This gene assignment is based in part on its
FT                   location adjacent to the gene for transposase.; similar to
FT                   GP:710585; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53585"
FT                   /db_xref="GOA:Q88BH9"
FT                   /db_xref="InterPro:IPR008868"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BH9"
FT                   /protein_id="AAO53585.1"
FT                   /translation="MANEVIKVIRSEGFFHGRMLRSYQRAFQVIEASLAGERQILPMFG
FT                   PSRIGKGEVAQALMADFPTQEVNGKICKPLIRVTAPTEPNQRALTLSIIRGLGGRVLSK
FT                   CSTPDLYDQALRQLEIAKVRAIIVDEVQHLAELHSPQKVRALADFFKVLSDELNISLIL
FT                   LGLPAAERLLGLNEQLRGRSLATELIYPYSWISAADRQDFAAGISLVAAAYSEQGWIFE
FT                   LSGDVAIKSLYASSLGRFGMLVDLFSHAETNNANKIIDVRCLAKAYRNAVNDQPFSGNP
FT                   FTPGTVISDHDLNAAYVKVLREAHLPIPRL"
FT   gene            36881..38767
FT                   /locus_tag="PSPTO_0030"
FT                   /old_locus_tag="PSPTO0030"
FT   CDS_pept        36881..38767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0030"
FT                   /old_locus_tag="PSPTO0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53586"
FT                   /db_xref="GOA:Q88BH8"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BH8"
FT                   /protein_id="AAO53586.1"
FT                   /translation="MSFFQNVALQSGESLNSLLMRKAELNGYGCAQALLGERGLKLAAA
FT                   YSSPELAQICECFELKEEQLSTTLIGQTHYLGQPSYLRNGHSPVCPECLASDGYAKEAW
FT                   SHLLVTACPTHGIVLLGNCPDCEKPISYHRRTLELCDCGYDLRLAVSAQASEFAMKLSA
FT                   LMADAGVGEHKGFTEICRRQGFEPLLPDFLTLLAKHQAQRSGLPMAKPRFSSSSPLQDS
FT                   LVMVGCLESLLSDWPARFDAAMQNQLRSGHGVGLAERIGSWYRELFSTYSSSSFDFVRD
FT                   QFRAQVAEHFDGRLGLNTRAMMFGPDNAEAMQWFSAAEAARLLGVAPDILANLVIKQAV
FT                   IGRVHQEGKSRFVAIHRSMLDQIASARAEYLSATEARRRLNVSKIFFERFVQAGGLRRY
FT                   KRDERPVLVAGEFLATEIDAVVAQLIKRVRKKARVSLPIGIQDISVRHGISNAKIVAVL
FT                   QDILQGTICPTGHVPALPGLAGLQFDQAEIEQRVRDNNPDVALSVDHLAQISGWKPAVI
FT                   KKWIQGGYLNAVEEKHGKAKRDVVPVSALVRFLLTYVPTAEISKQLETKTPYLLQSLRP
FT                   AKIECIVPPQEAGGAHRGLLLRSADLARGAQLRKPTIRDLANQMAQVDFIQC"
FT   gene            39345..40082
FT                   /locus_tag="PSPTO_0031"
FT                   /old_locus_tag="PSPTO0031"
FT   CDS_pept        39345..40082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0031"
FT                   /old_locus_tag="PSPTO0031"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to PFAM protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53587"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BH7"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53587.1"
FT                   /translation="MRIHLLSDLHNEFEPYLPSKLDVDLVILSGDIDIKTRGVAWAGKA
FT                   FTCPVLYVPGNHEYYGGHLTKTLEKMRLACDSHVQILDLEQVVIEGVRFLGATAWTDFS
FT                   ATGNAPLASISAQNLMNDFRQIRTENYRRIRPSDLVERSVNAREWLWARLKEPYDGATV
FT                   VITHHAPSLRSLQDNPHAGGHMDAAYANRWEHLMGSDRANLWVHGHSHTAVDYDVEGTR
FT                   VVCNPRGYPNEDTGFDAGLVLTV"
FT   gene            complement(40884..41852)
FT                   /locus_tag="PSPTO_0032"
FT                   /old_locus_tag="PSPTO0032"
FT   CDS_pept        complement(40884..41852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0032"
FT                   /old_locus_tag="PSPTO0032"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GP:14524331; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53588"
FT                   /db_xref="GOA:Q88BH6"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR011111"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BH6"
FT                   /protein_id="AAO53588.1"
FT                   /translation="MSNRKLSPDKTQPIYAPNNAFLDECVRVEIINILPLKVLRPAVKE
FT                   STKYHQILASIQDVGLVEPPAVTPAPGTSGQYFLLDGHLRIEVLKDLGELKVDCLVATD
FT                   DDTYSYNKRTNRLSAVQSNKMIVRAMERGVSAERLGKALGLSPQTIRQRFRLLNGICAE
FT                   VVALLGDTDCPANVFNLLRQMKPLRQIEAAELMIGNKNLSVLLAKALLAATPPDQLVMI
FT                   KKPSQDHQVSAESMARLERELAALQMQIKTVEEDYGPDVLHLTVIKGYLTKLLANAAVV
FT                   RWLARHQPEYLKEFQSIAELTELPWADNGPEDDLQSTTAEG"
FT   gene            complement(41852..42757)
FT                   /locus_tag="PSPTO_0033"
FT                   /old_locus_tag="PSPTO0033"
FT   CDS_pept        complement(41852..42757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0033"
FT                   /old_locus_tag="PSPTO0033"
FT                   /product="ParB family protein"
FT                   /note="identified by match to PFAM protein family HMM
FT                   PF02195"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53589"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR011111"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BH5"
FT                   /protein_id="AAO53589.1"
FT                   /translation="MTVPLTTRDRIALIPIAEIHILNPRTRNKKIHHELIENIKTVGLK
FT                   RPITVSRRVSTQGSFNYDLVCGQGRLEAFLALEATEIPAFVIDSAEEDCLVMSLVENVA
FT                   RRQHRPIDLMNEVGRLKGRGKTDAEIATIIGSTSSWVNMIVNLIERGEEKLLSAVETGL
FT                   IPLSMATDIARSSESDIQDLLTDAYERGIRGKKITKLRHLLELRAKKDKLVRGNPLGVS
FT                   QNKKKRLTPTDLRHLFEREAERQRLMVKKAAFTHDRVVFSIQAIKELLAVSDFEKLLST
FT                   EHLDSMPKLIQARLSNRGGL"
FT   gene            complement(42754..44310)
FT                   /locus_tag="PSPTO_0034"
FT                   /old_locus_tag="PSPTO0034"
FT   CDS_pept        complement(42754..44310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0034"
FT                   /old_locus_tag="PSPTO0034"
FT                   /product="recombinase, putative"
FT                   /note="identified by match to PFAM protein family HMM
FT                   PF00239"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53590"
FT                   /db_xref="GOA:Q877P4"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:Q877P4"
FT                   /protein_id="AAO53590.1"
FT                   /translation="MRKRLEDYSDGLIAAAEYVRMSTDHQRYSTENQSAAIHAYALSHG
FT                   MDIVKTYRDEGKSGLDIGGRDALRRLLDDVQAGNVQFQIILVYDVSRWGRFQNTDESAH
FT                   YEYLCTSSGIQVVYCAEPFENDGSPLATIYKGIKRSMAGEYSRELSQKVFAGQCRLVEK
FT                   GFHQGGPAGYGLRRALIDEKNEFKAELSRGQQKSIQTDRVILIPGPEAEIEIVQHIYHR
FT                   FIHNGMNEREIANALNADGVLTDFDRPWSRSSVHEVLTNEKYIGNNVYNKTSSKLRKRS
FT                   SRNPPDKWIRCDGAFQGIVSLEVFTCAREIILQRSHRLDDTQMLELLRALLQQAGSLSG
FT                   MLIDEQDNMPSSTVYISRFGGLLRAYTLIGYAPDRDYRYMDINRSLRQLHPQVFEDVIK
FT                   HLENAGASVEISAQNDVLTVNGEWTASVVIARCHSTPAGTLRWKLRFDISLAPDITIAV
FT                   RMERANLQVRDYYLVPLIDMGAWPQKMAEENSPLIDSYCFQTLDVLDGLAARCSLKEAC
FT                   Q"
FT   gene            complement(45183..46736)
FT                   /locus_tag="PSPTO_0035"
FT                   /old_locus_tag="PSPTO0035"
FT   CDS_pept        complement(45183..46736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0035"
FT                   /old_locus_tag="PSPTO0035"
FT                   /product="ISPsy5, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53591"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:Q877T3"
FT                   /protein_id="AAO53591.1"
FT                   /translation="MRPLPDNLPDDPVLLKQMLLESYEARSREQEVKDAYATHIVDLKE
FT                   QIKLLRDRIFGRKSEQTVEPNTPQLALFNEPESEPMLPVGDADEEVVAPAPRRGKRKPL
FT                   SADLPRIEVIHELPEHELTCACGCRKHVVSEETSEQLDIVPMQIRVIKHIRKVYGCRGC
FT                   ESAPVTAGKPAQLIEKSMASPSVLAMLLTTKYVDGLPLHRFETVLSRHGIEIPRQTLAR
FT                   WIIQCGEHLQPLLNLMRDRLLESPVIHCDETRVQVLKEPDRDPTSQSWMWVQASGPPDH
FT                   KVVLFDYTSSRAQDVPLRLLESYRGYVMTDDYAGYNALALQPGVERLACMAHARRKFVE
FT                   AQKVQPKGKTGRADIALTMINKLYGIERELKDGSDEQRFTGRQEKSLPILAQLKSWLDK
FT                   TQSHVTPQSVLGKAVGYLANNWSRLKRYVEAGFLPIDNNPAERAIKPFVIGRKAWLFSD
FT                   TPKGATASAQIYSLVETAKVNGQEPYTWLRHVLERLPLAQSVADYEALLPWNCSPEMPR
FT                   "
FT   gene            complement(46754..47113)
FT                   /locus_tag="PSPTO_0036"
FT                   /old_locus_tag="PSPTO0036"
FT   CDS_pept        complement(46754..47113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0036"
FT                   /old_locus_tag="PSPTO0036"
FT                   /product="ISPsy5, Orf1"
FT                   /note="The gene assignment is based on its position in a
FT                   multicopy insertion sequence, directly adjacent to an ORF
FT                   matching an HMM for the IS66 family.; similar to
FT                   GP:8037784; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53592"
FT                   /db_xref="GOA:Q877K1"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:Q877K1"
FT                   /protein_id="AAO53592.1"
FT                   /translation="MMRPDAKVEKVYLYPKPVDFRKSIDGLAALVELDIKVAVFDPVLF
FT                   VFLNKSRNRVKILYWERNGFCLWLKRLESERFKISPDDVDEAIVLTVQELNWLLDGFDL
FT                   WRNRPHKILTPRFVA"
FT   gene            47448..52358
FT                   /locus_tag="PSPTO_0037"
FT                   /old_locus_tag="PSPTO0037"
FT   CDS_pept        47448..52358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0037"
FT                   /old_locus_tag="PSPTO0037"
FT                   /product="helicase domain protein"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to PFAM protein family HMM PF00176"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53593"
FT                   /db_xref="GOA:Q88BH4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR039442"
FT                   /db_xref="InterPro:IPR041635"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BH4"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53593.1"
FT                   /translation="MSALSSLLDTYRSAAVTEREKGTYFEELICGYLRNEATYRDLYEK
FT                   VWTYAEWAKEQGLSGKDAGIDLVARTQGTGEYHAIQCKLYAEDYKVQKKDIDSFFTASG
FT                   KAPFTHRIIVATTNNWSEHAEDALQGQHQTINKIDLQALEESQIDWAKYQPHQAVVLKA
FT                   RKQLRDHQQTALNATAAGLNDAERGKLIMACGTGKTFTSLKIAERLAGKGKRVLFLVPS
FT                   LSLLSQTLTEWTQESETPLHSFAVCSDSDVGKKRKADEDTVQVFTHELRYPATTKADRL
FT                   AAEMLKRHDAEHMSVVFSTYHSIDVISRAQHEYDLAAFDLVICDEAHRTTGATFDDDDE
FT                   STFVRIHDVDYIRAIKRLYMTATPRIYGDNAKIKAESGEVTLCSMDDEALYGKELFVIN
FT                   FSEAVQRGLLTDYKVLVLTVEESIVNRRLQELLKDEDNQLKVDDAAKIVGCWKALAKQG
FT                   LAENLVGDDQPMKRAVAFCQVISPSYKGTKHKVSSINIASMFQSVVEAYQESENIDEAS
FT                   RIICEAAHVDGCMNASQKEAKLNWLKEEPPANTCRILSNVRCLSEGVDVPALDAVLFLT
FT                   PRNSQVDVVQSVGRVMRNAPGKRRGYVVLPVVIPAGMEPHEALNDNQTYKVVWQVLQAL
FT                   RSHDDSFDAMVNKLDLIGSDPRKMEVIAITDKADKKAKRTSGTSNGQAGKGQYGIGEKR
FT                   PRHDAEGQMTQQAELTYEVGEIEKAIYAKIVEKCGNRHHWEDWANDIAKIARTHIDRIQ
FT                   GILENSANTREKAAFNAFAAELRDDLNDSISDGEIVEMLAQHLVTKPVFDALFDEYSFA
FT                   KHNPMAKAMQGVLDALHEHHLEKEADTLEKFYASVRQRALGIDNAQGKQKIIVELYDKF
FT                   FRNAFPKMTERLGIVYTPVEVVDFILHSVNHLLQQEFGQTLGSKGVHIIDPFTGTGTFI
FT                   TRLIQSGLIKPEELPHKYKHEIHANELVLLAYYIAAINIEAAYHGEVIDGYTPFEGICL
FT                   TDTFQMYEKDDLVDALLVDNSARRKRQKNLDIRVIVGNPPYSEGQKSENDNNANLGYPK
FT                   LDSQIRSTYARQSAATLSKGLYNSYIRAIRWASDRLGESGIVGFVTNAGFLEARFADGM
FT                   RKCLAEEFSNIYIFHLRGLRGKHTSGERAKQEGGQIFGMGSGTAICIFFLVKNTDSERR
FT                   GNIYFHSIEEYLDRDQKLAKLKELQDVSGIAAANGWTEISPDSYGDWLRQREDGFNDFF
FT                   LLGDKKVNSPKLFHSYSQGILTARDTWCFNGSNKKVVKNMGAMIDFYNGEVLRFNKRFN
FT                   GIDQKSRNALVDSFIDANPEKISWTRALKQDLSKGKKFDFQESGMRECLYRPFTKQWIY
FT                   FDRRFNEMVYQMPRIFPNAADHNLMICVSGPGCITGFSAIISKVPVEFCIAAMKGGSQC
FT                   FPLYLYDEPTEGPDQGGLFVTSETPALRRRDAITDEGLTHFEASYQDEKIGKEDLFYYV
FT                   YGILHSQDYRERYADNLSKELPRIPAVRNAADFWVFSKAGRALADLHLNYETVEPYPLT
FT                   IEAKGTLTDADYRVEKMKFAKKGDKTTVIYNHRITLKGVPEAAWDYVVNAKAALSWVME
FT                   RQAVRTDKASGIVNDANDWATETMGNPKYPLELFQRVVTVSLETQKIVNSLPALDIA"
FT   gene            52403..54493
FT                   /locus_tag="PSPTO_0038"
FT                   /old_locus_tag="PSPTO0038"
FT   CDS_pept        52403..54493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0038"
FT                   /old_locus_tag="PSPTO0038"
FT                   /product="conserved domain protein"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:20136471, and GP:20136471; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53594"
FT                   /db_xref="GOA:Q88BH3"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BH3"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53594.1"
FT                   /translation="MQPSKTTVTGLFNSPHQYQIPIFQRGYVWTLEKQVGPLWADIQDR
FT                   ADAVLEQHSLSSTGTNAGLKPLQKHFLGSIVMTPVPNSFGRVAAFEVIDGQQRSTTLQL
FT                   LLLAFRQAALELPGSPIPQMLNGLVRNPGPYQCAEDHYKIWPTQAGQDEMRRLSDAATD
FT                   AQVICNGYPVRDGRVRIERPLMIQTYLYLYHACLAYMRGVDLTDAVNPASDATLGDTLI
FT                   ADIRRHNDVLPLQAGLPLISSRGEALYMALSDLMQIMTLTLEAEDDPQIIFETLNARGE
FT                   PLLASDLVRNYVFLEAARQGKDVPTLYESYWSPFDLVANSGKGVSTNAYWREKERQGRL
FT                   TYPRIDLFFYNYATLRSQEVTLASHVFQSFKTWWQKQPRDLEAELGRLVASSTHFKELV
FT                   SPEGTGYLAEFARLVRSLDVSTVTPVYLALRERLDKDSTELKQALSDLASYLTRRTVCG
FT                   STTKGYNRFFMRVLQSVSAASIDPHLALRETLLAATGTSEIWPDDASFSDKWCHRAVYK
FT                   ELRPVKTCGVLRALEYAARGSQQASNHVPAQSDLTVEHVLPQSWKNLSYYQIESMTEGQ
FT                   SQLRDIAVHGFGNLTLLTQPLNSSISNGPFTDTIGVDGELVLGKRSRLGQSALLLNTYF
FT                   HQSALASWDDVAIENRAKALLKAALLVWPKPVDSTASPVAVASAISRCPDRIVRLFDKE
FT                   GV"
FT   gene            complement(54971..56524)
FT                   /locus_tag="PSPTO_0039"
FT                   /old_locus_tag="PSPTO0039"
FT   CDS_pept        complement(54971..56524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0039"
FT                   /old_locus_tag="PSPTO0039"
FT                   /product="ISPsy5, transposase"
FT                   /note="similar to GP:8037785; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53595"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:Q877T3"
FT                   /protein_id="AAO53595.1"
FT                   /translation="MRPLPDNLPDDPVLLKQMLLESYEARSREQEVKDAYATHIVDLKE
FT                   QIKLLRDRIFGRKSEQTVEPNTPQLALFNEPESEPMLPVGDADEEVVAPAPRRGKRKPL
FT                   SADLPRIEVIHELPEHELTCACGCRKHVVSEETSEQLDIVPMQIRVIKHIRKVYGCRGC
FT                   ESAPVTAGKPAQLIEKSMASPSVLAMLLTTKYVDGLPLHRFETVLSRHGIEIPRQTLAR
FT                   WIIQCGEHLQPLLNLMRDRLLESPVIHCDETRVQVLKEPDRDPTSQSWMWVQASGPPDH
FT                   KVVLFDYTSSRAQDVPLRLLESYRGYVMTDDYAGYNALALQPGVERLACMAHARRKFVE
FT                   AQKVQPKGKTGRADIALTMINKLYGIERELKDGSDEQRFTGRQEKSLPILAQLKSWLDK
FT                   TQSHVTPQSVLGKAVGYLANNWSRLKRYVEAGFLPIDNNPAERAIKPFVIGRKAWLFSD
FT                   TPKGATASAQIYSLVETAKVNGQEPYTWLRHVLERLPLAQSVADYEALLPWNCSPEMPR
FT                   "
FT   gene            complement(56542..56901)
FT                   /locus_tag="PSPTO_0040"
FT                   /old_locus_tag="PSPTO0040"
FT   CDS_pept        complement(56542..56901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0040"
FT                   /old_locus_tag="PSPTO0040"
FT                   /product="ISPsy5, Orf1"
FT                   /note="The gene assignment is based on its position in a
FT                   multicopy insertion sequence, directly adjacent to an ORF
FT                   matching an HMM for the IS66 family.; similar to
FT                   GP:8037784; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53596"
FT                   /db_xref="GOA:Q877K1"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:Q877K1"
FT                   /protein_id="AAO53596.1"
FT                   /translation="MMRPDAKVEKVYLYPKPVDFRKSIDGLAALVELDIKVAVFDPVLF
FT                   VFLNKSRNRVKILYWERNGFCLWLKRLESERFKISPDDVDEAIVLTVQELNWLLDGFDL
FT                   WRNRPHKILTPRFVA"
FT   gene            56961..57347
FT                   /locus_tag="PSPTO_0041"
FT                   /old_locus_tag="PSPTO0041"
FT   CDS_pept        56961..57347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0041"
FT                   /old_locus_tag="PSPTO0041"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53597"
FT                   /db_xref="GOA:Q88BH2"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BH2"
FT                   /protein_id="AAO53597.1"
FT                   /translation="MWGSWIGYDGYWLTKAMTQNTCVATATVTEFGVGEGHLLHQASRW
FT                   LRSGILQNLEVFFRASLASWQQNVLAMIAHYQSFRTAEENTRPGAVRSANRVYPLSPHT
FT                   LYPFPTHPRPPNKAPYPPIAPIKE"
FT   gene            57351..58214
FT                   /locus_tag="PSPTO_0042"
FT                   /old_locus_tag="PSPTO0042"
FT                   /note="This region contains a match to at least one other
FT                   gene that is not full length,and is not the result of a
FT                   sequencing artifact; competence protein comM, truncation;
FT                   similar to SP:P45049; identified by sequence similarity;
FT                   putative"
FT   gene            58344..59906
FT                   /locus_tag="PSPTO_0043"
FT                   /old_locus_tag="PSPTO0043"
FT   CDS_pept        58344..59906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0043"
FT                   /old_locus_tag="PSPTO0043"
FT                   /product="cytidine/deoxycytidylate deaminase family
FT                   protein"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to PFAM protein family HMM PF00383"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53598"
FT                   /db_xref="GOA:Q88BH1"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BH1"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53598.1"
FT                   /translation="MAAPDFRLIASANSNKGGHFDDIGAIGKTITPEIVIALCGPMGTP
FT                   LHDVAKTFQELLLGTDYNYEKVNIIRLSDEIRKQKSLTGEKSILKLIEAGNKLREEHGN
FT                   EILARFAIRRITLEREEAQQAAEKIQEPDLFDTSGSPPTPKITVRYCHIIDSIKHIDEL
FT                   RLLRSVYGDMLHVVGVYSPIELRITRLERYKGQGDQIHDLIDRDSGEEMDHGQRVEDTF
FT                   PQADFFLRVEKTTDTHRKGRVKRFLDLILGTVIATPTLNERAMYAAFSAARNSACLSRQ
FT                   VGAAITSEEGEILATGWNDVPKAFGGLYQTESYGSSPDEDRRCWNLEGGRCSNDQEKEV
FT                   ISNAIVDLLSSEGLIDEANREKVYKAIRKKSQLKSLIEFSRAVHAEMHALLSAGSTDGG
FT                   KIRDGKLFVTTYPCHSCARHIVAAGVREVYFLEPYRKSLATKLHEDAITENENETDKVR
FT                   VMPFDGVAPSRFLRFFSAHPKGRKNSEGVMQTREAHPVAFVTMEAIPTLESLIVQGLSS
FT                   RGI"
FT   gene            complement(60407..61423)
FT                   /gene="hopK1"
FT                   /locus_tag="PSPTO_0044"
FT                   /old_locus_tag="PSPTO0044"
FT   CDS_pept        complement(60407..61423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hopK1"
FT                   /locus_tag="PSPTO_0044"
FT                   /old_locus_tag="PSPTO0044"
FT                   /product="type III effector HopK1"
FT                   /note="previously known as HopPtoK (PMID12032338;
FT                   Petnicki-Ocwieja et al, 2002) and HolPtoAB (PMID11872842;
FT                   Guttman et al, 2002); similar to GP:1008894; identified by
FT                   sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53599"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BH0"
FT                   /protein_id="AAO53599.1"
FT                   /translation="MNRISTSSVNSSFNYTAPTEEAQNRFASAPDNSPLVVTTTSIAQA
FT                   SEGLQRPGATLSMQAQRLRQLMGSPSEQCRRDTMLAKAFDAQRLNINTQAGSSNSPHLN
FT                   ALNTLQQRHFKPAAGGLEIPVTSNSLLGGGRQVYQIGSSSRELSHRPVNDQDRAPFRAL
FT                   ERLHAELFRGGPIEFVPRGSNVLASNVRDVDMDEFDVINSKDGCQGIGTTGLGPCIAVC
FT                   ARGMDREGLPVLGVYHHSGIGSPEDTMATLDQAMRDKGALQIKYSLVGGMIMPKEEEAG
FT                   SYDDEQSFLALKGSYSIEGARLHVSEGEEDVHTGEDNSVNVLLMPDRVLYGRDTLYC"
FT   regulatory      complement(61504..61536)
FT                   /bound_moiety="HrpL"
FT                   /note="PMID:17073300"
FT                   /inference="nucleotide motif:HMM2"
FT                   /experiment="microarray and/or RT-PCR"
FT                   /regulatory_class="promoter"
FT   gene            61526..61684
FT                   /locus_tag="PSPTO_0045"
FT                   /old_locus_tag="PSPTO0045"
FT   CDS_pept        61526..61684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0045"
FT                   /old_locus_tag="PSPTO0045"
FT                   /product="protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53600"
FT                   /db_xref="GOA:Q88BG9"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BG9"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53600.1"
FT                   /translation="MQFLAYWEIFALWQAVEIRRMRPSITPCVIKPIATYAVTADRFHS
FT                   PAASADA"
FT   gene            62078..64063
FT                   /locus_tag="PSPTO_0046"
FT                   /old_locus_tag="PSPTO0046"
FT   CDS_pept        62078..64063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0046"
FT                   /old_locus_tag="PSPTO0046"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:12719019, and GP:12719019; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53601"
FT                   /db_xref="GOA:Q88BG8"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR022602"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034139"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BG8"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53601.1"
FT                   /translation="MLIESAVLSGFRCFAPRPISVTISPKITTIVGPNAAGKTALLHAL
FT                   AKLFGVTRAQRTVRRSDFHLGPDDDPTSLESKHLYIEVLIALPELIDGTATPETIAPSF
FT                   RHMLIERPDDAPVCRLRLDAQWEDDGTVEGEVSQTLHWVDTLDDAPPEDKCHPVSVADR
FT                   GLIQLYYTPASRDAAAQTRATAGALAARLLRAIEWSSDTEEAVHDATENLASAFEEEAA
FT                   IAAITEALQTRWSALHDDVVDTNPRLSLVSRRFEEVVNKIAVMFEQGPDGQERGIEALS
FT                   DGQQSLFYFALAAAVFDLEREVVAGSIEGFRSDALRIPALTIFALEEPENHLSPYFLAR
FT                   IIRQVRSLTTDGSAQAIVTSHSPAVLSRVNPTEVRYCRCDPKTRVSTVKRIKLPVNDVE
FT                   ASKFVRGAMLAYPELYFARFVLLVEGDSERIVLPRLAEALNLLIDPAFVAIVPLGGRHV
FT                   QHFWRLLKHLGIPHATLLDLDLGRDGGGFGRVKTAIEKLIEFGAPKAEVLRITTGILSD
FT                   ADLANMHNWPDSVDHSGLLSWINNNLKAHGVYFSSPLDLDLAMLEAFPAAYAAIVPERG
FT                   GSRMAADKAAEVVLGTAGPGLKAYTGPFVGYPPQFPSYRYHFLTNSKPATHLAALTHIT
FT                   KAQLVAHMPVVLASVLKHISASLRRD"
FT   gene            64066..65970
FT                   /locus_tag="PSPTO_0047"
FT                   /old_locus_tag="PSPTO0047"
FT   CDS_pept        64066..65970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0047"
FT                   /old_locus_tag="PSPTO0047"
FT                   /product="UvrD/REP helicase family protein"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53602"
FT                   /db_xref="GOA:Q88BG7"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BG7"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53602.1"
FT                   /translation="MTLSSRRVSSENWKPVGVKSLEKHAFEVVCSHVNRSVIAGPGAGK
FT                   TELLAQRAAYLLQTGAAPAPRRILAISFKRDAASNLASRVRKRCHPDHAGRLDSMTFDA
FT                   FAKSLVDRFGQSLPERWRPRPDYEITSYYERDYKDFLFQDVGLPPTTIGTRADLRAVGP
FT                   KIFERNYVLGQPLPIDGWLCPTVGQWAADLFWRASLHGGEKSVLSFPMIGRLAELLLRV
FT                   NSMARDALRLTYSHLFMDEFQDTTQVQYDLVSTIFRGTDTVLTAVGDNKQQIMRWAMAM
FT                   DDPFSEFDADFSAKRTSLYNNYRSSPDLVRIQHILAQALDIAAVEPISQTAGTINEESC
FT                   TVFDFPSPHAEAHNLAVSVASNIASGKLTPRDFVLLVRQKAGEYAEVLEPAFTAQGLSL
FT                   RNEAGLVGAIMLQELLVEEVSVLLVSLLRLSMTLRAGRYWSECQKWMASLRGVEFDDEI
FT                   GHSKLTRELDACAIWLGANRSSLPTTLKAARSLVDEVMGFVGLGHLKSRHPAYAQGEWL
FT                   EKVLDAAATHLFNCAIKCADWPSALDTYEGVNAIPLMTIHKSKGLEYHTVIFVGLDDGA
FT                   WWSFSNDEIEATAGFFVAFTRAKQRVIFTYCAKRGGRTKIATLYHLLQTAGVQITQIS"
FT   gene            67445..68611
FT                   /locus_tag="PSPTO_0048"
FT                   /old_locus_tag="PSPTO0048"
FT   CDS_pept        67445..68611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0048"
FT                   /old_locus_tag="PSPTO0048"
FT                   /product="protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53603"
FT                   /db_xref="GOA:Q88BG6"
FT                   /db_xref="InterPro:IPR031009"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BG6"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53603.1"
FT                   /translation="MAAIPVEYHGREQAYVKHTILKTYLQRLFMIIGRNETVINYVDCF
FT                   AGPWSEESEDLRDTSIGISLKLMKDCAKSLEEVHGCKVKFRALYIEKNKEAFSKLKSFL
FT                   DDDSSSCVAADCIQGDYTTKIPEIAAWASHNFTFFFIDPKGWRKVINAPVLAPLLALKK
FT                   AEFLINLMYDFINRAMSMKAQQANVEELLGKPVSFSGKESATERQRIIVAQYRQAIGSL
FT                   YGGRSAHVTVERPGMDRVLYFLIYLTRHPKGLIVFKEAAEQMHMIQRVSQFETKLRHQS
FT                   SKRAPIDDLFGTIEEPPEATAAQDNRTLAKTFLLTKLSASPMLIDNECWAGFLEETDLY
FT                   PTDFQLAFKELVKEGKIYNLDTDVEGRTKKPVRPNWPRASERWALCAE"
FT   gene            68863..69606
FT                   /locus_tag="PSPTO_0049"
FT                   /old_locus_tag="PSPTO0049"
FT   CDS_pept        68863..69606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0049"
FT                   /old_locus_tag="PSPTO0049"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53604"
FT                   /db_xref="GOA:Q88BG5"
FT                   /db_xref="InterPro:IPR011101"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BG5"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53604.1"
FT                   /translation="MSTQTSIEWTEMTWNPIVGCTKVSPGCKHCYAENMAHRLQAMGTP
FT                   GYENGFKLSLRPEKLREPLQRKKPTIYFVNSMSDLFHEKVPDHYIDQVFEVIREATQHT
FT                   FQILTKRAERLADYFSKRTPPTNAWLGVSVEDKAYGVPRIDCLRRVNATIRFLSAEPLL
FT                   EDLGEIDLTDIHWVIVGGESGNKARPMQQEWVDNIHRQCDVSGSAFFFKQWGGWGADGV
FT                   KRSKKANGRLLNGQTWDEIPLLNLA"
FT   gene            69623..70954
FT                   /locus_tag="PSPTO_0050"
FT                   /old_locus_tag="PSPTO0050"
FT   CDS_pept        69623..70954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0050"
FT                   /old_locus_tag="PSPTO0050"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53605"
FT                   /db_xref="GOA:Q88BG4"
FT                   /db_xref="InterPro:IPR031009"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BG4"
FT                   /protein_id="AAO53605.1"
FT                   /translation="MAKDEKYKWNISTGTYPQIDPHSKIKHKIIEDYIRTYITVVMSNQ
FT                   RIPKIGINIIDGFCGGGVYQDDDGMGIHYGSPIIALDTVRQTVAELNILRRQDREVAAN
FT                   YYFVDIKKDNIDYLRGVLFERGYSHLIDQNVFLLKSRFTNALPALINKIKKFKLSERAL
FT                   FLLDQYAYKDVPFSSIRTIFNEVDNAEVLLTFNVDSLIDYLSERDENRKALQNIDLEKY
FT                   IPWEKLPSFKATMRREWQHLIQRFLAEGILKESGAEFMTVFFITPFGSNPRTYWFIHLA
FT                   NSYRANAVMKEIHWKYGNHFSHSMTPALFVGYDTKRDIQVTDQRNLGFGEEHFFDGVTG
FT                   KRIETELSELLPRKIYDRPTQSFRMMMRGMANGTMANESIVREALHLPILCKDIEVFDK
FT                   DRRTKRRKGSSIKSTDILMPASQRTMFFTPSVSVPRKAQSDADD"
FT   gene            71041..71484
FT                   /locus_tag="PSPTO_0051"
FT                   /old_locus_tag="PSPTO0051"
FT   CDS_pept        71041..71484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0051"
FT                   /old_locus_tag="PSPTO0051"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:17430647; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53606"
FT                   /db_xref="GOA:Q88BG3"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BG3"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53606.1"
FT                   /translation="MVGKKLVWVTVVTHVLIFAGWAQAQQPAAVAQRPVSVPYEVTEGT
FT                   FLNLTLERVDPNYVAAMVYENVYDDYENVAIARGSRLFGRLINKINDSHDVYFTQLQLS
FT                   TGQTLSLDPPLQATSPLGSAGITDFKPAAIAGTIWRRDQVMPH"
FT   gene            71711..73480
FT                   /locus_tag="PSPTO_0052"
FT                   /old_locus_tag="PSPTO0052"
FT   CDS_pept        71711..73480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0052"
FT                   /old_locus_tag="PSPTO0052"
FT                   /product="protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53607"
FT                   /db_xref="GOA:Q88BG2"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BG2"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53607.1"
FT                   /translation="MTEAVTRCNFAYGRPDLRNPDPKTQDWSGDYIVWWYGPAMRNNRA
FT                   MSIPLAVVLFRRLKDNVPGDFKVAYIPFTSLPHYRVGTIWRNGRCISDTELDTERLAVN
FT                   FNAGKWRTTSRRALIASGQGHLFADEEYPLILGNDDRCKLLNFSLDDGRNLLIPCTEYF
FT                   VRAYARNMEICRALANLRWSDVSNVLFQNPVAERNLPVWLVRPGPRMRFFDAVFLAHIL
FT                   YDPRTTSAVKRVNSQFISQSPGKPILLECRPWLEGPGEILARGKWLNGGKTFLCLDLMG
FT                   TNMPKGPEVEFQKLKFDSSEGVDGLGRLVLPRPIKSAALEEFLQERSTVEPDRHAEIYE
FT                   AKAAPFKVLGAKRPVKKTKSVVKANKSRLGPAPPEADGVSAGTGTGSGKQVGKLETVSD
FT                   EEHEAALDVVLEIQGFFMDIWKALKSIGAENPKQILRVDWYTPVARFSSKPPLGIVELA
FT                   VENEEDLPSDVRSWLYLDRSAGLRRGILIVRIKTIKGNYFCVEVQRKDGKKGEIPPGSA
FT                   GLLMKFSENEEAFKNFVNELCRRIVGYRGVFSKLNKLYPADYVTFNHGKHDKEILYRSI
FT                   LINKFSELGITLS"
FT   gene            complement(73641..75086)
FT                   /locus_tag="PSPTO_0053"
FT                   /old_locus_tag="PSPTO0053"
FT   CDS_pept        complement(73641..75086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0053"
FT                   /old_locus_tag="PSPTO0053"
FT                   /product="protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to PFAM protein family HMM PF03110"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53608"
FT                   /db_xref="GOA:Q88BG1"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BG1"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53608.1"
FT                   /translation="MVSVEHLARCECDGCGRAIEQPKRIYQEKRYCGNCYPRLFKRRLC
FT                   PACGNFARLPTFDKTARCSACLRRGSCARCNKVDFKIGRITPYGPVCKPCAVHFREPAI
FT                   CDACGTLSQRTARNSLTGRLLCPKCSGPAAETCPDCRRHRVLISELDGRKRCKVCIEQG
FT                   VLACATCGVSTPAGRGKECERCYWERTFQKRLAINTSGLSVLSMAQRFERFGNWVLLEL
FT                   GPKAAALKINTYYKFFKELENVWQGVPQYSQLLRHFSAEGLRRSRVPMSWLSEFDGLVV
FT                   CEQAREEDSEHRRVQGIMEQPRESWPQQLITGYHRMLQSRLAAGDISLRSIRLALRSAS
FT                   DLLDHSRLKAAAMIDQKVLDGYWRKSPGHVASVTGFVGYLNQVYNAGLNSRPDPRWARQ
FT                   QKQAKRERELVELLPQRDETSDFESRWIVKALAYFHGIGRVSRKGLVYTPATYQGTAGF
FT                   NIECSQRVLWVPSASTYERTIEE"
FT   gene            complement(75073..75684)
FT                   /locus_tag="PSPTO_0054"
FT                   /old_locus_tag="PSPTO0054"
FT   CDS_pept        complement(75073..75684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0054"
FT                   /old_locus_tag="PSPTO0054"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53609"
FT                   /db_xref="GOA:Q88BG0"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BG0"
FT                   /protein_id="AAO53609.1"
FT                   /translation="MQPELLRAGASLSDCYRCGAALSDGARCDAAEAALAFQIYVDENI
FT                   GRWPLYGSSPLDFRDWLTVARTLVSFAQAAVRRHSAAAERFFESLGIPLESLQPIPLGL
FT                   PLEYLSPAERSVLLSIVWVIMSAGPQRFIEAARHESLPASTLHLPTSGSPPVLLDLVAA
FT                   LQSPRHHLVSGVDREHPSSPAQTLRMWLRLKRKVRRRGIR"
FT   gene            75949..76971
FT                   /locus_tag="PSPTO_0055"
FT                   /old_locus_tag="PSPTO0055"
FT   CDS_pept        75949..76971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0055"
FT                   /old_locus_tag="PSPTO0055"
FT                   /product="ISPsy4, transposase"
FT                   /note="The annotation of this multicopy IS21 family element
FT                   is based in part on an HMM match, the ISFinder database,
FT                   and on positional information.; similar to GP:11527916, and
FT                   GP:17865160; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53610"
FT                   /db_xref="GOA:Q877U4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q877U4"
FT                   /protein_id="AAO53610.1"
FT                   /translation="MLTQEQSVEIKVLARQGHGIKFIARELGISRNTVRKYLRKARSLP
FT                   SDKVRPARPCKIDPFKDYLHERIEAARPHWIPATVLLREITALGYSGGVSRLKAYIRPF
FT                   KRKAEEPVVRFETLPGKQIQVDFTTIRRGRQPLKAFVATLGFSRASFVRFSEREDSEAW
FT                   LTGLREAFAYFGGVPEQALFDNAGTIITERDAFGEGQHRWHPRLAALADEFGFIPKVCR
FT                   PYRAQTKGKVERFNGYLKGSFITPLAATLKSAGLTLDVVTANAHIGQWLDEVAHQRIHG
FT                   TTGVQPAVRLAQEQQVLLPLPTQSLRPQPAQGLRLGRVLPYESLQHPLSVYEQLLEVRA
FT                   "
FT   gene            76968..77777
FT                   /locus_tag="PSPTO_0056"
FT                   /old_locus_tag="PSPTO0056"
FT   CDS_pept        76968..77777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0056"
FT                   /old_locus_tag="PSPTO0056"
FT                   /product="ISPsy4, transposition helper protein"
FT                   /note="The annotation of this multicopy IS21 family element
FT                   is based in part on an HMM match, the ISFinder database,
FT                   and on positional information.; similar to GP:6009454, and
FT                   GP:17865161; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53611"
FT                   /db_xref="GOA:Q877S2"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q877S2"
FT                   /protein_id="AAO53611.1"
FT                   /translation="MNLQHARLTELCKGLKLERVGVDWPHLAQQAASGEDSFADFLEKL
FT                   LAAETDARSERSRQALLKTAALPAVKTLEQYDFAFATGVPRAQLQELAALSFVGRAENI
FT                   VFLGPSGVGKSHLAIALAYRAVMAGIKTRFVTAADLMLQLTAAHRQERLKEYFSRVVMA
FT                   PGLLVIDEIGYLPFGRDEANLFFNVVAKRYEQGSLILTSNLPFTQWAGTFADDQTLTAA
FT                   MLDRLLHHAHIVQMTGESYRLKDKRKAGTKSSRAEPARKYEPEGGQN"
FT   gene            complement(78120..79010)
FT                   /locus_tag="PSPTO_0057"
FT                   /old_locus_tag="PSPTO0057"
FT   CDS_pept        complement(78120..79010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0057"
FT                   /old_locus_tag="PSPTO0057"
FT                   /product="transposition helper protein"
FT                   /note="This gene assignment is based in part on its
FT                   location adjacent to a gene for transposase.; see
FT                   PMID:20190049 for expression data; similar to GP:710585,
FT                   GB:L26976, GB:L27490, GB:L27490, GB:L27488, GB:L27489,
FT                   GB:S69200, GB:S69326, GB:U13216, GB:U13214, GB:X83860,
FT                   GB:X83859, GB:X83857, GB:X83861, GB:X83858, GB:X83862,
FT                   GB:X83863, GB:U13217, GB:U13215, GB:U13218, GB:S68874,
FT                   GB:L32660, GB:S68875, SP:P43115, PID:1199761, PID:483352,
FT                   PID:532738, PID:532740, PID:532742, PID:532744, PID:532746,
FT                   PID:633208, PID:633210, PID:633212, PID:633214, PID:633216,
FT                   PID:633218, and PID:633220; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53612"
FT                   /db_xref="GOA:Q88BF9"
FT                   /db_xref="InterPro:IPR008868"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BF9"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53612.1"
FT                   /translation="MSTYDHIHPDFRPVLQLSDRERILFIGEERWIGYALARTILDTLN
FT                   DLIVMPKRARMPNLLIVGDSNNGKTTVIRRFQKTHGEGYVDENDDPVRPLILAEAPSTA
FT                   DEKALYVALLEQLWMPYRITDTKLALRYQVIHSFRELKVRMLIIDEFHSLLTGSAIKQR
FT                   EVMNALKSLCNELVIPIIGVGTTDAVRILHHDPQHASRFDVIKLDQWKLDPEFQRMLKG
FT                   FESILPLKKPSGLAHPDKARRVHAISGGNLGNVHRLLMECSKQAIVSGKECIDIELIES
FT                   MSWLRPTRGIREQSL"
FT   gene            complement(79007..80794)
FT                   /locus_tag="PSPTO_0058"
FT                   /old_locus_tag="PSPTO0058"
FT   CDS_pept        complement(79007..80794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0058"
FT                   /old_locus_tag="PSPTO0058"
FT                   /product="transposase"
FT                   /note="This gene is adjacent to a gene for a transposition
FT                   helper protein.; see PMID:20190049 for expression data;
FT                   similar to GP:11071900, and SP:P13989; identified by
FT                   sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53613"
FT                   /db_xref="GOA:Q88BF8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BF8"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53613.1"
FT                   /translation="MIGTEVETGRSAALQIIDLRAVDPEKLDGLYVNHDISSISSDAWA
FT                   IAQKRYSAILPLLGNTVLSKETVAARAKATGISPATLYRWLDRYSRWNEVLALVPRKRG
FT                   WREGSTRLSVEGEKLVQDVLDDYYLTVQRYTVQSTISEIERRARALDIQPPGASAIRAR
FT                   IRQIPEVVKLRRRGYAEQANNRHTPSVGQFPDEGYPLAVVQIDHTPVNLIVVDERHRKP
FT                   IGRPWLTLAIDVYSCMIVGYYLAFEAPSETSVAMCIAHSILPKEAWLAAHDIRGEWPVW
FT                   GFPRTIHTDNGADFRAQNIVDSCKNYGIDSVFRPSKVPKYGGRIERVLGTFMRMVHELP
FT                   GTTFSNPQEREGYDSDAKAVLTMAEFEVWLVRSILKYHQTYHKKIHMSPARKWQLAFFG
FT                   NREVDPLVSVPARPTDPLAVQLDFLPSVRRTVQTYGVQWDLFYYSEALRHWINQKDPAT
FT                   GKAIKLLFRRDPRDVSVIWFYDPVLKQYFRVPASYQAFPAVTLWEYHAAKDKAVSEGRG
FT                   NIDDALIAEYAVENRKLVEEASATSKRARKDAQKSRTHSKKGTPAQPTKPVAKLVLDLV
FT                   QEDSDLLMLSEVESTGEVE"
FT   gene            complement(80922..81542)
FT                   /locus_tag="PSPTO_0059"
FT                   /old_locus_tag="PSPTO0059"
FT   CDS_pept        complement(80922..81542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0059"
FT                   /old_locus_tag="PSPTO0059"
FT                   /product="protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53614"
FT                   /db_xref="GOA:Q88BF7"
FT                   /db_xref="InterPro:IPR014832"
FT                   /db_xref="InterPro:IPR014833"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BF7"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53614.1"
FT                   /translation="MAFKGLGGVAFESSLERDFLKRMRFSHQVESVISQPVEVPFTDSL
FT                   GRPQIYTPDYLVFYHQQHLPYFGAMQPLLVEVKPREQWVENWRDWSGKWKEARRLARSQ
FT                   GWQFRIYDESRIRGLPLENIVFLERFERMIFEQGDIVAVLKTLREMEVAPVHYLLARHF
FT                   NGIFRDRGVSLLWHLIATRQVDCDITEPLNHDLELWVPDNETV"
FT   gene            81816..82382
FT                   /locus_tag="PSPTO_0060"
FT                   /old_locus_tag="PSPTO0060"
FT                   /note="This region contains a match to at least one other
FT                   gene that is not full length,and is not the result of a
FT                   sequencing artifact; magnesium chelatase family protein,
FT                   truncation; similar to SP:P45049; identified by sequence
FT                   similarity; putative"
FT   regulatory      82447..82478
FT                   /bound_moiety="HrpL"
FT                   /note="PMID:17073300"
FT                   /inference="nucleotide motif:HMM2"
FT                   /experiment="microarray and/or RT-PCR"
FT                   /regulatory_class="promoter"
FT   gene            82500..83363
FT                   /gene="hopY1"
FT                   /locus_tag="PSPTO_0061"
FT                   /old_locus_tag="PSPTO0061"
FT   CDS_pept        82500..83363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hopY1"
FT                   /locus_tag="PSPTO_0061"
FT                   /old_locus_tag="PSPTO0061"
FT                   /product="type III effector HopY1"
FT                   /note="Previously known as HolPtoY (PMID11872842; Guttman
FT                   et al, 2002) and ORF11 (PMID11854524; Fouts et al, 2002).;
FT                   similar to GP:19071534; identified by sequence similarity;
FT                   putative; see PMID:20190049 for expression data; Previously
FT                   known as HolPtoY; PMID1187284, Guttman et al, 2002; and
FT                   ORF11; PMID11854524, Fouts et al, 2002; ., see
FT                   PMID:20190049 for expression data; similar to GP:19071534,
FT                   identified by sequence similarity, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53615"
FT                   /db_xref="GOA:Q88BF6"
FT                   /db_xref="InterPro:IPR018581"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BF6"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53615.1"
FT                   /translation="MNITPLTSAAGKGSSAQGTDKISIPNSTRMINAASIKWLNKVRSA
FT                   ISDHIRTSIEKGKLFELASLGSNMFGVPALSARPSTLQPVLAFEADPNHDLNLVRVYMQ
FT                   DSAGKLTPWDPTPNAVTTTSNPSEPDAQSDTASSSLPRRPPAGSVLSLLGIALDHAQRH
FT                   SPRADRSAKGRPGREERNGARFNAKQTKPTEAEAYGDHQTPNPDLHRQKETAQRVAESI
FT                   NSMREQQNGMQRAEGLLRAKEALQAREAARKQLLDVLEAIQAGREDSTDKKISATEKNA
FT                   TGINYQ"
FT   gene            complement(83552..84859)
FT                   /locus_tag="PSPTO_0062"
FT                   /old_locus_tag="PSPTO0062"
FT   CDS_pept        complement(83552..84859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0062"
FT                   /old_locus_tag="PSPTO0062"
FT                   /product="citrate transporter"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53616"
FT                   /db_xref="GOA:Q88BF5"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR014738"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BF5"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53616.1"
FT                   /translation="MLTFLGFAMVIAFMYLIMSKRLTALIALILVPIIFALFGGFAAQI
FT                   GPMMLAGITKLAPTGVMLMFAILYFALMIDSGLFDPAVRKILKMVKGDPVRISVGTAVL
FT                   ALVVSLDGDGATTYMICVAAMLPLYSRVGMSPRIMAGLIILAGGVMNMTPWGGPTARAA
FT                   SALHVDASDIFVPMIPAMLAGVVAILAIAYFYGKRERARLGELHLKGDEVDHSEISVSQ
FT                   FPDARRPKLIWFNGALTLALMVALIMGLLPLPVLFMIAFSIAMIINYPNLQDQKDRVSA
FT                   HAGSVLAVVGLIFAAGIFTGILTGTGMVDAMSKSLLAVIPDALGPYLAVITALVSMPFT
FT                   FFMSNDAFYYGVLPVLSEAAAHYGISPVEMARASIVGQPVHLLSPLVPSTYLLVALAGI
FT                   EFGDHQRFTLKWAVLVCMCILVAALLMGIFPFYSSM"
FT   gene            85159..85557
FT                   /locus_tag="PSPTO_0063"
FT                   /old_locus_tag="PSPTO0063"
FT   CDS_pept        85159..85557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0063"
FT                   /old_locus_tag="PSPTO0063"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53617"
FT                   /db_xref="GOA:Q88BF4"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BF4"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53617.1"
FT                   /translation="MSEIHAGGCHCGRLRYQFDAPLKDIAHCHCSICWRTSGATVVTWI
FT                   SVPLASFKWLTGSPAAYDSAATCVRYFCGNCGAHMALFTRNSPNEMDVTIATLDQPELA
FT                   VPSRHIWIENRLPWLHLDEDLPGDEGEP"
FT   gene            complement(85784..87181)
FT                   /locus_tag="PSPTO_0064"
FT                   /old_locus_tag="PSPTO0064"
FT   CDS_pept        complement(85784..87181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0064"
FT                   /old_locus_tag="PSPTO0064"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to PFAM protein family HMM PF04073"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53618"
FT                   /db_xref="GOA:Q88BF3"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="InterPro:IPR014627"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BF3"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53618.1"
FT                   /translation="MTEVAHVNDSHHAPPVIRQLLEKLAISYNEVMDDKSLPPARKVQA
FT                   VLVEDAVGALLILFPQSQLLDLSRITELTGRQLTAVPHDRLARMLTKHSLQVLPGLPAL
FT                   TSSPCLYDDRLLQEPTLLVGSGEAGLLLEISSDDFKGMLSKASAAHFGQSVAAIHPNLD
FT                   RPDDDPAEITQAMRAFTARRIQQRLEATLEIPPLAGTAQKIIKLRVDPDATIDDITGVV
FT                   ETDPALAAQVVSWAASPYYASTGKIRSVEDAIVRVLGFDLVINLALGLALGKTLSLPKD
FT                   QPQQTTPYWQQSIYTAAVIEGLTRAIPRAKRPEGGLSYLAGLLHNFGYLLLAHVFPPHF
FT                   TLICRQLEVNPHLHHSYIEHHLLGISREQIGAWLMRYWDMPDELSTALRFQHDPHYAGE
FT                   HYAYANLVYLAVRLLRANGVGAGPEQEIPDELFDRLGLSREKANESVKKVLEAEVLLRE
FT                   LASQFSK"
FT   gene            complement(87268..89343)
FT                   /gene="recG"
FT                   /locus_tag="PSPTO_0065"
FT                   /old_locus_tag="PSPTO0065"
FT   CDS_pept        complement(87268..89343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="PSPTO_0065"
FT                   /old_locus_tag="PSPTO0065"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P24230; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53619"
FT                   /db_xref="GOA:Q88BF2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BF2"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53619.1"
FT                   /translation="MSELSRVSVTALKGVGEAMAEKLAKVGLENLQDVLFHLPLRYQDR
FT                   TRIVPIGALSPGQDAVIEGVVSGADVVMGKRRSLLVRLGDGTGVVSLRFYHFSNAQKES
FT                   MKRGTHLRCFGEARPGASGLEIYHPEYRAITGDEPPPVEQTLTPIYPTTEGLTQQRLRQ
FT                   LCQQSLAMLGPKSLPDWLPEELARDYQLAPLDDAIRYLHHPPADADVDELALGHHWAQH
FT                   RLAFEELLTHQLSQQRLRESLRSQRAPALPVAKKLPKQFLANLGFAPTGAQQRVGKEVA
FT                   YDLSQPEPMLRLIQGDVGSGKTVVAALAALQALEAGYQVALMAPTEILAEQHYINFQRW
FT                   LEPLGVDVAWLAGKLKGKARVTSLEQIATGTPMVVGTHALFQDEVQFKNLALVIIDEQH
FT                   RFGVQQRLALRKKGIGGLMCPHQLIMTATPIPRTLAMSAYADLDTSILDELPPGRTPVN
FT                   TVLVADSRRLEVVERVRAACAEGRQAYWVCTLIEESEELTCKAAETTYEELTSALGEVR
FT                   VGLIHGRMKHAEKAAIMAEFKQGALQLLVATTVIEVGVDVPNSSLMIIENPERLGLAQL
FT                   HQLRGRVGRGSAVSHCVLLYHPPLSQIGRQRLGIMRETNDGFIIAEKDLELRGPGEMLG
FT                   TRQTGLLQFKVADLMRDADLLPAVRDAAQALLERWPQHVSPLLDRWLRHGQQYGQV"
FT   gene            complement(89355..90278)
FT                   /locus_tag="PSPTO_0066"
FT                   /old_locus_tag="PSPTO0066"
FT   CDS_pept        complement(89355..90278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0066"
FT                   /old_locus_tag="PSPTO0066"
FT                   /product="oxidative stress regulatory protein OxyR,
FT                   putative"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:16580120, GB:M81325, and PID:976157; identified by
FT                   sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53620"
FT                   /db_xref="GOA:Q88BF1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BF1"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53620.1"
FT                   /translation="MTLTELRYIVTLAQEQHFGHAAERCHVSQPTLSVGVKKLEDELGV
FT                   LIFERSKSAVRLTPVGEGIVAQAQKVLEQAQGIRELAQAGKNQLTAPLKVGAIYTVGPY
FT                   LFPHLIPQLHRVAPQMPLYIEENFTHVLRDKLRNGELDAVIIALPFNEADVLTLPLYDE
FT                   PFSVLMPAGHPWTQKETIDASALNDKSLLLLGEGHCFRDQVLEACPTLGKGNEGARHTT
FT                   VESSSLETIRHMVASGLGISILPLSAVDSHHYAPGVIEVRPLTPPVPFRTVAIAWRASF
FT                   PRPKAIEILADSARLCSVARPKNVAS"
FT   gene            complement(90371..91117)
FT                   /gene="tonB-1"
FT                   /locus_tag="PSPTO_0067"
FT                   /old_locus_tag="PSPTO0067"
FT   CDS_pept        complement(90371..91117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tonB-1"
FT                   /locus_tag="PSPTO_0067"
FT                   /old_locus_tag="PSPTO0067"
FT                   /product="tonB protein"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:14595286, and GP:14595286; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53621"
FT                   /db_xref="GOA:Q88BF0"
FT                   /db_xref="InterPro:IPR003538"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BF0"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53621.1"
FT                   /translation="MISTRQKLTRYSGSLLLVLAVHAIAIIVAVRWPASQAIELPPAAM
FT                   MVELAPLPEPAPPPPPKVVQPPQPPAPEEQVPMPEVAQAPKPEIVVPKKVEKPKPKPQP
FT                   PKPQKKPEPPQEKPADEKPVDTPPSTAKPEKSAAPAPAPTPSPPSTALPSWQGDLLSHL
FT                   GKYKKYPEDARRRGMQGVARLRFVVDADGNVLSYSIANSSGSPALDRATMEMIRRAQPL
FT                   PKPPKEILNNGTIEILAPFVYSLDKR"
FT   gene            complement(91114..91539)
FT                   /gene="exbD-1"
FT                   /locus_tag="PSPTO_0068"
FT                   /old_locus_tag="PSPTO0068"
FT   CDS_pept        complement(91114..91539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exbD-1"
FT                   /locus_tag="PSPTO_0068"
FT                   /old_locus_tag="PSPTO0068"
FT                   /product="TonB system transport protein ExbD"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:Q05606, GB:X60188, SP:P27361, SP:P28482, PID:1335009,
FT                   PID:186696, and PID:31221; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53622"
FT                   /db_xref="GOA:Q88BE9"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014170"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BE9"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53622.1"
FT                   /translation="MGLHLNEGGDDLAENHEINVTPFIDVMLVLLIIFMVAAPLATVDI
FT                   KVDLPASTATPQPRPEKPIFLSVKTDKSLYLGEEKVAREQIGQVLDARTKGKKDTTIFF
FT                   QADKGVDYGDLMDVMNTLRGAGYLKVGLVGLETVGKK"
FT   gene            complement(91543..92499)
FT                   /gene="exbB-1"
FT                   /locus_tag="PSPTO_0069"
FT                   /old_locus_tag="PSPTO0069"
FT   CDS_pept        complement(91543..92499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exbB-1"
FT                   /locus_tag="PSPTO_0069"
FT                   /old_locus_tag="PSPTO0069"
FT                   /product="TonB system transport protein ExbB"
FT                   /note="similar to GP:14595284; identified by sequence
FT                   similarity; putative; see PMID:20190049 for expression
FT                   data; similar to GP:14595284, identified by sequence
FT                   similarity, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53623"
FT                   /db_xref="GOA:Q88BE8"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014164"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BE8"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53623.1"
FT                   /translation="MTRIQSIASPTKLPRLPRAWRGIAALVLSLMFVPVALADQSAPAT
FT                   TPPAASAAPAAAAPVAPDAAAPVQALEPVAEDNSLGMAHDLSPWGMYQNADIVVKIVMI
FT                   GLAIASIITWTIWISKGFELLGAKRRLRGEIVNLKKARSLTEASATASKEGTLAHLLVH
FT                   DALEEMRLSANSREREGIKERVSFRLERLVAACGRNMSMGTGVLATIGSTAPFVGLFGT
FT                   VWGIMNSFIGIAKTQTTNLAVVAPGIAEALLATALGLVAAIPAVVIYNVFARSIAGYKA
FT                   QVSDASAHVLLLVSRDLDHLPEPAERNQQQPHMVKVG"
FT   gene            92710..93558
FT                   /locus_tag="PSPTO_0070"
FT                   /old_locus_tag="PSPTO0070"
FT   CDS_pept        92710..93558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0070"
FT                   /old_locus_tag="PSPTO0070"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to PFAM protein family HMM PF03005"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53624"
FT                   /db_xref="GOA:Q88BE7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BE7"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53624.1"
FT                   /translation="MTAPSLLIAGCGDIGSRLATRLQPHGWVVHGLRRTVSELPAGVIG
FT                   VEGDLFEAQRPAQWPTAALDYVVYCATPSQRDETGYRMAYVEGLRNVLSWLEQTGQQPK
FT                   RLIFVSSSGVYGQQNGEWVDENSATEPGGYTGTVMLEAEQLALNSGLPATAVRLTGIYG
FT                   PGRSDLSNRVRQGHSVRVDPPVYANRIHADDAASLLEHLLQADLRGVALESCYLGVDDD
FT                   PAALADVVAWLREYLGVTEWSEDVSVQRVGSKRCSNARARALGWAPMYPDYRAGYAALL
FT                   G"
FT   gene            complement(93607..94344)
FT                   /locus_tag="PSPTO_0071"
FT                   /old_locus_tag="PSPTO0071"
FT   CDS_pept        complement(93607..94344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0071"
FT                   /old_locus_tag="PSPTO0071"
FT                   /product="lipoprotein, putative"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53625"
FT                   /db_xref="GOA:Q88BE6"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BE6"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53625.1"
FT                   /translation="MRSALVISLLAVILSGCASLADRNPDGTWINQTAIDAAVKQGNLR
FT                   QALLANGPNLEWKINSKANQAIYSNGFELGEGKIVSAAEGKLHIDFYGNFFEDLSVKGG
FT                   DLVQAASESGPEQHFQKPENPAPEGAQPGSSFERALYGAYMGGKWTVVEGDGQGSTVQF
FT                   MPDGSVQGLPENDRFALCLAGDCAAMSGEYDSMWLEKAEKGNPWIFSRKGKQLEIFQAV
FT                   NNAGPDQMPELRPGARHWLLQQQ"
FT   gene            complement(94399..94779)
FT                   /locus_tag="PSPTO_0072"
FT                   /old_locus_tag="PSPTO0072"
FT   CDS_pept        complement(94399..94779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0072"
FT                   /old_locus_tag="PSPTO0072"
FT                   /product="endoribonuclease L-PSP, putative"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GB:L19158, GB:D26443, GB:U03504, GB:Z31713, SP:P43003,
FT                   PID:487339, PID:607113, PID:825504, and PID:825663;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53626"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="PDB:3K0T"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BE5"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53626.1"
FT                   /translation="MTKTVITSDKAPAAIGPYSQAIKAGNTVYMSGQIPLDPSTMELVE
FT                   GIEAQITQVFENLKSVAQAAGGSFKDIVKLNIFLTDLGHFAKVNEIMGSYFSQPYPARA
FT                   AIGVAALPRGAQVEMDAILVIE"
FT   gene            complement(94805..96910)
FT                   /gene="spoT"
FT                   /locus_tag="PSPTO_0073"
FT                   /old_locus_tag="PSPTO0073"
FT   CDS_pept        complement(94805..96910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoT"
FT                   /locus_tag="PSPTO_0073"
FT                   /old_locus_tag="PSPTO0073"
FT                   /product="guanosine-3,5-bis(diphosphate)
FT                   3-pyrophosphohydrolase"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:9951657, and SP:P17580; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53627"
FT                   /db_xref="GOA:Q88BE4"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BE4"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53627.1"
FT                   /translation="MPSIDALADRLSAYLGKDQVNLVRRAYFYAEQAHDGQRRRSGEAY
FT                   VTHPLAVANILADMHMDHQSLMAAMLHDVIEDTGIAKEALSAQFGETVAELVDGVSKLT
FT                   QMNFETKAEAQAENFQKMAMAMARDIRVILVKLADRLHNMRTLEVLSGEKRRRIAKETL
FT                   EIYAPIANRLGMHSVRIEFEDLGFKAMYPMRSSRINQAVKRARGNRKELVNKIEESLSH
FT                   CLAVDGIEGDVSGRQKHLYGIYKKMRGKRRAFNEIMDVYAFRIIVDKVDTCYRVLGAVH
FT                   NLYKPLPGRFKDYIAIPKANGYQSLHTTLFGMHGVPIEIQIRTREMEEMANNGIAAHWL
FT                   YKSSDDEQPKGTHARARQWVKGVLEMQQRAGNSLEFIESVKIDLFPDEVYVFTPKGRIM
FT                   ELPKGSTAVDFAYAVHTDVGNSCIACRINRRLAPLSEPLQSGSTVEIVSAPGARPNPAW
FT                   LNFVVTGKARTHIRHALKLQRRSESINLGERLLNKVLNGFECSLDKVTPERIQLVLNEY
FT                   RVEVLEDLLEDIGLGNRMAYVVARRLLGEGEQLPSPEGPLAIRGTEGLVLSYAKCCTPI
FT                   PGDPIVGHLSAGKGMVVHLDNCRNISEIRHNPEKCIQLSWAKDVTGEFNVELRVELEHQ
FT                   RGLIALLASSVNAADGNIEKISMDERDGRISVVQLVVSVHDRVHLARVIKKLRALTGVT
FT                   RITRMRA"
FT   gene            complement(96971..97234)
FT                   /gene="rpoZ"
FT                   /locus_tag="PSPTO_0074"
FT                   /old_locus_tag="PSPTO0074"
FT   CDS_pept        complement(96971..97234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="PSPTO_0074"
FT                   /old_locus_tag="PSPTO0074"
FT                   /product="DNA-directed RNA polymerase, omega subunit"
FT                   /note="similar to SP:P08374; identified by sequence
FT                   similarity; putative; see PMID:20190049 for expression
FT                   data; similar to SP:P08374, identified by sequence
FT                   similarity, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53628"
FT                   /db_xref="GOA:Q88BE3"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88BE3"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53628.1"
FT                   /translation="MARVTVEDCLEHVDNRFELVMLSTKRARQLATGGKEPKLAWENDK
FT                   PTVMALREIAAGLMDYAVIAEAEIVEDEPLFAAFEDESNEAV"
FT   gene            complement(97382..98026)
FT                   /gene="gmk"
FT                   /locus_tag="PSPTO_0075"
FT                   /old_locus_tag="PSPTO0075"
FT   CDS_pept        complement(97382..98026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="PSPTO_0075"
FT                   /old_locus_tag="PSPTO0075"
FT                   /product="guanylate kinase"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P24234; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53629"
FT                   /db_xref="GOA:Q88BE2"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88BE2"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53629.1"
FT                   /translation="MTHITGTLYIISAPSGAGKTSLVKALMDAQQEPQHGAQAKIRVSV
FT                   SHTTRAMRPGEVDGVNYNFVDRAEFVRMIEHGDFLEQAEVFGNLYGTSQSHLQQTLDEG
FT                   HDLILEIDWQGARQVRTQMPQARSIFILPPSQQALRQRLTNRGQDSDEIIEARMREAVS
FT                   EMSHYNEYEYVVVNDDFAGALEDLKSIFRANRLTQQHQQEQYSELFQELLA"
FT   gene            complement(98040..98903)
FT                   /locus_tag="PSPTO_0076"
FT                   /old_locus_tag="PSPTO0076"
FT   CDS_pept        complement(98040..98903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0076"
FT                   /old_locus_tag="PSPTO0076"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to PFAM protein family HMM PF03755"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53630"
FT                   /db_xref="GOA:Q88BE1"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BE1"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53630.1"
FT                   /translation="MVHSMTAFARVERAGAQGTLSWELRSVNHRYLEPHLRLPESFRDL
FT                   EGAIREALRQGLSRGKVECTLRFVEETAGKPLQVDRERAGQLIAAAESVAGLIKQPAAL
FT                   NPLEVLAWPGVLVADASDPQVLNTEALTLFNDALSELKLGRGREGADLARLLDERLSSI
FT                   VGEVATLRTLVPQMLAAQRQKVLDRFADMKAELDPQRLEQEMVLLAQKSDVAEELDRLS
FT                   THVTEVRRVLKAGGQAGRRLDFLMQELNREANTLGSKAFDPRSTQAAVNLKVLIEQMRE
FT                   QVQNIE"
FT   gene            99223..99945
FT                   /gene="rph"
FT                   /locus_tag="PSPTO_0077"
FT                   /old_locus_tag="PSPTO0077"
FT   CDS_pept        99223..99945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="PSPTO_0077"
FT                   /old_locus_tag="PSPTO0077"
FT                   /product="ribonuclease PH"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P03842, GB:U07987, SP:P01871, PID:184726, and
FT                   PID:468239; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53631"
FT                   /db_xref="GOA:Q88BE0"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88BE0"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53631.1"
FT                   /translation="MKRPSGRAADQLRSIRITRNYTKHAEGSVLVEFGDTKVICTVSVE
FT                   NGVPRFLKGQGQGWLTAEYGMLPRATGERNQREASRGKQGGRTLEIQRLIGRSLRAALD
FT                   MSKLGDVTLYVDCDVIQADGGTRTASITGAMVALADALKVIKKRGGLKGGDPLKQMIAA
FT                   VSVGMYQGEPVLDLDYLEDSAAETDLNVVMTSAGGFIEVQGTAEGAPFQPEELNAMLAL
FT                   AQKGMTELFEMQRAALAD"
FT   gene            99962..100333
FT                   /locus_tag="PSPTO_0078"
FT                   /old_locus_tag="PSPTO0078"
FT   CDS_pept        99962..100333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0078"
FT                   /old_locus_tag="PSPTO0078"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to PFAM protein family HMM PF03675"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53632"
FT                   /db_xref="GOA:Q88BD9"
FT                   /db_xref="InterPro:IPR019109"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BD9"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53632.1"
FT                   /translation="MMNDSPQPLYKPSREARQWAMFCHLSALIGLVFPFGNLLAPLILW
FT                   QMKRESDPFIDSQGKEALNFQITAAIAGLICIMLMFVVIGIALFMLVCLGAFILTVIAG
FT                   VKANNGLEYRYPFTWRVLK"
FT   gene            complement(100403..101182)
FT                   /locus_tag="PSPTO_0079"
FT                   /old_locus_tag="PSPTO0079"
FT   CDS_pept        complement(100403..101182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0079"
FT                   /old_locus_tag="PSPTO0079"
FT                   /product="exodeoxyribonuclease III, putative"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P37454; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53633"
FT                   /db_xref="GOA:Q88BD8"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BD8"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53633.1"
FT                   /translation="MRIISVNVNGIQGAVERGLLSWLQAQNADVICLQDTRASAFELDD
FT                   PAFQLDGYFLYACEAEVPAQGGVALYSRLQPKAVISGLGFETADRYGRYLQADFDKVSI
FT                   ATLLFPSGMNGDEDLNQKFKLMDDFGKYMDKQRRKRREYIYCGSLYVAQQKLDIKNWRD
FT                   SQQSPGFLAPERAWMDEIVGTMGYVDALREVSREGDQYSWWPDNEQAEMLNLGWRFDYQ
FT                   ILTPGLRRFVRSARLPRQPRFSQHAPLIVDYDWTLTI"
FT   gene            101265..101906
FT                   /gene="pyrE"
FT                   /locus_tag="PSPTO_0080"
FT                   /old_locus_tag="PSPTO0080"
FT   CDS_pept        101265..101906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="PSPTO_0080"
FT                   /old_locus_tag="PSPTO0080"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /note="similar to SP:P00495; identified by sequence
FT                   similarity; putative; see PMID:20190049 for expression
FT                   data; similar to SP:P00495, identified by sequence
FT                   similarity, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53634"
FT                   /db_xref="GOA:Q88BD7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88BD7"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53634.1"
FT                   /translation="MQAYQRDFIRFAIDRGVLRFGEFTLKSGRTSPYFFNAGLFNTGSA
FT                   LAQLGRFYAAAVVESGIRFDVLFGPAYKGIPLASATAVALAEHHDRDLPWCFNRKEAKA
FT                   HGEGGSLVGSPLAGNVLIIDDVITAGTAIREVMQIIKDQDATAAGVLIALNRQERGNGE
FT                   LSAIQEVERDFGIPVVSIVSLNQVLEFLADDEQLKQHLPAVEAYRAQYGI"
FT   gene            101917..102549
FT                   /locus_tag="PSPTO_0081"
FT                   /old_locus_tag="PSPTO0081"
FT   CDS_pept        101917..102549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0081"
FT                   /old_locus_tag="PSPTO0081"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53635"
FT                   /db_xref="GOA:Q88BD6"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BD6"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53635.1"
FT                   /translation="MAVSGRRQHPVSGTLSILGLWLALGMLAPLIAQAADAPEIRLYRY
FT                   VDSRGVTVIDTQGVPPDYVAKGYEVLNGRGRVIQVVPPAPTAEQIRQIEADKRQAAADA
FT                   QLLSLYSSVGEVDRVKARKLAELDALVGVAQGNIQGLAAQQRNLQSQAADLERAGRPVQ
FT                   QALVDQLNDLRDQQYKLQADIAGYQAARVKAEAGFAEDRVRVQRLTQ"
FT   gene            complement(102801..103706)
FT                   /gene="argB"
FT                   /locus_tag="PSPTO_0082"
FT                   /old_locus_tag="PSPTO0082"
FT   CDS_pept        complement(102801..103706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="PSPTO_0082"
FT                   /old_locus_tag="PSPTO0082"
FT                   /product="acetylglutamate kinase"
FT                   /note="identified by match to PFAM protein family HMM
FT                   PF00696; see PMID:20190049 for expression data; identified
FT                   by match to PFAM protein family HMM PF00696"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53636"
FT                   /db_xref="GOA:Q88BD5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88BD5"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53636.1"
FT                   /translation="MTLERDAASNVAKVLSEALPYIRRFVGKTLVIKYGGNAMESEELK
FT                   TGFARDIVLMKAVGINPVVVHGGGPQIGDLLKRLSIESHFIDGMRVTDAQTMDVVEMVL
FT                   GGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLTVTRQTPEMTKPEIIDIGQVGEVV
FT                   GVNTGLLNMLVKGDFIPVIAPIGVGPDGESYNINADLVAGKVAEALKAEKLILLTNIAG
FT                   LMNKQGEVLTGLTTEQVDGLIADGTIYGGMLPKIRCALEAVQGGVNSSHIIDGRVPNAV
FT                   LLEIFTDSGVGTQITNRKRH"
FT   gene            complement(103735..105132)
FT                   /gene="algC"
FT                   /locus_tag="PSPTO_0083"
FT                   /old_locus_tag="PSPTO0083"
FT   CDS_pept        complement(103735..105132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="algC"
FT                   /locus_tag="PSPTO_0083"
FT                   /old_locus_tag="PSPTO0083"
FT                   /product="phosphomannomutase AlgC"
FT                   /note="similar to SP:P26276, and GP:150994; identified by
FT                   sequence similarity; putative; see PMID:20190049 for
FT                   expression data; similar to SP:P26276, and GP:150994,
FT                   identified by sequence similarity, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53637"
FT                   /db_xref="GOA:Q88BD4"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88BD4"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53637.1"
FT                   /translation="MNSPASVAPILPDTIFRAYDIRGVVEDTLNAETAYWIGRAIGSES
FT                   LAQNEPNVSVGRDGRLSGPELVQQLIQGLHDSGCHVSDVGLVPTPALYYAANVLAGKTG
FT                   VMLTGSHNPKDYNGFKIVIAGDTLANEQIQALHERIKTNNLTSQKGSITQVNILDRYFK
FT                   QIKDDIVMARKLKVVVDCGNGAAGVIAPQLIEALGCEVISLFAEVDGNFPNHHPDPGKL
FT                   ENLQDLIAKVKETGADLGLAFDGDGDRVGVVTNAGNVVYPDRLLMLFALDVLKRNPGAD
FT                   IIFDVKCTRRLTPLISEHGGRPVMWKTGHSLIKKEMKKSGALLAGEMSGHIFFKERWFG
FT                   FDDGIYSAARLLEILSQEPANAEDLFETFPNDISTPEINIKVTDVTKFSIIEALEKDAQ
FT                   WGDAKLTTIDGVRVDYPKGWGLVRASNTTPVLVLRFEAETQAELERIQGVFHAELKKVA
FT                   PDLDLPF"
FT   gene            complement(106375..106830)
FT                   /gene="dut"
FT                   /locus_tag="PSPTO_0084"
FT                   /old_locus_tag="PSPTO0084"
FT   CDS_pept        complement(106375..106830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="PSPTO_0084"
FT                   /old_locus_tag="PSPTO0084"
FT                   /product="deoxyuridine 5'triphosphate nucleotidohydrolase"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:7766857, and SP:P06968; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53638"
FT                   /db_xref="GOA:Q88BD3"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88BD3"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53638.1"
FT                   /translation="MHALQAKILDPRIGNEFPLPAYATVGSAGLDLRAMLKEDTLLEPG
FT                   QTLLIPTGLSIYIGDPGLAALILPRSGLGHKHGIVLGNLVGLIDSDYQGELMVSCWNRG
FT                   QTAFTIAVGERIAQLVLVPVVQARFELVEEFDESQRGTGGFGHSGSH"
FT   gene            complement(106837..108084)
FT                   /gene="coaBC"
FT                   /locus_tag="PSPTO_0085"
FT                   /old_locus_tag="PSPTO0085"
FT   CDS_pept        complement(106837..108084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaBC"
FT                   /locus_tag="PSPTO_0085"
FT                   /old_locus_tag="PSPTO0085"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P24285; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53639"
FT                   /db_xref="GOA:Q88BD2"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BD2"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53639.1"
FT                   /translation="MAVAYSLDQKGRSMQRLYRKRIVLGVGGGIAAYKSAELVRRLRDQ
FT                   GAEVRVVMTKGGAEFITPLTMQALSGHPVHLDLLDPAAEAAMGHIELAKWADLILIAPA
FT                   TADLIARLAQGIANDLLTTIVLATDATVAIAPAMNQAMWRDASVQANTRLLEQRDFRVF
FT                   GPASGSQACGDVGFGRMLEADDLARCAADCFQRLTLTGRHVLITAGPTQENIDPVRYIT
FT                   NHSSGKMGFALAEAAVEAGARVTLITGPVNLPTPDRVSRIDVVSARDMLAACEAAIPCD
FT                   LFIASAAVADYRPEVIAPHKLKKDPSNGDGLLLQMVRNPDILATIATRPDRPFSVGFAA
FT                   ETEHLLDYAARKLKDKNLDLIVANDVANPSIGFNSEENACSVIDRALHATLFAQTSKAK
FT                   IARQLITFIADRMNQV"
FT   gene            108181..108855
FT                   /gene="radC"
FT                   /locus_tag="PSPTO_0086"
FT                   /old_locus_tag="PSPTO0086"
FT   CDS_pept        108181..108855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radC"
FT                   /locus_tag="PSPTO_0086"
FT                   /old_locus_tag="PSPTO0086"
FT                   /product="DNA repair protein RadC"
FT                   /note="similar to SP:P25531; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53640"
FT                   /db_xref="GOA:Q88BD1"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88BD1"
FT                   /protein_id="AAO53640.1"
FT                   /translation="MSIRSWPAAERPRERLLELGAASLSDAELLAIFLRTGVAGKSAVD
FT                   LARHLLNQFDGLRSLLDADQPAFTAQLGLGPAKFAQLQAVMEMARRHMAESLRRDSALE
FT                   NPAQVRNYLKAQLRHEPHEVFACLFLDNKHRVMTFEILFRGTINASYVHPRQVVKRALA
FT                   HNAASLILCHNHPSGITTPSRSDIDLTKRLKEALKLVDVHVLDHVIVGDGEPLSMVEKG
FT                   LM"
FT   gene            complement(108910..110496)
FT                   /locus_tag="PSPTO_0087"
FT                   /old_locus_tag="PSPTO0087"
FT   CDS_pept        complement(108910..110496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0087"
FT                   /old_locus_tag="PSPTO0087"
FT                   /product="bacterial extracellular solute-binding protein,
FT                   family 5"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to PFAM protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53641"
FT                   /db_xref="GOA:Q88BD0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BD0"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53641.1"
FT                   /translation="MRLAALPFLLASTLLPLTAQASSLAVCTEASPEGFDVVQYNSLTT
FT                   TNASADVLMNRLVDFDAKSGKLVPSLAQSWTVSADGLTYDFKLRTGVKFHTTDYFTPTR
FT                   ELSADDVLFSFQRMLDPQNPWHKIAQSGFPHAQSMQLPALIKSIEAPDAHSVRFTLNRA
FT                   DSTFLATLSMGFASIYSAEYTAQLLKAGTPEKLNSQPIGTGPFVFKRFQKDAVVRYEAF
FT                   KDYFAGKSDIDTLVYAITPDANVRLQKIRQDECQIALSPKPLDIQAASKDDSLKVEKTD
FT                   AFMTAFVAINSQHPPFDKPEVRQAINLAFDKANYLKAVFEGTAGAANGPYPPNTWSYAK
FT                   DLPGYPHDVAKAKALLAKAGLKDGFKTTVWTRPSGSLLNPNPSLSAQLLQADLKQIGID
FT                   AEIKVIEWGELIRRAKAGEHDLLFMGWAGDNGDPDNFLTPQFSCAAVQSGTNFARYCDK
FT                   TLDKLIADGKSTSDQAERSKLYHQAQQQIQQQALWIPLAHPTAAALVRKDVSGYQVSPF
FT                   GRQDFYKVQVK"
FT   gene            complement(110557..110691)
FT                   /locus_tag="PSPTO_0088"
FT                   /old_locus_tag="PSPTO0088"
FT   CDS_pept        complement(110557..110691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0088"
FT                   /old_locus_tag="PSPTO0088"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53642"
FT                   /db_xref="GOA:Q88BC9"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BC9"
FT                   /protein_id="AAO53642.1"
FT                   /translation="MQQQAKHFSPNRRALCGGMLKHSGGTGKSTARRTVTIVLRHYMV"
FT   gene            110860..111093
FT                   /gene="rpmB"
FT                   /locus_tag="PSPTO_0089"
FT                   /old_locus_tag="PSPTO0089"
FT   CDS_pept        110860..111093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="PSPTO_0089"
FT                   /old_locus_tag="PSPTO0089"
FT                   /product="ribosomal protein L28"
FT                   /note="identified by match to TIGR protein family HMM
FT                   TIGR00009; see PMID:20190049 for expression data;
FT                   identified by match to TIGR protein family HMM TIGR00009"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53643"
FT                   /db_xref="GOA:Q88BC8"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88BC8"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53643.1"
FT                   /translation="MSRVCQVTGKGPVTGNNISHANNKTRRRFLPNLQHHRFWVEGEKR
FT                   FVRLRVSAKGMRIIDKRGIEVVLAELRRDGKI"
FT   gene            111105..111260
FT                   /gene="rpmG"
FT                   /locus_tag="PSPTO_0090"
FT                   /old_locus_tag="PSPTO0090"
FT   CDS_pept        111105..111260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="PSPTO_0090"
FT                   /old_locus_tag="PSPTO0090"
FT                   /product="ribosomal protein L33"
FT                   /note="identified by match to PFAM protein family HMM
FT                   PF00471"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53644"
FT                   /db_xref="GOA:Q88BC7"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88BC7"
FT                   /protein_id="AAO53644.1"
FT                   /translation="MRELIRLVSSAGTGHFYTTDKNKRTTPDKIEIKKFDPVVRKHVIY
FT                   KEGKIK"
FT   gene            complement(111368..111733)
FT                   /locus_tag="PSPTO_0091"
FT                   /old_locus_tag="PSPTO0091"
FT   CDS_pept        complement(111368..111733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0091"
FT                   /old_locus_tag="PSPTO0091"
FT                   /product="conserved protein of unknown function"
FT                   /note="RNA sequencing"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53645"
FT                   /db_xref="GOA:Q88BC6"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BC6"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53645.1"
FT                   /translation="MSIESIVDFSEASTDAEHYRPAPEKVFKGDPAQTIYNHYNSPCGQ
FT                   MSAGVWNGEPGQWQVNYTEHEYCEIVQGVSVLRDEQGTAKTLRAGDRFVIPAGFKGTWE
FT                   VLEACRKIYVVFEPKQG"
FT   gene            111972..113465
FT                   /locus_tag="PSPTO_0092"
FT                   /old_locus_tag="PSPTO0092"
FT   CDS_pept        111972..113465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0092"
FT                   /old_locus_tag="PSPTO0092"
FT                   /product="aldehyde dehydrogenase family protein"
FT                   /note="similar to SP:P23883, GB:M11147, GB:M10119,
FT                   GB:M12938, GB:X03742, GB:X03743, SP:P02792, PID:1340145,
FT                   PID:1340146, PID:182514, PID:182516, PID:182518,
FT                   PID:2230869, and PID:28519; identified by sequence
FT                   similarity; putative; see PMID:20190049 for expression
FT                   data; similar to SP:P23883, GB:M11147, GB:M10119,
FT                   GB:M12938, GB:X03742, GB:X03743, SP:P02792, PID:1340145,
FT                   PID:1340146, PID:182514, PID:182516, PID:182518,
FT                   PID:2230869, and PID:28519, identified by sequence
FT                   similarity, putative; see PMID:29293681 for functional data
FT                   and contribution to virulence"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53646"
FT                   /db_xref="GOA:Q88BC5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="PDB:5IUU"
FT                   /db_xref="PDB:5IUV"
FT                   /db_xref="PDB:5IUW"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BC5"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53646.1"
FT                   /translation="MTTLTRADWEQRAQNLKIEGRAFIQGEYTAAASGETFDCISPVDG
FT                   RLLAKVASCDAADAQRAVESARSAFDSGAWSRLAPAKRKATMIRFAGLLEQNAEELALL
FT                   ETLDMGKPISDSLGVDIPGGARALSWSGEAIDKLYDEVAATPHDQLGLVTREPVGVVAA
FT                   IVPWNFPLMMACWKLGPALSTGNSVVLKPSEKSPLTAIRIAQLAIEAGIPAGVLNVLPG
FT                   YGHTVGKALALHMDVDTVVFTGSTKIAKQLMIYAGESNMKRVWLEAGGKSPNIVFADAP
FT                   DLQAAADSAASAIAFNQGEVCTAGSRLLVERSIKDRFLPMVIEALGTWKPGNPLDPATN
FT                   VGALVDTQQMNTVLSYIAAGHTDGARLVAGGKQILQETGGTYVEPTIFDGVNNAMRIAQ
FT                   EEIFGPVLSVLTFDTAEEAIQIANDTPYGLAAAVWTANLSKAHLTARALRAGSVWVNQY
FT                   DGGDMTAPFGGFKQSGNGRDKSLHAFDKYTELKSTWIKL"
FT   gene            complement(113528..113779)
FT                   /locus_tag="PSPTO_0093"
FT                   /old_locus_tag="PSPTO0093"
FT   CDS_pept        complement(113528..113779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0093"
FT                   /old_locus_tag="PSPTO0093"
FT                   /product="protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53647"
FT                   /db_xref="GOA:Q88BC4"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BC4"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53647.1"
FT                   /translation="MVSETSELLVALDKLILSLKSTGKTGPAQFFAKKSIELQAGGTAD
FT                   AAIQGLSTCIAIAQYGDFTFSEERLLEAVVEVASRSRN"
FT   gene            113892..115040
FT                   /locus_tag="PSPTO_0094"
FT                   /old_locus_tag="PSPTO0094"
FT   CDS_pept        113892..115040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0094"
FT                   /old_locus_tag="PSPTO0094"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to PFAM protein family HMM
FT                   PF03626"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53648"
FT                   /db_xref="GOA:Q88BC3"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BC3"
FT                   /protein_id="AAO53648.1"
FT                   /translation="MRWGTYFAVLASVLGVGLAMGVSMPLVSLRLAGWGYGSFAIGIMA
FT                   AMPAVGVLLGAALASRLAARFGTASLMRLCLWAGAVSVGALALLPYYWIWLVLRLTLGA
FT                   ILTIVFVLGESWINQLVIERLRGRLVALYGSTYALSQLAGPLLLGVIGTEADYGFWIGV
FT                   VLLVGSPFLLLGRTGAPSTESCNVTLADLSGFCRGMPAIAWAVALFAAFEALILTLLPL
FT                   YCIRHGFTPQIALIMVSVVVVGDALLQLPIGMLADRISRRAMFTGCAALLLISSLLVPL
FT                   LIDTALIWPLWTVFGASAGGLFTLSLILIGERYRDDLLVRANAHVAQLWGIGCLLGPLI
FT                   AGAGSQWVSGEALPLMMAAGAFGLLMLIRRRGAFGDSQAAPA"
FT   gene            complement(115037..116665)
FT                   /locus_tag="PSPTO_0095"
FT                   /old_locus_tag="PSPTO0095"
FT   CDS_pept        complement(115037..116665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0095"
FT                   /old_locus_tag="PSPTO0095"
FT                   /product="phospholipase D family protein"
FT                   /note="similar to SP:P75919; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53649"
FT                   /db_xref="GOA:Q88BC2"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BC2"
FT                   /protein_id="AAO53649.1"
FT                   /translation="MGHIAKSSHLQTRKVNLNNSWALPFCLLVAVCVSGCAHQQIASEP
FT                   SQAMPPSDSAFGRSIQAMAMPHEGRSGFRLLPDSSDAFKARAELIRNAKTSLDLQYYIV
FT                   HDGLSTRALIDELLKAADRGVRVRILLDDTTSDGLDQAIATLAAHPNIQIRLFNPQNLG
FT                   RETGVTRSLGRLMNLSRQHRRMHNKLWLADSSAAIVGGRNLGDEYFDAEPNLNFTDIDM
FT                   LSVGPVAEQLGHSFDQYWNSTLSKPIDQFMYFLPDGQDLAEARQRLDDSLEQAHQQHKA
FT                   LYERLMAYKTQPRMKTWLNELVWAHNQALWDAPTKVLAQGEPDPHLLLTTQLAPELLNT
FT                   RKELMLISAYFVPGQEGLLYLTGRADAGVNVSLLTNSLEATDVPAVHGGYAPYRKALLE
FT                   HGVKLYELRRQPGETETMRSSGPHLFRKSHSLVSSESSLHSKAMIFDRQKVFVGSFNFD
FT                   PRSVLWNTEVGVLVDSPQLAEELRELTLQGMAPSLTYEARLEDGKVVWVTEDNGQIHTL
FT                   HTEPGDWWRRFNAWMSRAIGLERML"
FT   gene            complement(116690..118111)
FT                   /locus_tag="PSPTO_0096"
FT                   /old_locus_tag="PSPTO0096"
FT   CDS_pept        complement(116690..118111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0096"
FT                   /old_locus_tag="PSPTO0096"
FT                   /product="transcriptional regulator, GntR
FT                   family/aminotransferase, class I"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to TIGR protein family HMM TIGR01265"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53650"
FT                   /db_xref="GOA:Q88BC1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BC1"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53650.1"
FT                   /translation="MTLYVNLAELLGSRIENGFYRPGDRLPSVRALSVEHGVSLSTVQQ
FT                   AYRVLEDSGLAAPKPKSGYFVSVSRHAPALPAVGRPAQRPVDISQWDQVLDLIRVAPRE
FT                   AVTQLGRGMPDVTSPTLKPLMRALGQLSRHQDMPGLYYDNIYGVLRLREQVARLMLDSG
FT                   CNLTANDVIITNGCHEALSASVRAICSPGDIVAVDSPSFFGAMQTLKGVGMKALEIPTD
FT                   PLTGISLEALELALEQWPIKVIQLTPNCNNPLGYVMPEARKRALLTLAQRFDVAIIEDD
FT                   VYGDLAYNYPRPRTIKSFDEDGRVLLCSSFSKTLAPGLRIGWVAPGRYLERVLHMKYIG
FT                   TGSTAPQPQLAIADFLEGGHYEPHVRRMRTQYQRSRDQMIDWVMRYFPEGTRASRPQGS
FT                   FMLWVELAEDFDTLRLNRALLDKGVQIAVGSIFSASGKYRNCMRLNYAAKSSREIESAV
FT                   RIVGETIAQLIAQSD"
FT   gene            118233..118538
FT                   /locus_tag="PSPTO_0097"
FT                   /old_locus_tag="PSPTO0097"
FT   CDS_pept        118233..118538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0097"
FT                   /old_locus_tag="PSPTO0097"
FT                   /product="protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53651"
FT                   /db_xref="GOA:Q88BC0"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BC0"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53651.1"
FT                   /translation="MVVRFIIDPHPPRMRELEMNGFSDVRLALHSQELNEYRPTVLRTV
FT                   RPKKADLLAIMSRWALYRHRWASRRTLLTLTDDQLRDVGLDFQQARVEAMKPFWRA"
FT   gene            complement(118544..119857)
FT                   /locus_tag="PSPTO_0098"
FT                   /old_locus_tag="PSPTO0098"
FT   CDS_pept        complement(118544..119857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0098"
FT                   /old_locus_tag="PSPTO0098"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P37906; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53652"
FT                   /db_xref="GOA:Q88BB9"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BB9"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53652.1"
FT                   /translation="MNARVQHLARDDQHVASYYAASSHPQADHPALQGELKVDVCVVGG
FT                   GFSGLNTAIELAERGLSVALLEARKIGWGASGRNGGQLIRGVGHGVEQFANVIGSEGVR
FT                   QLKLLGIEAVEIVRRRIERYGIECDLKWGYCDLANKPRDLHSLAKDAEELRSLGYRHEL
FT                   TLLQADQMRTVVGSDRYVGGLIDLGSGHLHPLNLALGEAAVAQSLGVQVFEHSAVTRID
FT                   YGPQVKVHTAQGSVLAKTLVLGCNAYLDELNPEISGKVLPAGSYIIATEPLSEAQAREL
FT                   LPQDMAVCDQRVTVDYYRLSADRRLLFGGACHYSGRDPQDIAAYMRPKMLDVFPQLASV
FT                   AIDYQWGGMIGIGANRLPQIGRLSQQPNVFYAQAYSGHGVNATHLAGRLLAEAIAGQHS
FT                   DGFELFARVPHMTFPGGKHLRSPLLALGMLWHRLKELR"
FT   gene            119909..120316
FT                   /locus_tag="PSPTO_0099"
FT                   /old_locus_tag="PSPTO0099"
FT   CDS_pept        119909..120316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0099"
FT                   /old_locus_tag="PSPTO0099"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to PFAM protein family HMM
FT                   PF03692"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53653"
FT                   /db_xref="GOA:Q88BB8"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="InterPro:IPR016928"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BB8"
FT                   /protein_id="AAO53653.1"
FT                   /translation="MRLPTEAHLRQHVRVIDSMSCNREKVRDLRRQIPSFDCVPGCHDC
FT                   CGPVTTSSEEMSRLPRKTVAEQEAAFNELNCVHLGPQGCTVYDERPLICRLFGTTASLP
FT                   CPNGRRPVELIHPRAEKQIHEYMASTRQVLV"
FT   gene            complement(120331..120819)
FT                   /gene="lrp"
FT                   /locus_tag="PSPTO_0100"
FT                   /old_locus_tag="PSPTO0100"
FT   CDS_pept        complement(120331..120819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrp"
FT                   /locus_tag="PSPTO_0100"
FT                   /old_locus_tag="PSPTO0100"
FT                   /product="leucine-responsive regulatory protein"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P37403; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53654"
FT                   /db_xref="GOA:Q88BB7"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BB7"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53654.1"
FT                   /translation="MRTQHQSNRELDKIDRNILRILQADGRISFTELGERVGLSTTPCT
FT                   ERVRRLEREGIIMGYNARLNPQSLKASLLVFVEISLDYKSGDTFEEFRRAVLKLPHVLE
FT                   CHLVSGDFDYLVKARISEMASYRKLLGDILLKLPHVRESKSYIVMEEVKESLNLPIAD"
FT   gene            120976..122277
FT                   /gene="dadA"
FT                   /locus_tag="PSPTO_0101"
FT                   /old_locus_tag="PSPTO0101"
FT   CDS_pept        120976..122277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dadA"
FT                   /locus_tag="PSPTO_0101"
FT                   /old_locus_tag="PSPTO0101"
FT                   /product="D-amino acid dehydrogenase, small subunit"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53655"
FT                   /db_xref="GOA:Q88BB6"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023080"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88BB6"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53655.1"
FT                   /translation="MRVLVLGSGVIGTTSAYYLARAGFQVTVVDRQPAVGMETSFANAG
FT                   QVSPGYASPWAAPGVPLKAIKWLLQRHSPLAIKATADIDQYLWMAQMLRNCTANRYAVN
FT                   KERMVRLSEYSRDCLDELRIETGIAYEGRSLGTTQLFRTQAQLDNAAKDIAVLEQSGVP
FT                   YELLDRAGIARVEPALAGVTGILSGALRLPNDQTGDCQLFTTRLAQMAVELGVEFRYGQ
FT                   NIERLEHAGDTVSGVWIDGVLETADRYVLALGSYSPQLLKPLGIKAPVYPLKGYSLTVP
FT                   ISNPAMAPTSTILDETYKVAITRFDNRIRVGGMAEIAGFDLSLNPRRRETLEMIVGDLY
FT                   PQGGDLSQASFWTGLRPTTPDGTPIVGATPLRNLFLNTGHGTLGWTMACGSGRLLADLI
FT                   ARKRPQISAAGLDISRYGNPQENAQHVNPAPAHQ"
FT   gene            122249..122602
FT                   /locus_tag="PSPTO_0102"
FT                   /old_locus_tag="PSPTO0102"
FT   CDS_pept        122249..122602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0102"
FT                   /old_locus_tag="PSPTO0102"
FT                   /product="endoribonuclease L-PSP family protein"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to TIGR protein family HMM TIGR00004"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53656"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035709"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BB5"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53656.1"
FT                   /translation="MSIQRQLTNERMSQVVVHNGTVYLAGQVGDDMTAGVEQQTREVLN
FT                   SIERLLDLAGTDKTRILSVTIYLKDIDADFAGMNSVWDKWLPKGFAPARATVEAKLCEP
FT                   QILVELSVIAALP"
FT   gene            122682..123755
FT                   /gene="dadX"
FT                   /locus_tag="PSPTO_0103"
FT                   /old_locus_tag="PSPTO0103"
FT   CDS_pept        122682..123755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dadX"
FT                   /locus_tag="PSPTO_0103"
FT                   /old_locus_tag="PSPTO0103"
FT                   /product="alanine racemase, catabolic"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P29012; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53657"
FT                   /db_xref="GOA:Q88BB4"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BB4"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53657.1"
FT                   /translation="MRPARALIDLQALRHNYRLARDSSGGRALAVIKADAYGHGAVHVA
FT                   QALEAQADGFAVACIEEALELRAAGIRAPILLLEGFFEADELALIVEHDLWTVVHAIWQ
FT                   LEAIEQAQLGKPLTVWLKLDTGMHRVGLHPSEYRAAYQRLLATGKVARVVLMSHFSCAD
FT                   ELNSACSDQQVAVFEAARQGLVAETSLKNSPAVMGWPKIPSDWSRTGIMLYGATPFDQT
FT                   QPLAERLQPVMTLESKVISVRELPAGEAVGYGATFVSERPLRIGVVAMGYADGYPRHAP
FT                   TGTPVLIDGQRSRLLGRVSMDMLCVDLTDVPQAGLGSRVELWGKAVLASEVATQAGTIP
FT                   YQIFCNLRRVPRIYSEN"
FT   gene            complement(123740..123844)
FT                   /locus_tag="PSPTO_0104"
FT                   /old_locus_tag="PSPTO0104"
FT   CDS_pept        complement(123740..123844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0104"
FT                   /old_locus_tag="PSPTO0104"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53658"
FT                   /db_xref="GOA:Q88BB3"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BB3"
FT                   /protein_id="AAO53658.1"
FT                   /translation="MNAIMATAFIIYNTSTDTARLGGLADRSGNQFSE"
FT   gene            123831..124430
FT                   /locus_tag="PSPTO_0105"
FT                   /old_locus_tag="PSPTO0105"
FT   CDS_pept        123831..124430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0105"
FT                   /old_locus_tag="PSPTO0105"
FT                   /product="DNA-binding protein"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:9951617; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53659"
FT                   /db_xref="GOA:Q88BB2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BB2"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53659.1"
FT                   /translation="MMAFISTRPDKNWGNIALDVGERLQSIRKLKGLSQRELAKRAGVT
FT                   NSTISMIEKNSVSPSISSLRKVLGGIPMSMVEFFSEETVPENSAQVVYKASELIDISDG
FT                   AVTMKLVGKSHQGRAIAFLTETYPPGADTGEEMLIHEGEETGILVEGRLELVVGLDTYL
FT                   LEAGDSYYFASTRPHRFRNPFDVPARLISAATPANF"
FT   gene            124455..124778
FT                   /gene="cycB"
FT                   /locus_tag="PSPTO_0106"
FT                   /old_locus_tag="PSPTO0106"
FT   CDS_pept        124455..124778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cycB"
FT                   /locus_tag="PSPTO_0106"
FT                   /old_locus_tag="PSPTO0106"
FT                   /product="cytochrome c5"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GB:Z11766, and PID:47029; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53660"
FT                   /db_xref="GOA:Q88BB1"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BB1"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53660.1"
FT                   /translation="MNLTLKILATAGALTVWAFNAQAADNARSPDDIIATHCVACHSVG
FT                   LLKAPKIGDTAAWEERANKAGGLDGLLASTLKGLSIMPPKGSCADCTDDELKNAIRSMS
FT                   GLE"
FT   gene            124875..126806
FT                   /locus_tag="PSPTO_0107"
FT                   /old_locus_tag="PSPTO0107"
FT   CDS_pept        124875..126806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0107"
FT                   /old_locus_tag="PSPTO0107"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to PFAM protein family HMM
FT                   PF02550"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53661"
FT                   /db_xref="GOA:Q88BB0"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BB0"
FT                   /protein_id="AAO53661.1"
FT                   /translation="MPYSCSIEQAVDHVLAQLPEHVHLGMPLGLGKPNRFVNALYQRIS
FT                   QLPERRLTIYTALTLGRPTPGEGLQARFLEPFLERTFGDYPELEFLAALRRDKLPPNIR
FT                   VQQFFMQPGSLLDSAPAQQDYVSSNYSHAARDINAHGLNLVAQLVARDDQRPGTLSLSC
FT                   NPDVTLDLLPMIAKRRAAGETILMLGQVHADLPYMPGDSELDVEAFDLLLNEDEHSTLF
FT                   STPNMPVGYQDHLIGLHASTLVRDGGTLQIGIGSMGDALTGALLARQADNETWRSLLAD
FT                   LNMSNWQTLIDREGGTQPFASGLYGCSEMFVNGLLVLADAGIVRRKVYADAELQRLANM
FT                   GTLDEDAHPEGVVVHGGFFLGPSSFYERLRELPAERLAQFNMTAISYINELYGQEDLKR
FT                   LQRRDARFINSAFTVTLMGAAVADQLEDGRVLSGVGGQYNFVAQAHALEGARSILMLRS
FT                   WRESGGEVSSNIVWQYGHTTIPRHLRDIVVTEYGIADLRGQTDATVIERILNISDSRFQ
FT                   PGLIEQAQKAGKLPKDFILDPRFTQNTPERLRGIAAHYPSLFTEYPLGCDFTPEERDLL
FT                   RALNWLKSKLKLTEILELGKATLDAPDPETFPQHLQRMQLDQPQGLREELYQRLLLAGL
FT                   HNTTGLTG"
FT   gene            complement(126885..127703)
FT                   /locus_tag="PSPTO_0108"
FT                   /old_locus_tag="PSPTO0108"
FT   CDS_pept        complement(126885..127703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0108"
FT                   /old_locus_tag="PSPTO0108"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to PFAM protein family HMM
FT                   PF03334"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53662"
FT                   /db_xref="GOA:Q88BA9"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BA9"
FT                   /protein_id="AAO53662.1"
FT                   /translation="MIDHSLLGAGLGVIIGAVLALTGAGGGILAVPLLVFGLGLTIIEA
FT                   APVGLLAVGLAAGVGAVLGLRQGIVRYRAAGYIAGIGVLMAPIGLWLAHRLPNTPLALI
FT                   FSAVLLYACGRIFIRASRELRDGRQAPRAQMLPCVLNPLQGRLRWTMPCLRALTLTGMC
FT                   SGLLSGLLGVGGGFVIIPALTRYSDLNMKSVVATSLAVIALVSTGSVIIASLSGVMHWA
FT                   VGAPFALGAVAGLLGGRQVARYLAGPRLQQLFAVCGIAAALMLVFAVVQV"
FT   gene            complement(127696..128949)
FT                   /locus_tag="PSPTO_0109"
FT                   /old_locus_tag="PSPTO0109"
FT   CDS_pept        complement(127696..128949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0109"
FT                   /old_locus_tag="PSPTO0109"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to PFAM protein family HMM
FT                   PF00070"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53663"
FT                   /db_xref="GOA:Q88BA8"
FT                   /db_xref="InterPro:IPR015904"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BA8"
FT                   /protein_id="AAO53663.1"
FT                   /translation="MTALNTNCQILIVGGGAAGIATAASLLARDASLQITLVDPADTHY
FT                   YQPGWTMVGAGVFEPQSTARSMESLIPKGVQWIKAAVATFEPQDNALTLEDGRSIGYQQ
FT                   LVVCPGLKLDWAAIDGLVDTLGANGVTSNYRYDLAPYTWKLVQGLKQGRALFTQPPMPI
FT                   KCAGAPQKALYLSCDHWLKAGRLGQINAQFYNAGGVLFGVADYVPALMKYVQRYAIDLK
FT                   FSHRLIAVDGPGKRATFIQTLPDGTCETVEQSFEMLHVVPPQIAPDFIRNSPLADVAGW
FT                   VDVDPATLRHRRFANIHGLGDVTNTSNAKTAAAARKQAPVAANNVLVAMGRLSEPVIYD
FT                   GYGSCPLTVEKGKIVLAEFTYGGKVAPSFPGWLLDGRKPTRLAWWLKASVLPALYWNGM
FT                   LKGREWLARPKKATARHD"
FT   gene            complement(128977..129861)
FT                   /locus_tag="PSPTO_0110"
FT                   /old_locus_tag="PSPTO0110"
FT   CDS_pept        complement(128977..129861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0110"
FT                   /old_locus_tag="PSPTO0110"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /note="similar to GP:12721862; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53664"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BA7"
FT                   /protein_id="AAO53664.1"
FT                   /translation="MIIAEKLYVEALFDSHTWTISYLVMDLESRQCALIDSVLDYDPKS
FT                   GRTRTEAADRMIGRVRGLQGSVQWILETHVHADHLSAAPYLKQKLGGQVVIGSHITVVQ
FT                   ETFGALFNAPADFARNGSQFDVLVEDDASFAIGGLQVKAMHTPGHTPACTSYLIQVGEK
FT                   MVAFVGDTLFMPDYGTARCDFPGADARTLYRSIRKLLALPQQTILFMCHDYLPDGRDLK
FT                   YMTTVAEQRASNIHVHDGVDEDAFVSMREARDATLEMPVLMLPAVQVNMRGGHFPEPDD
FT                   NGVVYLKIPLNAF"
FT   gene            130125..131444
FT                   /locus_tag="PSPTO_0111"
FT                   /old_locus_tag="PSPTO0111"
FT   CDS_pept        130125..131444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0111"
FT                   /old_locus_tag="PSPTO0111"
FT                   /product="sigma-54 dependent transcriptional regulator"
FT                   /note="identified by match to PFAM protein family HMM
FT                   PF02796"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53665"
FT                   /db_xref="GOA:Q88BA6"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BA6"
FT                   /protein_id="AAO53665.1"
FT                   /translation="MSLIATDLPGSRMQSLVSYLEHDVQPTIVLDTDYNIIAANTAYQR
FT                   QFGVEGMPHVGEKCYRVSHQFAVPCDQAGEHCPMRKADETRRPERLLHIHHTPRGPEHV
FT                   DVELRPILDDRGEVIAYVERLTSVAVASVQPQQHGLVGRSAAFKDVLSALQRAAPAQIP
FT                   VLLQGESGTGKELFARALHASSSRSAGPLVVVDCTGLTENLLESELFGYEKGAFTGALQ
FT                   RKTGLAEAAHGGTLFLDEIGEVPLAMQVKLLRLIESGSFRPVGSLRTVHSDFRLVAATH
FT                   KPIKDMVAEGSFRQDLFYRISAFPIRLPALRERSEDLPLLIDSLLQRTSQGAAPRIDAH
FT                   AMKLLSHYHYPGNIRELRNILERARLFTDDGIIRAQDLPAEVRGHQEESGLAYRRTDDS
FT                   LEKLAHALRVFNGSRSELARELGLSERTLYRRLRALGVSG"
FT   gene            complement(131808..132377)
FT                   /gene="xpt"
FT                   /locus_tag="PSPTO_0112"
FT                   /old_locus_tag="PSPTO0112"
FT   CDS_pept        complement(131808..132377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xpt"
FT                   /locus_tag="PSPTO_0112"
FT                   /old_locus_tag="PSPTO0112"
FT                   /product="xanthine phosphoribosyltransferase"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P42085; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53666"
FT                   /db_xref="GOA:Q88BA5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010079"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88BA5"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53666.1"
FT                   /translation="MEALHKKIREEGIVLSDQVLKVDAFLNHQIDPALMKAIGDEFARL
FT                   FADAGVTKIVTIEASGIAPAVMAGLNMGVPVIFARKHQSLTLTENLLSATVYSFTKQVE
FT                   STVAISPRHLNSTDNVLIIDDFLANGKASQALISIIKQAGATVAGLGIVIEKSFQGGRA
FT                   ELDAQGYRVESLARVESLAGGVVTFK"
FT   gene            complement(132432..134441)
FT                   /gene="rep"
FT                   /locus_tag="PSPTO_0113"
FT                   /old_locus_tag="PSPTO0113"
FT   CDS_pept        complement(132432..134441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rep"
FT                   /locus_tag="PSPTO_0113"
FT                   /old_locus_tag="PSPTO0113"
FT                   /product="ATP-dependent DNA helicase Rep"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P09980; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53667"
FT                   /db_xref="GOA:Q88BA4"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BA4"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53667.1"
FT                   /translation="MSRLNPRQQEAVNYVGGPLLVLAGAGSGKTSVITRKIAHLIQNCG
FT                   IRAQYIVAMTFTNKAAREMKERVGTLLKGGEGRGLTVSTFHNLGLNIIRKEHTRLGYKP
FT                   GFSIFDETDVKALMTDIMQKEYSGDDGVDAIKNMIGSWKNDLILPAEALENARNPKEQT
FT                   AAIVYTHYQRTLKAYNAVDFDDLILVPVKLFQEHPDVLEKWQNKVRYLLVDEYQDTNAS
FT                   QYLLVKLLIGTRNQFTVVGDDDQSIYAWRGARPENLMLLKDDYPSLKVVMLEQNYRSTS
FT                   RILRCANVLISNNPHAFEKQLWSEMGHGDEIRVIRCRNEDAEAERVAMEILTLHLRTDR
FT                   PYSDFAILYRGNYQAKLIELKLQHHQVPYRLSGGNSFFGRQEVKDLMAYFRLLVNPDDD
FT                   NAFLRVINVPRREIGSTTLEKLGNYATERKVSMYAATEEIGLGEHLDSRYTDRLQRFKR
FT                   WMDGVRQQCAQNDPIAALRSMVMDIDYENWLRQNSSSEKAADYRMSNVWFLIEALKNTL
FT                   EKDEEGGMTIEEAIGKLVLRDMLERQQEEEDGAEGVQMMTLHASKGLEFPYVFIMGMEE
FT                   EILPHRSSIEADTIEEERRLAYVGITRARQTLAFTFAAKRKQYGEIIDCAPSRFLDELP
FT                   PDDLAWEGNDDTPTEVKAVRGNTALADIRAMLKR"
FT   gene            134647..136311
FT                   /locus_tag="PSPTO_0114"
FT                   /old_locus_tag="PSPTO0114"
FT   CDS_pept        134647..136311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0114"
FT                   /old_locus_tag="PSPTO0114"
FT                   /product="GGDEF domain/EAL domain protein"
FT                   /note="similar to GP:9951610; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53668"
FT                   /db_xref="GOA:Q88BA3"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BA3"
FT                   /protein_id="AAO53668.1"
FT                   /translation="MPTPVEPLRLLLLAHEPFWQALLNGCAAAPGGNVILLHGANWDVF
FT                   SARYGSERNTVLLTTPDLLPKTGTCLLPTVVLLEEEPLVGPSGVSDWLVRDTLTGDVLR
FT                   RCLRYVHERSRLEDTLRRLAGQDPLTGIANRQGFQALLANRLAEGGSLALGHLDLDNFR
FT                   HANDSLGHQAGDRLILQVVARLKNQLDAGDQIARLGGDEFALLIDTRTTPTRALQLAER
FT                   ITDVLAEPYWVDGESLLLGCSLGIAHSPTRPEADPLMWHAHIAMRQAKSMQGCTFHLFD
FT                   ERINRNARSLADLEGELRRALRRDEMELHYQPRLCLNTGRIVGLEALVRWRHQERGLLP
FT                   PSEFIPLAEQSGLIVPLGYWVIFRALKDMQALREQGLAPLHMAINLSFRQFQDSQLLPT
FT                   LNRLIEEHNVDAHWLEFELTETAVMRRSDQVRQTMEALGRLGVRFSLDDFGTGYSSFMH
FT                   LNSLPIALLKVDMGFVEQMEAREENRKLVNAMITLAHNLNLEVVAEGVETTGQLELLRS
FT                   FGCNQVQGYLISRPLPMEQLLTYLRLEASQADASQSG"
FT   gene            complement(136326..137708)
FT                   /locus_tag="PSPTO_0115"
FT                   /old_locus_tag="PSPTO0115"
FT   CDS_pept        complement(136326..137708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0115"
FT                   /old_locus_tag="PSPTO0115"
FT                   /product="multidrug resistance protein NorM, putative"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:Q9F5N7, and SP:P37340; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53669"
FT                   /db_xref="GOA:Q88BA2"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88BA2"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53669.1"
FT                   /translation="MQPPAFKELWIILRLAGPLIASQMAHMLMVFTDTVMMGKIGPEAL
FT                   AGGGLGAATYSFISFFCVGVMAAVGTLVSIRHGAGDSEGVTRLTQAGLWLAWGMALIAA
FT                   LLLWNLEPILLQLGQAEANVHMAAQFLITLPFALPGLLSFMALRGFTSALGRAGPVMTI
FT                   SVAGAVANFVLNYAMINQWLGLPNLGLMGIGLVTAMVTNCMALALAWHIKRHPAYAAYP
FT                   ISKGLSKLSRSHLKELWRLGLPIGGTYAVEVGLFTFAAFCMGAMGSTQMAAHQIALQTV
FT                   SMAFMIPVGISYAVTMRIGQHYGAGNILMARTAGRLGIGFGGSVMLLFGIFFWLAPHWV
FT                   IGLFLDLDDPAFAEIVVLAAKLLAIAAWFEFFDGTQTIAMGAIRGLKDARTTFLIGLGC
FT                   YWLIAAPAAWLLGFYADGGASGVWWGLALGLFCSAVALTYAFEWKTARLLRKEAVGAAV
FT                   PG"
FT   gene            137865..138785
FT                   /locus_tag="PSPTO_0116"
FT                   /old_locus_tag="PSPTO0116"
FT   CDS_pept        137865..138785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0116"
FT                   /old_locus_tag="PSPTO0116"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to PFAM protein family HMM
FT                   PF02954"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53670"
FT                   /db_xref="GOA:Q88BA1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BA1"
FT                   /protein_id="AAO53670.1"
FT                   /translation="MPRNLPPLYALRAFEAAARHTSFTRAAEELSITQSAVSRHIRTLE
FT                   EHFACRLFQRNGRNLQLTESARTLLPGVRDGFLALERACSTLQTDEGVLRMKAPSTLTM
FT                   RWLLARLSRFRHLQVGNEVQLTSAWMDIDAVDFTREPFDCAILLSQGHFPSDWEATLLF
FT                   AELLIPVGAPTLSQDPPWDVERLAKAELLHPTPDRRDWRTWLNRMGLADQVSLKGGQVF
FT                   DTLELGMIAAARGYGVSMGDLLMVAEDLAQSRLSLPWRTAVFSGENYYLVWPRTRPGAE
FT                   RLRRLSDFLQAEVKAMKLPLVEVLR"
FT   gene            138969..140945
FT                   /locus_tag="PSPTO_0117"
FT                   /old_locus_tag="PSPTO0117"
FT   CDS_pept        138969..140945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0117"
FT                   /old_locus_tag="PSPTO0117"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to TIGR protein family HMM
FT                   TIGR01755; see PMID:20190049 for expression data;
FT                   identified by match to TIGR protein family HMM TIGR01755"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53671"
FT                   /db_xref="GOA:Q88BA0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033462"
FT                   /db_xref="UniProtKB/TrEMBL:Q88BA0"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53671.1"
FT                   /translation="MSKPRTRIASQLGIALAVILAVVISGSTLFALRSLDASNLVIREE
FT                   HMSSEARLLADQLSTFHSTLRDSTQRLSGLFEKRFAGGLTLQTDKPVAVAGTQTPGLYL
FT                   RDTALNNDFTEVDEFRSMTAGVATIFVRSGDDFIRISTSLSKQDGTRAIGTVLDRKGTA
FT                   YERLMAGQSYVGKAVLFDRYYMTQYSPVRDSSGKIIAALFVGFDYTDAQKTQFDNLKSF
FT                   RIGSTGSLALLDEKGTWLVPPAGIKSLDGAAKAVADLASKPGKAQFWNEGGGDFYSVGQ
FT                   PFAGGPWTVIASMPRSEISEVTWSVGTQLAIGSLLAMLIAVISAIWLLRSKLRPLSELV
FT                   RQADALGAGDLSVRLNVTSNDEIGQLSGSFNKMSEALSSMVSHIRTAAQEVSTRAHALS
FT                   GLSGGAYEGMEQQSGEITSMAGAVEEFSATSMNIADNMGNTERLAQENAQQTRIGRTSM
FT                   DEASSSLQQIATSLSSTATVIDTLGQRSQEIGSIVGVITSIADQTNLLALNAAIEAARA
FT                   GEQGRGFAVVADEVRSLASRTREATDEISGMIASIQQETGNAISTMQQGNTLMQEGLSL
FT                   NAKVASALAQIDEQSRSAGHQFAAITTATQEQSSTATMLSSNLQSIAMANSEQRQVMSN
FT                   LAITAQELNGLATELRNEVDRFR"
FT   gene            141265..142917
FT                   /locus_tag="PSPTO_0118"
FT                   /old_locus_tag="PSPTO0118"
FT   CDS_pept        141265..142917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0118"
FT                   /old_locus_tag="PSPTO0118"
FT                   /product="Na/Pi cotransporter family protein"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GB:L02320, SP:P35241, and PID:307366; identified by
FT                   sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53672"
FT                   /db_xref="GOA:Q88B99"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B99"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53672.1"
FT                   /translation="MLTLLDLLSAVALLIWGTHIVRTGILRVYGAQLRRLLSQNMSKRP
FT                   LAFIAGILVTAMVQSSNATAMLVTSFVGQGLMTLTPALVIMLGADVGTALMSRVLTFDL
FT                   SWLSPLLIFLGVVFFLSRKQTRAGQLGRVGIGLGLIVLALQLIVAAAAPITQAAGVKVL
FT                   FASLTGDLLLDALVGAMFALISYSSLAAVLLTATLAGTEVIGLPVAIGLVIGANIGSGL
FT                   LAFLSTSMQNVAGRQVALGSLLYKLFGLLLIIPVLDPLVAWIDTLGFRPQELVIGFHLI
FT                   YNTVRCLIMLPTVGPMARLCAGLLPQQNEVGGLARPRHLDLTALATPSLALANAVRETL
FT                   RMGDLIESMLGSMLAVLRGTQTAVTQEVRRLNDDVEALYSAIKLYLAQMPREDLGEHDN
FT                   RRWAEIIELTINLELASGLIERMLRKIQQQKTSHRRSFSEVGLEELADLQVQLQSNLRL
FT                   GLSVFLSGDEESARQLLREKRRFRAQERRLAHAHVSRLRHKVVQSIETSSLHLELIADM
FT                   KRLNSLFCSSAYVVLETSDTGALSSEDQPERSL"
FT   gene            142975..144354
FT                   /locus_tag="PSPTO_0119"
FT                   /old_locus_tag="PSPTO0119"
FT   CDS_pept        142975..144354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0119"
FT                   /old_locus_tag="PSPTO0119"
FT                   /product="peptidase, M16 family"
FT                   /note="identified by match to PFAM protein family HMM
FT                   PF00675"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53673"
FT                   /db_xref="GOA:Q88B98"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B98"
FT                   /protein_id="AAO53673.1"
FT                   /translation="MRCLLFACLLLGSLPSFALDRLQVEGYLLPNGLQVLLKPGYEKGH
FT                   VAIRLVVGIGFDDFPCQDKELPHLLEHLLFSGIDDGGEGGLEERMQALGGEWNAFTSNA
FT                   DTTFVIEAPARNQRKVLDLLLEIMTRTELSQARLDGVKRVVEREDGGHFSHLQRLLDRR
FT                   DSGRSAISQLAVEMGLKCAERPEVGGIKLEHIEDVFANWYAPNNMTLIVVGDLDKLLPA
FT                   YLERTYGKLAPTDPIDHPPLAPGSGSAQARQELQRGGLGESAKLHLIYPEPQLDDQHDE
FT                   TWDLVKAYLDWALYTELRLKRSLSYGPSAEREVFGDVGFLSLNADVERNDTDEAERDIR
FT                   ALVERLQKDGMQPATFARLQQLAIDRQSWATQGNSALADYYWSALNDYEKGRFEDPAKR
FT                   IKAVKLETANQAMRQLLAQPGYMRIEKPLFSYDGLYWLAGGVLGLIVLLAVWRWRARGK
FT                   A"
FT   gene            144451..145638
FT                   /locus_tag="PSPTO_0120"
FT                   /old_locus_tag="PSPTO0120"
FT   CDS_pept        144451..145638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0120"
FT                   /old_locus_tag="PSPTO0120"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53674"
FT                   /db_xref="GOA:Q88B97"
FT                   /db_xref="InterPro:IPR016937"
FT                   /db_xref="InterPro:IPR022606"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B97"
FT                   /protein_id="AAO53674.1"
FT                   /translation="MRDLNRFVTPVLDLMQRYPGLIAAFGFVSGIASFILVDRQEALAT
FT                   WIAVVMLISWLWLMVENTMVGLLNKALGREIPQGLLRYGTQMIHQESLFFVLPFFFITT
FT                   TWNSGQAVFTAALGAAGLISIIDPLYYKWLAPKRWLFMTLHTLTLFAALLTALPIILHL
FT                   TTAESYKLALGVAMLLSVPSLMSTFALNTWRNALTVITMILAIGAAGWLLRSWVPPATL
FT                   WLTEVAVSPDFDNKNRTPGDSISLISVKQLRNGGLYAYTAINAPRGLDERIYHVWWHEG
FT                   KEMDRIALDIHGGRKEGYRAWTRKQNFPEDVTGRWQVRVLTEDGQMIGVLRFVVTDKDQ
FT                   PAVKRPTGRIIKLKPGGDSSDEAAPESAPAQPQAPAPAPAPAPAAAESAPAAPAQ"
FT   gene            complement(145643..146884)
FT                   /locus_tag="PSPTO_0121"
FT                   /old_locus_tag="PSPTO0121"
FT   CDS_pept        complement(145643..146884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0121"
FT                   /old_locus_tag="PSPTO0121"
FT                   /product="membrane protein, putative"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to PFAM protein family HMM PF03594"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53675"
FT                   /db_xref="GOA:Q88B96"
FT                   /db_xref="InterPro:IPR011415"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B96"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53675.1"
FT                   /translation="MLNGLWLGFFVVATISALVQWLVGGNAGIFAAMVESIFAMAKLSV
FT                   EVMVLLFGTLTLWLGFLRIAEKAGIVDWLAKVLGPLFLRLMPEVPPGHPALGLITLNFA
FT                   ANALGLDNAATPIGLKAMRSLQELNPSKTAASNAQILFLVLNASSLTLLPVTIFMYRAQ
FT                   QGAPDPTLVFLPILLATSVSTFVGLLSVAFMQRLRLWDPVVLAYLIPGALLLGAFMAFL
FT                   GTLSAAALAGLSSILGNLTLFGLIMMFLIIGTLRKVLVYEAFVEGAKEGFDVAKSLLPY
FT                   LVAMLCAVGVLRASGALDFGLEGIRHVVQWLGLDTRFVDALPTAMVKPFSGSAARALLI
FT                   ETMQTQGVDSFAALAAATIQGSTETTFYVLAVYFGAVGIQRARHAVGCALLAEFSGVVA
FT                   AIFVCYWFFGATAT"
FT   gene            147445..147960
FT                   /locus_tag="PSPTO_0123"
FT                   /old_locus_tag="PSPTO0123"
FT   CDS_pept        147445..147960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0123"
FT                   /old_locus_tag="PSPTO0123"
FT                   /product="ISPsy8, transposase OrfA"
FT                   /note="similar to GP:17428452; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53677"
FT                   /db_xref="GOA:Q877K7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:Q877K7"
FT                   /protein_id="AAO53677.1"
FT                   /translation="MAKYSEQFKLTVVKAYLAGNIGFRKVSSQFSIDSSLLRRWVANYK
FT                   SHGHTGHRKPGLRYSEAFKRSVLEHKREHGLSLRQTAAHFGIGDPGQIVIWEQQHYSND
FT                   LAPYVPKRRKSVAMPKKPYPTAPVIDDDTQKTRDQLMAELEYLRMENAYLKKLEELKEQ
FT                   QRRQKKKP"
FT   gene            148017..148796
FT                   /locus_tag="PSPTO_0124"
FT                   /old_locus_tag="PSPTO0124"
FT   CDS_pept        148017..148796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0124"
FT                   /old_locus_tag="PSPTO0124"
FT                   /product="ISPsy8, transposase OrfB"
FT                   /note="similar to GP:17428451; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53678"
FT                   /db_xref="GOA:Q877J0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q877J0"
FT                   /protein_id="AAO53678.1"
FT                   /translation="MARSTFYYQVQVQSRPDPDAALKQEVERIYHEERGLYGARRITAV
FT                   IRNSGTLVNKKVVERLMAELGLRSVVRPKKYRSYKGTVGKIAPNLLERNFTAQRPNQKW
FT                   VTDVTEFKVANRKLYLSPVMDLYNGEIVAYELSTRPCFELVTSMLDKALQQLQDEPKLV
FT                   MHSDQGWQYQHAQYRQKLAAKGVKQSMSRKGNCLDNAAMESFFGTLKSEFFYLKRFESI
FT                   EELTAGLEEYIRYYNHDRIKLKLGGLSPVKYRTQAAS"
FT   gene            complement(148983..150377)
FT                   /gene="argH"
FT                   /locus_tag="PSPTO_0125"
FT                   /old_locus_tag="PSPTO0125"
FT   CDS_pept        complement(148983..150377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="PSPTO_0125"
FT                   /old_locus_tag="PSPTO0125"
FT                   /product="argininosuccinate lyase"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53679"
FT                   /db_xref="GOA:Q88B94"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88B94"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53679.1"
FT                   /translation="MSTDKTNQSWGGRFSEPVDAFVARFTASVTFDQRLYRHDIMGSIA
FT                   HATMLAKVGVLTDAERDTIVDGLNTIQAEIEAGNFEWRVDLEDVHMNIEARLTDRIGIT
FT                   GKKLHTGRSRNDQVATDIRLWLRDEIDLILSEITRLQKGLLVQAERESDTIMPGFTHLQ
FT                   TAQPVTFGHHMLAWFEMLSRDYERLVDCRKRLNRMPLGSAALAGTTYPIDRELTCKLLG
FT                   FDVVGGNSLDGVSDRDFAIEFCSAASIAMMHLSRFSEELVLWTSAQFQFIDLPDRFCTG
FT                   SSIMPQKKNPDVPELVRGKSGRVFGALMGLLTLMKGQPLAYNKDNQEDKEPLFDAADTL
FT                   RDSLRAFADMIPAIKPRHAIMREAALRGFSTATDLADYLVRRGLPFRDCHEIVGHAVKY
FT                   GVETGKDLAEMSLEELRQFSNQIEQDVFAVLTLEGSVNARNHVGGTAPEQVRAAVARGQ
FT                   ELLAGR"
FT   gene            150512..151594
FT                   /locus_tag="PSPTO_0126"
FT                   /old_locus_tag="PSPTO0126"
FT   CDS_pept        150512..151594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0126"
FT                   /old_locus_tag="PSPTO0126"
FT                   /product="alginate biosynthesis protein AlgZ/FimS"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GB:Z31695, and PID:469144; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53680"
FT                   /db_xref="GOA:Q88B93"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B93"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53680.1"
FT                   /translation="MRIEPVKTPARPAPGKDFFLPELCLPQALLVLVVLAELLVVILVL
FT                   VEPMRAGFDWVRLALMSLFVQWIVLLSAALLCGLRPWLARLTPGLAGMLSCLLVVGLTL
FT                   LCTAVTDVCQLTGRISISGMVERYLRYSTIALIMSALMLRYFYLQSQWRKQQQGELRAR
FT                   IESLQARIRPHFLFNTLNSIASLVASDPGKAEQAVLDLSDLFRASLAKPGSLVTWSEEL
FT                   ALAKRYLSIEQYRLGERLQLDWRVSAIPDDLPIPQLTLQPLLENALIYGIAPRIDGGVV
FT                   TVEADYKGGEFILSVSNPYEEVANRQTSNGTQQALSNIGARIAALFGPHASLSVERRDG
FT                   RHYTCLRYPCARLTQEARAI"
FT   gene            151591..152337
FT                   /gene="algR"
FT                   /locus_tag="PSPTO_0127"
FT                   /old_locus_tag="PSPTO0127"
FT   CDS_pept        151591..152337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="algR"
FT                   /locus_tag="PSPTO_0127"
FT                   /old_locus_tag="PSPTO0127"
FT                   /product="alginate biosynthesis regulatory protein AlgR"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53681"
FT                   /db_xref="GOA:Q88B92"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B92"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53681.1"
FT                   /translation="MNVLIVDDEPLARERLSRMVNEIEGYRVLEDSASNGEEALALIEK
FT                   HKPDVVLLDIRMPGIDGLQVAAKLCEREAPPAVVFCTAHDEFALEAFQVSAVGYLVKPV
FT                   RAEHLIEALKKAERPNRVQLAAMTRPAAESGSGPRTHISARTRKGIELIPLDQVIYFIA
FT                   DHKYVTLRHEGGEVLLDEPLKALEDEFGDRFVRIHRNALVARKRIESMKRTPVGHFELF
FT                   LRGLNGDALIVSRRHVAGVRKMMQQL"
FT   gene            152560..153501
FT                   /gene="hemC"
FT                   /locus_tag="PSPTO_0128"
FT                   /old_locus_tag="PSPTO0128"
FT   CDS_pept        152560..153501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="PSPTO_0128"
FT                   /old_locus_tag="PSPTO0128"
FT                   /product="porphobilinogen deaminase"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53682"
FT                   /db_xref="GOA:Q88B91"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88B91"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53682.1"
FT                   /translation="MSSREIRIATRKSALALWQAEYVKARLEQAHPGLLVTLVPMVSRG
FT                   DKLLDSPLSKIGGKGLFVKELETALLEDNADIAVHSMKDVPMDFPQGLGLFCICEREDP
FT                   RDAFVSNTFESLDALPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGE
FT                   YNAIILAAAGLIRLGFEDRITSAISVDDSLPAGGQGAVGIECRSVDAEIHALLAPLHHE
FT                   DTAVRVIAERSLNKHLNGGCQVPIACYAVLEGDDVWLRGLVGDPSGRVLLHADARAPQT
FT                   SAQALGVQVAEALLAQGAAEILKAVYGEANNE"
FT   gene            153498..154274
FT                   /gene="hemD"
FT                   /locus_tag="PSPTO_0129"
FT                   /old_locus_tag="PSPTO0129"
FT   CDS_pept        153498..154274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemD"
FT                   /locus_tag="PSPTO_0129"
FT                   /old_locus_tag="PSPTO0129"
FT                   /product="uroporphyrinogen-III synthetase"
FT                   /note="see PMID:20190049 for expression data; see
FT                   PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53683"
FT                   /db_xref="GOA:Q88B90"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="PDB:3RE1"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B90"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53683.1"
FT                   /translation="MSAWRLLLTRPAEESAALARVLADAGIFSSSLPLLETEPLPLTPA
FT                   QRSIIFELLNYSAVIVVSKPAARLAIELIDEVWPQPPMQPWFSVGSATGQILLDYGLDA
FT                   SWPEQGDDSEALLDHPRLKQAIAVPGSRVLIMRGNEGRELLAEQLRERGVGVDYLPLYR
FT                   RYLPQHAPGTLLQRVEVERLNGLVVSSGQGFEHLLQLAGDSWPDLAGLPLFVPSPRVAS
FT                   LAQAAGARNVIDCRGASAAALLAALRDQPQPAVKAY"
FT   gene            154316..155446
FT                   /locus_tag="PSPTO_0130"
FT                   /old_locus_tag="PSPTO0130"
FT   CDS_pept        154316..155446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0130"
FT                   /old_locus_tag="PSPTO0130"
FT                   /product="uroporphyrin-III C-methyltransferase, putative"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53684"
FT                   /db_xref="GOA:Q88B89"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B89"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53684.1"
FT                   /translation="MGYVSETALPKDEESVLKTPASKPEPVRVERTGNRSSGLVFLALL
FT                   LGIAGIAVAGWGVWQLRMLQAGHQQQRGQVEDIAEQTLVLAQNDQQLSARLAQLPPANQ
FT                   LEDSRRLVAQLQGDQQRLSQRLETVLGASRKDWRLAEAEHLLRLASLRLSALQDINSAQ
FT                   ALVQGADEILREQDDPGSFAAREQLAKSLAALRSVEQPDRTGLFLQLGALREQAVQLNK
FT                   LAPEYEDKGESLLGLTADNTEQSRWSQWWDEISHYFRVDFNANKDIRPVLAGQSLAQVR
FT                   LALSLALEQAQWAALNGEPQVYSQAITEAQNVLKANFNQDDPQSKVLGQGLEALASKPV
FT                   SVKTPDLAPTLSSVQAYLERRHAAGQPAEAQQGTSR"
FT   gene            155443..156687
FT                   /locus_tag="PSPTO_0131"
FT                   /old_locus_tag="PSPTO0131"
FT   CDS_pept        155443..156687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0131"
FT                   /old_locus_tag="PSPTO0131"
FT                   /product="hemY protein, putative"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53685"
FT                   /db_xref="GOA:Q88B88"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B88"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53685.1"
FT                   /translation="MKRVYVLFFIAIVAAALIGVAVAEHSGYVLIAYQNFRYESSLWAT
FT                   LALLVAVLLVIAILRLLITLLTTSGRVVNPWSRRNRRRRVQIAIEQGQMDLAEGRWSSA
FT                   QRHLQRAAEADAHPLLYYIGAARAANEQGRYEDCDALLERALERQPQAELAVALNHAQL
FT                   QQDRGDTDGALVTLQAMNERHPHNPQVLRQLQRLYQQRGDWSDLIRLMPELRKDKVLPP
FT                   KELAELERRAWGENLTLAAYRDEHEGAPTGLPSLEAAWQGLSSAQRQEPQLVLAYADQL
FT                   RRLGAEAQAEEVLRAALKRDYNSHLARLYGLVRGSDPLKQLQTAEGWLKHHPADPSLLL
FT                   SLGRICLQGRLWGKARDYLESSLRLERNPETCAELARLLAQLGETDRSNMLFQEGLGLL
FT                   DERFLSRPLPALTKA"
FT   gene            156902..157429
FT                   /locus_tag="PSPTO_0132"
FT                   /old_locus_tag="PSPTO0132"
FT   CDS_pept        156902..157429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0132"
FT                   /old_locus_tag="PSPTO0132"
FT                   /product="DsbB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53686"
FT                   /db_xref="GOA:Q88B87"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR022920"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B87"
FT                   /protein_id="AAO53686.1"
FT                   /translation="MYLARTRFLFFMAFLACASIFSTALYLQQAFALDPCVLCLLQRAA
FT                   IVGCGLLALTATCHAPGQVGWRRYSLGLLLIALAGVGAAGVQVWLQTASADQLIPFIAR
FT                   LEHVMGLLSLDTCVDRLRSDALLCAEITWSLFGITLPEWSLLAFTGIALLPLYPLLSEF
FT                   SHWLAGKSQGEY"
FT   gene            157434..157586
FT                   /locus_tag="PSPTO_0133"
FT                   /old_locus_tag="PSPTO0133"
FT   CDS_pept        157434..157586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0133"
FT                   /old_locus_tag="PSPTO0133"
FT                   /product="protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53687"
FT                   /db_xref="GOA:Q88B86"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B86"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53687.1"
FT                   /translation="MYELYLLRTLMALSSEHNLGRTRHWKYAVLTHLSGQVLADQQERH
FT                   RTAYP"
FT   gene            157604..158077
FT                   /gene="algQ"
FT                   /locus_tag="PSPTO_0134"
FT                   /old_locus_tag="PSPTO0134"
FT   CDS_pept        157604..158077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="algQ"
FT                   /locus_tag="PSPTO_0134"
FT                   /old_locus_tag="PSPTO0134"
FT                   /product="transcriptional regulator AlgQ"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53688"
FT                   /db_xref="GOA:Q88B85"
FT                   /db_xref="InterPro:IPR007448"
FT                   /db_xref="InterPro:IPR038309"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B85"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53688.1"
FT                   /translation="MLESCQNAQERWGGVNKLIDRWLQSRLELIEAYDALGDTPEALAA
FT                   DREGLQNFCGILVDYVSAGHFEVYEQLGDEARAFNDERGLELADTIYPRLDVITKFALT
FT                   FNDRCDKGDCSDAAVVAKEFNQLGQLLHERFELEDCLIEVLHTSHKEEVAAQV"
FT   gene            complement(158162..158836)
FT                   /locus_tag="PSPTO_0135"
FT                   /old_locus_tag="PSPTO0135"
FT   CDS_pept        complement(158162..158836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0135"
FT                   /old_locus_tag="PSPTO0135"
FT                   /product="peptidyl-prolyl cis-trans isomerase, FKBP-type"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53689"
FT                   /db_xref="GOA:Q88B84"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="PDB:5XB0"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B84"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53689.1"
FT                   /translation="MSRYLLTSLFLLLPLAQAAEAPPDNDAHDLAYSLGASLGERLHQE
FT                   VPDLDLKALVDGLKQAYQGKPLALKQERIDQILREHDAAIAQAETAGTDAPTEAALKAE
FT                   RTFMAGEKAKPGVKELADGILMTELTPGTGPKPDANGRVEVRYVGRLPDGKIFDQSTQP
FT                   QWFRLDSVISGWTSALQNMPTGAKWRLVIPSDQAYGAEGAGDLIDPFTPLVFEIELIAV
FT                   SQ"
FT   gene            159053..160009
FT                   /locus_tag="PSPTO_0136"
FT                   /old_locus_tag="PSPTO0136"
FT   CDS_pept        159053..160009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0136"
FT                   /old_locus_tag="PSPTO0136"
FT                   /product="alginate regulatory protein AlgR3"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53690"
FT                   /db_xref="GOA:Q88B83"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B83"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53690.1"
FT                   /translation="MSAKKKPVNTPLHLLQQLSGSLLEHLEDACSQALADAEKLLAKLE
FT                   KQRGKAQEKLHNSRIKLQDAATAGKSKAQTKAKDAVAELEELLDALKSRQTETRTYILH
FT                   LKRDAQESLKLAQGIGRVKEAVGKILTTRSAKPAAPKAATKAPAAKAPAKAPSKAPAKP
FT                   PVKAAAAKPVAKAAAKPAVAAKPAAKPAVVKAPAKTAAKPAARSAAAAKPVAAKSTAAK
FT                   PAAKPAVTKAPAAAKAPASSAAKPAAAKPAVAKPAVKAPAKAPVKAVTKPAAVKPAAKP
FT                   AAAKSATPAPAAAKPTPAAPAAASAKPADNATPTSAS"
FT   gene            complement(160006..160494)
FT                   /locus_tag="PSPTO_0137"
FT                   /old_locus_tag="PSPTO0137"
FT   CDS_pept        complement(160006..160494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0137"
FT                   /old_locus_tag="PSPTO0137"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   PIR:JQ0136, and PIR:JQ0136; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53691"
FT                   /db_xref="GOA:Q88B82"
FT                   /db_xref="InterPro:IPR012659"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B82"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53691.1"
FT                   /translation="MPSALWSFTLDFYARPGVEQACLTLQANGGNVCMVLCGVWLGARE
FT                   VACTAQRLAQIRQLATPWHDDVVRPLRNLRSEWRNAALEDVALGGLRAKVKALELEAEQ
FT                   SLMARLEGLSADWPAGEARDAEEWLIGLVDERAEGCVEGHRDALHVLRIAVGRSDDQL"
FT   gene            160496..162451
FT                   /locus_tag="PSPTO_0138"
FT                   /old_locus_tag="PSPTO0138"
FT   CDS_pept        160496..162451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0138"
FT                   /old_locus_tag="PSPTO0138"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53692"
FT                   /db_xref="GOA:Q88B81"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B81"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53692.1"
FT                   /translation="MIHLFRTKLVDSAAIMIRLQSLTLQRGPQRLLEDAELTLHAGHKA
FT                   GLIGANGAGKSSLFALLRAELTPDAGDCLLPADWRIAHMRQEVDTLERLAVDYVLDGDE
FT                   RLREVQSSLAEAEAAQDGAAQARLHSELDSADGYTADARARKLLAGLGFTNEQMERQVG
FT                   SFSGGWRMRLNLAQALMCPSDLLLLDEPTNHLDLDAILWLEDWLKSYPGTLLLISHDRD
FT                   FLDAVVDHIAHVEQRKITLYRGGYSAFERARAERLAQQQQAYEKQQVQRAHMEKYIARF
FT                   KAQATKARQAQSRIKALERMEELSAAHVDSPFNFVFRESDKISSPLLDLSDARLGYGDK
FT                   TVLEKVKLQLTPGARIGLLGPNGAGKSTLIKNLAGELEPQSGRLVRGENLTVGYFAQHQ
FT                   LDSLDAKATPLLHLQRLAPTEREQTLRDFLGGFDFRGARLDEPVLNFSGGEKARLALAL
FT                   IAWEKPNLLLLDEPTNHLDLEMRLALTMALQEFGGAVLVVSHDRHLLKSTTDDFLLVAD
FT                   GRVQEFDGDLDDYTRWLADYRLRNAPVSNTPVNADKTDKKAQRQQAAALRQQLAPHKRE
FT                   ADKLERDLGLVNEKLAKVEEALADSTNYEAANKDKLRDLLAEQAKLKVRESELEDAWMQ
FT                   ALELLESMQAELEALS"
FT   gene            162468..163061
FT                   /locus_tag="PSPTO_0139"
FT                   /old_locus_tag="PSPTO0139"
FT   CDS_pept        162468..163061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0139"
FT                   /old_locus_tag="PSPTO0139"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to PFAM protein family HMM PF00924"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53693"
FT                   /db_xref="GOA:Q88B80"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B80"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53693.1"
FT                   /translation="MEVLGLPISAYWIEPLLIGVQILLILLAGYVLQRVVGGFLTGLGE
FT                   RYPLPPELLVPVRGGLRWLIMGSAFVFVLGRLGVSATVLWTALSGFVAVAAVAFFAMWS
FT                   VLSNLLCAILIFTIGPFRIGDMVELVDTLDKPGVKGRVVAINLMFTTLIETPEAGGALV
FT                   QVPNSQFFQKSVRRWRGSDLFPQMVAAKPADEQD"
FT   gene            163128..163760
FT                   /locus_tag="PSPTO_0140"
FT                   /old_locus_tag="PSPTO0140"
FT   CDS_pept        163128..163760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0140"
FT                   /old_locus_tag="PSPTO0140"
FT                   /product="homoserine/homoserine lactone efflux protein"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53694"
FT                   /db_xref="GOA:Q88B79"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B79"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53694.1"
FT                   /translation="MALETWLGFFAACWIISLSPGAGAIASMSCGLQYGFLRGYWNALG
FT                   LQIALVAQIAIVAAGLGAVLAASEMAFTLIKWFGVAYLVYLGIKQWRASPTDLADESAV
FT                   RPVGKPMTLVFRGFLVNISNPKALIFILAILPQFIEPTAPLFMQYVIIAATMVVVDLIV
FT                   MAGYTGLASKVLRALKTPRQQRRLNRTFASLFVGAAGFLATLHRGTA"
FT   gene            163941..165839
FT                   /locus_tag="PSPTO_0141"
FT                   /old_locus_tag="PSPTO0141"
FT   CDS_pept        163941..165839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0141"
FT                   /old_locus_tag="PSPTO0141"
FT                   /product="lead uptake protein, putative"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:12718499, and GP:12718499; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53695"
FT                   /db_xref="GOA:Q88B78"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B78"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53695.1"
FT                   /translation="MPLRSRFLVWLLVPLLTLCSSIALADPVEGAAQALHLLDYLGADY
FT                   PASVADGKVVEAADYQQQIEALTTLQGLVLALPQRAERADLEQAVAQLKNAVSSKQDGT
FT                   QVARQARQLAAKLAVAYEVSQAPAITPDPARGAPLYAQHCSVCHGDTGAGDGPAGIGLE
FT                   PPPSNLRDTARLDRLSLYDLYNALGLGIAGTDMPAFADQLDDRQRWDIATSIASFSAQP
FT                   VATATKAFNLADLARQTPAEVQAAEGPDAAATFRAQRAQPPQVQRGPAQLLDYTGVTLD
FT                   KSLAAYKAGDREQAYDLSVAAYLEGFELVESSLDNVDANVRKDTEKSLMAYRQSLQDSL
FT                   PLPQVEQKLEVAKAKLKESAGLLGSDGLSLSLSYISGLLILLREGLEAILVLAAILAFL
FT                   RNTGQQSAVRSVNVGWGLALLAGLGTWALAAYVIDVSGAQRELLEGATALFASVMVLWL
FT                   GVWMHDRRHAAAWQDYVKSSLVGGGGRFGFAVLAFFSVYRELFEVILFYETLWLQAGPA
FT                   GHNAVLAGGATALVLLVGLAWVILRGSAKLPLSLFFGINAALLCALSVVFAGHGVKALQ
FT                   EAGIFGTRPVPFFEFDWLGIHADLYSLGAQAIALTAIAVLYGRSVLAEKRRLQASA"
FT   gene            166054..166284
FT                   /locus_tag="PSPTO_0142"
FT                   /old_locus_tag="PSPTO0142"
FT   CDS_pept        166054..166284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0142"
FT                   /old_locus_tag="PSPTO0142"
FT                   /product="protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53696"
FT                   /db_xref="GOA:Q88B77"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B77"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53696.1"
FT                   /translation="MVKYEIRLWAEDTERHNHPVIAIEFYEEDELQEHALIKLYPHGRY
FT                   KIIEGELGRDEDVLHDLALAFRKKVGELADW"
FT   gene            complement(166389..166676)
FT                   /locus_tag="PSPTO_0143"
FT                   /old_locus_tag="PSPTO0143"
FT   CDS_pept        complement(166389..166676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0143"
FT                   /old_locus_tag="PSPTO0143"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53697"
FT                   /db_xref="GOA:Q88B76"
FT                   /db_xref="InterPro:IPR012658"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B76"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53697.1"
FT                   /translation="MTDTPAVITKKRFIAGAVCPACSEPDKLMMWSENDVPHRECVGCG
FT                   YSDTLNEQGISIPKELGTRVNKAVVKPADPKVQGVQFFPNPKLKKPVDLG"
FT   gene            complement(166673..168724)
FT                   /gene="prlC"
FT                   /locus_tag="PSPTO_0144"
FT                   /old_locus_tag="PSPTO0144"
FT   CDS_pept        complement(166673..168724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prlC"
FT                   /locus_tag="PSPTO_0144"
FT                   /old_locus_tag="PSPTO0144"
FT                   /product="oligopeptidase A"
FT                   /note="similar to SP:P27298; identified by sequence
FT                   similarity; putative; see PMID:20190049 for expression
FT                   data; similar to SP:P27298, identified by sequence
FT                   similarity, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53698"
FT                   /db_xref="GOA:Q88B75"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B75"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53698.1"
FT                   /translation="MSANNPLLQSYDLPPFSAIRAEHVKPAIEQILADNRAAIVDILSK
FT                   QGSTPTWAGLVLTMDELNDRLGAAWSPVSHLNAVCNSPELREAYESCLPALSAYSTEMG
FT                   QNRALFQAYEALANSPEAAGFDVGQKTILEQSLRDFRLSGIDLPPEQQKRYAQVQSKLS
FT                   ELGSQFSNQLLDATQAWTKLVADESALAGLTDSAKQQMAAAAKAKDLEGYLITLEFPSY
FT                   YAVMTYAEDRALREEVYAAYCTRASDQGPNAGKNDNTPVMEQILDLRQELAQLLGYANF
FT                   AELSLATKMAESSDQVLSFLRDLAKRSKPFAAQDLEQLKTYAAEQGCPDLQSWDSGFYG
FT                   EKLREQRYSVSQEILRAYFPIDKVLGGLFAIVQRLYGIEIAEQKGFDTWHPDVRLFEIK
FT                   ENGQHVGRFFFDLYARANKRGGAWMDGARDRRRTAQGALQSPVANLVCNFTPAAAGKPA
FT                   LLTHDEVTTLFHEFGHGLHHLLTRVEHAGVSGINGVAWDAVELPSQFMENWCWEPEGLA
FT                   LISGHYETGEPLPQDLLEKMLAAKNFQSGLMMVRQLEFSLFDFELHATHGDGRSVLDVL
FT                   EGIRDEVSVMRPPAYNRFPNSFAHIFAGGYAAGYYSYKWAEVLSADAFSKFEEDGVLNA
FT                   ETGRAFREAILARGGSQVPMVLFVDFRGREPSIDALLRHSGLSEDAAA"
FT   gene            168837..169382
FT                   /locus_tag="PSPTO_0145"
FT                   /old_locus_tag="PSPTO0145"
FT   CDS_pept        168837..169382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0145"
FT                   /old_locus_tag="PSPTO0145"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:9945890; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53699"
FT                   /db_xref="GOA:Q88B74"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B74"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53699.1"
FT                   /translation="MAIRKFQDHTPALGERAFIDHSAMVIGDVEIGADSSIWPLTVVRG
FT                   DMHRIRIGARTSVQDGSVLHITHAGPFNPDGFPLLIGDEVTIGHKSMLHGCTIGNRILV
FT                   GMGTTIMDGAVVEDEVIIGAGSLVPPGKVLESGFLYVGRPVKQARALTEKEIAFFPYSA
FT                   TNYVKLKDQHLAEGFDKP"
FT   gene            complement(169523..170578)
FT                   /locus_tag="PSPTO_0146"
FT                   /old_locus_tag="PSPTO0146"
FT   CDS_pept        complement(169523..170578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0146"
FT                   /old_locus_tag="PSPTO0146"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GP:9945887; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53700"
FT                   /db_xref="GOA:Q88B73"
FT                   /db_xref="InterPro:IPR014553"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B73"
FT                   /protein_id="AAO53700.1"
FT                   /translation="MPIPSASRLRHLFALTALTLLAGCSSVSYYGQLAQGQWQLLQARE
FT                   PVEKIIADPTRDAGLREHLARSQLARRFASDHLHLPDNKSYRLYADLGRPYVVWNVFAT
FT                   DEFSLEPVTHCFPIAGCVAYRGYYSPGGARGEAALQRQAGKDVYLSGVEAYSTLGWFDD
FT                   PILSSMLGWGDERLATLIFHELAHQRFYVKDDTEFNESYASFVEQEGTRQWRAARGLPP
FT                   ESVSQSARRDQFIRLVLETRERLKALYRQPLSAEVMRARKAAEFERLRRDYRQMRDEQW
FT                   AGDKRFDGWVNGPMNNAKLLPFGLYDQWVPAFAALFRQVNGDWPAFYQAVEALGGLPVE
FT                   SRKTALRRLMH"
FT   gene            170766..171197
FT                   /locus_tag="PSPTO_0147"
FT                   /old_locus_tag="PSPTO0147"
FT   CDS_pept        170766..171197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0147"
FT                   /old_locus_tag="PSPTO0147"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53701"
FT                   /db_xref="GOA:Q88B72"
FT                   /db_xref="InterPro:IPR021994"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B72"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53701.1"
FT                   /translation="MTKTPTSGRGDLPRALIFIPLGLCLLYLTVCLVVDRINFLAQAQR
FT                   AEGHVSALNAGGSHPQVDFTDAVGKAVSYPQGGFIFGYSVGDPVTVLYLGEAPSSTAII
FT                   EDQGALWGVSLLTGLFAIVFTAGGGYHMAAWIRRRRMAR"
FT   gene            171406..173142
FT                   /locus_tag="PSPTO_0148"
FT                   /old_locus_tag="PSPTO0148"
FT   CDS_pept        171406..173142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0148"
FT                   /old_locus_tag="PSPTO0148"
FT                   /product="oligopeptide transporter, OPT family"
FT                   /note="identified by match to PFAM protein family HMM
FT                   PF03169"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53702"
FT                   /db_xref="GOA:Q88B71"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B71"
FT                   /protein_id="AAO53702.1"
FT                   /translation="MPTAPTPQIPPVQRELSLRAVITGIVLGILLTPSNVYAGLKIGWS
FT                   FNMSIIALLIGYAIWQGLAKRSPHQPPWTLHESNINQTVASAAASIISGGLVAPIPAYT
FT                   LLTGQQLDAIPMMAWVFSVSFLGIWIAWYLRPSLLNDTSLKFPEGMATLETLLHIYNHG
FT                   REAATRLKVLLNAALLSGLAKWVDTFVWAFPRWSPSASLERLTFTADPSLLLVGFGAII
FT                   GIRVGVTLLLGALLAWGGLAPWLLAQGLVTLPAGSSGPQFAALVEWLLWPGVSLMVCST
FT                   LASLAIRLWGLHRSTKANSGTIWAVPKAGPALGLLLSIILVVSLQALLFGINLWMALLT
FT                   IPLAICLAAVAARVVGATGIPPIGAIGQLSQLSFGIVAPGQVTINLMSANTAGGSAGQC
FT                   TDLMNDFKVGKAIGATPRKQLVAQTLGIFVGSIVGVLAYMALIPDPQSMLLTEEWPAPA
FT                   VATWKAVAQTLTHGLDSLSASIRWAIFIAGLTGLLLGVLDSTLPARRARYLPSAAALGL
FT                   AFVLPASVSLMMALGAVLTWTVSGRWASLTERFAITAAAGLIAGESITGVGASLWQMFG
FT                   NG"
FT   gene            173456..174133
FT                   /locus_tag="PSPTO_0149"
FT                   /old_locus_tag="PSPTO0149"
FT   CDS_pept        173456..174133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0149"
FT                   /old_locus_tag="PSPTO0149"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:6498207, and GP:9836729; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53703"
FT                   /db_xref="GOA:Q88B70"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B70"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53703.1"
FT                   /translation="MSSMSTLEVAKAIRLSISSARISTYENAALAVGRGLDEAVTLYAW
FT                   NALVSGAFLTPLHLCEVIVRNGVADAIASVYGPRWPWSPGFEQSLPDVTGPTFKPKQEL
FT                   ARARQKCSTTGSVIAELKFVFWEKMFTKRFEGRLWAPYLHRFFPNLEKCFTVSTHRAKI
FT                   AADLEQIRLLRNRIAHHEPIFSRNLKSDFAVIQRLTETRCIVSADWMNGQQQVMSTVAT
FT                   KPF"
FT   gene            174152..174586
FT                   /locus_tag="PSPTO_0150"
FT                   /old_locus_tag="PSPTO0150"
FT   CDS_pept        174152..174586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0150"
FT                   /old_locus_tag="PSPTO0150"
FT                   /product="lipoprotein, putative"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53704"
FT                   /db_xref="GOA:Q88B69"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B69"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53704.1"
FT                   /translation="MPSRFLTLTIAFTLATLAGCAGPLPAVDPNMAWIDMRTLTGQLIM
FT                   ADKLDGKNTYDGRYFQVTPGSHELQVRYDYEYRSGGMGMIGDEYTEITCYVSVRYKHFA
FT                   AGQHYMLEVRSLANSVDAWLYDEKRNVVAEEEEEGGVHCI"
FT   gene            complement(174587..174820)
FT                   /locus_tag="PSPTO_0151"
FT                   /old_locus_tag="PSPTO0151"
FT   CDS_pept        complement(174587..174820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0151"
FT                   /old_locus_tag="PSPTO0151"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53705"
FT                   /db_xref="GOA:Q88B68"
FT                   /db_xref="InterPro:IPR010595"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B68"
FT                   /protein_id="AAO53705.1"
FT                   /translation="MKRFILAATCTLLATSALAAPKSCDELKDEIEAKIQANNVTSYTL
FT                   EIVSNEEATDPNMVVGSCENGSKKIIYQRNDR"
FT   gene            complement(174938..175369)
FT                   /gene="osmC"
FT                   /locus_tag="PSPTO_0152"
FT                   /old_locus_tag="PSPTO0152"
FT   CDS_pept        complement(174938..175369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="osmC"
FT                   /locus_tag="PSPTO_0152"
FT                   /old_locus_tag="PSPTO0152"
FT                   /product="osmotically inducible protein"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P23929, GB:M16447, GB:X04882, SP:P09417, PID:181553, and
FT                   PID:30819; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53706"
FT                   /db_xref="GOA:Q88B67"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019904"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B67"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53706.1"
FT                   /translation="MSIVKKASAHWEGDLKSGIGSISTETGVLREAPYGFKARFEGGKG
FT                   TNPEELIGAAHAGCFSMALSMILGDAGLKADSIDTSAEVSLDQVEGGFAISAVHLVLKA
FT                   KVPGATQEQFDELTKKAKEGCPVSKVLNAKITLDATLVS"
FT   gene            175580..176581
FT                   /locus_tag="PSPTO_0153"
FT                   /old_locus_tag="PSPTO0153"
FT   CDS_pept        175580..176581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0153"
FT                   /old_locus_tag="PSPTO0153"
FT                   /product="bacterial luciferase family protein"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to PFAM protein family HMM PF00296"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53707"
FT                   /db_xref="GOA:Q88B66"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B66"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53707.1"
FT                   /translation="MKRLADVKISTLDLVPVRHDKGPAESLRNSLSLAQHVEKLGYNRF
FT                   WVAEHHNMDGIASSATSVLLAYLAGGTSTIRVGAGGIMLPNHAPLVVAEQFGTLASLYP
FT                   DRIDLGLGRAPGSDQMTARALRRERSGSAEDFPDDVTELMEYLGPRTPDQKVIAVPGSG
FT                   TNVPIWLLGSSLFSAQLAGMRGLPYAFASHFAPRYMHEAIRVYRNHFQPSAVLDKPYVM
FT                   LGVPLSAADTDEQAEYLATSVYQRILALMRGHSLMQRPPVDSMDGLWLPHEREAVASFL
FT                   GLAMVGGPEKIRAKLDVLLEQTDADELIFTCDMYEHEDRLRSYEILAQVAHG"
FT   gene            complement(176728..176952)
FT                   /locus_tag="PSPTO_0154"
FT                   /old_locus_tag="PSPTO0154"
FT   CDS_pept        complement(176728..176952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0154"
FT                   /old_locus_tag="PSPTO0154"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:9945860; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53708"
FT                   /db_xref="GOA:Q88B65"
FT                   /db_xref="InterPro:IPR010595"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B65"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53708.1"
FT                   /translation="MKKFLLAVGLLSIAGTALAAGKPCDELKSELDAKLQSKGVTSYTL
FT                   EVVEKGSAAGKQVVGTCEGGTKEIVYQRG"
FT   gene            complement(177102..177317)
FT                   /locus_tag="PSPTO_0155"
FT                   /old_locus_tag="PSPTO0155"
FT   CDS_pept        complement(177102..177317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0155"
FT                   /old_locus_tag="PSPTO0155"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53709"
FT                   /db_xref="GOA:Q88B64"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036694"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B64"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53709.1"
FT                   /translation="MSDNHTYKKVEIVGSSTTTIEDAINNALAEASKSLSHLEWFEVTE
FT                   TRGHIENGKVAHFQVTLKVGFRIAAS"
FT   gene            177485..177811
FT                   /locus_tag="PSPTO_0156"
FT                   /old_locus_tag="PSPTO0156"
FT   CDS_pept        177485..177811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0156"
FT                   /old_locus_tag="PSPTO0156"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:15978663; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53710"
FT                   /db_xref="GOA:Q88B63"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B63"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53710.1"
FT                   /translation="MVSTSLRKASLQSMEAEIESLLKSLEGLKDDATDESRKTLKNLKA
FT                   NAESALSHSRSLLSDVYEDVKEKTRENALATRDYAQEHPWTTAGVAVGAIGLLAAYLLF
FT                   KRGN"
FT   gene            complement(177812..178720)
FT                   /gene="trpI"
FT                   /locus_tag="PSPTO_0157"
FT                   /old_locus_tag="PSPTO0157"
FT   CDS_pept        complement(177812..178720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpI"
FT                   /locus_tag="PSPTO_0157"
FT                   /old_locus_tag="PSPTO0157"
FT                   /product="trpBA operon transcriptional activator"
FT                   /note="similar to SP:P34818; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53711"
FT                   /db_xref="GOA:Q88B62"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037418"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B62"
FT                   /protein_id="AAO53711.1"
FT                   /translation="MSRDLPPLNALRAFESTARFGSVSQAAEQLSVTHGAVSRQLKVLE
FT                   EHLGVSLFSKDGRGLKLTDAGIRLRDASADAFDRLRSVCAELSKGSVDAPFVLGCSGSL
FT                   LARWFIPRLSRLNAELPDLRLHLSAGEGDLDPRRPGLDALLVFAEPPWPADMQVFELAS
FT                   ERIGPVLSPRFARFESMRDAPANALLEESLLQTTSRPQAWPSWAQQNGIDPDALRYGQG
FT                   FEHLYYLLEAAVAGLGIAIAPEPLVIDDLKAGRLAAPWGFSETPAQLALWVPRRAADGR
FT                   ARQLAQWLKNELKRSGDPIRN"
FT   gene            178848..180077
FT                   /gene="trpB"
FT                   /locus_tag="PSPTO_0158"
FT                   /old_locus_tag="PSPTO0158"
FT   CDS_pept        178848..180077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpB"
FT                   /locus_tag="PSPTO_0158"
FT                   /old_locus_tag="PSPTO0158"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /note="identified by match to PFAM protein family HMM
FT                   PF02863; see PMID:20190049 for expression data; identified
FT                   by match to PFAM protein family HMM PF02863"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53712"
FT                   /db_xref="GOA:Q88B61"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88B61"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53712.1"
FT                   /translation="MTQTNFRSGPDANGLFGSFGGRYVAETLMPLVLDLNREYEAAKAD
FT                   PEFIKEMAYFQRDYIGRPNPLYFAERLTEFCGGAKIYFKREELNHTGAHKINNCIGQVL
FT                   LAKRMGKKRLIAETGAGMHGVATATVAARFGLPCVIYMGATDIERQQANVFRMKLLGAE
FT                   IVPVTSGTGTLKDAMNEALRDWVTNVDDTFYLIGTVAGPHPYPAMVRDFQSVIGKETKE
FT                   QMQEKEGRLPDSLIACVGGGSNAMGLFHPFLDDASVEIIGVEAGGHGVDTDKHAASLNG
FT                   GVPGVLHGNRTYLLQDNDGQITDAHSISAGLDYPGIGPEHAYLHEVKRVEYVSITDEEA
FT                   LDAFHQCCLLEGIIPALETAHALAEAMKRATNLRDDHLMVVCLSGRGDKDMQTVMNHMA
FT                   AADNTQEKLV"
FT   gene            180074..180886
FT                   /gene="trpA"
FT                   /locus_tag="PSPTO_0159"
FT                   /old_locus_tag="PSPTO0159"
FT   CDS_pept        180074..180886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpA"
FT                   /locus_tag="PSPTO_0159"
FT                   /old_locus_tag="PSPTO0159"
FT                   /product="tryptophan synthase, alpha subunit"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to TIGR protein family HMM TIGR01768"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53713"
FT                   /db_xref="GOA:Q88B60"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88B60"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53713.1"
FT                   /translation="MSRLEQRFAQLKTEGRAVLVTFITAGDPGYDTSLKVLKGLPAAGA
FT                   DVIELGMPFTDPMADGVAIQLATLRALDAGQTLLKTLQMVSEFRVDDQTTPIVLMGYYN
FT                   PIHRFGVEAFVAQAKEAGVDGLIIVDLPPEHDAELATPAQASGIDFIRLTTPTTDDARL
FT                   PRVLERSSGFVYYVSVAGVTGAGSATTEHVTEAIARLRRHTSLPISVGFGIRTPEQAAA
FT                   IARLADGVVVGSAFVDKIATAESPEQAIDGVLTLCAALAEGVRNARVS"
FT   gene            181013..181528
FT                   /locus_tag="PSPTO_0161"
FT                   /old_locus_tag="PSPTO0161"
FT   CDS_pept        181013..181528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0161"
FT                   /old_locus_tag="PSPTO0161"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GP:4324614; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53715"
FT                   /db_xref="GOA:Q88B58"
FT                   /db_xref="InterPro:IPR024572"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B58"
FT                   /protein_id="AAO53715.1"
FT                   /translation="MKLPNRFITGLGILMISASSLLQAAPPDQRGEGPDSNRGGQQQGP
FT                   QNGGHNERGNERGNERGPGNDKSNGPGKQAHQDNRGGNRPPQDFGPVRETFQQHRDVIG
FT                   RGQPLPPGVHIAKGQPLPRGYGKRLDSRSLQYLPRYDGYEWRRLGTDVVLIAVGSGIVY
FT                   AILDGVLN"
FT   gene            complement(181714..182538)
FT                   /locus_tag="PSPTO_0162"
FT                   /old_locus_tag="PSPTO0162"
FT   CDS_pept        complement(181714..182538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0162"
FT                   /old_locus_tag="PSPTO0162"
FT                   /product="3-oxoadipate enol-lactone hydrolase family
FT                   protein"
FT                   /note="similar to GP:17736948; identified by sequence
FT                   similarity; putative; see PMID:20190049 for expression
FT                   data; similar to GP:17736948, identified by sequence
FT                   similarity, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53716"
FT                   /db_xref="GOA:Q88B57"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B57"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53716.1"
FT                   /translation="MPDLLIDGKTLHYADQGTGPVVLLGHSYLWDKAMWSAQIDTLASR
FT                   YRVIVPDLWGHGDSSGFPEGTRNLDDLARHALALLDHLNIERCSIVGLSVGGMWGAIAA
FT                   LLAPERITGLVLMDTYLGKETEAKKAYYFSLLDKLEEAGAFPAPLLDIVVPIFFRPGID
FT                   PQSPVYQAFRSALAGMNAEQLRQSVVPLGRMIFDRDDRLGLIEQLNADTTLVMCGDADI
FT                   PRPPEETREMAGLIGCPYVLVPEAGHIANLENPAFVSGALMTFLARVNQKQG"
FT   gene            complement(182751..183083)
FT                   /locus_tag="PSPTO_0163"
FT                   /old_locus_tag="PSPTO0163"
FT   CDS_pept        complement(182751..183083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0163"
FT                   /old_locus_tag="PSPTO0163"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:17135034, GB:L04309, SP:Q07567, and PID:310375;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53717"
FT                   /db_xref="GOA:Q88B56"
FT                   /db_xref="InterPro:IPR014980"
FT                   /db_xref="InterPro:IPR023389"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B56"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53717.1"
FT                   /translation="MQDIHGYHAHIYFNAQTLDQARALCEAATEKFAVQMGRVHQKLVG
FT                   PHPDWSCQLAFGHEQLADVTLWLALNRDGLVVFLHPLTGDELRDHTDHAIWMGAVRPLD
FT                   LSALTG"
FT   gene            complement(183857..184807)
FT                   /locus_tag="PSPTO_0164"
FT                   /old_locus_tag="PSPTO0164"
FT   CDS_pept        complement(183857..184807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0164"
FT                   /old_locus_tag="PSPTO0164"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="similar to GP:15158554; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53718"
FT                   /db_xref="GOA:Q88B55"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017786"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B55"
FT                   /protein_id="AAO53718.1"
FT                   /translation="MFEAFGDMSLDLLRAFEVAARLRSFTAAAIELGTIQPAVSQQIKR
FT                   LEEQLATRLFDRIYRGIELTEAGEILFSHVQAGLQSIDSGLIAITEQQQHEVLQVATDF
FT                   AFAAYWLMPRLHRFHKLNPDVDVSLVTSERTHSMLRADIDVTVLFGDGRFKQGESRWLF
FT                   SEEVFPVCSPLLIADRQTPLPNDALRDFPLLHLRGDSINNWFDWSGVFRALDIPQAPAP
FT                   GQLRFDNYTLLIQAAIGGQGIAIGWKHLVDDLLDQGLLCRPIAGAAISGHGYYVVLPQR
FT                   KRRVQIVQQFMDWLASEQALSGVSLAGRPLPSIAV"
FT   gene            184922..186427
FT                   /locus_tag="PSPTO_0165"
FT                   /old_locus_tag="PSPTO0165"
FT   CDS_pept        184922..186427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0165"
FT                   /old_locus_tag="PSPTO0165"
FT                   /product="sulfatase family protein"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to PFAM protein family HMM PF00884"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53719"
FT                   /db_xref="GOA:Q88B54"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017785"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="InterPro:IPR025863"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B54"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53719.1"
FT                   /translation="MKRKNILFIMADQMAAPMLPFYAPSPILMPNLSRLAADGVVFDSA
FT                   YCNSPLCAPSRFTLVSGQLPSRIGGYDNAADFPADVPTYAHYLRALGYKTALSGKMHFC
FT                   GPDQLHGYEERLTSDIYPADYGWSVNWDEPDVRPSWYHNMSSVLQAGPCVRTNQLDFDE
FT                   EVLFKAQQYLYDHVRQDGDAPFCLTVSMTHPHDPYTIPRPFWDLYSDDEIPMPTPHANQ
FT                   AALDPHSQRLLKVYDLWDKPMPTNKIRDARRAYFGACSYIDLNVGKLMQTLDEVGLADD
FT                   TIVVFSGDHGDMLGEKGLWYKMHWFEMAARVPLVVYAPGQFKPGRVSASVSTADLLPTF
FT                   VEMAKGTLDAGLPLDGRSLMPHLKRKGGHDEVFGEYMAEGTTSPLMMIRRGAYKFIYSE
FT                   QDPCLLFDVKKDPKEQKDLSQSPAHEKLFNDFLAEARAKWDIPAIHQQVLASQRRRRFV
FT                   AKSLATGKLKSWDHQPLVDASQQYMRNHIDLDDLERKARFPQP"
FT   gene            186464..187390
FT                   /locus_tag="PSPTO_0166"
FT                   /old_locus_tag="PSPTO0166"
FT   CDS_pept        186464..187390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0166"
FT                   /old_locus_tag="PSPTO0166"
FT                   /product="glycine/betaine family, ABC transporter,
FT                   substrate-binding protein"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:15158553; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53720"
FT                   /db_xref="GOA:Q88B53"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B53"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53720.1"
FT                   /translation="MKQLSTAVAVAVMTFGSFAAQAEDASCSTVKMADTGWSDIAATNA
FT                   ITGVVLEGLGYKAKVDTLAVPIAYGGLKDGKLDVFLGNWMPAQQGFYDKFVATGDVTQL
FT                   ARNLEGTEFTLAVPDYVWEAGVHDFTDLSKFAEKFDKKIYGIGSGAPANLSLQEIIKKN
FT                   EFDLGQWKLVESSEQAMLAEVNRNVKKKAFVVFLGWTPHPMNVQIKGMHYLKGGEKYFG
FT                   DTGSVFTLTRKGYAQACPNVGKLLTNLSFTLDMENSIMAEVTNKKLSNSAAAKAWIKAN
FT                   PAVLDTWLEGVKTVDGKDGLAAVKAKL"
FT   gene            187452..187874
FT                   /locus_tag="PSPTO_0167"
FT                   /old_locus_tag="PSPTO0167"
FT   CDS_pept        187452..187874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0167"
FT                   /old_locus_tag="PSPTO0167"
FT                   /product="protein of unknown function"
FT                   /note="identified by Glimmer2; putative; see PMID:20190049
FT                   for expression data; identified by Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53721"
FT                   /db_xref="GOA:Q88B52"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B52"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53721.1"
FT                   /translation="MALQSVILEDTSWEPTEGGKPPGCRAACPLTLENSMKKSLIPLSL
FT                   ALILSASFASAGNWPPETSAKVPGNALEYPTKLEAVNVSMEEMLNAGATVVSSYVAENG
FT                   PVVTLNNKKHYVICMLRGAGTGSDTNVATSKCYAMN"
FT   gene            187946..189514
FT                   /locus_tag="PSPTO_0168"
FT                   /old_locus_tag="PSPTO0168"
FT   CDS_pept        187946..189514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0168"
FT                   /old_locus_tag="PSPTO0168"
FT                   /product="sulfate transporter family protein"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to PFAM protein family HMM PF03594"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53722"
FT                   /db_xref="GOA:Q88B51"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B51"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53722.1"
FT                   /translation="MRWLNRHKFLPFLAWLPQQSRASVGRDALVGLSGAILALPQSIAY
FT                   ALIAGLPPEYGLYAAIVPVLIACLWGSSWHLICGPTAAISIVLYVSVSPLAVPASQDYI
FT                   MLILLLTFIAGVFQLLLGMMRFGALVNFVSHSVVLGFTLGAAVVIALGQMPNLLGIDLP
FT                   SQTTALKSLSAVLEHRGELDKPSLMLGLLTLTLGIGLKAWVPRWPTLLIALVSSSLLVW
FT                   LWPAMFGHVRVVSAFVGHLPPFSPLPLDLELILKLLPTAVAVGMLGLVNSLSIARSLSA
FT                   RSQQMLNANQEVRAQGLSNMVGSLFSGYLSAGSFTRAALSYEAGARSPLAGVFSALWVA
FT                   LFAVAGASLVSHIPIPAMAASILLICWGLVDRRGIRALLRVSRAEFFVMALTCLATLLL
FT                   ELQTAIYAGVLASLFFYLKRTSQPRVQQWREGDEDVLRVGGSIFFGASHYLQTRLQRTE
FT                   GLRVVIDAQQINFIDYSGVEMLHQEARRLGQQGRVLVLRNARPLVIEELHKLEGPENCP
FT                   ILFED"
FT   gene            complement(189618..190442)
FT                   /gene="aroE"
FT                   /locus_tag="PSPTO_0169"
FT                   /old_locus_tag="PSPTO0169"
FT   CDS_pept        complement(189618..190442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="PSPTO_0169"
FT                   /old_locus_tag="PSPTO0169"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P15770; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53723"
FT                   /db_xref="GOA:Q88B50"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B50"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53723.1"
FT                   /translation="MDQYVVFGNPIGHSKSPLIHRLFAEQTGQALNYQTALAPLDDFTA
FT                   FAQAFFQTGRGANVTVPFKEEAFRLADSLTERGQRAGAVNTLSKLDDGTLLGDNTDGAG
FT                   LVRDLTVNCACSLRGQRVLLLGAGGAVRGALEPLLAEKPAVLVIANRTVEKAERLAQEF
FT                   ADLGPVFASSFDWLEEPVDLIINATSASLAGELPPISPSLIQPGATFCYDMMYSKAPTA
FT                   FCRWATEQGAAQSVDGLGMLVEQAAEAFLLWRGVRPDSAPVLAELRRLLAAG"
FT   gene            complement(190442..191356)
FT                   /gene="hemF"
FT                   /locus_tag="PSPTO_0170"
FT                   /old_locus_tag="PSPTO0170"
FT   CDS_pept        complement(190442..191356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemF"
FT                   /locus_tag="PSPTO_0170"
FT                   /old_locus_tag="PSPTO0170"
FT                   /product="coproporphyrinogen III oxidase, aerobic"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P36553; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53724"
FT                   /db_xref="GOA:Q88B49"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88B49"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53724.1"
FT                   /translation="MSTRTEAVKAYLLDLQDRICTALEQEDGNAHFVEDAWTRPAGGGG
FT                   RTRVVENGAVIEKGGVNFSHVFGSNLPPSASAHRPELAGRGFEALGVSLVIHPHSPHVP
FT                   TSHANVRFFIAEKEGEEPVWWFGGGFDLTPYYGVEEDCVHWHRVAERACAPFGDDVYPR
FT                   YKAWCDSYFHLKHRDEPRGIGGLFFDDVNQWDFDTSFAFIRAIGDAFINAYLPIVRRRK
FT                   AAAYTVQQREFQEFRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRWGYDWKA
FT                   APGSEEARLTDYFLTDRDWLADN"
FT   gene            191660..192508
FT                   /locus_tag="PSPTO_5630"
FT   CDS_pept        191660..192508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_5630"
FT                   /product="protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   gb:AAO55966; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_5630"
FT                   /db_xref="EnsemblGenomes-Tr:ABV02589"
FT                   /db_xref="UniProtKB/TrEMBL:A7WK44"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="ABV02589.1"
FT                   /translation="MRIFADTPDWDDVERTLKDTFDTVNQSFDRGWTSTQDEWHGFTRR
FT                   ISLRVTSIFGDMGPDRIDAVKEALRLSYPIILTRLSRRWASIEIDQIINILLQVAKEVT
FT                   MIVGGSVLAGSIIGGSIGALAYGTGIGAGVVIGGGIGFQLGNVILMALGLSAIADYFYE
FT                   GLPACLATLHDGLALAWNAEYGTPVGLDPTGGSAARRDSRIDEASRLLANGQEQLITLL
FT                   LTAIVTYVMRGQIKNSLQSSADDIMARSAQLQAEISNKQLADWLAKNIEKLLKETLKKV
FT                   S"
FT   gene            192549..193526
FT                   /locus_tag="PSPTO_0171"
FT                   /old_locus_tag="PSPTO0171"
FT   CDS_pept        192549..193526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0171"
FT                   /old_locus_tag="PSPTO0171"
FT                   /product="ISPssy, transposase"
FT                   /note="similar to GP:13094159, and GP:4514540; identified
FT                   by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53725"
FT                   /db_xref="GOA:Q877U1"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:Q877U1"
FT                   /protein_id="AAO53725.1"
FT                   /translation="MKQMTFADAEYAGKRKHTRRERFLIEMDQVVPWKGLIALIEPHYP
FT                   KGEGGRPAYPLMAMLRIHLMQNWFGYSDPAMEEALYETTILRQFAGLSLDRIADETTIL
FT                   NFRRLLEKHELAGGILQVINGYLGDRGLMLRQGTVVDATIIHAPSSTKNKDGKRDPEMH
FT                   QTKKGNQYFFGMKAHIGVDAESGLVHSLVGTAANVADVTQVDQLLHGEETYVSGDAGYT
FT                   GVDKRAEHQDRQMIWSIAARPSRYKKHGEKSLIARVYRKIEFTKAQLRAKVEHPFRVIK
FT                   RQFGYTKVRFRGLAKNTAQQATLFALSNLWMVRKRLLAMGEVRL"
FT   gene            194114..194407
FT                   /locus_tag="PSPTO_0172"
FT                   /old_locus_tag="PSPTO0172"
FT   CDS_pept        194114..194407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0172"
FT                   /old_locus_tag="PSPTO0172"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53726"
FT                   /db_xref="GOA:Q88B48"
FT                   /db_xref="InterPro:IPR022080"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B48"
FT                   /protein_id="AAO53726.1"
FT                   /translation="MAIEKMHSGHSCLSLSAEVDWEGFPRYAEIILGLLGGTVTSKSDA
FT                   VDVRVWDVQIKGEAFFLAYEDFPSMVGLESKSAKGDALIEGFLSVLSQSSQS"
FT   gene            194503..195480
FT                   /gene="qor"
FT                   /locus_tag="PSPTO_0173"
FT                   /old_locus_tag="PSPTO0173"
FT   CDS_pept        194503..195480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qor"
FT                   /locus_tag="PSPTO_0173"
FT                   /old_locus_tag="PSPTO0173"
FT                   /product="quinone oxidoreductase"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P28304; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53727"
FT                   /db_xref="GOA:Q88B47"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:3JYL"
FT                   /db_xref="PDB:3JYN"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B47"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53727.1"
FT                   /translation="MAKRIQFSTVGGPEVLEYVDFEPEAPGPQAVVVRNKAIGLNFIDT
FT                   YYRSGLYPAPFLPSGLGAEGAGVVEAVGDEVTRFKVGDRVAYGTGPLGAYSEVHVLPEA
FT                   NLVKLADSVSFEQAAALMLKGLTVQYLLRQTYQVKPGEIILFHAAAGGVGSLACQWAKA
FT                   LGAKLIGTVSSPEKAAHAKALGAWETIDYSHEDVAKRVLELTDGKKCPVVYDGVGQDTW
FT                   LTSLDSVAPRGLVVSFGNASGPVSGVNLGILAQKDSVYVTRPTLGSYANNAQNLQTMAD
FT                   ELFDMLASGKLKVDGIEQYALKDAAKAQIELSARRTTGSTILIP"
FT   gene            complement(195488..196045)
FT                   /locus_tag="PSPTO_0174"
FT                   /old_locus_tag="PSPTO0174"
FT   CDS_pept        complement(195488..196045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0174"
FT                   /old_locus_tag="PSPTO0174"
FT                   /product="SUA5/yciO/yrdC family domain protein"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to TIGR protein family HMM TIGR00057"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53728"
FT                   /db_xref="GOA:Q88B46"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88B46"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53728.1"
FT                   /translation="MVSSWRVQQAAQNIRAGAVIAYPTEAVWGLGCDPWDEEAVYRLLA
FT                   IKLRPVEKGLILIADNIRQFDFLFEDFPELWLDRMASTWPGPNTWLVPHQNLLPEWITG
FT                   IHETVALRVTDHPTVRELCALVGPLISTSANPAGRPAARSRLRVEQYFRGQINGVLGGS
FT                   LGGRRNPSVIRDIATGQVMRAG"
FT   gene            complement(196084..197268)
FT                   /locus_tag="PSPTO_0175"
FT                   /old_locus_tag="PSPTO0175"
FT   CDS_pept        complement(196084..197268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0175"
FT                   /old_locus_tag="PSPTO0175"
FT                   /product="DNA processing protein DprA, putative"
FT                   /note="similar to SP:P43862, GB:L29642, and PID:461402;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53729"
FT                   /db_xref="GOA:Q88B45"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B45"
FT                   /protein_id="AAO53729.1"
FT                   /translation="MLSTELSTGLRTIPGAQWIRDDLMPLFEKERSSPAELEARLRVHR
FT                   LPEVGPKRFFRLMEAFGSASSALSAPASAWRALGLPGACAEARRDPLVRDGASVALAWL
FT                   ERPGQHLLMWDDPCYPALLAQIADPPPLIFIAGDPSILERPQLGMVGSRRASKPGLDTA
FT                   KAFARSLAGAGFVVTSGLARGIDGAAHQGALDVGGLTIGVLGTGLGKLYPQQHRALATQ
FT                   IAAQGGAVISEFPLDAGPQPSNFPRRNRIISGLSLGVLVVEASVASGSLITARLAAEQG
FT                   REVYAIPGSIHHPGAKGCHQLIRDGATLVETVDHILEGLQHWKRVAPSADSSNTEPAPC
FT                   DHPLLALLHAAPHTSEGLSVSSGWPLPKVLAGLTELELDGRISCEAGRWFASAP"
FT   gene            complement(197323..198348)
FT                   /locus_tag="PSPTO_0176"
FT                   /old_locus_tag="PSPTO0176"
FT   CDS_pept        complement(197323..198348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0176"
FT                   /old_locus_tag="PSPTO0176"
FT                   /product="LysM domain protein"
FT                   /note="similar to GB:L21196, and PID:347174; identified by
FT                   sequence similarity; putative; see PMID:20190049 for
FT                   expression data; similar to GB:L21196, and PID:347174,
FT                   identified by sequence similarity, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53730"
FT                   /db_xref="GOA:Q88B44"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B44"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53730.1"
FT                   /translation="MRKSLLALLLLTASGLAQAQVQLREGYPQSYTVVAGDTLWDISGK
FT                   FLREPWKWREIWRANPQVHDPDLIYPGDTLALTWVDGQPRVTLNRGESRGTIKLSPRVR
FT                   STPMVQAIPSIPLGAINAFLISNRIVDNAEQFDKAPYIVAGNAERVLSGNGDRAYARGK
FT                   LDPTHTVYGIFRQGKIYTDAQTKEVLGINADDIGSAEVVATEGDVSTLSLQRSTQEVRL
FT                   GDRLFASEERSINSTFLPSAPQTPIEGLILDVPRGVTQVAVMDVVTLNKGKRDGLTEGN
FT                   VLAIYKTSETVRDRITGEQVKIPDERAGLLMVFRTYDKLSYALVLQANRSLAIMDKVRN
FT                   P"
FT   gene            198474..198980
FT                   /gene="def-1"
FT                   /locus_tag="PSPTO_0177"
FT                   /old_locus_tag="PSPTO0177"
FT   CDS_pept        198474..198980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def-1"
FT                   /locus_tag="PSPTO_0177"
FT                   /old_locus_tag="PSPTO0177"
FT                   /product="polypeptide deformylase"
FT                   /note="similar to SP:P27251; identified by sequence
FT                   similarity; putative; see PMID:20190049 for expression
FT                   data; similar to SP:P27251, identified by sequence
FT                   similarity, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53731"
FT                   /db_xref="GOA:Q88B43"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88B43"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53731.1"
FT                   /translation="MAILNILEFPDSRLRTLAKPVAMVDDGIRQLVDDMFETMYEAPGI
FT                   GLAATQVNVHKRVVVMDLSEDRSAPMVFINPEIEKLTDEMDQYQEGCLSVPGFYENVDR
FT                   PQKVRVKALDRDGKPYELVAEGLLAICIQHECDHLNGKLFVDYLSNLKRDRIKKKLEKQ
FT                   HKLNA"
FT   gene            199041..199985
FT                   /gene="fmt"
FT                   /locus_tag="PSPTO_0178"
FT                   /old_locus_tag="PSPTO0178"
FT   CDS_pept        199041..199985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="PSPTO_0178"
FT                   /old_locus_tag="PSPTO0178"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="identified by match to PFAM protein family HMM
FT                   PF02900"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53732"
FT                   /db_xref="GOA:Q88B42"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88B42"
FT                   /protein_id="AAO53732.1"
FT                   /translation="MTEPLRIVFAGTPEFAAEHLKALLDSPHQIVAVYTQPDRPAGRGQ
FT                   KLMPSPVKQLALQHDIPVMQPPTLRAPEAQAELAALKPDLMVVVAYGLILPQVVLDIPR
FT                   LGCINSHASLLPRWRGAAPIQRAVQAGDAESGVTVMRMEAGLDTGPMLLKAVTPISAQD
FT                   TGGTLHDRLAELGPPAVLQAIAGLAEGSLVGEAQDDSLANYAHKLNKDEARIDWTRPAD
FT                   ELERLVRAFNPWPICHSTLNEEALKVLAADLAEGQGAPGTILSASKDGLIVACGQNALR
FT                   LTRLQLPGGKPLNFTDLFNSRREKFAIGTVLGQ"
FT   gene            199982..201328
FT                   /gene="sun"
FT                   /locus_tag="PSPTO_0179"
FT                   /old_locus_tag="PSPTO0179"
FT   CDS_pept        199982..201328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sun"
FT                   /locus_tag="PSPTO_0179"
FT                   /old_locus_tag="PSPTO0179"
FT                   /product="sun protein"
FT                   /note="identified by match to TIGR protein family HMM
FT                   TIGR00446"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53733"
FT                   /db_xref="GOA:Q88B41"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88B41"
FT                   /protein_id="AAO53733.1"
FT                   /translation="MNPRLAAAKALAAVLSGKASLNSSLPTQLDKVELRDRGLTQDLAF
FT                   GTARWQPRLSALAAKLLQKPFKAADADVEALLLVGLYQLFYSRIPAHAAIGETVGCADK
FT                   LKKPWAKGLLNAVLRNAQRDGEALLIELEHDPVVRTAHPRWLQKALKAAWPEQWEAICA
FT                   ANNAHPPMILRVNRRHQRRDQYLELLKTAGLEASACTFSQDGIVLAEPCDVRSLPGFAE
FT                   GWISVQDEAAQLAADLLELAPGQRVLDACCAPGGKTCHLLEVQPQLSGVVAVDLEAKRL
FT                   VRVRENLERLGLDAELIAADARETAQWWDGKPFQRILLDAPCSATGVIRRHPDIKLTRQ
FT                   LDDIAALATLQGELLDALWPTLQVGGMLVYATCSTLPTENTDVIEAFLARTSGARELDI
FT                   AGQAGQPPAGIKQPHGRQLLAQQGGHDGFYYAKLIKIAAQDRGGAGVTS"
FT   gene            201325..202698
FT                   /gene="trkA"
FT                   /locus_tag="PSPTO_0180"
FT                   /old_locus_tag="PSPTO0180"
FT   CDS_pept        201325..202698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA"
FT                   /locus_tag="PSPTO_0180"
FT                   /old_locus_tag="PSPTO0180"
FT                   /product="Trk system potassium uptake protein TrkA"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P39448; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53734"
FT                   /db_xref="GOA:Q88B40"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B40"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53734.1"
FT                   /translation="MKIIILGAGQVGGTLAEHLAGEANDITVVDTDGDRLRDLGDRLDI
FT                   RTVQGKGSYPAVLRQAGADDADMLVAVTSSDEANMIACQVAHTLFHTPTKIARIREAAY
FT                   LTRAGLFDKNAIPVDVLISPEQVVTNYIKRLIEYPGALQVIDFAEGKAQLVAVKAYYGG
FT                   ALVGQQLRQLRAHMPNVDTRIAAIYRRDRAILPKGDTVIEADDEVFFIAARADIRAVMG
FT                   ELRRLDENYKRIVIAGGGNIGERLAEAIESRYQVKIIEVNPARCRYLSENLDSTVVLQG
FT                   SSSDRDLLLEENIGNTDLFLALTNDDEANIMSSLLAKRLGARKVMTLINNPAYVDLVQG
FT                   GEIDVAVSPQLATIGTLLAHVRRGDIVSVHSLRRGAAEAIEIVAHGDPKSSKVVGRAIK
FT                   DINLPTGTAIGAIIRDEQVLIAHDVTLIESGDHVIMFLVDKKCIRDVERLFQVGLSFF"
FT   gene            202781..205195
FT                   /locus_tag="PSPTO_0181"
FT                   /old_locus_tag="PSPTO0181"
FT   CDS_pept        202781..205195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0181"
FT                   /old_locus_tag="PSPTO0181"
FT                   /product="molybdopterin oxidoreductase, alpha subunit"
FT                   /note="similar to GP:15158403; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53735"
FT                   /db_xref="GOA:Q88B39"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B39"
FT                   /protein_id="AAO53735.1"
FT                   /translation="MYLNYTRTKPVTGFTRETYAMSDSNAPLQGSQTDGSPAGGWPALN
FT                   AVNKHLLHQHVLVKGNRTLLSMNKPGGFDCPSCSWPDPKKPHTFEYCENGAKALAWEST
FT                   KKRVTPEFFARHTVSELATWSDHDLEKQGRIAEPMRYDAASDKYLPVTWDEAFAEIGEE
FT                   LRQLSDPWKLELYTSGRTSNEAAFLYQLFGRLYGMANFPDCSNMCHETTTVALPESIGV
FT                   GKGTTTLEDFENADAIFIIGQNPGSNSPRMMSELHAAAKRGASIISFNPLREKALVRFA
FT                   SPQDPRDMLSLHGVEISSQYHQVRIGGDMIALQGVCKAVIEADDVARREHLPRVLDVAF
FT                   IEEHTHGFEQYADYCRQLPWDLIESHSGLTRQAIEDVAAVYRRSERVICCWGMGVTQHK
FT                   RGGDAVQQIINLLLLRGNIGKLGAGACPVRGHSNVQGDRTMGIYEKAGEPFLASMSKVF
FT                   GFEASRRKGHAVAETCEALLRGEVEALISMGGNFFRAIPDIDAICPTVSRLKMTVLVNT
FT                   KLNRSATVHGQKAFLLPCVARSERDLQNGVAQTITVEDSMSIVHGSTGMLEPASKHLIS
FT                   EVAIIAGIAKATLAPNPNVDWDSYVGDYARIRDKIEEVLPEQFYDFNRRILEPGGFRLP
FT                   NAASERKWDTESGKANFLFTEGIYDEDDTPPGAAHLQLMTIRSHDQFNTTVYSNDDRYR
FT                   DIFGDRMVVMLNPQDIERLGLKAGDYIEFQTALDLTTPRRAPGFKVIAYDVPPGCCAAY
FT                   YPETNGLLPLANRDSRSNTPAAKSIPVNLVRMSPEGAQVALERRGLIAAAS"
FT   gene            complement(205278..206165)
FT                   /locus_tag="PSPTO_0182"
FT                   /old_locus_tag="PSPTO0182"
FT   CDS_pept        complement(205278..206165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0182"
FT                   /old_locus_tag="PSPTO0182"
FT                   /product="lipid A biosynthesis lauroyl acyltransferase,
FT                   putative"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:9945830, and SP:P24187; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53736"
FT                   /db_xref="GOA:Q88B38"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B38"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53736.1"
FT                   /translation="MDKFKGAVMVGALRLFALLPWRAVQWVGTAIGWLMWKLPNRSREV
FT                   ARINLSKCFPELSEPELEKLVGRSLMDIGKTLTESACAWIWPAQKSINLVREVEGLEVL
FT                   KDALASGKGVVGITSHLGNWEVLNHFYCSQCKPIIFYRPPKLKAVDDLLRKQRVQLGNR
FT                   VAASTKEGILSVIKEVRKGGSVGIPADPEPAESAGIFVPFCGTQALTSKFVPNMLAGGK
FT                   AVGVFLHAMRLPDGSGYKVVLEAAPEAMYSTDTQTSAAAMSKVVEKYVRAYPSQYMWTM
FT                   KRFKKRPPGEARWY"
FT   gene            complement(206203..206754)
FT                   /gene="tag"
FT                   /locus_tag="PSPTO_0183"
FT                   /old_locus_tag="PSPTO0183"
FT   CDS_pept        complement(206203..206754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tag"
FT                   /locus_tag="PSPTO_0183"
FT                   /old_locus_tag="PSPTO0183"
FT                   /product="DNA-3-methyladenine glycosidase I"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P05100; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53737"
FT                   /db_xref="GOA:Q88B37"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B37"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53737.1"
FT                   /translation="MTRCFWCNEDPLYIAYHDQEWGVPLRDAQKLFELLLLEGFQAGLS
FT                   WITILKRRARYREVLFGFDAERLAQLSDAEIDALMLDPTIIRNRLKLKAVRTNARAWLA
FT                   LEDPVGLLWSFVGGKQKINHFKDRSEVPAITAEAEAMSKALKKAGFTFVGPTICYAYMQ
FT                   ATGMVMDHTVDCDRYTLLSR"
FT   gene            206834..207781
FT                   /gene="glyQ"
FT                   /locus_tag="PSPTO_0184"
FT                   /old_locus_tag="PSPTO0184"
FT   CDS_pept        206834..207781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="PSPTO_0184"
FT                   /old_locus_tag="PSPTO0184"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /note="identified by match to TIGR protein family HMM
FT                   TIGR00388; see PMID:20190049 for expression data;
FT                   identified by match to TIGR protein family HMM TIGR00388"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53738"
FT                   /db_xref="GOA:Q88B36"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88B36"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53738.1"
FT                   /translation="MSQPTPAVRTFQDLILALQQYWAEQGCVVLQPYDMEVGAGTFHTA
FT                   TFLRAVGPETWNAAYVQPSRRPTDGRYGENPNRLQHYYQFQVILKPNPDNFQELYLGSL
FT                   KHIGLDPLVHDVRFVEDNWESPTLGAWGLGWEIWLNGMEVSQFTYFQQVGGIECYPVTG
FT                   EITYGLERLAMYQQGVDSVYDLVWADGPFGKVTYGDVFHQNEVEQSTYNFEHANVDKLF
FT                   ELFDFYESEAARLIELELPLPGYEMVLKASHTFNLLDARRAISVTARQQYILRVRTLAR
FT                   SVAQAYLQARARLGFPMAPPDLRDEVLAKLEAAQ"
FT   gene            207778..209832
FT                   /gene="glyS"
FT                   /locus_tag="PSPTO_0185"
FT                   /old_locus_tag="PSPTO0185"
FT   CDS_pept        207778..209832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="PSPTO_0185"
FT                   /old_locus_tag="PSPTO0185"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to PFAM protein family HMM PF01966"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53739"
FT                   /db_xref="GOA:Q88B35"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88B35"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53739.1"
FT                   /translation="MSAQDFLVELGTEELPPKTLVSLADAFLAGIEKGLAGAGLTYSAK
FT                   QVYAAPRRLAVLITALATQQPDRSVNLDGPPRQAAFDADGNPTQAALGFAKKCGVDLSE
FT                   IDQSGPKLRYSQTILGKPTTSLLPTIVEDSLNDLPIAKRMRWGARKEEFVRPTQWLVML
FT                   FGDQVVDCTILAQSAGRHSRGHRFHHPEDVRISSPAGYLSDLRAANVLADFNERRQIIS
FT                   KRVEELASQQEGTAIVPPSLLDEVAGLVEWPVPLVCSFEERFLDVPQEALITTMQDNQK
FT                   YFCLLDADGKLLPRFITVANIESKDPAQIIAGNEKVVRPRLTDAEFFFKQDKKQKLETF
FT                   NDRLKNVVFQAQLGSVFDKAERVSKLAAYIAPRIGGDAQRAARAGLLSKCDLSSEMVGE
FT                   FPEMQGIAGYYYAKADGEAEDVALALNEQYMPRGAGAELPTTLTGAAVAIADKLDTLVG
FT                   IFGIGMLPTGSKDPYALRRAALGILRILIEKKLDLNLVETVKFAVTQFGAKVKPAGLAE
FT                   QVLEFIFDRLRARYEDEGVEVAVYLSVRALQPASALDFDQRVQAVQAFRKLPQAAALAA
FT                   VNKRVSNLLSKAEGSIAQTVEPKYFDNANEFSLYSAIQQADHAVQPMAAERQYSESLAR
FT                   LAMLREPVDAFFEAVMVNAEDANVRANRYALLARLRGLFLGVADISLLG"
FT   gene            209846..210397
FT                   /locus_tag="PSPTO_0186"
FT                   /old_locus_tag="PSPTO0186"
FT   CDS_pept        209846..210397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0186"
FT                   /old_locus_tag="PSPTO0186"
FT                   /product="histidinol-phosphate phosphatase family protein"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:11120073; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53740"
FT                   /db_xref="GOA:Q88B34"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B34"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53740.1"
FT                   /translation="MKLLILDRDGVINHDSDAYIKSVEEWIPIPGSVEAIAALSKAGWT
FT                   VAIATNQSGIARGYYDLAILDAMHARLRTLVAEQGGEVGLIVYCPHGPDDGCDCRKPRP
FT                   GMLQAIARHYSADLKGLWFVGDSKGDLQAALAVDSQPVLVLTGKGRKTMNGEVPTGTLI
FT                   FDDLAAVAAELIHTSASLNN"
FT   gene            210455..211225
FT                   /locus_tag="PSPTO_0187"
FT                   /old_locus_tag="PSPTO0187"
FT   CDS_pept        210455..211225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0187"
FT                   /old_locus_tag="PSPTO0187"
FT                   /product="hdtS protein"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to TIGR protein family HMM TIGR00530"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53741"
FT                   /db_xref="GOA:Q88B33"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B33"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53741.1"
FT                   /translation="MSIMQAIRTFIFYLLLGTSSLLWCTLSFFIAPFLPFKARYRFINV
FT                   YWCRCALWLTRVFLNIKVEVSGADNVPKTPCVIISNHQSTWETFFLSAYFEPLSQVLKR
FT                   ELLYVPFFGWAMAMLRPIAIDRDNPKAALREIAKKGDELLKDGVWVLIFPEGTRVPYGQ
FT                   VGKFSRGGTALAVNADLPVLPIAHNAGKYWPRDGWGKKPGTIQVVIGEPMYAEGTGPRA
FT                   IAALNERVQTWNEDTQRALGSPVAPATSTEKVPA"
FT   gene            complement(211395..212333)
FT                   /locus_tag="PSPTO_0188"
FT                   /old_locus_tag="PSPTO0188"
FT                   /note="This region contains an authentic point mutation,
FT                   causing a premature stop, and is not the result of a
FT                   sequencing artifact; transcriptional regulator, authentic
FT                   point mutation; similar to SP:Q47129, GB:U00018, and
FT                   PID:467066; identified by sequence similarity; putative"
FT   gene            212468..213511
FT                   /locus_tag="PSPTO_0189"
FT                   /old_locus_tag="PSPTO0189"
FT   CDS_pept        212468..213511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0189"
FT                   /old_locus_tag="PSPTO0189"
FT                   /product="nitrilase, putative"
FT                   /note="similar to GP:15143035, and SP:Q03217; identified by
FT                   sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53742"
FT                   /db_xref="GOA:Q88B32"
FT                   /db_xref="InterPro:IPR000132"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B32"
FT                   /protein_id="AAO53742.1"
FT                   /translation="MATYPPFELMTMKAPLKVACVQAAPMFLNLDATVDKTIALIEQAA
FT                   AAGAGLIAFPETWIPGYPWFLWLDAPAWNMPLVHRYHQQSLVLDSAQARRISDAARQHG
FT                   IYVVLGYSERSKASLYIGQWIIDDQGETVGTRRKLKATHVERTLFGEGDGASLRPFETP
FT                   VGVLGALCCWEHLQPLSKYAMYAQNEQIHVAAWPSFSLYQNATRALGPEVNTAASRVYA
FT                   AEGQCFVIAPCAVVSPEMIEMLCDSDAKHSLLQAGGGHARIFGPDGSDLATPLGEHEEG
FT                   LLYATLDPAALIFAKVAADPAGHYSRPDVTRLMFNPNPNPCVVELPGLPIGSNAGEPIQ
FT                   PVIAMEV"
FT   gene            213513..214433
FT                   /locus_tag="PSPTO_0190"
FT                   /old_locus_tag="PSPTO0190"
FT                   /note="This region contains a match to at least one other
FT                   gene that is not full length,and is not the result of a
FT                   sequencing artifact; phenylacetaldoxime dehydratase,
FT                   truncation; similar to GP:6855269; identified by sequence
FT                   similarity; putative"
FT   gene            214448..214963
FT                   /locus_tag="PSPTO_0191"
FT                   /old_locus_tag="PSPTO0191"
FT                   /note="This region contains a match to at least one other
FT                   gene that is not full length,and is not the result of a
FT                   sequencing artifact; There appears to be a deletion which
FT                   extends upstream into the C-terminus of the neighboring
FT                   ORF.; conserved hypothetical protein, truncation; similar
FT                   to GP:6690107, and GP:6014667; identified by sequence
FT                   similarity; putative"
FT   gene            215807..217363
FT                   /locus_tag="PSPTO_0192"
FT                   /old_locus_tag="PSPTO0192"
FT   CDS_pept        215807..217363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0192"
FT                   /old_locus_tag="PSPTO0192"
FT                   /product="recombinase, putative"
FT                   /note="identified by match to PFAM protein family HMM
FT                   PF00239"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53743"
FT                   /db_xref="GOA:Q877P4"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:Q877P4"
FT                   /protein_id="AAO53743.1"
FT                   /translation="MRKRLEDYSDGLIAAAEYVRMSTDHQRYSTENQSAAIHAYALSHG
FT                   MDIVKTYRDEGKSGLDIGGRDALRRLLDDVQAGNVQFQIILVYDVSRWGRFQNTDESAH
FT                   YEYLCTSSGIQVVYCAEPFENDGSPLATIYKGIKRSMAGEYSRELSQKVFAGQCRLVEK
FT                   GFHQGGPAGYGLRRALIDEKNEFKAELSRGQQKSIQTDRVILIPGPEAEIEIVQHIYHR
FT                   FIHNGMNEREIANALNADGVLTDFDRPWSRSSVHEVLTNEKYIGNNVYNKTSSKLRKRS
FT                   SRNPPDKWIRCDGAFQGIVSLEVFTCAREIILQRSHRLDDTQMLELLRALLQQAGSLSG
FT                   MLIDEQDNMPSSTVYISRFGGLLRAYTLIGYAPDRDYRYMDINRSLRQLHPQVFEDVIK
FT                   HLENAGASVEISAQNDVLTVNGEWTASVVIARCHSTPAGTLRWKLRFDISLAPDITIAV
FT                   RMERANLQVRDYYLVPLIDMGAWPQKMAEENSPLIDSYCFQTLDVLDGLAARCSLKEAC
FT                   Q"
FT   gene            complement(217450..218259)
FT                   /locus_tag="PSPTO_0193"
FT                   /old_locus_tag="PSPTO0193"
FT   CDS_pept        complement(217450..218259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0193"
FT                   /old_locus_tag="PSPTO0193"
FT                   /product="ISPsy4, transposition helper protein"
FT                   /note="The annotation of this multicopy IS21 family element
FT                   is based in part on an HMM match, the ISFinder database,
FT                   and on positional information.; similar to GP:6009454, and
FT                   GP:17865161; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53744"
FT                   /db_xref="GOA:Q877S2"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q877S2"
FT                   /protein_id="AAO53744.1"
FT                   /translation="MNLQHARLTELCKGLKLERVGVDWPHLAQQAASGEDSFADFLEKL
FT                   LAAETDARSERSRQALLKTAALPAVKTLEQYDFAFATGVPRAQLQELAALSFVGRAENI
FT                   VFLGPSGVGKSHLAIALAYRAVMAGIKTRFVTAADLMLQLTAAHRQERLKEYFSRVVMA
FT                   PGLLVIDEIGYLPFGRDEANLFFNVVAKRYEQGSLILTSNLPFTQWAGTFADDQTLTAA
FT                   MLDRLLHHAHIVQMTGESYRLKDKRKAGTKSSRAEPARKYEPEGGQN"
FT   gene            complement(218256..219278)
FT                   /locus_tag="PSPTO_0194"
FT                   /old_locus_tag="PSPTO0194"
FT   CDS_pept        complement(218256..219278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0194"
FT                   /old_locus_tag="PSPTO0194"
FT                   /product="ISPsy4, transposase"
FT                   /note="The annotation of this multicopy IS21 family element
FT                   is based in part on an HMM match, the ISFinder database,
FT                   and on positional information.; similar to GP:17865160;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53745"
FT                   /db_xref="GOA:Q877U4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q877U4"
FT                   /protein_id="AAO53745.1"
FT                   /translation="MLTQEQSVEIKVLARQGHGIKFIARELGISRNTVRKYLRKARSLP
FT                   SDKVRPARPCKIDPFKDYLHERIEAARPHWIPATVLLREITALGYSGGVSRLKAYIRPF
FT                   KRKAEEPVVRFETLPGKQIQVDFTTIRRGRQPLKAFVATLGFSRASFVRFSEREDSEAW
FT                   LTGLREAFAYFGGVPEQALFDNAGTIITERDAFGEGQHRWHPRLAALADEFGFIPKVCR
FT                   PYRAQTKGKVERFNGYLKGSFITPLAATLKSAGLTLDVVTANAHIGQWLDEVAHQRIHG
FT                   TTGVQPAVRLAQEQQVLLPLPTQSLRPQPAQGLRLGRVLPYESLQHPLSVYEQLLEVRA
FT                   "
FT   gene            complement(219554..221107)
FT                   /locus_tag="PSPTO_0196"
FT                   /old_locus_tag="PSPTO0196"
FT   CDS_pept        complement(219554..221107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0196"
FT                   /old_locus_tag="PSPTO0196"
FT                   /product="ISPsy5, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53746"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:Q877T3"
FT                   /protein_id="AAO53746.1"
FT                   /translation="MRPLPDNLPDDPVLLKQMLLESYEARSREQEVKDAYATHIVDLKE
FT                   QIKLLRDRIFGRKSEQTVEPNTPQLALFNEPESEPMLPVGDADEEVVAPAPRRGKRKPL
FT                   SADLPRIEVIHELPEHELTCACGCRKHVVSEETSEQLDIVPMQIRVIKHIRKVYGCRGC
FT                   ESAPVTAGKPAQLIEKSMASPSVLAMLLTTKYVDGLPLHRFETVLSRHGIEIPRQTLAR
FT                   WIIQCGEHLQPLLNLMRDRLLESPVIHCDETRVQVLKEPDRDPTSQSWMWVQASGPPDH
FT                   KVVLFDYTSSRAQDVPLRLLESYRGYVMTDDYAGYNALALQPGVERLACMAHARRKFVE
FT                   AQKVQPKGKTGRADIALTMINKLYGIERELKDGSDEQRFTGRQEKSLPILAQLKSWLDK
FT                   TQSHVTPQSVLGKAVGYLANNWSRLKRYVEAGFLPIDNNPAERAIKPFVIGRKAWLFSD
FT                   TPKGATASAQIYSLVETAKVNGQEPYTWLRHVLERLPLAQSVADYEALLPWNCSPEMPR
FT                   "
FT   gene            complement(221125..221484)
FT                   /locus_tag="PSPTO_0197"
FT                   /old_locus_tag="PSPTO0197"
FT   CDS_pept        complement(221125..221484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0197"
FT                   /old_locus_tag="PSPTO0197"
FT                   /product="ISPsy5, Orf1"
FT                   /note="The gene assignment is based on its position in a
FT                   multicopy insertion sequence, directly adjacent to an ORF
FT                   matching an HMM for the IS66 family.; similar to
FT                   GP:8037784; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53747"
FT                   /db_xref="GOA:Q877K1"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:Q877K1"
FT                   /protein_id="AAO53747.1"
FT                   /translation="MMRPDAKVEKVYLYPKPVDFRKSIDGLAALVELDIKVAVFDPVLF
FT                   VFLNKSRNRVKILYWERNGFCLWLKRLESERFKISPDDVDEAIVLTVQELNWLLDGFDL
FT                   WRNRPHKILTPRFVA"
FT   gene            complement(222528..223745)
FT                   /locus_tag="PSPTO_0200"
FT                   /old_locus_tag="PSPTO0200"
FT   CDS_pept        complement(222528..223745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0200"
FT                   /old_locus_tag="PSPTO0200"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:11071202; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53748"
FT                   /db_xref="GOA:Q88B31"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR040570"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B31"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53748.1"
FT                   /translation="MNIIALEALTFGLGRLAEASKKYGCSLTLLTRDKTVYSYELSSLD
FT                   ERLVKVVEIDTFDNNRVVQLIRGEGDAVALLSSTDTWSLHCLDVSGILNLHAQNPDAIR
FT                   IARDKFQLRNRLFEAGLSSVRSILADPKNFDKNSLAENFSFPCIIKDSAGTGSQNVWVA
FT                   YSEEELLKTLVKADQETIRGKIVIEPFFSGTLYSLETISWKGETRVIALTSRVLSQEPY
FT                   FREEAFSSPVTISDSVNEALDAWIKRILHCIGYDNGFAHTEFMITSNGFEVIEINPRLG
FT                   GVQIGEALCQSFSINIYEAWIEMALNRRPNLLDAPLESNKGIGQLIVYATEAGEFSHIE
FT                   GVERLNAHPGRPKFYPTAYCGKKINTIDDQRASIGILLAEGETSEIALLNAFAARNKIR
FT                   VIMKKN"
FT   gene            complement(224484..225383)
FT                   /locus_tag="PSPTO_0201"
FT                   /old_locus_tag="PSPTO0201"
FT   CDS_pept        complement(224484..225383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0201"
FT                   /old_locus_tag="PSPTO0201"
FT                   /product="conserved domain protein"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to PFAM protein family HMM PF02750"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53749"
FT                   /db_xref="GOA:Q88B30"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B30"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53749.1"
FT                   /translation="MKTVLFLSDYEDEIEYDAVFEILSKWGIKGITAKPCEICIENGVH
FT                   GSSFVFRDSPLKPDLVVGYAYEEDLIPAMKLMKLWKMMGVTILNDAETLFCGQNKDLSS
FT                   AMLNSSPDVRHLPYYKFLEAPSAEALSCVGFPLVAKPVNGACGRGLFKIDSYDDFIIWF
FT                   REQAANIKDYYIQPYIQKKNNEDFRVVVVNHVAVYAYSRRGANGSWITNLMKDGTGKTF
FT                   AINALPQELVSMAEKSSVAAKSLFCGVDIAMDTSNVPFIIEINTCPAIKISRYISGADT
FT                   LVEHAYAEFIRQVLDHDI"
FT   gene            complement(225386..226549)
FT                   /locus_tag="PSPTO_0202"
FT                   /old_locus_tag="PSPTO0202"
FT   CDS_pept        complement(225386..226549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0202"
FT                   /old_locus_tag="PSPTO0202"
FT                   /product="membrane protein, putative"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to TIGR protein family HMM TIGR00792"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53750"
FT                   /db_xref="GOA:Q88B29"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B29"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53750.1"
FT                   /translation="MKNYIVFSTSFILSFVNFMIFYSYPFKLEEMGVENGIAGLVVGGA
FT                   TVLTLIMRLVSGVVADRIKTRWAMFITTILYCSSLLLINLNWVPSVILGRLAQGALLGV
FT                   LSTLLMYYSIAFSDNAAEKSKNVSMITFFNVLPTCLAPFIALKITQTWGGGSVALAALM
FT                   LFLICLFLTFVLDARQTYSGIPDKTSSSTKGVLQIVTDSNVRTALIILGLVYIISGTTV
FT                   TFLPFFLTKKGMSDPSWYFLVFTVSMMLPRLFLNKKLPKDSRFPTRILAACVVSAICGT
FT                   LSNYFMVGSGFVYIGAICCGAALGLIYPAVMSYVVCNIDQALVGTSSSVVAASADIGVI
FT                   FSNIGLGVVVVKFGGDAAMLIPIITSCVALAFIFSKAWTRNFIQGEI"
FT   regulatory      complement(225876..225903)
FT                   /locus_tag="PSPTO_0202"
FT                   /old_locus_tag="PSPTO0202"
FT                   /bound_moiety="PvdS"
FT                   /note="PMID18363796"
FT                   /inference="nucleotide motif:PvdS_box_model_C_DC3000.hmm"
FT                   /regulatory_class="promoter"
FT   gene            complement(226554..227672)
FT                   /locus_tag="PSPTO_0203"
FT                   /old_locus_tag="PSPTO0203"
FT   CDS_pept        complement(226554..227672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0203"
FT                   /old_locus_tag="PSPTO0203"
FT                   /product="cysteine synthase"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:12082815, and SP:P37887; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53751"
FT                   /db_xref="GOA:Q88B28"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B28"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53751.1"
FT                   /translation="MSFAKKNVIDGISKTPLIDLARINKEISTNVIVKLEKYNPGGSIK
FT                   DRAAAYIIREAEKKGQLKPGGTIIESSSGNFAISLAMIGAVSGYKVIALVDPKATETNK
FT                   ALMKAYGAEVITVTEKDDTGSYHKTRIKLANDLAKKIPGSYRPDQCFNVLSSLAHYNST
FT                   AKEIHEQTSGNIAGVVCAVSTGGQIGGVSEYFKDHLPDVKVTCVDAYGSAVFGGPSHAY
FT                   KIPGVGLGWTPRNINDTTKIDYFYRAKDESAYIAARLLCRHEGILVGVSSGAVLLAALN
FT                   LSLHLGNQKPIVAILGDSGERYLDTLYNDDWLNEHGVDTGLELNKLQLLIDNMATPIES
FT                   PHIKSNYRDDLIGILEVPETTITHFNMLEGRN"
FT   gene            complement(231080..232075)
FT                   /locus_tag="PSPTO_0205"
FT                   /old_locus_tag="PSPTO0205"
FT   CDS_pept        complement(231080..232075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0205"
FT                   /old_locus_tag="PSPTO0205"
FT                   /product="protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53752"
FT                   /db_xref="GOA:Q88B27"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B27"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53752.1"
FT                   /translation="MNALMAAICITWSGFSFLFYRGLYHRRVRHAAYAEFARATFTAVQ
FT                   AHFPELKSKSSSLVIDKGFGVKNDEAWQEALHTFISHRVVPELSPRIRESLKASPSANK
FT                   DFSTLTVNLVLTLVEYQSMPETYNLTEAIALIEEPEDPFAFLSGTPKFKPQKEVLTRLA
FT                   VVVLAVGIIGETSPSNAAGGEAFSPLSACSALADIDGFQPNKSGYIELYDGIFSCATPY
FT                   KELGNQALPNNIALYGRGNASEVTRVKLMLNVNVSSRGAQDAMLLASLCTQMITNVTGN
FT                   PASGFEHKIAQGKPFKQSFHGYSVYLDRTLWGTGKGYELNCGIATLNNKE"
FT   gene            complement(232469..232945)
FT                   /locus_tag="PSPTO_0206"
FT                   /old_locus_tag="PSPTO0206"
FT   CDS_pept        complement(232469..232945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0206"
FT                   /old_locus_tag="PSPTO0206"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53753"
FT                   /db_xref="GOA:Q88B26"
FT                   /db_xref="InterPro:IPR011979"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B26"
FT                   /protein_id="AAO53753.1"
FT                   /translation="MMVSATTRNVEPAAPARRPTEYLLRTDAGQLSQVMVYKLTVKGFE
FT                   LKDVQDMLSISDLYSTNKIMSRIVGKSVRTIQRQGSSKQPAHLNSQQSAVAFQYAKVLE
FT                   HATHVFGNQKLAEEWLGRPCKYLDGDVPLDVIDNPIGFQTVEDYLERIEYGVYQ"
FT   gene            complement(233124..233427)
FT                   /locus_tag="PSPTO_0207"
FT                   /old_locus_tag="PSPTO0207"
FT                   /note="This region contains an authentic frame shift and is
FT                   not the result of a sequencing artifact; conserved domain
FT                   protein, authentic frameshift; similar to GP:15155846;
FT                   identified by sequence similarity; putative"
FT   gene            complement(233476..234099)
FT                   /locus_tag="PSPTO_0208"
FT                   /old_locus_tag="PSPTO0208"
FT   CDS_pept        complement(233476..234099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0208"
FT                   /old_locus_tag="PSPTO0208"
FT                   /product="protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53754"
FT                   /db_xref="GOA:Q88B25"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B25"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53754.1"
FT                   /translation="MTHNPSISRWLVAGTLSLLIGTSAFADSTTLRSGKYEQLMLAVTP
FT                   DHQVEGYYEEERGEDPPFRCAFYLKGTIEAGKDVAVASWSDGAYPGTLKPSADGVTLTI
FT                   KEGQNNSGCLNVLMPEIATGLDLTRTASKQWISLVKVNADKAWLQKTANAKATRGPYIV
FT                   KGDVVGVLAFKDGAAQVEFINADNRSFTGWISQDQYARLTAPRQ"
FT   gene            complement(234287..235525)
FT                   /gene="lsyA-1"
FT                   /locus_tag="PSPTO_0209"
FT                   /old_locus_tag="PSPTO0209"
FT   CDS_pept        complement(234287..235525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lsyA-1"
FT                   /locus_tag="PSPTO_0209"
FT                   /old_locus_tag="PSPTO0209"
FT                   /product="diaminopimelate decarboxylase"
FT                   /note="similar to SP:P00861; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53755"
FT                   /db_xref="GOA:Q88B24"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B24"
FT                   /protein_id="AAO53755.1"
FT                   /translation="MKTLADSQLSRLADQYGTPLWVYDGQLIKKRVQQLAAFDTVRFAQ
FT                   KACSNLHILRLLRDAGAAVDAVSLGELERALHAGFSAQTTQGAAGVVFTADVFDRATLQ
FT                   RVVEAQVEVNVGSIDMLHQLGALSPGHRVWLRINPGFGHGHSRKTNTGGENSKHGIWHT
FT                   HLQDALTLVHYYRLHLVGLHMHIGSGVDYQHLQQVCSTMAELVVEMDHDIEAISAGGGL
FT                   SVPYRAGELPINTSHYFAQWDHARKRIEAHLGHPIRLEIEPGRFLVAQAGVLVSEVRAT
FT                   KHMGGKHFTLVDAGFNDLMRPSLYGSYHEMSLITSRDEPLPMQETVVAGPLCESGDVFT
FT                   QAEGGIVESRLLPVAQVGDYLVFHDAGAYGASMSSNYNSRTHAAEVLVDDGQERLIRRR
FT                   QPLDDLLRLEEDC"
FT   gene            complement(235527..236402)
FT                   /locus_tag="PSPTO_0210"
FT                   /old_locus_tag="PSPTO0210"
FT   CDS_pept        complement(235527..236402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0210"
FT                   /old_locus_tag="PSPTO0210"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to TIGR protein family HMM
FT                   TIGR00950"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53756"
FT                   /db_xref="GOA:Q88B23"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B23"
FT                   /protein_id="AAO53756.1"
FT                   /translation="MIPYLYVLAAAFLWGTSFVAGKIAFGVADAPLIVLARFAMAGLFW
FT                   LPVFCRSVRSVPSSRWGALLLLSFLMIPATFLLQFMGLQYTSATSATLMIGFEPLMVML
FT                   VGWLIWREQMTALHLLLGTVALAGVLLVMGWPSGANFLGCLLVLLSTVVVAIWVRWSKI
FT                   WMQSLSVNAFTALTTVLGTIMLIPFALFLTNDWQVNLSTQGASALLYLGVGCSLGAGWL
FT                   WNMGMRSIPANAGGMFLALEPIFGVIFAVALLYEPLGATTLAGIGLVVIPVLVISVLPV
FT                   LQARRLPEAC"
FT   gene            complement(236402..237685)
FT                   /gene="iucD"
FT                   /locus_tag="PSPTO_0211"
FT                   /old_locus_tag="PSPTO0211"
FT   CDS_pept        complement(236402..237685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iucD"
FT                   /locus_tag="PSPTO_0211"
FT                   /old_locus_tag="PSPTO0211"
FT                   /product="L-lysine 6-monooxygenase"
FT                   /note="similar to SP:P11295; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53757"
FT                   /db_xref="GOA:Q88B22"
FT                   /db_xref="InterPro:IPR025700"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B22"
FT                   /protein_id="AAO53757.1"
FT                   /translation="MDAQIFDAVGVGAGPFNLSVAALLHPLKDVRHLFLEKQSQFCWHA
FT                   GMLLDNTTVQNSFLKDLVSFADPTSAFSFLAFLHQHKRLYQYVNAGFQRTTRREFNQYL
FT                   QWAARSLPAVQWGQEVRTVKPHACGFEVFTDTGAYIARNLIVGTGPRPSVPVMAMPLLG
FT                   EQVFHSSDYLFKRQALAGRRVAVIGGGQSGAEIVLDLLGQSVPPSEIVWVSSRTHLAPL
FT                   DESHFANELYTPAYVEYFWGLERSKKHQLLAQHTLTSDGISPETLEALYQRLYHLRFVE
FT                   DGAPCRLMHSRRVEDIRPTADGYLLDIRELDTGGTDVINAERIVLATGYKQDAIPAVLE
FT                   NLLDDIEFAHDEPVVRLDFSLGYRGPGKIFLLNAARHSHGVSEPNLSLNSWRAATIINA
FT                   IVGHEHYPSPHAQSMLELGHFPHRVGVA"
FT   gene            237840..238775
FT                   /gene="lysR"
FT                   /locus_tag="PSPTO_0212"
FT                   /old_locus_tag="PSPTO0212"
FT   CDS_pept        237840..238775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysR"
FT                   /locus_tag="PSPTO_0212"
FT                   /old_locus_tag="PSPTO0212"
FT                   /product="transcriptional activator LysR"
FT                   /note="similar to SP:P03030; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53758"
FT                   /db_xref="GOA:Q88B21"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B21"
FT                   /protein_id="AAO53758.1"
FT                   /translation="MSVTLRHIEVFRAVMTSGSVTEAANMLNTSQPTVSRELARFELLT
FT                   QLTLFDRVRGRLRPTAQALSLFEEVQRAYFGLGRILSTAASLREFEHGQLSIACLPVFS
FT                   QSLLPKACQRFFAQFPKASMSITPQESPLLEEWLSAQRYDLGLTEVASAPPGTELVPLM
FT                   VVDEVCVLPVGHPLLAKQVLAPEDFASKPFISLSSLDSYRQQIDEIFRLAQVERQMVLD
FT                   THSAASVCAMVRERIGLAIVNPLTALDFVGQGLEIRPFTASIPFTVSLVKPLHRPASRL
FT                   VGLFEEALREQASIVEARLAAINVPIAAGP"
FT   gene            239026..239304
FT                   /locus_tag="PSPTO_0213"
FT                   /old_locus_tag="PSPTO0213"
FT   CDS_pept        239026..239304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0213"
FT                   /old_locus_tag="PSPTO0213"
FT                   /product="proteic killer protein, putative"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:21203107; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53759"
FT                   /db_xref="InterPro:IPR007711"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B20"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53759.1"
FT                   /translation="MIVSFKCVHTRYLFLQGKTRLWPSIKSVAERKLAMLDAATSILDL
FT                   RSPPGNRLEALDGSRSGQYSVRINAPFRICFVWSINGPEDVEIVDYH"
FT   gene            239314..239619
FT                   /locus_tag="PSPTO_0214"
FT                   /old_locus_tag="PSPTO0214"
FT   CDS_pept        239314..239619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0214"
FT                   /old_locus_tag="PSPTO0214"
FT                   /product="virulence-associated protein, putative"
FT                   /note="similar to SP:Q46560, GB:D31762, and PID:498150;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53760"
FT                   /db_xref="GOA:Q88B19"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B19"
FT                   /protein_id="AAO53760.1"
FT                   /translation="MNKNGMRPVHPGEVLKEEYLEPMGLTAAALARALKVSTPTVNDIV
FT                   LQRRGVSADVALRLAVCLETSPEFWLNLQLAYDLRKAETEKGAQIREQVKCLAHCA"
FT   gene            complement(239653..239934)
FT                   /locus_tag="PSPTO_0215"
FT                   /old_locus_tag="PSPTO0215"
FT   CDS_pept        complement(239653..239934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0215"
FT                   /old_locus_tag="PSPTO0215"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53761"
FT                   /db_xref="GOA:Q88B18"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B18"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53761.1"
FT                   /translation="MLAPKAFLDALSGHASRLFNGETPVPRSEFETQFKALLQSGFSKL
FT                   DLVSREEFDSQMAVLARTRARLEALEAKMAELEGKVGGAEKAGSEKAE"
FT   gene            240015..240155
FT                   /locus_tag="PSPTO_0216"
FT                   /old_locus_tag="PSPTO0216"
FT   CDS_pept        240015..240155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0216"
FT                   /old_locus_tag="PSPTO0216"
FT                   /product="protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53762"
FT                   /db_xref="GOA:Q88B17"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B17"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53762.1"
FT                   /translation="MARWGGHISTIVVHYPHCNTCLMKRNASKGLYSMNIHEMASFLLS
FT                   G"
FT   gene            240354..240692
FT                   /gene="glnK"
FT                   /locus_tag="PSPTO_0217"
FT                   /old_locus_tag="PSPTO0217"
FT   CDS_pept        240354..240692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnK"
FT                   /locus_tag="PSPTO_0217"
FT                   /old_locus_tag="PSPTO0217"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="similar to GP:2735324; identified by sequence
FT                   similarity; putative; see PMID:20190049 for expression
FT                   data; similar to GP:2735324, identified by sequence
FT                   similarity, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53763"
FT                   /db_xref="GOA:Q88B16"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B16"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53763.1"
FT                   /translation="MKLVTAIIKPFKLDDVRESLSEIGVQGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKVKIDVAIDDKDLDRVIEAITKAANTGKIGDGKIFVVNLEQAIRIRT
FT                   GETDTDAI"
FT   gene            240728..242065
FT                   /gene="amt-1"
FT                   /locus_tag="PSPTO_0218"
FT                   /old_locus_tag="PSPTO0218"
FT   CDS_pept        240728..242065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amt-1"
FT                   /locus_tag="PSPTO_0218"
FT                   /old_locus_tag="PSPTO0218"
FT                   /product="ammonium transporter"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P37905; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53764"
FT                   /db_xref="GOA:Q88B15"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B15"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53764.1"
FT                   /translation="MTLRQFAGLGALLSLAIPGLALAADPVAEPVLNSGDTAWMLTATA
FT                   LVLFMTIPGLALFYGGMVRSKNILSVMMQCFAITGLISILWVVYGYSIAFDTTGMEAGV
FT                   VNFNSFFGGMGKAFLAGITPASLTGPAALFPEAVFVTFQMTFAIITPALIVGAFAERMK
FT                   FSAMLIFMGIWFTLVYAPIAHMVWGGVGGLMWDWGVLDFAGGTVVHINAGVAGLVACLV
FT                   LGKRKGFPTTPMAPHNLGYTLIGAAMLWVGWFGFNAGSAAAANGTAGMAMLVTQIATAA
FT                   AALGWMFAEWLTHGKPSALGIASGVVAGLVAITPAAGTVGPMGALIIGLAAGVICFFCA
FT                   TSLKRKLGYDDSLDAFGVHGIGGIVGAILTGVFAAPALGGFGTVTDIGAQVWIQFKGVA
FT                   FTVVYTAIVTFIILKVLDAVMGLRVTDEEESVGLDLAQHNERGYNL"
FT   gene            242307..242732
FT                   /locus_tag="PSPTO_0219"
FT                   /old_locus_tag="PSPTO0219"
FT   CDS_pept        242307..242732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0219"
FT                   /old_locus_tag="PSPTO0219"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to TIGR protein family HMM TIGR00149"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53765"
FT                   /db_xref="GOA:Q88B14"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B14"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53765.1"
FT                   /translation="MWHQSRIALRARSRGFHLVTDEIVAGLPQLRDCRVGLLHVWLQHT
FT                   SASLTVNENADPAVRRDFERFFNRLVPQGVDGYEHDDEGPDDLPAHFKASLLGCQLFLP
FT                   VTAGRLALGTWQGIYLGEHRDAGGSRNVLATLQGEYA"
FT   gene            242831..243160
FT                   /locus_tag="PSPTO_0220"
FT                   /old_locus_tag="PSPTO0220"
FT   CDS_pept        242831..243160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0220"
FT                   /old_locus_tag="PSPTO0220"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53766"
FT                   /db_xref="GOA:Q88B13"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B13"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53766.1"
FT                   /translation="MSDDDTNDDLVDDLEGEEDGEELAAASPEDDSAEPDDSDVPAAPA
FT                   KGKAKAAVSVDELPSVEAKNKERDALARAMEEFLARGGKVQEVEANVVADPPKKPDNKY
FT                   GSRPI"
FT   gene            complement(243235..243927)
FT                   /locus_tag="PSPTO_0221"
FT                   /old_locus_tag="PSPTO0221"
FT   CDS_pept        complement(243235..243927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0221"
FT                   /old_locus_tag="PSPTO0221"
FT                   /product="HAD-superfamily hydrolase"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to TIGR protein family HMM TIGR01691"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53767"
FT                   /db_xref="GOA:Q88B12"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="PDB:3VAY"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B12"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53767.1"
FT                   /translation="MIKLVTFDLDDTLWDTAPAIVGAEAALRDWLAEQAPKLGPVPVEH
FT                   LWEIRSRLLDEDPSFKHRISALRRRVLFHALEDAGYDSDEAQQLADESFEVFLHGRHQV
FT                   QIFPEVQPTLEILAKTFTLGVITNGNADVRRLGLADYFAFALCAEDLGIGKPDPAPFLE
FT                   ALRRAKVDASAAVHVGDHPSDDIAGAQQAGMRAIWYNPQGKAWDADRLPDAEIHNLSQL
FT                   PEVLARWA"
FT   gene            complement(243920..244819)
FT                   /gene="xerC"
FT                   /locus_tag="PSPTO_0222"
FT                   /old_locus_tag="PSPTO0222"
FT   CDS_pept        complement(243920..244819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerC"
FT                   /locus_tag="PSPTO_0222"
FT                   /old_locus_tag="PSPTO0222"
FT                   /product="integrase/recombinase XerC"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P22885; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53768"
FT                   /db_xref="GOA:Q88B11"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88B11"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53768.1"
FT                   /translation="MEQHLDAYCMHLRSERQVSPHTLEAYRRDLSKVLAYCQKARLSSW
FT                   NDLDIQHLRSFTARQHQQGQSSRSLARMLSAVRGFYKYLNREGLCQHDPANGLSPPKGE
FT                   RRLPKTLDTDRTAQLLDGGVEDDFLAHRDQAIMELLYSSGLRLSELTGLNLDQLDLRDG
FT                   LVQVLGKGSKTRVLPVGSKARQALETWLPLRALTNPQDDAVFVSQQGKRLGPRAVQLRI
FT                   KTAGERELGQNLHPHMLRHSFASHLLESSQDLRAVQELLGHADIKTTQIYTHLDFQHLA
FT                   TVYDSAHPRAKRKGAADD"
FT   gene            complement(244822..245556)
FT                   /locus_tag="PSPTO_0223"
FT                   /old_locus_tag="PSPTO0223"
FT   CDS_pept        complement(244822..245556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0223"
FT                   /old_locus_tag="PSPTO0223"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:1929096, GB:X65867, GB:S60710, SP:P30566, PID:28904, and
FT                   PID:28905; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53769"
FT                   /db_xref="GOA:Q88B10"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B10"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53769.1"
FT                   /translation="MTDQPPASTGTPSESPVDSAAPDLEAEAVIAFLLEHPQFFAEHDE
FT                   LLVSMRIPHQRGDTVSLVERQLNLLRERNIEMRHRLSQLMDVARDNDRLFEKTRRLNLA
FT                   LMDATSLDELVIAVEDSLRQDFQVPFVSLILFSDSPMPVGRWVSSAEAQKAIGGLIGEK
FT                   IICGALREHELAFLFGAEQGKEVGSTAIASLNHLGLHGVLAIGSRDPQHYKSSVGTLFL
FT                   SYIADVLSRLLPRFAHSLRSVR"
FT   gene            complement(245570..246400)
FT                   /gene="dapF"
FT                   /locus_tag="PSPTO_0224"
FT                   /old_locus_tag="PSPTO0224"
FT   CDS_pept        complement(245570..246400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="PSPTO_0224"
FT                   /old_locus_tag="PSPTO0224"
FT                   /product="diaminopimelate epimerase"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to PFAM protein family HMM PF04303"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53770"
FT                   /db_xref="GOA:Q88B09"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88B09"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53770.1"
FT                   /translation="MLLRFTKMHGLGNDFMVLDLVSQHAHILPKHAKQWGDRHTGIGFD
FT                   QLLLVEAPNNPDVDFRYRIFNSDGSEVEQCGNGARCFARFVLDKRLTAKKQIRVETKGG
FT                   IIELEIRSDGQISVDMGPPRLVPEEIPFQAAEQAKSYSLDVDGQTVELAAVSMGNPHAV
FT                   LRVDDINNAPVHTLGPKIEHHPRFPARVNVGFLHVVDRQRAQLRVWERGAGETQACGTG
FT                   ACAAAVAAISQGWMDSPLLIDLPGGRLSIEWAGPGHPVMMTGPATRVYEGQVRL"
FT   gene            complement(246405..247652)
FT                   /gene="lsyA-2"
FT                   /locus_tag="PSPTO_0225"
FT                   /old_locus_tag="PSPTO0225"
FT   CDS_pept        complement(246405..247652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lsyA-2"
FT                   /locus_tag="PSPTO_0225"
FT                   /old_locus_tag="PSPTO0225"
FT                   /product="diaminopimelate decarboxylase"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to PFAM protein family HMM PF02784"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53771"
FT                   /db_xref="GOA:Q88B08"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B08"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53771.1"
FT                   /translation="MDAFNYRDGELFAEGVALSAIAERFGTPTYVYSRAHIEAQYRAFA
FT                   DALSGMPHMVCFAVKANSNLGVLNVLARLGAGFDIVSRGELERVLAAGGKAERIVFSGV
FT                   GKTREDMRRALEVGVHCFNVESTDELERLQEVAAELNVRAPISLRVNPDVDAGTHPYIS
FT                   TGLKENKFGIAIAAAEDVYIRASQLPNLEVIGVDCHIGSQLTTLEPFIDALDRLLDLVD
FT                   RLGDCGIHLHHIDLGGGLGVRYRHEEPPLAGDYIKAVRERLAGRDLGLLFEPGRFIVAN
FT                   AGVLLTQVEYLKHTEHKDFAIVDAAMNDLIRPALYQAWMDVTAVRPRDSEPRAYDIVGP
FT                   ICETGDFLAKGRELALAEGDLLAVHSAGAYGFVMSSNYNTRGRAAEVLVDGTQAFEVRR
FT                   RETVAELFAGESLLPE"
FT   gene            complement(247662..247808)
FT                   /gene="lppL"
FT                   /locus_tag="PSPTO_0226"
FT                   /old_locus_tag="PSPTO0226"
FT   CDS_pept        complement(247662..247808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lppL"
FT                   /locus_tag="PSPTO_0226"
FT                   /old_locus_tag="PSPTO0226"
FT                   /product="lipoprotein LppL"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P17323, GB:J03810, SP:P11168, and PID:307125; identified
FT                   by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53772"
FT                   /db_xref="InterPro:IPR017254"
FT                   /db_xref="InterPro:IPR032831"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B07"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53772.1"
FT                   /translation="MKRLISSLAALVAVACLVSACGQKGPLYLPDDSKTPEEQAKSQSH
FT                   KHL"
FT   gene            248015..248347
FT                   /gene="cyaY"
FT                   /locus_tag="PSPTO_0227"
FT                   /old_locus_tag="PSPTO0227"
FT   CDS_pept        248015..248347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyaY"
FT                   /locus_tag="PSPTO_0227"
FT                   /old_locus_tag="PSPTO0227"
FT                   /product="cyaY protein"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:Q9HTS5, and SP:Q9HTS5; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53773"
FT                   /db_xref="GOA:Q88B06"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88B06"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53773.1"
FT                   /translation="MSLTEARFHDLVDATQQNIEDVFDESGLDVDLENSAGVLTVKFEG
FT                   GSQLIFSRQEPLRQLWLAAKSGGFHFDYDEEESRWACDTSDELLSEMLARMTFEQAGAD
FT                   LDFSEI"
FT   gene            248350..248586
FT                   /locus_tag="PSPTO_0228"
FT                   /old_locus_tag="PSPTO0228"
FT   CDS_pept        248350..248586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0228"
FT                   /old_locus_tag="PSPTO0228"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:9949921, and GP:17740341; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53774"
FT                   /db_xref="GOA:Q88B05"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B05"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53774.1"
FT                   /translation="MSQTPARPPKPLFSNVSPAVASPCVSLCRLDEQKVCLGCFRHVED
FT                   IREWRSADDDRRRQIRLNADQRRAAAEVGQAAG"
FT   gene            248724..249131
FT                   /gene="rnk"
FT                   /locus_tag="PSPTO_0229"
FT                   /old_locus_tag="PSPTO0229"
FT   CDS_pept        248724..249131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnk"
FT                   /locus_tag="PSPTO_0229"
FT                   /old_locus_tag="PSPTO0229"
FT                   /product="regulator of nucleoside diphosphate kinase"
FT                   /note="similar to SP:P40679; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53775"
FT                   /db_xref="GOA:Q88B04"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR029462"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B04"
FT                   /protein_id="AAO53775.1"
FT                   /translation="MTTAPSIILTRLDVQRLESFIDSQDENTPGLQALQAELDRAEQVV
FT                   GHDEVPAGVVTMNSRVHCREEVSGKDYHLKLVYPQDAGAEGTVSVLAPMGSALLGLQVG
FT                   QHIDWPAPGGKTLKLTLLAVEYQPEAAGEYE"
FT   gene            complement(249596..252442)
FT                   /gene="cyaA"
FT                   /locus_tag="PSPTO_0230"
FT                   /old_locus_tag="PSPTO0230"
FT   CDS_pept        complement(249596..252442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyaA"
FT                   /locus_tag="PSPTO_0230"
FT                   /old_locus_tag="PSPTO0230"
FT                   /product="adenylate cyclase, class I"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:Q05878, and SP:Q05878; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53776"
FT                   /db_xref="GOA:Q88B03"
FT                   /db_xref="InterPro:IPR000274"
FT                   /db_xref="InterPro:IPR024685"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B03"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53776.1"
FT                   /translation="MTRNPEIRPDLDEGIDRKVLSQLRNRFLSLNDGRYARALEGMSTR
FT                   QQSVLTLLPLFFHVNHPLLPGYVSGSTPAGVSHYEPDTLALAEAQRLTRSFSYKARHGN
FT                   PPQPIHGLFLMGSLGTLAQADQSDMDVWVCHDSELDLEAIAELRKKCQALEAWAATMGA
FT                   EAHFFLIDPQRFKSGERDSQLSSDDCGTTQHYLLLDEFYRTAIWLAGRTPMWWMVPVYE
FT                   EQNYEDYTYTLLSKRFIRASEVLDLGPMSHIPATEFIGAGLWQLFKGIGSPYKSVLKLL
FT                   LIEVYSSEHPRVQCLSLRFKQAVFANQLDLDELDPYVVVYRRIEEHLQARNEPERLELV
FT                   RRSLYLKVNKKLTGSTRQRNIGWQRLLLARLTSEWGWDERQLTLLDSRSQWKVRQVASE
FT                   RRALVNELNYSYRFQTRFARAQSTADTLDARDLTILGRRLYAAYERKAGKVEFINPGIA
FT                   PDLAEDTLTLVHSPDKREPGKHQWALYNGNLGIHEWANFSPIKRSRELLELLAWCHRNN
FT                   VIDTTTRVALHPGTSDLSEFELFNLLGALQQSIELPLPEVSDDELLKPSAPSEILLLIN
FT                   VGVDPLRHHRDLNILMTTERTDSLSYAGVRENLVLTLDQITLNTWNETLVSRYDGPHAL
FT                   LDCMSELLGSLPTSGKQPQIRVRCFCHNRASAIAQRVEELISTAQLLLARQLNHRYLIQ
FT                   VQQQYHVLEIKPGQVGHVVVNSLPGLFKYLGEELPRYSPLHLDPQALDGHDLALILPLG
FT                   QPECIQVFYRINEPDADLYVLDEHNSLWHQRVPYHDEQSLLTPLQRFFHSLVYRRGASL
FT                   PLDDPSEPVSLEALYYQILPSGPGHARRVEHRLAPTATDRSFYDVQAIIEETSPGQLNA
FT                   TLYCDNSEFSELEYGDQLYAAVARQILGKRLEPQRYRCYITDLDLSGLMDGKHGQSILF
FT                   LRHKAELETLLNEAMEQA"
FT   gene            complement(252625..252873)
FT                   /locus_tag="PSPTO_0231"
FT                   /old_locus_tag="PSPTO0231"
FT   CDS_pept        complement(252625..252873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0231"
FT                   /old_locus_tag="PSPTO0231"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53777"
FT                   /db_xref="GOA:Q88B02"
FT                   /db_xref="InterPro:IPR013468"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B02"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53777.1"
FT                   /translation="MSYTPELVAELEILALFNLGNTQEGLKVHHVAAPAAVSAAKRLFE
FT                   KGLTTQVDGGYLTSLGLESAQHAQSLLTILSVSRQAA"
FT   gene            complement(253090..253365)
FT                   /locus_tag="PSPTO_0232"
FT                   /old_locus_tag="PSPTO0232"
FT   CDS_pept        complement(253090..253365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0232"
FT                   /old_locus_tag="PSPTO0232"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53778"
FT                   /db_xref="GOA:Q88B01"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B01"
FT                   /protein_id="AAO53778.1"
FT                   /translation="MTDAIDNDEEEFAASTLIEAIENQIESGNPPAAKAVFNMLTLVNY
FT                   EREDILEMMAHVLAIEIDALLEQDRAFDTQWYEAALRALPELPPEK"
FT   gene            complement(253459..254790)
FT                   /gene="gltP"
FT                   /locus_tag="PSPTO_0233"
FT                   /old_locus_tag="PSPTO0233"
FT   CDS_pept        complement(253459..254790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltP"
FT                   /locus_tag="PSPTO_0233"
FT                   /old_locus_tag="PSPTO0233"
FT                   /product="proton/glutamate symporter"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P21345; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53779"
FT                   /db_xref="GOA:Q88B00"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR034703"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:Q88B00"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53779.1"
FT                   /translation="MKKAKLSLAWQILIGLVLGVAVGALLNHFGDEKAWWISNILQPAG
FT                   DIFIRLIKMIVIPIVVASLIVGIAGMGDAKKLGRIGLKTILYFEVVTTIAILVGLVLAN
FT                   VFHPGTGIDMSTLGTVDISKYQQTTAEVQHDHAFVATILNLIPSNIFAAMTRGEMLPII
FT                   FFSVLFGLGLSSLQAEVREPLVKLFQGVSETMFKVTHMIMNYAPIGVFALIAVTVANFG
FT                   FASLLPLAKLVILVYVAIAFFAFVVLGLIARAFGFSVIKLMRIFKDELILSYSTASSET
FT                   VLPRVIQKMEAYGAPKAICSFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIDLSISAQL
FT                   MLVVTLMVTSKGIAGVPGVSFVVLLATLGSAGIPLEGLAFIAGVDRIMDMARTALNVIG
FT                   NALAVLVISRWEGLYDDAKGERYWNSLPHWRSKESVALGQPTAD"
FT   gene            complement(255243..256148)
FT                   /gene="rimK"
FT                   /locus_tag="PSPTO_0234"
FT                   /old_locus_tag="PSPTO0234"
FT   CDS_pept        complement(255243..256148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimK"
FT                   /locus_tag="PSPTO_0234"
FT                   /old_locus_tag="PSPTO0234"
FT                   /product="ribosomal protein S6 modification protein"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53780"
FT                   /db_xref="GOA:Q88AZ9"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR023533"
FT                   /db_xref="InterPro:IPR041107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88AZ9"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53780.1"
FT                   /translation="MKIAVLSRNPRLYSTRRLVEAGIERGHEMVVIDTLRAYMNIASHK
FT                   PQIHYRGKPLEGFDAVIPRIGASVTFYGCAVLRQFEMMGVFPLNESVAIARSRDKLRSL
FT                   QLLSRRGIGLPVTGFAHSPDDIPDLIQMVNGAPLVIKVLEGTQGIGVVLCETATAAESV
FT                   IEAFMGLKQDIMVQEYIKEAGGADIRCFVVGDKVIASMKRQAKPGEFRSNLHRGGSASL
FT                   IKITPEERMTALRAAKVMGLSVAGVDILRSNHGPLVMEVNSSPGLEGIEVTTSKDVAGM
FT                   IIEYLEKNSGPHMTRTKGKG"
FT   gene            complement(256145..256621)
FT                   /locus_tag="PSPTO_0235"
FT                   /old_locus_tag="PSPTO0235"
FT   CDS_pept        complement(256145..256621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0235"
FT                   /old_locus_tag="PSPTO0235"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53781"
FT                   /db_xref="GOA:Q88AZ8"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AZ8"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53781.1"
FT                   /translation="MKTFDHLTVIGLREWVALPDLGVAGLRAKIDTGASTSSLHATEIE
FT                   PFERDGQKWVRFNAHLGTVVQLRHRRCEAQLVAMKTIKSSNGQAQVRYVIRTTLALGDR
FT                   IWPVEFTLACRRSMRYRLLLGSKALIDGHLVVNPGITYVQDKPVFPASTSSGVA"
FT   gene            complement(256638..257420)
FT                   /locus_tag="PSPTO_0236"
FT                   /old_locus_tag="PSPTO0236"
FT   CDS_pept        complement(256638..257420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0236"
FT                   /old_locus_tag="PSPTO0236"
FT                   /product="EAL domain protein"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to PFAM protein family HMM PF00563"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53782"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AZ7"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53782.1"
FT                   /translation="MTDFPTSLTAPKKGCEGCTGSPELGFSFDYAYQPIVNLHDQSIFA
FT                   HEALVRGPNGEGAMSVLNQVTDQNRYRFDQKCRTTAIAGAAKLGMTERLSINFLPNAVY
FT                   RPELCIRSTLEAAKQHDFPIERLIFETIESEHVDNNNHLSNILREYREFGFMTAIDDFG
FT                   AGYSGLTLLADFQPDLIKLDMNLVRDIHRDRARQAIVRGVVTMCKDLGIKLIAEGIEHI
FT                   EERDFLADCGISLMQGYLFAKPAFKALAQIAPEAWQKP"
FT   gene            257588..257995
FT                   /gene="hslR"
FT                   /locus_tag="PSPTO_0237"
FT                   /old_locus_tag="PSPTO0237"
FT   CDS_pept        257588..257995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslR"
FT                   /locus_tag="PSPTO_0237"
FT                   /old_locus_tag="PSPTO0237"
FT                   /product="heat shock protein 15"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53783"
FT                   /db_xref="GOA:Q88AZ6"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AZ6"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53783.1"
FT                   /translation="MAQKMEEDDKVRLDKWLWAARFFKTRALAKAAIESGKVHCRGERC
FT                   KPGKEPRLGDEFQIRMGFDERTVVVEALSIVRRGAPQAQTLYRETPESIAKRENAALQR
FT                   KAGNLGVTTDGKPTKKQRRQLFDFRGARDSE"
FT   gene            258156..259058
FT                   /gene="hslO"
FT                   /locus_tag="PSPTO_0238"
FT                   /old_locus_tag="PSPTO0238"
FT   CDS_pept        258156..259058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="PSPTO_0238"
FT                   /old_locus_tag="PSPTO0238"
FT                   /product="chaperonin, 33 kDa"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53784"
FT                   /db_xref="GOA:Q88AZ5"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88AZ5"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53784.1"
FT                   /translation="MHDFPDIDFTQRFIFDESDVRGELVALERSYAEVLAKHPYPEPVA
FT                   QLLGELMAAAALLVGTLKFDGLLILQARSSGAVPLLMVECSSERELRGIARYDEALITP
FT                   GAGLQDLMPDGSLALTVDPRQGKRYQGIVALDGVDLSESLSNYFVMSEQLGTRFWLKAD
FT                   GHRARGLLLQQLPAAQITDPEERDASWEHVVTLASTLTAEEMLSLDNQTVLHRLYHEDP
FT                   VRLFDVQPICFRCSCSRERSANALASLGLEDAQQLVIEHNGSIEIDCQFCNERYLFDAT
FT                   DVAQLFAGGGVDSPSDTRH"
FT   gene            259238..260782
FT                   /gene="pckA"
FT                   /locus_tag="PSPTO_0239"
FT                   /old_locus_tag="PSPTO0239"
FT   CDS_pept        259238..260782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pckA"
FT                   /locus_tag="PSPTO_0239"
FT                   /old_locus_tag="PSPTO0239"
FT                   /product="phosphoenolpyruvate carboxykinase"
FT                   /note="identified by match to PFAM protein family HMM
FT                   PF01293; see PMID:20190049 for expression data; identified
FT                   by match to PFAM protein family HMM PF01293"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53785"
FT                   /db_xref="GOA:Q88AZ4"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88AZ4"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53785.1"
FT                   /translation="MTQINNAVHTDLSTDELVKEALARNEGVLSDTGALVVETGHRTGR
FT                   SPVDRFIVEEPSTQDAIAWGPINRKFPAEKFDALWNRVGAYLAERERFVSHVHVGSDPA
FT                   HYLPVKMTTETAWHNLFGRCLFINPEQYNPAGKDEWEIQNAPWFVCDPERDGTNSDGTV
FT                   IINFAARKVLIAGMRYAGEMKKAMFSVQNFLLPAVDVLPMHCAANMGEEGDVTLFFGLS
FT                   GTGKTTLSADESRYLIGDDEHGWGVGVVFNIEGGCYAKCIDLSEKNEPVIWKAIQHGAV
FT                   LENVVLDPVTKTADYADSSLTQNSRAAYPRELIEKRAPKNLGGEPNAVIFLTCDLTGVL
FT                   PPVSILSEEQAAYHFLSGYTALVGSTEMGSGSGIKSTFSTCFGAPFFPRPAGEYAELLI
FT                   KRIRGFKSKVYLVNTGWTGGGYGVGKRFNIPTTRGVIAAIQSGALIGAETEHLDTINLD
FT                   VPKLVPGVDTGLLNPRNTWADKAAYDEAAKALAGLFVENFKKFDVSDAIKAAGPKL"
FT   gene            261079..261330
FT                   /locus_tag="PSPTO_0240"
FT                   /old_locus_tag="PSPTO0240"
FT   CDS_pept        261079..261330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0240"
FT                   /old_locus_tag="PSPTO0240"
FT                   /product="prevent-host-death family protein"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:6523510, and GP:6523510; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53786"
FT                   /db_xref="GOA:Q88AZ3"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AZ3"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53786.1"
FT                   /translation="MRVETISYLKRNAADLPLDEPLIVTQNGVPAYVVESYADRKRRDE
FT                   SIALVKLLAISSREYSQGKHCSADELKARLSRRFAHKE"
FT   gene            261343..261693
FT                   /locus_tag="PSPTO_0241"
FT                   /old_locus_tag="PSPTO0241"
FT   CDS_pept        261343..261693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0241"
FT                   /old_locus_tag="PSPTO0241"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:5834753; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53787"
FT                   /db_xref="GOA:Q88AZ2"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AZ2"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53787.1"
FT                   /translation="MNMFALRFTDVAQQSLEDQVEHLAVYQGFSPAAQRIDTLIDAIQD
FT                   KLLSTPLGYPVSPQLSELGVLHYRELNADGYRIFYEVRETDDINVIVIVLVLGGKQSVE
FT                   QALIRYCLLQPI"
FT   gene            complement(262839..263411)
FT                   /locus_tag="PSPTO_0242"
FT                   /old_locus_tag="PSPTO0242"
FT   CDS_pept        complement(262839..263411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0242"
FT                   /old_locus_tag="PSPTO0242"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53788"
FT                   /db_xref="GOA:Q88AZ1"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AZ1"
FT                   /protein_id="AAO53788.1"
FT                   /translation="MALCGYSLFHYRHLPKTTDPNPSPPPASVVADATVIAPLPVNETQ
FT                   GRPQTLPECMGPDNLIDEAVATCRFGKNQRVVPGSTAQGMVSARYMSQYKAQQQMHQPR
FT                   LAAAQFIESAVVSQWDRKRTYAAEWVVSGNQIDGTSVCRNWRRGSIEYRECRKGAKVHF
FT                   KEQCKRLAESIIRQRYCSAASGFNPLG"
FT   gene            complement(263550..264371)
FT                   /locus_tag="PSPTO_0243"
FT                   /old_locus_tag="PSPTO0243"
FT   CDS_pept        complement(263550..264371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0243"
FT                   /old_locus_tag="PSPTO0243"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GP:19070034, and GP:19070034; identified
FT                   by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53789"
FT                   /db_xref="GOA:Q88AZ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AZ0"
FT                   /protein_id="AAO53789.1"
FT                   /translation="MSHFDTHAFQRKTKAVSGWADTKSEYKAMDWPLPRGRSMIDTKSI
FT                   THLTSKIALTTVEKSISATTINSSLKELDSAPAIDGATFSTLSSQLSSSAARAQARDSS
FT                   LDLKNLGALAKNISDKVAGNSYYANRKLHDAEIPDTDDPVLLERARQATSFSNGAGKNP
FT                   FAGLSQDQLRLIIYDEGGDFTINERNAAYSENYSQEQVWKRAICQRYTDEYNETGKSTQ
FT                   TLVMLLAHYNQLPPIEKAQYPANYAANITSGDSSALDIFNTLKSQSHTQEA"
FT   gene            complement(265284..265997)
FT                   /locus_tag="PSPTO_0244"
FT                   /old_locus_tag="PSPTO0244"
FT   CDS_pept        complement(265284..265997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0244"
FT                   /old_locus_tag="PSPTO0244"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53790"
FT                   /db_xref="GOA:Q88AY9"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="PDB:3MYX"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AY9"
FT                   /protein_id="AAO53790.1"
FT                   /translation="MPQPTVLLLARADLSPVGTEFTTGPIDAHDPFDSGRRTAFVDEQG
FT                   IAAGIVEFGTALSVEAYPYTEMLVMHRGSVTLTSGTDSVTLSTGESAVIGRGTQVRIDA
FT                   QPESLWAFCASTQASGPDKSGITALDRLALLTPSSPPDPSIMISPLPQCRSNNLFEDTA
FT                   STLRIGVWDSTPYERISRPHKIHELMNLIEGRVVLSLENGSSLTVNTGDTVFVAQGAPC
FT                   KWTSTGYVRKFYAVT"
FT   gene            complement(266158..267015)
FT                   /locus_tag="PSPTO_0245"
FT                   /old_locus_tag="PSPTO0245"
FT   CDS_pept        complement(266158..267015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0245"
FT                   /old_locus_tag="PSPTO0245"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to TIGR protein family HMM
FT                   TIGR01575"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53791"
FT                   /db_xref="GOA:Q88AY8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR041496"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AY8"
FT                   /protein_id="AAO53791.1"
FT                   /translation="MLAQQRLDFEFRPMTAADVGNAHELSIALKWPHRLEDWAMLQRVA
FT                   QGFVAVRNGRLIGSAFACHQGEFSTIGLVIVSDDYQGKGIGRKLMELAVGSIPPRTAIL
FT                   NATLAGAPLYEKMGFVSFGEIQQRQGQAQLPDATLLTAEESCRVLSEADHDRVLELGNA
FT                   GSGLDRSVTLGDLLNNLEHAVGIDRDGQLQAFALLRPFGRGLCIGPVVAQTVEQARHMI
FT                   EHLLARVPYAFVRIDIPTHCGLADWLEAAGLKRVDSVTCMSMGAVPQAREGVSQFALIT
FT                   QAIG"
FT   gene            complement(267161..267574)
FT                   /locus_tag="PSPTO_0246"
FT                   /old_locus_tag="PSPTO0246"
FT   CDS_pept        complement(267161..267574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0246"
FT                   /old_locus_tag="PSPTO0246"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53792"
FT                   /db_xref="GOA:Q88AY7"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AY7"
FT                   /protein_id="AAO53792.1"
FT                   /translation="MNFGRRKLIVCGPESSLRSWHDEQSGLVSRAVMHAAAHPHYNTVK
FT                   SAYGVKSDGCLIETTVLRCALSRLCGALQPWANPGFRRFFDPFQGAQAQTRGFAPQKLR
FT                   RATDCGAGKSGHAIKSLIRIKNHKHLLPSPRPI"
FT   gene            267549..268217
FT                   /gene="dehII"
FT                   /locus_tag="PSPTO_0247"
FT                   /old_locus_tag="PSPTO0247"
FT   CDS_pept        267549..268217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dehII"
FT                   /locus_tag="PSPTO_0247"
FT                   /old_locus_tag="PSPTO0247"
FT                   /product="haloacid dehalogenase, type II"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:Q52087; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53793"
FT                   /db_xref="GOA:Q88AY6"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AY6"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53793.1"
FT                   /translation="MSFLRPKFITFDCYGTLTNFHMGTMTREIFADRVPAEQMDQFVRD
FT                   FSAYRLDQVMGDWMPYDEILKVALARTCKRWNVEYREEGQLYYDAVPTWGPHADVPAGL
FT                   SKIADKIPLVIFSNASDSQIMSNVEKLGAPFHKVFTADQAKVYKPRLAAFEFMLDNLGC
FT                   GPEDILHVSSSFRYDLFSAHDMKIKNKAFVARGHEQPANSFYEYHQIPDIGGLAGLVGL
FT                   "
FT   gene            268284..269558
FT                   /locus_tag="PSPTO_0248"
FT                   /old_locus_tag="PSPTO0248"
FT   CDS_pept        268284..269558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0248"
FT                   /old_locus_tag="PSPTO0248"
FT                   /product="oxidoreductase, FAD-binding protein"
FT                   /note="similar to GP:14524166; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53794"
FT                   /db_xref="GOA:Q88AY5"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AY5"
FT                   /protein_id="AAO53794.1"
FT                   /translation="MRSESYWLDTAPDFTGAQDGAVEGQADVVVVGGGFTGLAAARALA
FT                   LKGASVVVLEAGRVIGEASGRNGGQCNTGVAQDYASLSATLGADQAREYYKAYESAVQS
FT                   VVTVVEQESIACDIKRNGKLKLAAKPGHYEGLARTCELIRREVDADVELLSAQDVRSEI
FT                   DSNEFHGGLLQRNGVQMHVGRFGLGLADAAVRHGARVYQDATVKDWKANRGGFVVNTSK
FT                   GSIQAGQVLLATGACQHGGLGWYRRRIVPVGSFVIVTEVLPQALINQLFPHQRAYVTSR
FT                   LIGNYFRLTPDNRLLFGGRARFAMSNSSSDAKSGKVLQAAMVQMFPQLAHVKVDYCWGG
FT                   LVDMTSDRLPRAGEHNGVFYSMGYSGHGVQMSVHMGQVMAEVMEGKAQANPWKDLNWPA
FT                   IPGHFGKPWFLPLVGAYYRYQDSRH"
FT   gene            269650..271287
FT                   /locus_tag="PSPTO_0249"
FT                   /old_locus_tag="PSPTO0249"
FT   CDS_pept        269650..271287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0249"
FT                   /old_locus_tag="PSPTO0249"
FT                   /product="peptide ABC transporter, periplasmic
FT                   peptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53795"
FT                   /db_xref="GOA:Q88AY4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AY4"
FT                   /protein_id="AAO53795.1"
FT                   /translation="MADNKTDSQLITGQDSLRVFEGLNRGLSRRDALRMLGVAGVVAAG
FT                   STSLFGAAGKVFADDADTPVKGKPGGRIRVAGMSSSTADTLDPAKGALSTDYVRHFMFY
FT                   NGLTRFDSHLVPHMELAEKIESDNATVWTVTLRQGVTFHNGKALTAGDVVFSLSRHKDP
FT                   ATGSKVLPLMAQFSEIKATGPMEVQITLSSPNAELPSILAVSHLLIVPEGTTDFSKGIG
FT                   TGPFTVKEFNPDVRSVSARNPNYWKPGLPYLDEIEFIAISDEPSRVNALLSGDVHMINE
FT                   VNPRSTTRIAASARHRVVDAPSGNYTDLIIRQDQMPGKSPEFTEAMKHLLDREQVKSAV
FT                   FRGYARVGNDHPIAPGSRYFNADLPQRAYDPEKARFLLKKAGMEKITMAVAASPAATGS
FT                   VDIAVLLQQSAKQAGLTLNVNRLPSDGYWSNHWMKHPLSFGNINPRPNADVIFSQFFQS
FT                   SAPWNESGWKNDQFDQLLLLARGETDDAKRAKMYGDMQTLVSQNCGIGIPVFISNIDGV
FT                   DKRIQGYSSNPLGGFMGYMFSEQVWLDA"
FT   gene            271319..272275
FT                   /locus_tag="PSPTO_0250"
FT                   /old_locus_tag="PSPTO0250"
FT   CDS_pept        271319..272275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0250"
FT                   /old_locus_tag="PSPTO0250"
FT                   /product="peptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53796"
FT                   /db_xref="GOA:Q88AY3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AY3"
FT                   /protein_id="AAO53796.1"
FT                   /translation="MNSNTLWLIVQRLGAAIVTLLIVSIVVFAITAVLPGDAAQQALGQ
FT                   FATPEQVAALRIKLGLDQPGVVRYLHWLTNLLGGNFGESVSNAMPVSELIAGRFPKTLM
FT                   LAATTALVSVPVALTLGIGAAMGRGGRLDGALNFITLSLVAVPEFLVATLAVLIFAVNL
FT                   GWLSALSYGSDVTSPWQFMRTYALPVMTLCCVIVAQMARMTRAAVIDQLDSPYVEMARL
FT                   KGVSPVRIVLRHALPNAIGPIVNAVALSLSYLLGGVVIVETIFNYPGIASLMVDAVTNR
FT                   DMALVQGCTMLFCAAYLGLVLMADLCAILSNPRLRTQ"
FT   gene            272272..273150
FT                   /locus_tag="PSPTO_0251"
FT                   /old_locus_tag="PSPTO0251"
FT   CDS_pept        272272..273150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0251"
FT                   /old_locus_tag="PSPTO0251"
FT                   /product="peptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53797"
FT                   /db_xref="GOA:Q88AY2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AY2"
FT                   /protein_id="AAO53797.1"
FT                   /translation="MTQFIAKSTPAAPEPVLRKKASRPTSWLGLLGATVCFLWLMVALF
FT                   GPWLAPHPVGEVVSDNMFENMSAVYPFGTDYLGRDMLSRVLVGAKFTVGLALISAVLAS
FT                   GIGTLCALLSVVAPKWLDEIISRLMDAFISIPSKMLALIMVSAFGSSEVLLICTAVLSY
FT                   SPGAFRIARSLAVNIEALEYVQVARTRGEGRVYIACREILPNMLNPVLTDLGLRFGFIV
FT                   LLLSGMSFLGLGVQPPDADLGSLVRENIGGLSQGAPAIVIPALAIGTLTIGVNLFIDRL
FT                   ASRRGRRSGGH"
FT   gene            273152..274993
FT                   /locus_tag="PSPTO_0252"
FT                   /old_locus_tag="PSPTO0252"
FT   CDS_pept        273152..274993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0252"
FT                   /old_locus_tag="PSPTO0252"
FT                   /product="peptide ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53798"
FT                   /db_xref="GOA:Q88AY1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AY1"
FT                   /protein_id="AAO53798.1"
FT                   /translation="MSQLIRVQDLRVVAEGDHGELEIVKGVSFALEKGEVLALIGESGS
FT                   GKTTIALALLGYARRGCKLAGGVVRVGEHDMLSLPESQLQGLRGNRVSYVAQSAAAAFN
FT                   PAKKLIDQVIEGALIHGLGSRADLQAKAIELFRDLALPNPETIGQRYPHQVSGGQLQRV
FT                   MAAMALISDPLLVILDEPTTALDVTTQIDVLRAFKRVVRERGATAVYVSHDLAVVAQMA
FT                   DQIVVLNGGRIIEQSSTAALLKGPEDPYTRSLLAAARPDKVLKPASEVVKDSTLLTIKG
FT                   LTAGYGKKNLQGMPMIRVLEDIDLTIRRGQAIGVIGESGSGKSTLARVVAGLLDPAHGS
FT                   LTFDGAELSGTLAGRTEEQFRRIQMVFQNADTALNPMHSVGAILARPLKMYFGLKGKAL
FT                   RERIDELMDLVRLPRELAERRPNELSGGQKQRVNLARALAAKPDLILCDEVTSALDTVV
FT                   GACILELLGELRRKLGVSYLFISHDISTVRALCDDIVVMYSGHKVEEGSRETFSHVPFH
FT                   PYTDLLVHSVPELRQGWLESCGVTSGKLPPISAPVNNRELCTFLNRCPARIEGLCNRTA
FT                   PGRRRIAGGSEILCHRDSDELQAVQENLNPVTVGAYA"
FT   gene            274990..275301
FT                   /locus_tag="PSPTO_0253"
FT                   /old_locus_tag="PSPTO0253"
FT   CDS_pept        274990..275301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0253"
FT                   /old_locus_tag="PSPTO0253"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53799"
FT                   /db_xref="GOA:Q88AY0"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AY0"
FT                   /protein_id="AAO53799.1"
FT                   /translation="MSGRFVRLGERDRPVVSLLVDGAPIEALQGDTLMVALLTRKATLR
FT                   QSEFDSGRRAGFCLMGACQDCWVWTRSGERLRACSNEVRDGLDIVTTQPEAKWPLLHG"
FT   gene            275280..276689
FT                   /locus_tag="PSPTO_0254"
FT                   /old_locus_tag="PSPTO0254"
FT   CDS_pept        275280..276689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0254"
FT                   /old_locus_tag="PSPTO0254"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase
FT                   family protein"
FT                   /note="similar to GP:14026612, and SP:P72300; identified by
FT                   sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53800"
FT                   /db_xref="GOA:Q88AX9"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR017224"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AX9"
FT                   /protein_id="AAO53800.1"
FT                   /translation="MATSSRLDVHNPGSPRVVIIGAGPAGTRCAQTLLAAGIKPILIDE
FT                   NRRDGGQIYRRQPEGFKRDYSALYGTEAAKARDLHESFDRLRKQIDYRPDTLAWNLTQG
FT                   ELCCASQGVHSVVEYDALILCAGATDRLMPIKGWQLAGTYSLGGSQIALKSQSVSIGSR
FT                   VVFMGSGPLLYLVASQYVKAGAEVAAVLDTSPFSKRIGAMPKLLARPGLLFNGMKLLAQ
FT                   LYSANVPVHLGVQPEEIMGSEQDGVTGVRVKLASGNVLTVDCDALALGYHLRPETQLAD
FT                   LAGCQLRFDDASGQWVLAVDEEGRTSVKGVYAAGDGAKIRGADAAEQAGRLAAMALLED
FT                   LGRPVDKSHREAVRKNLVVMDRFRVGLAEAFPWPAAQAAALPDEAIVCRCEMISAGELR
FT                   GVVREKGACEVNRAKAFSRVGMGRCQGRYCSQAGAEVIAAEAGVPVEQVGRQRGQAPVK
FT                   PLSMLIDEVVS"
FT   gene            276686..277840
FT                   /locus_tag="PSPTO_0255"
FT                   /old_locus_tag="PSPTO0255"
FT   CDS_pept        276686..277840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0255"
FT                   /old_locus_tag="PSPTO0255"
FT                   /product="oxidoreductase, FAD-binding protein"
FT                   /note="similar to GP:2665709; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53801"
FT                   /db_xref="GOA:Q88AX8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AX8"
FT                   /protein_id="AAO53801.1"
FT                   /translation="MKQPKVDVLIVGGGFMGSASAFFLRQRGKSVTLLERDVVGQYASG
FT                   VNFGNVRRQGRHLGQLELSNRSRALWQRLPELIGEDLEFLPSGHMRVCYREDEIAELEA
FT                   YAAAPEARELDLKIYRGKALHERFPFLGSDVKGGSYAPHDGHANPRLAAPAFARAAIRA
FT                   GARIEERTEVAHVEKVGNEFEVTTTDGRIFTADQLLITAGAWGQKLSAQFGEPVPLETN
FT                   GPQMAVTEPVPYALPTVIGVFTKIPHEVIYFRQIARGNIVIGGGFRSKPDMVNRRAYVE
FT                   PRSIVNQVQQMRRLLPGVGNLNIIRVWSGIEGYTPDSLPVMGRSGKVDGLFYAFAFCGH
FT                   GFQLGPGVGDVMAELISTGTTSTSISPFDIRRFEIVTEHASKAS"
FT   gene            277837..278994
FT                   /gene="argE-1"
FT                   /locus_tag="PSPTO_0256"
FT                   /old_locus_tag="PSPTO0256"
FT   CDS_pept        277837..278994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argE-1"
FT                   /locus_tag="PSPTO_0256"
FT                   /old_locus_tag="PSPTO0256"
FT                   /product="acetylornithine deacetylase"
FT                   /note="similar to SP:P23908; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53802"
FT                   /db_xref="GOA:Q88AX7"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AX7"
FT                   /protein_id="AAO53802.1"
FT                   /translation="MSPRALEILKRLIAFDTVSSEPNMALIEYVRELLASKGIESLIVK
FT                   DETGKKANLFASTGPRDVPGVLLSGHTDVVPAAGQAWTMPPFQATLRDGRIYGRGTCDM
FT                   KGFIALAIDAMLNAADMTLLRPLQLALSHDEEIGCVGVRRLLDVLHLAPVRPFLCVVGE
FT                   PTLMQFAVGHKGKASYRTFCRGQEAHSSLAPRAVNAIHLASDFIAELRNSQKRIEQQGS
FT                   RDEGYDIPYSTVHIGRIDGGKALNIVPNLCTMEFEYRNLPGDNPEVLLEQLRERADVLV
FT                   REAKHLSGVAAIEIEVMNEYPALETHPSVEAVRMLHAFAEPGTQHIKVSYGTEGGLFAG
FT                   RLNVPVVVCGPGSIEQAHKPDEFIDESQMDAGERFLHSLLGSLKQ"
FT   gene            279109..280566
FT                   /gene="gabD-1"
FT                   /locus_tag="PSPTO_0257"
FT                   /old_locus_tag="PSPTO0257"
FT   CDS_pept        279109..280566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD-1"
FT                   /locus_tag="PSPTO_0257"
FT                   /old_locus_tag="PSPTO0257"
FT                   /product="succinate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53803"
FT                   /db_xref="GOA:Q88AX6"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AX6"
FT                   /protein_id="AAO53803.1"
FT                   /translation="MLKNQLKDPSLLVDRAYVDGQWISADDGATLAISDPATGEVIAQV
FT                   PALQGAETRRAIEAADRAWPAWRARPAAERAALLERWHQAMLDNVEDLALIMTLEQGKP
FT                   LNESRGEIRYGASFVKWFAEEARRSYGETIPTPSADRRLMTLKQPVGVCAAITPWNFPN
FT                   AMITRKCAPALAAGCTIIVKPSDLTPLSALALAVLAERAGIPVGVFSVVTGMPTAIGEE
FT                   LTGNPVVRKISFTGSTPIGRLLMRQSAEHIKRLSLELGGNAPFIVFDDADLEQAVAGIM
FT                   LSKFRNAGQTCVCANRILVQSGIYDRFAARLVEEVAKLKVGNGLEEGVTIGPLINPAAV
FT                   SKIARHIDDALSQGAKLLYGGLPNGDGQFVQPTVLGDTHAGMLLANEETFGPVAPLMRF
FT                   TDEAEALALANATPYGLAAYYFTQDLRRSWRFGEALEFGMVGLNTGIISMEIAPFGGIK
FT                   QSGLGREGSSYGLDEYLEVKAFHVGGL"
FT   gene            complement(280829..281794)
FT                   /locus_tag="PSPTO_0258"
FT                   /old_locus_tag="PSPTO0258"
FT   CDS_pept        complement(280829..281794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0258"
FT                   /old_locus_tag="PSPTO0258"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   family protein"
FT                   /note="similar to GP:14524160, and GP:13360870; identified
FT                   by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53804"
FT                   /db_xref="GOA:Q88AX5"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AX5"
FT                   /protein_id="AAO53804.1"
FT                   /translation="MMRLHFHTQEMPMPALLYKADPARAERWRVLFAEHAPDIEWRVWP
FT                   DIGDPADIHYLGAWLAPDDLQDLLPNLKVLFALSAGVDQLDLSRIPKSLPVVRLLDPGI
FT                   SHGMCEYASFAVLSLHREMLRYRQQQVEGLWKAQPLIPANKRRVGVMGLGLQAQHILSS
FT                   LKPFGFQLSGWARSAHQVEGVTCYAGEEQLSEFLGQCDILLCVLPLTAQTEGILNRQLF
FT                   ERLPEGAALINMGRGGHLVEADLLEALDSGQLSAAVLDVLQQEPAPADHPFWQHPKILL
FT                   TPHVAAMTQPESAFPGLLDNIRRFERGEAMQGQVNRGQGY"
FT   gene            282043..283347
FT                   /gene="gabT-1"
FT                   /locus_tag="PSPTO_0259"
FT                   /old_locus_tag="PSPTO0259"
FT   CDS_pept        282043..283347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabT-1"
FT                   /locus_tag="PSPTO_0259"
FT                   /old_locus_tag="PSPTO0259"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53805"
FT                   /db_xref="GOA:Q88AX4"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AX4"
FT                   /protein_id="AAO53805.1"
FT                   /translation="MNSKVDETPHLLRQRDQFVPRGIVTAHPLVIDRAQGSELWDVDGK
FT                   RYLDFVGGIGVLNIGHNHPNVVKAIQAQLSKVTHACFQVASYQPYLDLAKRLSLMIAGQ
FT                   SGIDHKAVFFTSGAEAVENAVKIARARTNRPAIISFRGGFHGRTLLGTTLTGMSQPYKQ
FT                   NFGPMAPEVFHTPYPNEYRGVTTEVALAALHELLATQVAPDRVAAILIEPIQGDGGFLT
FT                   APVEFLKALRALTEQHGIVLILDEIQTGFGRTGKWFGFEHAGIQPDLVTVAKSLAGGMP
FT                   LSGVVGRAEIMDAPLPGGLGGTYGGNALSCAAALAVIDTYEQDNLLARGEQLGEHLRAG
FT                   LLRLKDRYACIGDVRGTGFMLAMELTKNDAARSPDADLNQKVIDQARIGGLLVIKCGVY
FT                   RNVLRFLAPLVTTEQQIDEALSILDAALARVLKSS"
FT   gene            283423..284079
FT                   /locus_tag="PSPTO_0260"
FT                   /old_locus_tag="PSPTO0260"
FT   CDS_pept        283423..284079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0260"
FT                   /old_locus_tag="PSPTO0260"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to TIGR protein family HMM
FT                   TIGR01428"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53806"
FT                   /db_xref="GOA:Q88AX3"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AX3"
FT                   /protein_id="AAO53806.1"
FT                   /translation="MGLIDYRALLIDCDEVLVDRDSGVWAALQPLLENGLNTPDKESIL
FT                   TEFNGVVRTLYARFDELGFSGLLCFAHRQLAERLAIKTSWEEGMTFARSVPDWTLFEDA
FT                   PGAMLYLRKFYRLLVYADRDLQDRGILCERLGLEPDSLLSRATHPLDDTRWLAEMDLDT
FT                   RDTLLVSRPPASAPGLGGLCLIRRRREQHRQPCTADICISSMADLVAQHQLSLRR"
FT   gene            284127..284615
FT                   /locus_tag="PSPTO_0261"
FT                   /old_locus_tag="PSPTO0261"
FT   CDS_pept        284127..284615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0261"
FT                   /old_locus_tag="PSPTO0261"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P37403; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53807"
FT                   /db_xref="GOA:Q88AX2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AX2"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53807.1"
FT                   /translation="MEGLVKLDRIDINILVELQKDGRMTNVSLADAVGLSASPCLQRVK
FT                   RLESAGYISSYKAHLNLAKITESVTVFTEISLSDHKREDFAKFEANIRHVDEVLECHLI
FT                   SGGYDYLVRFMTRSIQHYQEVIEELLDKNIGISKYFSYIVIKSPVMKDGVPLRKLLRH"
FT   gene            complement(284644..285102)
FT                   /locus_tag="PSPTO_0262"
FT                   /old_locus_tag="PSPTO0262"
FT   CDS_pept        complement(284644..285102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0262"
FT                   /old_locus_tag="PSPTO0262"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GP:7379272; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53808"
FT                   /db_xref="GOA:Q88AX1"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AX1"
FT                   /protein_id="AAO53808.1"
FT                   /translation="MHVYSASKRLRTGRYSAIGQIYMVTSVTRGREPVFADVRLGRLLV
FT                   RELRRCEEQELVKSLAWVVMPDHFHWLFELKKNSLPMLIQQLKARSSIAIGKIRAHPDT
FT                   LWQSGYHDQAVRNEQNMVGLARYIVANPLRAGLVKKIGDYPLWDAIWI"
FT   gene            285536..287032
FT                   /locus_tag="PSPTO_0263"
FT                   /old_locus_tag="PSPTO0263"
FT   CDS_pept        285536..287032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0263"
FT                   /old_locus_tag="PSPTO0263"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53809"
FT                   /db_xref="GOA:Q88AX0"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AX0"
FT                   /protein_id="AAO53809.1"
FT                   /translation="MPAAPRFLEHYRKADRIMLGLIWLLFVYALGLGFWFDTFTQAVVV
FT                   GGGTALVLTGLYRVIGGTRLMRCCVGIGLMVMAALHINQAHGQIEIHFGIFVFLAVLTF
FT                   YRDWLPILVAAVTIAIHHIGFHALHHSGFPVYVMQHGGGWSMVAMHAVYVVVESTILVY
FT                   LAVQNQAEAVENQDMLDRMLATTNQFSPDSRIDERSGKHVSLAQRFEQFLAQITGLVDG
FT                   VVRDTRGLGELGHDLAKASGTLETGAQHQLSEIARMTGAMQRMGDAMNDISGHVAQAVQ
FT                   RAGDASDQVAHGRDSVDRAQSEITQLAARISTTDETVQALANQSEQIGKVLDVIGSIAE
FT                   QTNLLALNAAIEAARAGEQGRGFAVVADEVRNLAQRTASSTKEIQTIIEDLQKGSRQAA
FT                   TAMSDSLQGVGRCVENSQRASESLRSVGEGIGHITQLNGLIATTTEQQATASREIADQL
FT                   RSVQAIAEHTAANIGVLASSSQSLSPLAVRLAALGQSFHN"
FT   gene            complement(287061..288644)
FT                   /locus_tag="PSPTO_0264"
FT                   /old_locus_tag="PSPTO0264"
FT   CDS_pept        complement(287061..288644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0264"
FT                   /old_locus_tag="PSPTO0264"
FT                   /product="peptide ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53810"
FT                   /db_xref="GOA:Q88AW9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AW9"
FT                   /protein_id="AAO53810.1"
FT                   /translation="MQDNLIEIRDLRVAFNGHEVVHGISLDIRRGECLALVGESGSGKS
FT                   VTAHSILRLLPPKNVSTQGSIRYDGLDLVTASDKQLRSLRGNRVAMIFQEPMSSLNPLH
FT                   TVEKQIGEILVTHKGLKGKAALSRTLELLELVGIREPLLRLKAYPHQLSGGQRQRVMIA
FT                   MALANEPDLLIADEPTTALDVTVQVKILELLKSLQQRLNMSLLLISHDLNLVRRIAQRV
FT                   CVMREGEIVEQADCQALFDNPQHPYSRLLINAEPDGEPVPSTHSNTLLSVQDLKVWFPL
FT                   GKAWFQREQQYVKAVDGVSFELLKGKTLGIVGESGSGKSTLGQAILRLVDSEGSIRFGT
FT                   KELSLHSQHLMRPLRRQLQVVFQDPFGSLSPRMTVEQIIAEGLVTHKIGTPKEREQTVI
FT                   RVLQEVGLDPATRHRYPHEFSGGQRQRISIARALVLEPDLILLDEPTSALDRTVQKQIV
FT                   ALLRDLQIRHGLTYLFISHDLAVVHALAHDLIVIKDGKVVEQGPSREIFAAPQQAYTQE
FT                   LLRSSGLVFA"
FT   gene            complement(288646..289668)
FT                   /locus_tag="PSPTO_0265"
FT                   /old_locus_tag="PSPTO0265"
FT   CDS_pept        complement(288646..289668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0265"
FT                   /old_locus_tag="PSPTO0265"
FT                   /product="peptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53811"
FT                   /db_xref="GOA:Q88AW8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AW8"
FT                   /protein_id="AAO53811.1"
FT                   /translation="MFEFSPQTQRRFALFKANRRGWWSLWIFIGLMLVCLCGELIANDK
FT                   PLLINYDGQMYYPVLHTYMETDFGGELPFEPDYASDYVRKLIAAKNGWMLFAPIPFSYD
FT                   TINYDLDAPSPSPPDGTNWLGTDEQARDVLARVLFGARISILFALLLTVISTVIGVCAG
FT                   AIQGYYGGMTDLIGQRIQEIWSGLPVLYLLIILSGFVSPSFWWLLGIMALFSWLSLVDV
FT                   VRAEFLRGRNLEYVKAARALGLTDAALMWRHILPNAMTSTLTYLPFIITGAIATLTALD
FT                   FLGFGMPAGSASLGELIGEAKRNLQAPWLGLTAFVALALILSLLVFIGEACRDAFDPRS
FT                   "
FT   gene            complement(289668..290735)
FT                   /locus_tag="PSPTO_0266"
FT                   /old_locus_tag="PSPTO0266"
FT   CDS_pept        complement(289668..290735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0266"
FT                   /old_locus_tag="PSPTO0266"
FT                   /product="peptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53812"
FT                   /db_xref="GOA:Q88AW7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AW7"
FT                   /protein_id="AAO53812.1"
FT                   /translation="MLAYVIRRLLLIIPTLLAILIVNFLIVQAAPGGPVEQAIARIQGF
FT                   SPNGVGGGGGEVAASGTASRSTRGLDPALIEQIKEHYGFDKPMHERLWLMLKNYAQLDF
FT                   GTSFFRGAPVTELIAQKLPVSLSLGLWATLITYLISIPLGIRKAVRHGSAFDVWSSTLV
FT                   IIGYATPAFLFAILLIVVFAGGSYLSWFPAQGLLSENFDSLSTWGKVKDYLWHLVLPVS
FT                   SLVIGGFATLTILTKNSFLNEISRQYVVTARAKGLTEHRVLYGHVFRNAMLLVIAGIPQ
FT                   ALIEVFFAGSLLIETIFGLDGLGRMSYEAAVSRDYPIVFGTLFLFTLFGLLIKLIGDLC
FT                   YTLVDPRIDFSARSA"
FT   gene            complement(290737..292653)
FT                   /locus_tag="PSPTO_0267"
FT                   /old_locus_tag="PSPTO0267"
FT   CDS_pept        complement(290737..292653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0267"
FT                   /old_locus_tag="PSPTO0267"
FT                   /product="bacterial extracellular solute-binding protein,
FT                   family 5"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53813"
FT                   /db_xref="GOA:Q88AW6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AW6"
FT                   /protein_id="AAO53813.1"
FT                   /translation="MSFSAYEESPTMLRHTRLLQRLILGVALLSGWQVTQAAPTHALTV
FT                   YGEAPKYPAGFQHFDYVNPNAPKGGSLTRSAEEIGQFNYLNPYVDQGINVREVDSWVYS
FT                   PLAYRSLDEPYTVYGLIAEKMEMDPNGLWIRFFLNPKARFEDGKPVTAQDVRYTFELMT
FT                   TKASFSYRPMFADVKEVIIEGPLQIRFDFKNNLNRMLALDIASLHILPEHWWKSRDFAN
FT                   GGGFEPPLGNGPYRVAKVDAGRSVAFERVKDWWGKDLPVSRGLYNFDSLTVNYYGDTEI
FT                   ARQLLQAGAFDYNREFSSSGFVVGYSGPAIDDGRLQKNIFAQQRPVAAQGFVFNLDNPI
FT                   FKDRRVREALSLLWDFDWINRRVMRNFYVREQSYFPKSDMAATALPTPAELKILEPLRA
FT                   QVPDEVFTTVYQPPKTDGSGYIRDKQLQALKLLAEAGWHPKDNKLVNAAGEPMVFSFLD
FT                   GQGGFDRLILPFKRTLAQIGITLDFLRIDSAQYINRLNARDYDMIVVTLPKNGNPIISP
FT                   GRELYNLYGSQSATEVGSSNAMVLRNPAVDTLIDGLVSANTRNDMVTYARALDRVLQWG
FT                   YYMIPNYYSKGTPLVFANRFGMPAVAPIYDVGLETWWQISPTPLTNAQAAALAGKTTAA
FT                   KEH"
FT   gene            complement(292765..295398)
FT                   /locus_tag="PSPTO_0268"
FT                   /old_locus_tag="PSPTO0268"
FT   CDS_pept        complement(292765..295398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0268"
FT                   /old_locus_tag="PSPTO0268"
FT                   /product="TonB system transport protein, putative"
FT                   /note="identified by match to TIGR protein family HMM
FT                   TIGR01783"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53814"
FT                   /db_xref="GOA:Q88AW5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AW5"
FT                   /protein_id="AAO53814.1"
FT                   /translation="MGMSGAQAAEAVDADTSGSAVSSSAAVVPATTQLQRVEVTGSAIR
FT                   RVDAETAVPITILRADDLKKQGVTTTQEMVQRITGSQSINNSAGSVGAGTGGASFADMR
FT                   GIGANKTLVLLNGRRLANNALSGVGTPNGSAIDLNMIPFAAIDRVEVLRDGASALYGTD
FT                   AIGGVINFITKKSLTDGSLTLGGETPTASGGGATKDMSASWGFGDLEQDRFNVMGVFNY
FT                   NKQQNLDANDRSFAKDYVPGRGLNQTSGTAYPGNYFQGDNSANPLGRNCGGANLIASNG
FT                   ICRFSTREYIDLIPQTEKTSFFGKATGKLADDHNVSLEYFWARNNNHTDIGPAPLTGLS
FT                   LDSSSPFYPGNGITPAPTDFTLDPTQPISTAWRETAAGPRGSSDQNTSQRFLLNFDGLV
FT                   GGWDYNVGASYNQNKVLSSLTNGYISDAAMLNGLANGTLNPFGPQTTAGQALIDASEYH
FT                   GQYSSAVGRVAGLDARISREIGDWFGAGPAGIALGGEYRKEKMHQEYEAYVNDISSLGA
FT                   DAAGSVEGDRSVKAQYAELNVPVLDSLELTAAVRHDKYSDFGSTTNPKYSFRYQPFKQL
FT                   VVRGAYSEGFRAPSLYELYAPRSTTFTQGYYNDPVLCAGGVVQPGGNAGRDCQQQFLNN
FT                   GGGNTELAPEKARNMTLGFVYQPVSNLSMGLDFWWIHISNQIQAFPESTVFDDPNTYAD
FT                   RYVRAADGSIANIVTGNANLGIVKTSGVDVTLDYRFPNTPYGQFGLGMTGTYVTRYDFQ
FT                   NIIDGPYTDKVGDFQGDGVISRWKHVLTGTWALGDTRASLTNRFTSGYNDYDRTTNARV
FT                   ASYALWDMSVGHTFDKVLDIDAGVRNMFDRNPPFSNQAYNFQSGYDPRYADPLGRTLFA
FT                   RATYHF"
FT   gene            complement(295690..296091)
FT                   /locus_tag="PSPTO_0269"
FT                   /old_locus_tag="PSPTO0269"
FT   CDS_pept        complement(295690..296091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0269"
FT                   /old_locus_tag="PSPTO0269"
FT                   /product="biopolymer transport protein ExbD, putative"
FT                   /note="identified by match to PFAM protein family HMM
FT                   PF02472"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53815"
FT                   /db_xref="GOA:Q88AW4"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AW4"
FT                   /protein_id="AAO53815.1"
FT                   /translation="MSFSTQDNDEVLSEMNVTPLVDVMLVLLVVFIVTTPLMTNAIKVN
FT                   LPKTDSVAPAEKKNPVVVSVDQDGKFYLAKSEIAPELLEKSLQDEKAKDPEIRVQLQAD
FT                   TAVNYGQVAKAMASIERSGITKISVMTAK"
FT   gene            complement(296091..296798)
FT                   /locus_tag="PSPTO_0270"
FT                   /old_locus_tag="PSPTO0270"
FT   CDS_pept        complement(296091..296798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0270"
FT                   /old_locus_tag="PSPTO0270"
FT                   /product="biopolymer transport protein ExbB, putative"
FT                   /note="similar to SP:O34260, and SP:P18783; identified by
FT                   sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53816"
FT                   /db_xref="GOA:Q88AW3"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AW3"
FT                   /protein_id="AAO53816.1"
FT                   /translation="MNASLSSMIVPAVLWALIVFSVLSWALLLIKSAQYVRQKSQNKQF
FT                   TKAFWSAPDLLTAAEHSAQYPGALARIANSGFEAMAVDESPRTTQQLAHTINRSDRLER
FT                   NLRQQIQKERRALESGQAILASIGSTAPFIGLFGTVWGIMEALQSIGLTGSASLEAVAG
FT                   PIGHALVATGVGIAVAVPAVLIYNFFLRRLKLAVADMDDFAHDFDALAQRSAFAVTRQP
FT                   IASKNGHAVREAS"
FT   gene            complement(296849..297670)
FT                   /locus_tag="PSPTO_0271"
FT                   /old_locus_tag="PSPTO0271"
FT   CDS_pept        complement(296849..297670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0271"
FT                   /old_locus_tag="PSPTO0271"
FT                   /product="tonB protein, putative"
FT                   /note="similar to SP:O34261; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53817"
FT                   /db_xref="GOA:Q88AW2"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AW2"
FT                   /protein_id="AAO53817.1"
FT                   /translation="MNDAVIMKAVPGPSPDITPTAWQGIPFTANTSRPGGLNKPQVMVL
FT                   IAASVLIHGVIWWYMQTAQPALPEVAPQVPEMTIELTSPTPPAPEPPPPEPPPPPPPPP
FT                   PPEPEQPVEDPDAVEPPPKPIEKPKVEKPKPVKKPEPVKKPTPPAPTPAAAPSPPAPPT
FT                   PAPAPAAPAAPPAPAKESAAVSGLASLGNPPPEYPGLALRRSWEGRVILRIKVLPNGRA
FT                   GSVEVTKSSGKPALDDAAVEAVRNWKFIPAKRGDTPIEGFATQTIDFKLPE"
FT   gene            complement(298850..300016)
FT                   /gene="iscS-1"
FT                   /locus_tag="PSPTO_0272"
FT                   /old_locus_tag="PSPTO0272"
FT   CDS_pept        complement(298850..300016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iscS-1"
FT                   /locus_tag="PSPTO_0272"
FT                   /old_locus_tag="PSPTO0272"
FT                   /product="cysteine desulfurase"
FT                   /note="similar to SP:P39171, GB:D90244, and PID:216809;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53818"
FT                   /db_xref="GOA:Q88AW1"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AW1"
FT                   /protein_id="AAO53818.1"
FT                   /translation="MNLPMTTPALYLDYAATTPVDEQVIEAMVACMGREGHFGNPASSG
FT                   HGYGQVARQAVELARRQVADAVGAPADTIVWTSGATESNNLAIKGIAHDSSAQRRHIIT
FT                   SVLEHKAVLDTVSTLERQGFPVTWLKPDAQGLIQPQAVQAALREDTLLVSLMLVNNELG
FT                   TLTDIARIGAIVREHGALFHVDAAQAVGKVKVDLASLAVDLMSFSAHKAYGPKGIGALY
FT                   VGPRAHSLLQAQIHGGGHEGGFRSGTLATHQIVGMGTAFALAISQAEAENRRIEELSCH
FT                   LREGLLALPDVQLNGSPEQRIPHTLNLCITRSGFTSSQLSHNLAVSSTSACNSASNAPS
FT                   HVLLALGMDSTKALASVRVSLGRYTTQADVERAVEVFSKALSAPAAFW"
FT   gene            300484..300954
FT                   /locus_tag="PSPTO_0273"
FT                   /old_locus_tag="PSPTO0273"
FT   CDS_pept        300484..300954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0273"
FT                   /old_locus_tag="PSPTO0273"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="similar to GP:15074813; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53819"
FT                   /db_xref="GOA:Q88AW0"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AW0"
FT                   /protein_id="AAO53819.1"
FT                   /translation="MDKFDRAILDILQTDCTRSVADIAERIGLGSTACWRRIQKLEESG
FT                   IIDRRVALLNPQQLNVSVSVFAAIRTNQHNAAWLEKFHAAVGELPEVVECYRMAGDTDY
FT                   MLRIVVADIAGYDAVYKQLISIPGISDVSSSFAMEQIKFTTGLPLQYASFGG"
FT   gene            301038..301292
FT                   /locus_tag="PSPTO_0274"
FT                   /old_locus_tag="PSPTO0274"
FT   CDS_pept        301038..301292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0274"
FT                   /old_locus_tag="PSPTO0274"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53820"
FT                   /db_xref="GOA:Q88AV9"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AV9"
FT                   /protein_id="AAO53820.1"
FT                   /translation="MTTDPILTNTVPKEDPASARLGQYDREADPVLAMNANKPGAGAKK
FT                   GDEVKARTEEDEAYEDDEPEVYSDDPDIVADEGGGVSPG"
FT   gene            complement(301329..302462)
FT                   /locus_tag="PSPTO_0275"
FT                   /old_locus_tag="PSPTO0275"
FT   CDS_pept        complement(301329..302462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0275"
FT                   /old_locus_tag="PSPTO0275"
FT                   /product="DNA-binding protein"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to PFAM protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53821"
FT                   /db_xref="GOA:Q88AV8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AV8"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53821.1"
FT                   /translation="MSQAAFVNPSILTWSRERAGLSAAQVARKLPVKPERVEEWESGEA
FT                   RPTFLQAQKWASVAHVPFGFLFLLQPPVEQLPLPDLRTVGNSAPLRPSLELLDTVKDAI
FT                   RKQDWYLEYLHVQERQPLPFVGRFDSRTPVKTVVSDIRQTLGVDPEKSRLDYDKYSRAL
FT                   IDAAEVAGVLVMRSGIALGNTHRKLEVSEFRGFAISNPLAPVVFINSSDAPTARLFTLM
FT                   HELAHIWIGSSGVSDAGTANGREEERFCNAVAGEFLVPEALFRTVWSASIEWESNLATL
FT                   ATRFHVSKLVIGRRAMDLGYVTQEQYGAYYQKILKAFRDEKGGAEDYYRNATAKNSTRL
FT                   SKAVLTETLSGRMLLREAGNLLGVQPAKLRTLAAEHL"
FT   gene            complement(302698..303681)
FT                   /locus_tag="PSPTO_0276"
FT                   /old_locus_tag="PSPTO0276"
FT   CDS_pept        complement(302698..303681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0276"
FT                   /old_locus_tag="PSPTO0276"
FT                   /product="hydrolase, haloacid dehalogenase-like family"
FT                   /note="similar to GP:1518395; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53822"
FT                   /db_xref="GOA:Q88AV7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="PDB:3S6J"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AV7"
FT                   /protein_id="AAO53822.1"
FT                   /translation="MEAFALVSLGQRIYHTDSRSYRQRGSPIIRQTCLPPKRSNPQPIK
FT                   HSKTCDLKTRPFSLRLASPYLKPWLSPGIAAFPTPTLTCRRRLQTSPDGQPELKKSNPM
FT                   RPQTSFIFDLDGTLTDSVYQNVAAWKEALDAENIPLAMWRIHRKIGMSGGLMLKSLSRE
FT                   TGMSITDEQAERLSEKHAQAYERLQHQIIALPGAVELLETLDKENLKWCIATSGGIDTA
FT                   TINLKALKLDINKINIVTRDDVSYGKPDPDLFLAAAKKIGAPIDECLVIGDAIWDMLAA
FT                   RRCKATGVGLLSGGYDIGELERAGALRVYEDPLDLLNHLDEIASRP"
FT   gene            303927..304415
FT                   /locus_tag="PSPTO_0277"
FT                   /old_locus_tag="PSPTO0277"
FT   CDS_pept        303927..304415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0277"
FT                   /old_locus_tag="PSPTO0277"
FT                   /product="protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to PFAM protein family HMM PF04234"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53823"
FT                   /db_xref="GOA:Q88AV6"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AV6"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53823.1"
FT                   /translation="MKRTTLLVLALTVLSASLAQAAEQLKVSTNVKVDGKALPVQIDYV
FT                   ESGKQVIYTEHDSIEYVTSVTKGVERKKTRALGLSGKITPRLVKPEGTVRITGELSFVG
FT                   IDRMKTVKYGASDYQLPKFWSQLIALSPKKGNVGEAITLDHYSGSGHVLDVEVTVTRP"
FT   gene            complement(304528..304968)
FT                   /locus_tag="PSPTO_0278"
FT                   /old_locus_tag="PSPTO0278"
FT   CDS_pept        complement(304528..304968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0278"
FT                   /old_locus_tag="PSPTO0278"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P42621, GB:L05186, GB:L13616, SP:Q05397, and PID:439875;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53824"
FT                   /db_xref="GOA:Q88AV5"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AV5"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53824.1"
FT                   /translation="MVFCRGCAKEISDDAGTCPHCGAPQLIISSASANKEAPASGNWYF
FT                   EVLKKYAVFTGRARRKEYWMFFLFNVLISIVIGVIGGLVGDGGILANLYSLAVLVPGIA
FT                   VGVRRLHDTDRSGWWLLVPIANLVFLVQEGHAGPNRFGPSPK"
FT   gene            complement(304985..305341)
FT                   /locus_tag="PSPTO_0279"
FT                   /old_locus_tag="PSPTO0279"
FT   CDS_pept        complement(304985..305341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0279"
FT                   /old_locus_tag="PSPTO0279"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:19915183; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53825"
FT                   /db_xref="GOA:Q88AV4"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AV4"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53825.1"
FT                   /translation="MAMVFCRGCAKEIHETALNCPQCGASQFPATPVKQLQENGSPWMA
FT                   ITSLVLGILCSLALFDDGEWDLETIVGLGMCSVAGLALGIVSINKKMPGYGIAIAGTVL
FT                   SAVSLLVFFGLIVN"
FT   gene            complement(305562..306266)
FT                   /locus_tag="PSPTO_0280"
FT                   /old_locus_tag="PSPTO0280"
FT   CDS_pept        complement(305562..306266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0280"
FT                   /old_locus_tag="PSPTO0280"
FT                   /product="methionine aminopeptidase, putative"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P19994; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53826"
FT                   /db_xref="GOA:Q88AV3"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AV3"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53826.1"
FT                   /translation="MASDLLLSVKPMIREGGSGAAIQSYVLTQFERYGWLPMLVGYKGY
FT                   TAAVPVSVNNQVGNVQPTDTPFPDAALVKVELVAASTQAHVAQVWTFATPNATQQQRQL
FT                   LATARSALRSGIDQVCAGERLFNVGQAIQKVLDANQAVAIHELSGYAMGQARIQKPQVL
FT                   GYKGNINDDTLMLPGQVLNVYVIAKAGAFGVRFQPPDFWTILTQDGADSVMLSAMVEVT
FT                   ADGHRLLSRLVD"
FT   gene            complement(306711..307076)
FT                   /locus_tag="PSPTO_0281"
FT                   /old_locus_tag="PSPTO0281"
FT   CDS_pept        complement(306711..307076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0281"
FT                   /old_locus_tag="PSPTO0281"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53827"
FT                   /db_xref="GOA:Q88AV2"
FT                   /db_xref="InterPro:IPR035616"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AV2"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53827.1"
FT                   /translation="MSKLAEFRQLEKHLAEQLQALEAMKGNEGLKKEIEFETKLRKLLE
FT                   HYGFSLKHIVNLLEPQGSASRQTSEKPAGTRKPRELKVYKNPKTGEVIETKGGNHRGLK
FT                   EWKAEHGSDVVEGWLKK"
FT   gene            complement(307260..307940)
FT                   /locus_tag="PSPTO_0282"
FT                   /old_locus_tag="PSPTO0282"
FT   CDS_pept        complement(307260..307940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0282"
FT                   /old_locus_tag="PSPTO0282"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to TIGR protein family HMM
FT                   TIGR00790"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53828"
FT                   /db_xref="GOA:Q88AV1"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AV1"
FT                   /protein_id="AAO53828.1"
FT                   /translation="MAGLLSGLPMTSALVMLFLSLEQGAVFASMAVPGALAGLAAIQAT
FT                   YLFYFLVTRRVSAVAGCVLALALYGATAFLMNLSGSLALSILFTLLMVALIIVATSKQT
FT                   PPAAAPYVALPRWVIPMRMLTATLLLLAITASATWLGPVVSGLLAPIPVIAWPLAVFVH
FT                   VQGGRYELAAIIRGNAIGAVGVLSFYLTLRYSLLQWGALLSITTAVLLAVVVTAVLARL
FT                   LAKR"
FT   gene            complement(308181..308624)
FT                   /locus_tag="PSPTO_0283"
FT                   /old_locus_tag="PSPTO0283"
FT   CDS_pept        complement(308181..308624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0283"
FT                   /old_locus_tag="PSPTO0283"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53829"
FT                   /db_xref="GOA:Q88AV0"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AV0"
FT                   /protein_id="AAO53829.1"
FT                   /translation="MRAPWYHSKKTPKPQPQRVKYRRPRRGSGVFPWSFTLKSFSKVVA
FT                   AAVCGLVLAGCTGTPMKTQQYDSNQYTVVGHSEASATGLMLFGLIPIRQNDRFVRAQNS
FT                   AIQAKGGDALINTQVQEKWFWAWVLNGYTTTVSGDVIKLKTAK"
FT   gene            308896..309108
FT                   /locus_tag="PSPTO_0284"
FT                   /old_locus_tag="PSPTO0284"
FT   CDS_pept        308896..309108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0284"
FT                   /old_locus_tag="PSPTO0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GP:14524342, and GP:3822047; identified
FT                   by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53830"
FT                   /db_xref="GOA:Q88AU9"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AU9"
FT                   /protein_id="AAO53830.1"
FT                   /translation="MLLWGLGRKNWLFAGSLRSGKRAAAIMSLTQSARFNGHDPYAYLK
FT                   DVLTHLPTHRSSETGHLLPHNWKPV"
FT   gene            complement(309736..310818)
FT                   /locus_tag="PSPTO_0285"
FT                   /old_locus_tag="PSPTO0285"
FT   CDS_pept        complement(309736..310818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0285"
FT                   /old_locus_tag="PSPTO0285"
FT                   /product="conserved domain protein"
FT                   /note="similar to SP:Q07606; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53831"
FT                   /db_xref="GOA:Q88AU8"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AU8"
FT                   /protein_id="AAO53831.1"
FT                   /translation="MNAFDELVFAPMYVTSVDGRQAGVFHAHKGRRLIAAHRKAGTTPF
FT                   VGASRVNNSITGFADTPALFPGGWITLIYNGDGGTGHAKYQPAPFNASDDVIALEPISK
FT                   QATEPALLLIASMLTLQCVPKFGFGYKLTLHRLDRQKIMIPVLTNADGEQVVNWSGLTR
FT                   HGKRLLNEAKTRARAVRELTSTAKPKLPELNYMPMFITDVFESMNAAGKWFDFAKACLS
FT                   GKPFAPYIARSGGGNGVGSFVPHQGFAPPNAGNAITIGVSTSTVFYQPVPFYTSKEIQV
FT                   LRHHKLTADSGLILVALLREQMGKFQWGNGASLERLKATRIMVPAMVGADGEDVVDWDG
FT                   LSRYGRALRARVELAINAVL"
FT   gene            complement(310815..312821)
FT                   /locus_tag="PSPTO_0286"
FT                   /old_locus_tag="PSPTO0286"
FT                   /note="This region contains an authentic point mutation,
FT                   causing a premature stop, and is not the result of a
FT                   sequencing artifact; restriction enzyme BgcI alpha subunit,
FT                   putative, authentic point mutation; similar to SP:Q07605,
FT                   GB:X51417, SP:P11475, and PID:36611; identified by sequence
FT                   similarity; putative"
FT   gene            314157..315395
FT                   /locus_tag="PSPTO_0287"
FT                   /old_locus_tag="PSPTO0287"
FT   CDS_pept        314157..315395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0287"
FT                   /old_locus_tag="PSPTO0287"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:6166382; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53832"
FT                   /db_xref="GOA:Q88AU7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AU7"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53832.1"
FT                   /translation="MLSPCCHGQSMKTKITGKTISRIVPAEKVYRIHDTLQPGLSIRVL
FT                   PSGHASYMVTWARNKAATLGRVGVITLEQARTDASRYLADAHAIGEPVAITEKRTGAAM
FT                   PTLDHFLTHTFEPWAAEHHRDAKNGNRAIRHSFEALLSIPLSSIDTKRVEQIRTAWLRA
FT                   GLAPSTANRNITRLRGVLSRALEWGVLQEHPLKVRKLKVDDRSRVRYLSIEEETALREA
FT                   LEARSNEMRDARDSANKWRLERHKEPLADLRAVRYADHLEPLVVLSINTGVRRGEAFNL
FT                   TWADVDLKNKLITVEGDTSKSGQTRHVPLNREALDTLTKWKEQRGGNGFVFPGQHGKRL
FT                   DNVKKSWSGLLKLAKVERFRWHDLRHTFASKLVMAGVPLNTVRELLGHTDIKMTLRYAH
FT                   LAPGTKAAAVELI"
FT   gene            316071..316271
FT                   /locus_tag="PSPTO_0288"
FT                   /old_locus_tag="PSPTO0288"
FT   CDS_pept        316071..316271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0288"
FT                   /old_locus_tag="PSPTO0288"
FT                   /product="excisionase, putative"
FT                   /note="This gene assignment is based partly on its
FT                   proximity to an integrase gene, which might represent an
FT                   int-xis pair.; similar to GP:404799, and GP:5453491;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53833"
FT                   /db_xref="GOA:Q88AU6"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AU6"
FT                   /protein_id="AAO53833.1"
FT                   /translation="MSQLAVTPQLSVSVEEAARLVGHSRSGIYEVIASGDLKAFKLGKR
FT                   RLILMTELRAWIERAAKAGAR"
FT   gene            316268..316423
FT                   /locus_tag="PSPTO_0289"
FT                   /old_locus_tag="PSPTO0289"
FT   CDS_pept        316268..316423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0289"
FT                   /old_locus_tag="PSPTO0289"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53834"
FT                   /db_xref="GOA:Q88AU5"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AU5"
FT                   /protein_id="AAO53834.1"
FT                   /translation="MMAAIDGTTVKVALHDGEERFLCQIALPAATKVIDLEMLRKLGAW
FT                   RAKVVA"
FT   gene            316546..316782
FT                   /locus_tag="PSPTO_0290"
FT                   /old_locus_tag="PSPTO0290"
FT   CDS_pept        316546..316782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0290"
FT                   /old_locus_tag="PSPTO0290"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GP:17428886, and GP:17428886; identified
FT                   by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53835"
FT                   /db_xref="GOA:Q88AU4"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AU4"
FT                   /protein_id="AAO53835.1"
FT                   /translation="MTRHSSTEQDRKMIEALREGPISTIEAAQNLDIVQPPNTIRRLRN
FT                   RGFDIRTNWVWQATEPGRPPHRVAKYVLMREAS"
FT   gene            complement(316980..317789)
FT                   /locus_tag="PSPTO_0291"
FT                   /old_locus_tag="PSPTO0291"
FT   CDS_pept        complement(316980..317789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0291"
FT                   /old_locus_tag="PSPTO0291"
FT                   /product="ISPsy4, transposition helper protein"
FT                   /note="The annotation of this multicopy IS21 family element
FT                   is based in part on an HMM match, the ISFinder database,
FT                   and on positional information.; similar to GP:6009454, and
FT                   GP:17865161; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53836"
FT                   /db_xref="GOA:Q877S2"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q877S2"
FT                   /protein_id="AAO53836.1"
FT                   /translation="MNLQHARLTELCKGLKLERVGVDWPHLAQQAASGEDSFADFLEKL
FT                   LAAETDARSERSRQALLKTAALPAVKTLEQYDFAFATGVPRAQLQELAALSFVGRAENI
FT                   VFLGPSGVGKSHLAIALAYRAVMAGIKTRFVTAADLMLQLTAAHRQERLKEYFSRVVMA
FT                   PGLLVIDEIGYLPFGRDEANLFFNVVAKRYEQGSLILTSNLPFTQWAGTFADDQTLTAA
FT                   MLDRLLHHAHIVQMTGESYRLKDKRKAGTKSSRAEPARKYEPEGGQN"
FT   gene            complement(317786..318808)
FT                   /locus_tag="PSPTO_0292"
FT                   /old_locus_tag="PSPTO0292"
FT   CDS_pept        complement(317786..318808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0292"
FT                   /old_locus_tag="PSPTO0292"
FT                   /product="ISPsy4, transposase"
FT                   /note="The annotation of this multicopy IS21 family element
FT                   is based in part on an HMM match, the ISFinder database,
FT                   and on positional information.; similar to GP:11527916, and
FT                   GP:17865160; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53837"
FT                   /db_xref="GOA:Q877U4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q877U4"
FT                   /protein_id="AAO53837.1"
FT                   /translation="MLTQEQSVEIKVLARQGHGIKFIARELGISRNTVRKYLRKARSLP
FT                   SDKVRPARPCKIDPFKDYLHERIEAARPHWIPATVLLREITALGYSGGVSRLKAYIRPF
FT                   KRKAEEPVVRFETLPGKQIQVDFTTIRRGRQPLKAFVATLGFSRASFVRFSEREDSEAW
FT                   LTGLREAFAYFGGVPEQALFDNAGTIITERDAFGEGQHRWHPRLAALADEFGFIPKVCR
FT                   PYRAQTKGKVERFNGYLKGSFITPLAATLKSAGLTLDVVTANAHIGQWLDEVAHQRIHG
FT                   TTGVQPAVRLAQEQQVLLPLPTQSLRPQPAQGLRLGRVLPYESLQHPLSVYEQLLEVRA
FT                   "
FT   gene            319381..319689
FT                   /locus_tag="PSPTO_0293"
FT                   /old_locus_tag="PSPTO0293"
FT   CDS_pept        319381..319689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0293"
FT                   /old_locus_tag="PSPTO0293"
FT                   /product="protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53838"
FT                   /db_xref="GOA:Q88AU3"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AU3"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53838.1"
FT                   /translation="MGITLKKYQIRAAMKDHLIMPISIMRSRAWKGAPQYSRMVLVSFF
FT                   HQIWDARPRELRPDVDRDLPSQLKVRKALANLVERGLIVKTLTKPDRYALNFPPYDK"
FT   gene            319703..319903
FT                   /locus_tag="PSPTO_0294"
FT                   /old_locus_tag="PSPTO0294"
FT   CDS_pept        319703..319903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0294"
FT                   /old_locus_tag="PSPTO0294"
FT                   /product="protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53839"
FT                   /db_xref="GOA:Q88AU2"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AU2"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53839.1"
FT                   /translation="MSVIDCDYLPTAKVEFPPELALLIVRKAGAMATAFEEKALDQMTA
FT                   DARRALQRGVEPRVIARQMGL"
FT   gene            complement(320707..320928)
FT                   /locus_tag="PSPTO_0295"
FT                   /old_locus_tag="PSPTO0295"
FT   CDS_pept        complement(320707..320928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0295"
FT                   /old_locus_tag="PSPTO0295"
FT                   /product="protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53840"
FT                   /db_xref="GOA:Q88AU1"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AU1"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53840.1"
FT                   /translation="MQQYQKYTETVGNQDIIAETAVVLELLAFALAIIAMPGTTPIVSK
FT                   VLATLAQHTASSWAELLAQSSAVEGGAQ"
FT   gene            322507..322830
FT                   /locus_tag="PSPTO_0296"
FT                   /old_locus_tag="PSPTO0296"
FT   CDS_pept        322507..322830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0296"
FT                   /old_locus_tag="PSPTO0296"
FT                   /product="protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53841"
FT                   /db_xref="GOA:Q88AU0"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AU0"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53841.1"
FT                   /translation="MKKEVVSQPGAREFLERMNANTKGYADGGYVGSAASTSRVSSSSA
FT                   SVGLPTIEQNFYFQGGADENTAQQLKQAADDGASRGMRGGYEMMLRDLQRNGPAMQIIR
FT                   GKR"
FT   gene            322827..323117
FT                   /locus_tag="PSPTO_0297"
FT                   /old_locus_tag="PSPTO0297"
FT   CDS_pept        322827..323117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0297"
FT                   /old_locus_tag="PSPTO0297"
FT                   /product="protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53842"
FT                   /db_xref="GOA:Q88AT9"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AT9"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53842.1"
FT                   /translation="MKISDINMPELIEALSQALVPVIFKGMEAETPPHVWRERAQLNAD
FT                   VMGRFIAVIHCGEEVGPEVVELTEIFTKQMRESYAESFGTLLGPRGKFSVA"
FT   gene            323239..323856
FT                   /locus_tag="PSPTO_0298"
FT                   /old_locus_tag="PSPTO0298"
FT   CDS_pept        323239..323856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0298"
FT                   /old_locus_tag="PSPTO0298"
FT                   /product="resolvase, putative"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:15159448, and SP:P22996; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53843"
FT                   /db_xref="GOA:Q88AT8"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AT8"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53843.1"
FT                   /translation="MFIRAYLRASTDEQDAGRARASLEQFASDHNKVIASEYLENASGA
FT                   TADRPELLRLLKDARKGDVLLVESIDRLSRLPVDDWQKLKAAIDSKGLRIVALDLPTSH
FT                   QGMQDTKGDEFTARMLGAINSMLVEMMAAIARKDYEQRRERQAQGIEKAKAEGKYQGRP
FT                   VDADLHKRVKELLRAGLGIRATARHADCSTTTVLRIRESSGS"
FT   gene            complement(323982..324058)
FT                   /gene="tRNA-Arg-1"
FT                   /locus_tag="PSPTO_t01"
FT                   /old_locus_tag="PSPTOt01"
FT   tRNA            complement(323982..324058)
FT                   /gene="tRNA-Arg-1"
FT                   /locus_tag="PSPTO_t01"
FT                   /old_locus_tag="PSPTOt01"
FT                   /product="tRNA-Arg"
FT                   /note="codon recognized: CGG"
FT   gene            324439..325494
FT                   /locus_tag="PSPTO_0299"
FT                   /old_locus_tag="PSPTO0299"
FT   CDS_pept        324439..325494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0299"
FT                   /old_locus_tag="PSPTO0299"
FT                   /product="monooxygenase"
FT                   /note="similar to GP:5763911; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53844"
FT                   /db_xref="GOA:Q88AT7"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AT7"
FT                   /protein_id="AAO53844.1"
FT                   /translation="MDVRGAAREVLRLMGLEQAVKDLNTGETGLAWVDEDNRTAAQIDL
FT                   SGLDGDGPTAELEVLRGDLARLLYEASSADAFYRFAYRIVSVVHDDAGVSVTFENGDEE
FT                   RFDLLIIAEGVGSRTRELVFPGENQPRRMDMACAFFTVPRAPTDSQTARWYNAVGGRSA
FT                   GVRPDNRGTTRAFFNVHGRSHLGVGNSIAEQKAFLRSSFDGAGWEVPRLLAGMEAAEDF
FT                   WFDDLRQVKIDRWSNGPVVLLGDAAWCVTPLGGVGASLALIGAYVLAGELTKTDSIAAA
FT                   LAAYEYVLRPVVKKSQSVPRLVPRLVHPRSRTGVRILRAVQRLVATPFISKRAARALTP
FT                   AVQSFTLPDYR"
FT   gene            325765..327207
FT                   /gene="gabD-2"
FT                   /locus_tag="PSPTO_0300"
FT                   /old_locus_tag="PSPTO0300"
FT   CDS_pept        325765..327207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD-2"
FT                   /locus_tag="PSPTO_0300"
FT                   /old_locus_tag="PSPTO0300"
FT                   /product="succinate-semialdehyde dehydrogenase"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53845"
FT                   /db_xref="GOA:Q88AT6"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AT6"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53845.1"
FT                   /translation="MQLKDSTLFRQQAYINGQWLDADGGQSIKVNNPATNEILGTVPKM
FT                   GAAETRRAIEAADKALPAWRALTAKERGNKLRRWFELMIENQDDLGLLMTLEQGKPLAE
FT                   AKGEITYAASFIEWFAEEAKRVYGDVIPGHQPDKRLIVLKQPIGVTAAITPWNFPAAMI
FT                   TRKAGPALAAGCTMVLKPASQTPFSALALAELAERAGIPAGVFSVVTGSAGDIGSELTG
FT                   NPIVRKLSFTGSTEIGRQLMAECAKDIKKVSLELGGNAPFIVFDDADLDKAVEGAMISK
FT                   YRNNGQTCVCANRIYVQDGVYDAFAEKLKVAVGKLKIGNGLEDGITTGPLIDEKAVAKV
FT                   KEHIADAVSKGATVLTGGNSLEGSFFEPTILVNVSKDAAVAREETFGPLAPLFRFKDEA
FT                   EAIALANDTEFGLASYFYAQNMSRVFRVAEALEYGMVGINTGLISNELAPFGGIKSSGL
FT                   GREGSKYGIEDYLEIKYLCLSV"
FT   gene            327391..328671
FT                   /gene="gabT-2"
FT                   /locus_tag="PSPTO_0301"
FT                   /old_locus_tag="PSPTO0301"
FT   CDS_pept        327391..328671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabT-2"
FT                   /locus_tag="PSPTO_0301"
FT                   /old_locus_tag="PSPTO0301"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53846"
FT                   /db_xref="GOA:Q88AT5"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AT5"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53846.1"
FT                   /translation="MSQTNESLMQRRHAAVPRGVGQIHPIFAASAKNATVTDVEGREFI
FT                   DFAGGIAVLNTGHLHPKIVAAVQEQLTKLTHTCFQVLAYEPYVELCEKINAKVPGDFDK
FT                   KTLLVTTGSEAVENAVKIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVVPYSAGMGLM
FT                   PGGIFRALYPCELHGVSVDDSIASIERIFKNDAEPRDIAAIIIEPVQGEGGFYVAPKAF
FT                   MLRLRELCDKHGILLIADEVQTGAGRTGTFFAMEQMGVAADLTTFAKSIAGGFPLAGVC
FT                   GKAEYMDAIAPGGLGGTYAGSPVACAAALAVLDIFEEEHLLERCKTVGERLVTALKGMQ
FT                   AKYPVIGEVRALGAMIAVELFEDGDSHKPNAAAVAQVVAKARDKGLILLSCGTYGNVLR
FT                   VLVPLTAEEELLTRGLAILDECFAEIA"
FT   gene            328701..328877
FT                   /locus_tag="PSPTO_0302"
FT                   /old_locus_tag="PSPTO0302"
FT   CDS_pept        328701..328877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0302"
FT                   /old_locus_tag="PSPTO0302"
FT                   /product="protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53847"
FT                   /db_xref="GOA:Q88AT4"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AT4"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53847.1"
FT                   /translation="MTKRTKKARFDGFFFVWSKVFHSFGYIRANALAKVNASMSESHDD
FT                   CCSFTRGTSRLDC"
FT   gene            328831..330219
FT                   /locus_tag="PSPTO_0303"
FT                   /old_locus_tag="PSPTO0303"
FT   CDS_pept        328831..330219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0303"
FT                   /old_locus_tag="PSPTO0303"
FT                   /product="response regulator"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53848"
FT                   /db_xref="GOA:Q88AT3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AT3"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53848.1"
FT                   /translation="MTAVVLPAVPRVLIAESDPWVRETLSDLVLGVRADVELEMCTDGK
FT                   QAVEWMKKQLPDLVIAARELPGIDGLSLLRGVRNLRRQPVIPFILISSRSDSASVREVL
FT                   PLAPTAYLTKPLNTEGLRQRLESLLLEHRAPAPGEVPALTPGLTLTKFLDKRRDVADGA
FT                   PLFVDVATAVKLSQTANGIDVALLEQELRNDPHITAVLIAAANSAAQHLGKPVQTMGGA
FT                   LGILGPVQGANIASGLAKKRMAVLTDDALLAQAHEFWTMSQRTADYARILGGMLELDVE
FT                   RCFCAGLLQSLGDLAVLGCLQEWLLAGGVLNEEVIKQSLEQYSAAFGSALRTRWRLPLE
FT                   LRELIAAVYQYNTGIFTREVLAMNLAGQMARLGEEESVTPLIKTKSAKLLKLSVGDLQR
FT                   LRKKLTGVTDPSLLIPLPVEPEAVADAVEEDEHDLLDLTPEAPIQEPAALEDPGDAVQG
FT                   VTKK"
FT   gene            complement(330437..331435)
FT                   /locus_tag="PSPTO_0304"
FT                   /old_locus_tag="PSPTO0304"
FT   CDS_pept        complement(330437..331435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0304"
FT                   /old_locus_tag="PSPTO0304"
FT                   /product="sensory box/GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53849"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AT2"
FT                   /protein_id="AAO53849.1"
FT                   /translation="MEKQSPTALPGTPITDMPAAAETLLALMHAQAEVARLSEREQLFS
FT                   SLLVSVNAVLWAFDWETQRMIYVSPAYEHIFGRSAGLLLADYSEWRDSIYPDDLNYAER
FT                   SLSEVIEKGAVEDREYRIIRADGEVRWLSDKCFVSHRADASQRLIVVGIAEDITDKKHL
FT                   EDELQRLATTDVLTQSSNRRHFFECAQREFELARLNGTPLAFLLLDIDDFKLVNDTYGH
FT                   QEGDTVLQRIAESGRSALRRGDLFGRIGGEEFAAVFPGCAPEMAMQIAERLQREIQRQN
FT                   FQANGSTFSITASQGLTNLGPEDQGLEALYGRADAAMYQAKRQGKNQIVLV"
FT   gene            complement(331569..332807)
FT                   /locus_tag="PSPTO_0305"
FT                   /old_locus_tag="PSPTO0305"
FT   CDS_pept        complement(331569..332807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0305"
FT                   /old_locus_tag="PSPTO0305"
FT                   /product="fatty acid desaturase"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53850"
FT                   /db_xref="GOA:Q88AT1"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AT1"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53850.1"
FT                   /translation="MLIATFFFTSHFSRAKQPMWYNGLLDLSVWQVIAVTLAMTHVTIV
FT                   GVTVYLHRYSAHRSLELNAGLKHFFRFWLWLTTAQNTREWTAIHRKHHAKCETVDDPHS
FT                   PVVKGLSTVLRKGAELYREEAQNQDTLRIYGKNCPEDWIERNLYSRYKMLGIVLMAVID
FT                   LALFGAIGITVWAIQMMWIPFWAAGVVNGLGHAVGYRNFECRDAATNLVPWGIVIGGEE
FT                   LHNNHHTYPNSAKLSVKPWEFDMGWAWIKLFSFLRLAKVQRVAPIAHRVEGKGHIDMDT
FT                   AMAILNNRFQIMAQYRKLVIAPLVTQELAKADESVRHQFRRAKRLLSRETSLLDDKHHL
FT                   RIQTMLEHSHALKVIYEKRLALQQIWVKTSSNGHDMLSAMKEWIHEAEASGIQSLREFA
FT                   DQLKTYSLRPVHA"
FT   gene            332910..334841
FT                   /locus_tag="PSPTO_0306"
FT                   /old_locus_tag="PSPTO0306"
FT   CDS_pept        332910..334841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0306"
FT                   /old_locus_tag="PSPTO0306"
FT                   /product="sensory box/GGDEF domain/EAL domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53851"
FT                   /db_xref="GOA:Q88AT0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AT0"
FT                   /protein_id="AAO53851.1"
FT                   /translation="MSDYSRDALRTAVLYGLLSILWFMACDILLPLFVDEPARLAFCHQ
FT                   MAGYAWVLLSAVTIFVARDRLRKIIGGEAHFERQQDDYDRLRLAEAVFDSTREGVLVSD
FT                   AQGRIVHVNRAFVDITGYQAEEVLGFNPSTFKSGRHGPEFYRQMYHSLLSVGQWSGEIW
FT                   NRRKSGEIYPQWQTIRSVMGDDGQLKHFVAVFSDITAIKRSERELAQLIHFDALTDLPN
FT                   RLLLTDRISQALTSARASKRGCALLLIDLDHFKNINDSLGHNVGDDVLKAVAERLKGLC
FT                   GNETTLARPGGDEFALLVKNCSQVVRAAALAQQVSEVLKAPFVIAAHQLFVTASMGISL
FT                   YPGDAQSAEQLLRNADSALFKAKSEGRDCYALYTEELTAHAQQRVQLAGELRQAIEQGE
FT                   LRVFYQPVHDLITRSVCGVEALVRWQHPTRGMVSPGEFIPIAEQNGLIADIDAWVLNTA
FT                   CRQMRAWLTEGVPIAFVAVNVSSRLFSRGDLDRQVAQVLHDIGLDPAFLELEVTESAVM
FT                   EDPEQAIEQLHRLRELGLSLAIDDFGTGYSSLLRLKRMPVQKLKIDQGFVAGLPGDGDD
FT                   IAIVRAVIALGASLGMRVLAEGIEQASQAAFLLENGCQLGQGYWFARPMAAHLIDWSHA
FT                   PVFGPGAS"
FT   gene            335032..335214
FT                   /locus_tag="PSPTO_0307"
FT                   /old_locus_tag="PSPTO0307"
FT   CDS_pept        335032..335214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0307"
FT                   /old_locus_tag="PSPTO0307"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P33159, GB:X68014, and PID:40807; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53852"
FT                   /db_xref="GOA:Q88AS9"
FT                   /db_xref="InterPro:IPR018743"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AS9"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53852.1"
FT                   /translation="MSASLRSVDGQDEAAILREIQSALRDLRFGAVEITVHNAQVVQIE
FT                   RKEKFRLQNPAAKQS"
FT   gene            335361..336377
FT                   /gene="sbp"
FT                   /locus_tag="PSPTO_0308"
FT                   /old_locus_tag="PSPTO0308"
FT   CDS_pept        335361..336377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbp"
FT                   /locus_tag="PSPTO_0308"
FT                   /old_locus_tag="PSPTO0308"
FT                   /product="sulfate-binding protein"
FT                   /note="similar to SP:P06997, GB:M25322, GB:M60218,
FT                   GB:M60219, GB:M60222, GB:M60223, GB:M60224, GB:M60225,
FT                   GB:M60226, GB:M60227, GB:M60228, GB:M60229, GB:M60230,
FT                   GB:M60231, GB:M60232, GB:M60233, GB:M60234, GB:M60235,
FT                   SP:P16109, PID:183389, and PID:183391; identified by
FT                   sequence similarity; putative; see PMID:20190049 for
FT                   expression data; similar to SP:P06997, GB:M25322,
FT                   GB:M60218, GB:M60219, GB:M60222, GB:M60223, GB:M60224,
FT                   GB:M60225, GB:M60226, GB:M60227, GB:M60228, GB:M60229,
FT                   GB:M60230, GB:M60231, GB:M60232, GB:M60233, GB:M60234,
FT                   GB:M60235, SP:P16109, PID:183389, and PID:183391,
FT                   identified by sequence similarity, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53853"
FT                   /db_xref="GOA:Q88AS8"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AS8"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53853.1"
FT                   /translation="MSIRRFALAALASAVFAGSAVAKDYELLNVSYDPTRELYQDYNAE
FT                   FVNFWKKSHPDDTVKINQSHGGSGKQARGVIDGLRADVVTLALAGDIDEIAKLGKTLPE
FT                   NWQTRLPDASTPYTSTIVFLVRKGNPKGIKDWGDLIKKDVSVITPNPKTSGGARWNFLA
FT                   AWAYGLKAGGGDEAKAKEYVQTLFKHVPILDTGARGSTITFVNNGQGDVLLAWENEAFL
FT                   AQNEDGGKGKDKFDIVVPSLSILAEPPVAVVDKNAEKKGNTEIATEYLKHLYSKEGQEI
FT                   AAKNYYRPRNAEVAAKYEKQFPKLDLVTIDKDFGGWKTAQPKFFNDGGVFDQIYQAQ"
FT   gene            336472..337293
FT                   /gene="cysT"
FT                   /locus_tag="PSPTO_0309"
FT                   /old_locus_tag="PSPTO0309"
FT   CDS_pept        336472..337293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysT"
FT                   /locus_tag="PSPTO_0309"
FT                   /old_locus_tag="PSPTO0309"
FT                   /product="sulfate ABC transporter, permease protein CysT"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53854"
FT                   /db_xref="GOA:Q88AS7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AS7"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53854.1"
FT                   /translation="MSRRISPVIPGFGLTLGYTLVYLSLIVLLPLAAMFIHAAQLTWDQ
FT                   FWTIITAPRVIAALKLSFGTAFYAALINGVIGTLLAWVLVRYTFPGRKIIDAMIDLPFA
FT                   LPTAVAGIALTALYAPNGWVGQFAADLGFKIAYTPLGITLALTFVTLPFVVRTVQPVLA
FT                   DIPREVEEAAACLGARPLQVFRHILVPALLPAWLTGFALAFARGVGEYGSVIFIAGNMP
FT                   MKTEILPLLIMVKLDQYDYTGATAIGVMMLVVSFILLLLINLLQRRIETPS"
FT   gene            337307..338179
FT                   /locus_tag="PSPTO_0310"
FT                   /old_locus_tag="PSPTO0310"
FT   CDS_pept        337307..338179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0310"
FT                   /old_locus_tag="PSPTO0310"
FT                   /product="sulfate ABC transporter, permease protein CysW"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53855"
FT                   /db_xref="GOA:Q88AS6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AS6"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53855.1"
FT                   /translation="MSYSSVSAAASANAARRGSAVSRRILIGLCWLVFVLFLGLPLFIV
FT                   VSQGLKNGLGAFFTAILEPDALSALKLTVIAVLISVPLNVVFGVSAAWCVSKYSFRGKS
FT                   ILVTLIDLPFSVSPVIAGLVYVLMFGAQGLFGPWLQDHDIQIVFALPGIVLATIFVTVP
FT                   FVARELIPLMQEQGTQEEEAARLLGANGWQMFWHVTVPNIKWGLIYGVVLCTARAMGEF
FT                   GAVSVVSGHIRGVTNTLPLHVEILYNEYNHVAAFAVASLLLILALFILLLKQWSESRIN
FT                   RLRHNAAEE"
FT   gene            338182..339162
FT                   /gene="cysA"
FT                   /locus_tag="PSPTO_0311"
FT                   /old_locus_tag="PSPTO0311"
FT   CDS_pept        338182..339162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysA"
FT                   /locus_tag="PSPTO_0311"
FT                   /old_locus_tag="PSPTO0311"
FT                   /product="sulfate ABC transporter, ATP-binding protein
FT                   CysA"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53856"
FT                   /db_xref="GOA:Q88AS5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR014769"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR024765"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88AS5"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53856.1"
FT                   /translation="MSIEVRNVSKNFNAFKALNNISLDIQSGELVALLGPSGCGKTTLL
FT                   RIIAGLETPDDGSIVFHGEDVSGHDVRDRNVGFVFQHYALFRHMTVFDNVAFGLRMKPK
FT                   SERPNETRIAEKVHELLNMVQLDWLADRYPEQLSGGQRQRIALARALAVEPKVLLLDEP
FT                   FGALDAKVRKELRRWLARLHEDINLTSVFVTHDQEEAMEVADRIVVMNKGVIEQIGSPG
FT                   EVYENPSNDFVYHFLGDSNRLSLGDEGHVLFRPHEVSLSRQEIEDHHAAEVRDIRPLGA
FT                   TTRVTLKVEGQNELIEAEVVKDHDSLVGLAKGETLFFKPKVWQKL"
FT   gene            complement(339425..339949)
FT                   /locus_tag="PSPTO_0312"
FT                   /old_locus_tag="PSPTO0312"
FT   CDS_pept        complement(339425..339949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0312"
FT                   /old_locus_tag="PSPTO0312"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:5091483, and GP:5091483; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53857"
FT                   /db_xref="GOA:Q88AS4"
FT                   /db_xref="InterPro:IPR009305"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AS4"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53857.1"
FT                   /translation="MKTLVDHLSQYASYHRDSRNILTHFVGIPLIVLAVAVLLSRPGWN
FT                   ISGLWISPAALLALGSTVFYLRLDKALGAVMAVLLALCIWAGANLAQQATMAWLSAGVG
FT                   LFVIGWIIQFIGHYYEGRKPAFIDDLTGLIIGPLFVVAELAFLMGLRKTLQHAIEERSG
FT                   PVGRNARKAAV"
FT   gene            340034..340738
FT                   /locus_tag="PSPTO_0313"
FT                   /old_locus_tag="PSPTO0313"
FT   CDS_pept        340034..340738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0313"
FT                   /old_locus_tag="PSPTO0313"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="similar to GP:5139625; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53858"
FT                   /db_xref="GOA:Q88AS3"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AS3"
FT                   /protein_id="AAO53858.1"
FT                   /translation="MTNGVLWRSSLLSDYWFSHLPAALQDSVLHAARQVRKTPGKMLFE
FT                   KGAAPCGLYALLEGDVRIGGAHFQRLGPRLEPIRRPYWFGEVSLFDEMPRRFDVCSLEQ
FT                   TIFLQVPHSFLVSLLDRHPEYWRHFAALLSQKLGLPLQNPEKLQLLPPRSRVASRLLLL
FT                   SEGYGPLSHARRLITLDEVTSLQDLSHSALLEVLEDLHERKVVRLGIGQLEVFDVDKLR
FT                   KIANFSRARAVC"
FT   gene            340857..341858
FT                   /locus_tag="PSPTO_0314"
FT                   /old_locus_tag="PSPTO0314"
FT   CDS_pept        340857..341858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0314"
FT                   /old_locus_tag="PSPTO0314"
FT                   /product="iron ABC transporter, periplasmic iron-binding
FT                   protein"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53859"
FT                   /db_xref="GOA:Q88AS2"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AS2"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53859.1"
FT                   /translation="MQASKRLLAALTLTLLGSAAQAADEVVVYSSRIDELIKPVFDAYT
FT                   AKTGVKIKFITDKEAPLMQRIKAEGENATADLLLTVDAGNLWQAEQMGILQPFTSPVIE
FT                   ANIPPQYRSSTHGWTGLSLRARTIAYSTDRVKPVELTTYEALADKNWEGRLCLRTAKKV
FT                   YNQSLTATLIETHGAEASEKILKGWVNNLSTDVFSDDIAVLEAINAGQCDVGIVNTYYY
FT                   GRLHKQNPDLAVKLFWPNQADRGVHVNLSGIGLTKHAPHPQAAKALVEWMTGPEAQKIF
FT                   SSVNQEFPANPNVAPSEEVASWGQFKADTIPVEVAGKRQAEAIRMMDRAGWN"
FT   gene            342066..343682
FT                   /locus_tag="PSPTO_0315"
FT                   /old_locus_tag="PSPTO0315"
FT   CDS_pept        342066..343682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0315"
FT                   /old_locus_tag="PSPTO0315"
FT                   /product="iron ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53860"
FT                   /db_xref="GOA:Q88AS1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AS1"
FT                   /protein_id="AAO53860.1"
FT                   /translation="MAHPVQRRWYPLVFAIAALVLLPLSVLLLSWETIDTQIWSHLLET
FT                   QMARLLSNTLILLLGVGVGVTLLGVSLAWLTSLCEFPGRRWLDWALMLPFAIPAYVLAF
FT                   VFVGLLDFSGPVQTLMREWFGAGLRLPRVRSTGGVIIVLVLVFYPYVYLLARTAFLAQG
FT                   KGLMEAARVLGNSPWQAFWRVALPMARPAIGAGVALALMETLADFGAVSVFNFDTFTTA
FT                   IYKTWYGFFSLSSAAQLASLLLLAVLILLYGERRARGASRPGNERPRATALYTLHGVKA
FT                   WSASLWCGLVFLCAFVVPVLQLIVWVWQRGRFDLDERYTGLILHTLYLGGMAALITVSV
FT                   AMILAFARRMAPTPAIRSGVSLANLGYALPGSVLAVSIMLAFSYLDRVLVVPLSGWLGG
FT                   AGKPLLLGSLSALLLAYLVRFIAVAFGPLEHSLSRIRPSLPEAARSLGVSGPKLFLNVY
FT                   LPLLIPGALSAALLVFVDVLKEMPATLLMRPFGWDTLAVRIFEMTSEGEWARAALPALS
FT                   LVLVGLLPVIVLIRRSARQIG"
FT   gene            343836..344918
FT                   /gene="gcvT-1"
FT                   /locus_tag="PSPTO_0316"
FT                   /old_locus_tag="PSPTO0316"
FT   CDS_pept        343836..344918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvT-1"
FT                   /locus_tag="PSPTO_0316"
FT                   /old_locus_tag="PSPTO0316"
FT                   /product="glycine cleavage system T protein"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to PFAM protein family HMM PF01571"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53861"
FT                   /db_xref="GOA:Q88AS0"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88AS0"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53861.1"
FT                   /translation="MGQRTPLFDLHLALGAKMVDFGGWDMPLHYGSQVEEHHQVRRDCG
FT                   VFDVSHMNVIDVLGREAKAWLRRLLANDVDKLKTPGRALYSAMLDEQAGVIDDMIVYLT
FT                   ADGYRLVVNAATGAKDLAWMQSQLGDFDVQLLARSEMAMLAIQGPQARNRIAQLVSSAR
FT                   AELIRQLKPFEGLDDGDWFIARTGYTGEDGLEIMLPADEAQRFFNELVGAGISPIGLGA
FT                   RDTLRLEAGMNLYGQDIGEHVSPLASNMAWSIAWEPAERDFIGRQALESERAEGTAFKL
FT                   VGLVLEERGVLRAHQVVRVAEIGEGEITSGSFSPTLSKSIALARVPMATADRAEVEIRG
FT                   KWYPVRVVQPAFVRHGKTLI"
FT   gene            344962..345348
FT                   /gene="gcvH-1"
FT                   /locus_tag="PSPTO_0317"
FT                   /old_locus_tag="PSPTO0317"
FT   CDS_pept        344962..345348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvH-1"
FT                   /locus_tag="PSPTO_0317"
FT                   /old_locus_tag="PSPTO0317"
FT                   /product="glycine cleavage system H protein"
FT                   /note="identified by match to PFAM protein family HMM
FT                   PF01597; see PMID:20190049 for expression data; identified
FT                   by match to PFAM protein family HMM PF01597"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53862"
FT                   /db_xref="GOA:Q88AR9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88AR9"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53862.1"
FT                   /translation="MSNIPAELRFAESHEWARLEADGTVTVGISDHAQEALGDVVFVEL
FT                   PEIGKVFAAGDVAGVVESVKAASDIYSPVAGEVVEVNEALGDSPESLNSEPYSAWIFKV
FT                   KPASAEADLAKLLDAAGYKGAIGE"
FT   gene            complement(345431..345751)
FT                   /locus_tag="PSPTO_0318"
FT                   /old_locus_tag="PSPTO0318"
FT   CDS_pept        complement(345431..345751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0318"
FT                   /old_locus_tag="PSPTO0318"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53863"
FT                   /db_xref="GOA:Q88AR8"
FT                   /db_xref="InterPro:IPR012661"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AR8"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53863.1"
FT                   /translation="MRLKFAVATVALLSIPMGSAMADTFWRNVLSSGATTGSSYLTFKD
FT                   HKLIVAAQDDAGSYVASNGDIRGPFLEAAIQQVRIDNPGLKATDMELANAILEKNLVAE
FT                   SQ"
FT   gene            complement(345891..347675)
FT                   /locus_tag="PSPTO_0319"
FT                   /old_locus_tag="PSPTO0319"
FT   CDS_pept        complement(345891..347675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0319"
FT                   /old_locus_tag="PSPTO0319"
FT                   /product="type IV pilus biogenesis protein"
FT                   /note="similar to GB:D26185, SP:P37437, PID:467335, and
FT                   GB:AL009126; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53864"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AR7"
FT                   /protein_id="AAO53864.1"
FT                   /translation="MAALAPSSQDRWLDLNDVLRELVTEGYLSQDDTETALSQRRSAVN
FT                   IQLHPLEFLASQQFDDLKRPGKKLDLETLTAWLAKASGQPYMRIDPLKINVAAVTPLMS
FT                   YAFAQRHKILAVAVDRESVTIASAQPYVRSWEADLAHVLKLQIKRVVANPTDIQRMAME
FT                   FFRLAKSVSGANASEQKMSNMGNFEQLLKLGASDQEPDANDAHIVNIVDWLFQYAFQQR
FT                   ASDIHIEPRREQGTVRFRIDGVLHNVYQFPAQVIMAIVSRLKSLGRMNVAEKRKPQDGR
FT                   VKTTTPENREVELRLSTLPTAFGEKMVMRIFDPEVLLKDFDQLGFSSDDLRRWQEMTRQ
FT                   PNGIILVTGPTGSGKTTTLYTTLKKLATSEVNLCTIEDPIEMVEPAFNQMQVQHNIDLS
FT                   FAAGVRALMRQDPDIIMIGEIRDLETAEMAIQAALTGHLVLSTLHTNDAPSAISRMLEL
FT                   GVPHYLLKATILGVMAQRLVRTLCPHCKAPINLNETDWQTLTRPWQAPVPPGAHQAVGC
FT                   VECRDTGYRGRAGVYEIMVMSDNIKALISADLDLTAMRRQAFKEGTRSLRLSGAQKVSA
FT                   GLTTLEEVLRVTPQSEQR"
FT   gene            complement(347786..348133)
FT                   /locus_tag="PSPTO_0320"
FT                   /old_locus_tag="PSPTO0320"
FT   CDS_pept        complement(347786..348133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0320"
FT                   /old_locus_tag="PSPTO0320"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53865"
FT                   /db_xref="GOA:Q88AR6"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AR6"
FT                   /protein_id="AAO53865.1"
FT                   /translation="MPNLEAVTAASQRPDNWSSSNAPCCARYQIVAEAEPALLCQVLNL
FT                   LAMQYLIPHQLTVVQQESTLIIDLHVARLSWHRAQVIGEKMRNLIDVCSVGVEQIDALN
FT                   TPQTHVALATG"
FT   gene            348259..348738
FT                   /locus_tag="PSPTO_0321"
FT                   /old_locus_tag="PSPTO0321"
FT   CDS_pept        348259..348738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0321"
FT                   /old_locus_tag="PSPTO0321"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to TIGR protein family HMM TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53866"
FT                   /db_xref="GOA:Q88AR5"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AR5"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53866.1"
FT                   /translation="MQIDLDMYDRKILALLQEDVSLSSAQIAEQVGLSQSPCWRRIQRL
FT                   KDEGVIRRQVALLDRKKIGLNTQIFAEVKLNAHGRSNFTEFTDAIRGFPEVLECYVLMG
FT                   SVDFLLRIVTPDIEAYERFFFEKLSLVPGIQEVNSTVALSEIKSTTSLPLLREGG"
FT   gene            complement(349816..351231)
FT                   /locus_tag="PSPTO_0322"
FT                   /old_locus_tag="PSPTO0322"
FT   CDS_pept        complement(349816..351231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0322"
FT                   /old_locus_tag="PSPTO0322"
FT                   /product="adenylate cyclase"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to PFAM protein family HMM PF01928"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53867"
FT                   /db_xref="GOA:Q88AR4"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR039013"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AR4"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53867.1"
FT                   /translation="MGCAPVISISVWIPPAMQKETEIKLRVSRETLAALREHPLLKKRN
FT                   KSGWERLELSNQYFDTPERELAHAKVALRIRRDGDQIIQTMKTRGQSVAGLSERNEYNW
FT                   DLTKAKLDLKKLEGDCWPEQLTELDKKSIKPLFTTDFIREKAEIAWGRGKTKVVIEAAL
FT                   DLGQVVAGKQKEEICELELELREGDPAALLELAAELAATLPLMPCDISKAERGYRLLDA
FT                   SSYSLSLPAPTLNAETPLDDAYSALAWHLLGSSQRLAEQYRFNGHWRLLQDWVEMLGEL
FT                   RALTSSLGQAAPRTSTAQLRTALDALLEDWRPLVQAGQEDADVRGAAHEQFLEELQDTR
FT                   WGEFSLNTSRWLLARSWTAERNTRGNRQGAALLSSWLPRLLGEEATSLQLSRYQQQPED
FT                   LAEQLPRIERIQAWLHWARGALDLPELDRLYGELRKLEELAHLDISDEILDARVQQAIT
FT                   VFQSRAWKTLLRL"
FT   gene            351346..352494
FT                   /gene="argE-2"
FT                   /locus_tag="PSPTO_0323"
FT                   /old_locus_tag="PSPTO0323"
FT   CDS_pept        351346..352494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argE-2"
FT                   /locus_tag="PSPTO_0323"
FT                   /old_locus_tag="PSPTO0323"
FT                   /product="acetylornithine deacetylase"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:8671268, and SP:P23908; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53868"
FT                   /db_xref="GOA:Q88AR3"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AR3"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53868.1"
FT                   /translation="MPLPSMKDQFAALIAAPSVSCTQPSLDQTNRPVIDLLAGWLGDLG
FT                   FACDIQQVSLGKFNLLATFGTGPGGLVLAGHSDTVPFDEALWKTDPLKLTEVDGRWVGL
FT                   GSCDMKGFFALVIEAVRGLVDQPFKQPLLILATCDEESSMAGARALAEAGRPLGRAAVI
FT                   GEPTGLKPIRMHKGVMMERIHILGRSGHSSDPSLGHSALEAMHDAISELKGLRTQWQLE
FT                   YRNPQFTVPQPTLNLGCIHGGDNPNRICGQCSLEFDLRPLPGMDPQVLRAAIRQKLQPL
FT                   AELHQVQIDYAPLFPECAPFEQVADAELVRVAERLTGHTAAAVAFGTEAPYLQRLGCET
FT                   LVLGPGDIACAHQPGEYLEMSRLDPTVRLLRQLIEHYCLTPQ"
FT   gene            352570..353916
FT                   /gene="argA"
FT                   /locus_tag="PSPTO_0324"
FT                   /old_locus_tag="PSPTO0324"
FT   CDS_pept        352570..353916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argA"
FT                   /locus_tag="PSPTO_0324"
FT                   /old_locus_tag="PSPTO0324"
FT                   /product="N-acetylglutamate synthase"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P08205, GB:M23419, GB:U17969, SP:P10159, PID:181997, and
FT                   PID:602245; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53869"
FT                   /db_xref="GOA:Q88AR2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR033719"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88AR2"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53869.1"
FT                   /translation="MRAFSFRPFFLQALVVMPEYVNWLRHASPYINAHRDCTFVVMLPG
FT                   DGVAHPNFGNIVHDLVLLHSLGVRLVLVHGSRPQIESRLAQRGITPRYHRDMRITDTET
FT                   LECVIDAVGQLRISIEARLSMDMAASPMQGSRLRVTSGNVVTARPIGVLEGIDYQHTGE
FT                   VRRVDRKGINRLLDERHIVLLSPLGYSPTGEIFNLACEDVATRAAIDLAADKLLLFGAE
FT                   TGLLDEQGRLVRELRPQQVPAHLQRLGGNYQAELLDAAAEACRGGVARSHIVSYAEDGA
FT                   LLTELFTRDGGGTLVAQEQFELVREAAIEDVGGLMDLITPLEEQGILVRRSREVLEREI
FT                   TQFSVVEREGLIIACAALYPIADSESGELACLAVNPEYRHGGRGDELLERIENRARALG
FT                   IKTLFVLTTRTAHWFRERGFEPSSVDRLPSARASLYNFQRNSKIFEKAI"
FT   gene            complement(354040..355629)
FT                   /gene="gshA"
FT                   /locus_tag="PSPTO_0325"
FT                   /old_locus_tag="PSPTO0325"
FT   CDS_pept        complement(354040..355629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshA"
FT                   /locus_tag="PSPTO_0325"
FT                   /old_locus_tag="PSPTO0325"
FT                   /product="glutamate--cysteine ligase"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53870"
FT                   /db_xref="GOA:Q88AR1"
FT                   /db_xref="InterPro:IPR006334"
FT                   /db_xref="InterPro:IPR007370"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88AR1"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53870.1"
FT                   /translation="MSELLNRRLALLGERNNLSLLEQCLHGIERECLRVTPQAELARTP
FT                   HPQALGAALTNGLVTTDYSESLLEFITPALKNPVDTLDSLDKIHRFAYSKLDNELLWSP
FT                   SMPCPLPDEEHIPIAYYGTSNIGKLKYVYRKGLALRYGKTMQCIAGIHYNFSLPEDAWA
FT                   LLKQTEDFAGDARDYQSHSYIALIRNFRRYSWLLMYLFGASPALDAGFLRGREHQLEQF
FT                   DADTLYLPYATSLRMSDLGYQSDAQADLTPCYNDLVSYTDSLRKAVATPYKPYVDIGTH
FT                   DQNGEWVQLNTNVLQIENEYYSNIRPKRVTYSGERPIQALVARGVQYVEVRCLDINPFL
FT                   PTGISLEQSRFIDAFVLYCALEESQQLAGHECSNASSNFLAVVKEGRRPGLNLQRDDSP
FT                   VELKAWATDLLEKITPIARLLDQAQGTDEHIKSIAVQQAKIDDTSLTPSAQVLASMRAH
FT                   GEGFTAFSLRQSQVHAEYFRTHPLSAAEQAHFEDLAKTSLEEQAELEATEEVVDFDTFV
FT                   GSYQASILSISN"
FT   gene            complement(355873..356256)
FT                   /locus_tag="PSPTO_0326"
FT                   /old_locus_tag="PSPTO0326"
FT   CDS_pept        complement(355873..356256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0326"
FT                   /old_locus_tag="PSPTO0326"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53871"
FT                   /db_xref="GOA:Q88AR0"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AR0"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53871.1"
FT                   /translation="MDIPEDLTQSAYFKMLGCELRRLDEGVAEVALPLEAHLRNRGNVM
FT                   HGGAIFSLVDISMGLACSSSHGFDQRSVTIECKINYVRGVSDGEVLCIANVLHAGRRTL
FT                   VVEAQVVQGDKLVAKAQGTFAVI"
FT   gene            complement(356256..358577)
FT                   /locus_tag="PSPTO_0327"
FT                   /old_locus_tag="PSPTO0327"
FT   CDS_pept        complement(356256..358577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0327"
FT                   /old_locus_tag="PSPTO0327"
FT                   /product="S1 RNA binding domain protein"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53872"
FT                   /db_xref="GOA:Q88AQ9"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AQ9"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53872.1"
FT                   /translation="MDSINSRIAEELGVRPQQVAAAVALLDEGSTVPFISRYRKEVTGS
FT                   LDDTQLRHLEERLRYLRELDDRRVSILASIEEQGKLTPELARDIKLADTKTRLEDLYLP
FT                   YKQKRRTKGQIALEAGLGELADGLFNDPSLTPDAEAARFVDAEKGVADVKAALEGAKYI
FT                   LMERFAEDASLLDKLRSFLKQEAVISARVVPGKEEEGSKFRDYFEHDEPLKSMPSHRAL
FT                   AIFRGRNEGFLSSALKVGEELPGAMHPCELMIGERFGIQNQSRAADKWLAEVVRWTWKV
FT                   KLYSHLETDLLGELREGAETEAINVFAHNLHDLLLAAPAGQRATLGLDPGLRTGCKVAV
FT                   VDATGKLLDYATVYPHVPKNQWDQTIAVLAALCAKHSVDLIAIGNGTASRETDKLAADL
FT                   IKKYPGLKMTKVMVSEAGASVYSASELAAKEFPDLDVSIRGAVSIARRLQDPLAELVKI
FT                   DPKSIGVGQYQHDVSQLKLARGLDAVVEDCVNAVGVDVNTASVALLARISGLNTTLAQN
FT                   IVAHRDENGAFKTRAALKKVSRLGEKTFEQAAGFLRVMTGDNPLDSSAVHPEAYPLVQR
FT                   IAAETDRDIRSLIGDASFLKRLDPKKFTDETFGLPTVTDILQELEKPGRDPRPEFKTAE
FT                   FQEGVEDLKDLQPGMILEGVVTNVTNFGAFVDIGVHQDGLVHISALSEKFIKDPREAVK
FT                   AGDVVKVKVMEIDIPRKRVGLSMRMSDTPGEKIDGARGARPGASPRQQNSAPRKETTAP
FT                   APANNAMASLFANAKQLKKR"
FT   gene            358877..359617
FT                   /gene="ompR"
FT                   /locus_tag="PSPTO_0328"
FT                   /old_locus_tag="PSPTO0328"
FT   CDS_pept        358877..359617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompR"
FT                   /locus_tag="PSPTO_0328"
FT                   /old_locus_tag="PSPTO0328"
FT                   /product="DNA-binding response regulator OmpR"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53873"
FT                   /db_xref="GOA:Q88AQ8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AQ8"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53873.1"
FT                   /translation="MSSTAQNAEGEKILIVDDDPGLSSLLERFFSSKGYRARAVANVEQ
FT                   MDRLLAREVFNLVVLDLMLPGEDGLSACRRLRAANNQVPIIMLTAKGDELSRIKGLELG
FT                   ADDYLAKPFNPDELMARVKAVLRRQAAPVPGAPGSEDESVSFGDYVLSLATRELKRGEE
FT                   VHMLTTGEFAVLKALVMHAREPLTRDKLMNLARGREWDALERSIDVQISRLRRLIEPDP
FT                   SKPRYIQTVWGVGYVFVPDGAGSR"
FT   gene            359769..361091
FT                   /gene="envZ"
FT                   /locus_tag="PSPTO_0329"
FT                   /old_locus_tag="PSPTO0329"
FT   CDS_pept        359769..361091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="envZ"
FT                   /locus_tag="PSPTO_0329"
FT                   /old_locus_tag="PSPTO0329"
FT                   /product="osmolarity sensor protein EnvZ"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53874"
FT                   /db_xref="GOA:Q88AQ7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AQ7"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53874.1"
FT                   /translation="MAAVMKTPLWFPQSFFSRTLWLVLIVVLFSKALTLVYLLMNEDVL
FT                   VDRQYSHGVALTLRAYWAADENDREAIAEAAGLIRVVGGGVPEGEQHWPYSEIYQRQMQ
FT                   AELGADTEVRLRVHAPPALWVRAPSLGDGWLKVPLYPHPLRGQKIWSVLGWFLAIGLLS
FT                   TASAWIFVRQLNQPLKRLVFAARQLGQGRSVRLPVSDTPSEMTEVYRAFNQMAEDVEQA
FT                   GQERELMLAGVSHDLRTPLTRLRLSLELMNDNEFSEGMVRDIEDMDAILDQFLAFIRDG
FT                   RDEEIEEVDLGDLVRDVVAPFNNAEGSIRLCLEPIPPFPLRRVSMKRLLTNLIGNARHH
FT                   AGNGIEVAAYVSGDRNAPYVVLSVLDRGAGIDPSELDTIFNPFIRGDRARSGKGTGLGL
FT                   AIVKRIAAMHGGNVELRNRSGGGLEARVRLPLGLMLPRDAI"
FT   gene            complement(361341..361808)
FT                   /locus_tag="PSPTO_0330"
FT                   /old_locus_tag="PSPTO0330"
FT   CDS_pept        complement(361341..361808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0330"
FT                   /old_locus_tag="PSPTO0330"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:Q9HT89; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53875"
FT                   /db_xref="GOA:Q88AQ6"
FT                   /db_xref="InterPro:IPR014453"
FT                   /db_xref="InterPro:IPR036501"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AQ6"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53875.1"
FT                   /translation="MHRSFRTLAAALLMGGSAIVMAANDGQSRVNELLSSAPEYRTTWA
FT                   KVVKKEERLPEWVLNLSGASEQQMTATSEDRDKYLVGPLCETADTCKSKRLIVAFSLDK
FT                   EDAYAMLVEVPAGLPADKSPTRHATYRYLGKPDEGMQKLLNEELRKDPNWY"
FT   gene            361787..362011
FT                   /locus_tag="PSPTO_0331"
FT                   /old_locus_tag="PSPTO0331"
FT   CDS_pept        361787..362011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0331"
FT                   /old_locus_tag="PSPTO0331"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53876"
FT                   /db_xref="GOA:Q88AQ5"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AQ5"
FT                   /protein_id="AAO53876.1"
FT                   /translation="MCETTCACSASTTTTEEERYNEHHQEHDEQDLGDTSSRTSDTAKA
FT                   QYCSDNGDDQKRDSPTQHGDTPFWCRFLM"
FT   gene            complement(362035..362322)
FT                   /locus_tag="PSPTO_0332"
FT                   /old_locus_tag="PSPTO0332"
FT   CDS_pept        complement(362035..362322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0332"
FT                   /old_locus_tag="PSPTO0332"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53877"
FT                   /db_xref="GOA:Q88AQ4"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AQ4"
FT                   /protein_id="AAO53877.1"
FT                   /translation="MNSQRIAQLRISPLHIQQGLFLLLALLVTLIAIQQFQRWNQASEA
FT                   TQARQQFIHASSMSFRGVSAPAVKDLSSSLRPVDGLVSVDEVAPQQKWVF"
FT   gene            complement(362552..363391)
FT                   /locus_tag="PSPTO_0333"
FT                   /old_locus_tag="PSPTO0333"
FT   CDS_pept        complement(362552..363391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0333"
FT                   /old_locus_tag="PSPTO0333"
FT                   /product="conserved domain protein"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P27291; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53878"
FT                   /db_xref="GOA:Q88AQ3"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AQ3"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53878.1"
FT                   /translation="MFSLKKIALVTAAAAMLGSGPVLAQPDLPAQLDEARQEGSIWTAF
FT                   ALNKHLSPFKIDVDVEQGTAILKGKVENEVDRELAERIALDTKGIEKVDNQLEIDPAVA
FT                   SDPGTRTNMAQRFEDATLVATVKSKLLWSSVTEALSIDVDSKDGVITLKGRAQSPEAKE
FT                   LAGSLASNTDGVVSVNNLISLSAADSIAAKTQPQSVIPTEEMSDAWITSKVKASLIYSR
FT                   TLDGLNIKVDTKAGVVSLNGVVANFAEKELAVEIARNIRGVKGVNGDALKVMARSAG"
FT   gene            363589..364935
FT                   /gene="algB"
FT                   /locus_tag="PSPTO_0334"
FT                   /old_locus_tag="PSPTO0334"
FT   CDS_pept        363589..364935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="algB"
FT                   /locus_tag="PSPTO_0334"
FT                   /old_locus_tag="PSPTO0334"
FT                   /product="alginate biosynthesis transcriptional regulatory
FT                   protein AlgB"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53879"
FT                   /db_xref="GOA:Q88AQ2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88AQ2"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53879.1"
FT                   /translation="MEAATENQGRILLVDDESAILRTFRYCLEDEGYSVATANSAAQAD
FT                   TLMQRQVFDLCFLDLRLGEDNGLDVLAQMRIQAPWMRVVIVTAHSAVDTAVDAIQAGAA
FT                   DYLVKPCSPDQLRLATAKQLEVRQLSARLEALEGEVRKPKDGLDSHSPSMMAILETARQ
FT                   VAVTDANILILGESGTGKGELARAIHGWSKRAKKSCVTINCPSLTAELMESELFGHSRG
FT                   AFTGASESTLGRVNQADGGTLFLDEIGDFPLTLQPKLLRFIQDKEYERVGDPVTRRADV
FT                   RILAATNLNLEDMVRSGRFREDLLYRLNVITLHLPALRERSEDILTLADRFLARFVKEY
FT                   ARPARGFSEEARAALLNYRWPGNIRELRNVIERASIICPQERVEVSHLGMAEQPANNAP
FT                   RVGAALSLDELEKAHIGAVLATSETLDQAAKTLGIDASTLYRKRKQYNL"
FT   gene            364946..366733
FT                   /locus_tag="PSPTO_0335"
FT                   /old_locus_tag="PSPTO0335"
FT   CDS_pept        364946..366733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0335"
FT                   /old_locus_tag="PSPTO0335"
FT                   /product="sensory box histidine kinase"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53880"
FT                   /db_xref="GOA:Q88AQ1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR031909"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038320"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AQ1"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53880.1"
FT                   /translation="MKLAMKLRTRLFLSISALITVALLGLLLGLVSVMQMARTQESLIQ
FT                   HNFAILDLGLKLRQNLGDQLVLMTGATRNPPELEKIQRQFEELLEEASAQDTQEDVRNG
FT                   LEGTWVDYRRFIDALKQFGTDPRGIRGNPQLSESFDSLRNGLLNVHRKALENISSAEIN
FT                   SRDRALWIAGLLGLVGLAVLCIGFVTAHGIARRFGAPIEALAKAADRIGEGDYEVTLPI
FT                   SSAAEMNLLTRRFGIMAEALRQHQATNVDELLAGQQRLQAVLDSIDDGLLMIDRQGHLE
FT                   HLNPVAQRQLGWDESRLGQSLGEALSRPELDEQLHLVLRGGTLERAPEDLAIDIDGESR
FT                   LLTYSMTPVSHTKGHILGAVMVLHDVTEQRAFERVRSEFVLRASHELRTPVTGMHMAFG
FT                   LLQERLHFAPESREADLLNTVTEEMQRLMQLINDLLNFSRYQNGLQKLKLAPCSIETLL
FT                   EEARARYEGQAQEQEIVLMLDIQEPMPRLHADQSQLERVLDNLLDNALRHTPPNGLIRL
FT                   QARRHGERAIISVEDNGEGIAYGQQGRIFEPFVQVGRKKGGAGLGLALCKEIVQLHGGR
FT                   MGVYSRPGQGTQFYMALLL"
FT   gene            complement(366822..367070)
FT                   /locus_tag="PSPTO_0336"
FT                   /old_locus_tag="PSPTO0336"
FT   CDS_pept        complement(366822..367070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0336"
FT                   /old_locus_tag="PSPTO0336"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53881"
FT                   /db_xref="GOA:Q88AQ0"
FT                   /db_xref="InterPro:IPR009614"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AQ0"
FT                   /protein_id="AAO53881.1"
FT                   /translation="MHFTLSGWDDYTHWKDADQAISLSIDSLISQCLRTPFKGTGKPRP
FT                   LTGDLTGYWSRRITKEHRLVYFYEGGVLTVIACRHHY"
FT   gene            complement(367096..367374)
FT                   /locus_tag="PSPTO_0337"
FT                   /old_locus_tag="PSPTO0337"
FT   CDS_pept        complement(367096..367374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0337"
FT                   /old_locus_tag="PSPTO0337"
FT                   /product="prevent-host-death family protein"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53882"
FT                   /db_xref="GOA:Q88AP9"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AP9"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53882.1"
FT                   /translation="MQVLSFSQARAGLKQAMDDVCRDHEPALITRLRGDHVVMLSLDDY
FT                   NSMSETMYLLGTEANAKHLRQSIAQHKAGKAFVKEISLDVTGSETEE"
FT   gene            complement(367634..368413)
FT                   /locus_tag="PSPTO_0338"
FT                   /old_locus_tag="PSPTO0338"
FT   CDS_pept        complement(367634..368413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0338"
FT                   /old_locus_tag="PSPTO0338"
FT                   /product="N-acetylmuramoyl-L-alanine amidase, family 2"
FT                   /note="similar to SP:P25262, SP:P25266, and PID:43471;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53883"
FT                   /db_xref="GOA:Q88AP8"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AP8"
FT                   /protein_id="AAO53883.1"
FT                   /translation="MKLYLSAFILLALTACSSAPKLDTSHPSVNFDNRVQYVVMHYTST
FT                   SMERSLQLLTHGEVSSHYLIGDDSKATIYKLVDENARAWHAGESEWEGRTWLNSSSIGI
FT                   EIVNPGFKDTPTGRLWYPYTEAQIQSITVLLKDIVKRNRIDPKHVIGHSDIAPLRKQDP
FT                   GPLFPWKRLAAEGLGTWPDERLVAQRQAMLATNLPSVSWFQQQLARLGYSTPQTGELDT
FT                   ATRQVIAAFQMHYRPARFDGEPDTQSAAILQVLNHLK"
FT   gene            complement(368509..370542)
FT                   /locus_tag="PSPTO_0339"
FT                   /old_locus_tag="PSPTO0339"
FT   CDS_pept        complement(368509..370542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0339"
FT                   /old_locus_tag="PSPTO0339"
FT                   /product="GGDEF domain protein"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to TIGR protein family HMM TIGR01690"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53884"
FT                   /db_xref="GOA:Q88AP7"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AP7"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53884.1"
FT                   /translation="MSDEAERWREKYLKGIEQQDKLEKRWDARLDLLRRGLVRSSLAAE
FT                   GSDRAVDECMKEMREIVRRDDMDAGLAALIPRLEKAVLDSEQRREVRVGQIGSALTALV
FT                   TQLQALPLTREVRKPLKRFAKDLEERAAQARELPLLLSELSGLQGQALTQLEKQDEGQR
FT                   PGLLQRLFGSRDEHGNEHPPEAAHPQSLPPAQEMHDEVHEPPEAPDAQAPTSPAPAALE
FT                   REIESKPAVPAPEPNAETPALTNTVEPVPPPAAVSVAPVPVEITVEPASVPVEHIDTTD
FT                   MLAPTPIVPYQQRPAPAALEVEPEDDPEPDTEGEDSEEGYALPSSPEPSYSSVAAHIEE
FT                   TLLGLLNDLTLSEHFRPQVEDMQLRLKHGLNWYELLPILDDLAVLMLAINNGDQQEFSS
FT                   YLKQLNERLESFQSHLQAASEDHAENQSSARDLNEQLREQVGGLQSSVQDAYDLNSLKQ
FT                   VLDNRFEGLLSTMDNYQLKRDEREREVASRLQGLASRVASMEQEALGFRTHLEEQRQKA
FT                   LIDPLTGLPNRASWGERLEQEMADWQRDKNSLLVCILDLDHFKRINDGYGHLAGDKVLK
FT                   IVANVFKKRLRPADFLARFGGEEFVMLLPATLLGAGLTLLDELRTAVELCPFHFKGERV
FT                   TITVSIGVTALRTGERSDTAIKRADQALYKAKENGRNRVEQG"
FT   gene            complement(370539..371414)
FT                   /locus_tag="PSPTO_0340"
FT                   /old_locus_tag="PSPTO0340"
FT   CDS_pept        complement(370539..371414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0340"
FT                   /old_locus_tag="PSPTO0340"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:9106456; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53885"
FT                   /db_xref="GOA:Q88AP6"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AP6"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53885.1"
FT                   /translation="MRRWGKGSPRIVGLHDPQVNEHHLTQSGLPEDGRLRLLSFNIQVG
FT                   ISTERYRHYLTRSWQHLLPHVGRAGNLQKIGDLINDFDLVALQEVDGGSMRSGFVNQVE
FT                   HLAQLGGFPFWYQQLNRNLGRFAQHSNGVLSRLRPTKIEDHPLPGPAGRGAILVRFGEG
FT                   EDALVVVMMHLALGTRTRTRQLAYIRELIGGYRHQVLMGDMNTHANDLLEHSPLRDLGL
FT                   LAPQIEATFPSWRPQRCLDHILLSPTLTLERVQVLAHPISDHLPVAVEIRLPASLHGDS
FT                   LPVPSGGNLA"
FT   gene            complement(371424..372068)
FT                   /gene="dsbA"
FT                   /locus_tag="PSPTO_0341"
FT                   /old_locus_tag="PSPTO0341"
FT   CDS_pept        complement(371424..372068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbA"
FT                   /locus_tag="PSPTO_0341"
FT                   /old_locus_tag="PSPTO0341"
FT                   /product="thiol:disulfide interchange protein DsbA"
FT                   /note="identified by match to PFAM protein family HMM
FT                   PF01323; see PMID:20190049 for expression data; identified
FT                   by match to PFAM protein family HMM PF01323"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53886"
FT                   /db_xref="GOA:O52376"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:O52376"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53886.1"
FT                   /translation="MRNLIISAALVAASLFGMSAQAAEPIESGKQYVELTSAVPVAVPG
FT                   KIEVIELFWYGCPHCYAFEPTINPWVEKLPSDVNFVRIPAMFGGPWDAHGQLFITLDTM
FT                   GVEHKVHAAVFEAIQKGGKRLTDKNDMADFVATQGVNKDDFLKTFDSFAVKGKIAQYKE
FT                   LAKKYEVTGVPTMIVNGKYRFDLGSAGGPEKTLQVADQLIDKERAAAKAAK"
FT   gene            complement(372072..372212)
FT                   /locus_tag="PSPTO_0342"
FT                   /old_locus_tag="PSPTO0342"
FT   CDS_pept        complement(372072..372212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0342"
FT                   /old_locus_tag="PSPTO0342"
FT                   /product="protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53887"
FT                   /db_xref="GOA:Q88AP5"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AP5"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53887.1"
FT                   /translation="MTCFTPYAKRPSKAAHFYNLSVTLTNSGFRDRSNNRRLKAILSAQ
FT                   E"
FT   gene            372362..372997
FT                   /gene="engB"
FT                   /locus_tag="PSPTO_0343"
FT                   /old_locus_tag="PSPTO0343"
FT   CDS_pept        372362..372997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engB"
FT                   /locus_tag="PSPTO_0343"
FT                   /old_locus_tag="PSPTO0343"
FT                   /product="GTP-binding protein EngB"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:Q9HT81; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53888"
FT                   /db_xref="GOA:Q88AP4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88AP4"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53888.1"
FT                   /translation="MQLKNPILGLCQQATFMLSAAKVDQCPDDEGFEVAFAGRSNAGKS
FT                   SALNTLTHASLARTSKTPGRTQLLNFFGLDEDRRLVDLPGYGYAKVPIPLKLHWQRHLE
FT                   AYLGSRESLKGLILMMDIRHPMTDFDLLMLDWAIASHMPMHILLTKADKLTYGAAKNTL
FT                   LKVQAEIRKGWGDAVSIQLFSAPKRMGLEEAYTVLAGWMELEDKAPAE"
FT   gene            complement(373014..373131)
FT                   /locus_tag="PSPTO_5670"
FT   ncRNA           complement(373014..373131)
FT                   /locus_tag="PSPTO_5670"
FT                   /product="Spot42"
FT                   /note="PMID:20190049"
FT                   /inference="nucleotide motif:RFAM:RF00021"
FT                   /experiment="RNA sequencing"
FT                   /ncRNA_class="scRNA"
FT   gene            complement(373243..376020)
FT                   /gene="polI"
FT                   /locus_tag="PSPTO_0344"
FT                   /old_locus_tag="PSPTO0344"
FT   CDS_pept        complement(373243..376020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polI"
FT                   /locus_tag="PSPTO_0344"
FT                   /old_locus_tag="PSPTO0344"
FT                   /product="DNA polymerase I"
FT                   /note="similar to SP:P00582; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53889"
FT                   /db_xref="GOA:Q88AP3"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AP3"
FT                   /protein_id="AAO53889.1"
FT                   /translation="MILLMTQAPLVLVDGSSYLYRAFHALPPLTTSKGLPTGAVKGVLN
FT                   MLKSLRRQYPDSPLAVVFDAKGGTFRDALYTDYKANRPSMPDDLRVQVDLLHACVKGMG
FT                   YPFLCVEGVEADDVIGTLARSSAAADRPVVISTGDKDMAQLVDGHITLVNTMTGSVLDV
FT                   AGVKEKFGVGPEHIIDYLALMGDKVDNIPGVPGVGEKTAVGLLVGVGGGIKELYDNLEM
FT                   VATLPIRGAKTLAAKLEEHRAMAFLSYELATIKIDVPLDIELEQLHCSEPDRDKLMELY
FT                   AELEFKSWIEDLQRDAKRAGQELVVEEPTVAAKEAAYEVILEQGQFDAWLKKLQAAPLF
FT                   AFVTQSNGTDAQRAQLVGLSFAIQPHEAAYIPLTHSYMGVPQQLDRDTVLKTLKPLLED
FT                   PNKIKVGQHAKFAINLLANCAIGGDQAQGIELQGVRFDTILESYVLDSTATRHDRDSLV
FT                   AKYLTHTPINFQDIAGKGAKQLTFDQIAIEQAGNYAAEEADLTLRLHEVFEARLAAIPT
FT                   LQPVLNEIEMPLVPVLARIERQGALVDANLLGIQSVELGDKMTALEREAFAIAGEEFNL
FT                   GSPKQLGVILYEKLGMPILSKTATGQPSTAEAVLAELAEQDFPLPKVLMQYRSMSKLKS
FT                   TYTDRLPEQINPRTGRIHTSYHQAVAVTGRLSSSDPNLQNIPIRTAEGRRIRQAFVAPK
FT                   GYKLLAADYSQIELRIMAHLAKDEGLLHAFRNDLDVHRATASEVFGVELENVTTDMRRS
FT                   AKAINFGLIYGMSAFGLAKQIGVDRKQSQAYVDRYFARYPGVLDYMERTRTQAAEQGFV
FT                   ETIFGRRLYLPDINAKNPSLRNGAQRMAINAPMQGTAADIIKKAMVAVNGWLDESGLDA
FT                   RVILQVHDELVLEVREDLVDQISEQIRPHMSGAAELAVPLLVEVGVGNNWDEAH"
FT   gene            376083..376370
FT                   /locus_tag="PSPTO_0345"
FT                   /old_locus_tag="PSPTO0345"
FT   CDS_pept        376083..376370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0345"
FT                   /old_locus_tag="PSPTO0345"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53890"
FT                   /db_xref="GOA:Q88AP2"
FT                   /db_xref="InterPro:IPR021357"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AP2"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53890.1"
FT                   /translation="MRKVNRLILTGLLALCPLLAVSAEDPPSAAPDVTIRTDGDKTIQE
FT                   YRQNGFLYAVKITPKHGKPYFLVRADGTSPNFIRSDQPDMLIPQWEIFSW"
FT   gene            376407..377357
FT                   /gene="thrB"
FT                   /locus_tag="PSPTO_0346"
FT                   /old_locus_tag="PSPTO0346"
FT   CDS_pept        376407..377357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="PSPTO_0346"
FT                   /old_locus_tag="PSPTO0346"
FT                   /product="homoserine kinase"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to PFAM protein family HMM PF01636"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53891"
FT                   /db_xref="GOA:Q88AP1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AP1"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53891.1"
FT                   /translation="MSVFTPLARPELETFLAPYGLGRLLDYQGIAAGSENTNYFISLEQ
FT                   GEFVLTLVERGPVQEMPFFIELLDVLHDANLPVPYALRTTDGQALRELAGKPALLQPRL
FT                   PGKHISEPNTQHCVQIGELLANLHLATREQVLERKTDRGLDWMLSEGRNFLSHLGETQR
FT                   ALLEKSLQEIEDLKPQIMALPRANLHADLFRDNVLFEGTHLTGLIDFYNACSGPMLYDL
FT                   AIALNDWCSRENGQLDAVRARALLGAYAGLRPFTAAESKLWATMLRIACVRFWLSRLIA
FT                   AETFAGQDVLIHDPVEFEQRLAERQTPHIALPFAL"
FT   gene            complement(377461..378507)
FT                   /locus_tag="PSPTO_0347"
FT                   /old_locus_tag="PSPTO0347"
FT   CDS_pept        complement(377461..378507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0347"
FT                   /old_locus_tag="PSPTO0347"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="identified by match to TIGR protein family HMM
FT                   TIGR01481"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53892"
FT                   /db_xref="GOA:Q88AP0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AP0"
FT                   /protein_id="AAO53892.1"
FT                   /translation="MADEKPATRKRRGAGRVTITAVARQAGVSAITVSRYFNQPEQVSP
FT                   ELRERIAAVVNTLGYVPNLVAGGLASARSKVVAMVIPNISGPIFANTIQGFSDTLSQHG
FT                   FQLLLASSYFSAEQEESAVRAFLGWSPAALVLTSHFHSPATEKMIEQTEVPVIETWDHQ
FT                   PDRSPIQIGFSHYDVGVSAARYLYAKGYRRIAFVQNSVAGDFSALERRDGYAATLEGLG
FT                   LRPWVFVPDAGRAPFEAGKQAMEMLMSQAPRPDAIFFANDNLAAGALLASQRAGLHIPQ
FT                   DCAVMGFGDYAFAEMMLPSLTTIKPPALEIGVMAATRVLESFGVLPVEGAPQRLNLLDC
FT                   RLVEREST"
FT   gene            378728..380987
FT                   /locus_tag="PSPTO_0348"
FT                   /old_locus_tag="PSPTO0348"
FT                   /note="This region contains an authentic frame shift and is
FT                   not the result of a sequencing artifact; TonB-dependent
FT                   receptor, authentic frameshift; similar to GP:6019468;
FT                   identified by sequence similarity; putative"
FT   gene            381023..382348
FT                   /locus_tag="PSPTO_0349"
FT                   /old_locus_tag="PSPTO0349"
FT   CDS_pept        381023..382348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0349"
FT                   /old_locus_tag="PSPTO0349"
FT                   /product="xenobiotic compound monooxygenase, DszA family, A
FT                   subunit"
FT                   /note="similar to SP:P54989, GB:M37435, GB:M27087,
FT                   GB:M11038, GB:M11295, GB:M11296, GB:M64592, SP:P09603,
FT                   PID:181135, PID:181144, PID:187463, PID:508986, PID:757917,
FT                   and PID:758781; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53893"
FT                   /db_xref="GOA:Q88AN9"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AN9"
FT                   /protein_id="AAO53893.1"
FT                   /translation="MSTTARQMKLGAFLMATGHHVAAWRHPDVPADAGLDFKHYRHLAQ
FT                   VAEAAKFDTLFVADSVAAATGDIASRMARSDHFEPLTLLSALSAVTDHIGLIATATTTY
FT                   NEPYHVARKFASLDHLSGGRAGWNLVTSDAAAEAQNFGRAEHVGHAERYSRAREFHQVV
FT                   TGLWDSWTDDAFTRDKASGQYYDPANVHVLDHVGEHFSVKGPLNVARSPQGQPVVVQAG
FT                   SSEVGRDLAAQTAEVVFTAQTSLASAQAFYADIKGRLSAYGRDADSLKVMPGVFIVVAE
FT                   TEALAKQKFESFQDLVEPQVGVAPLGRMLGNFDLSGYPLDGPLPELPLTDSGQRSRQKL
FT                   LTELADQENLTLAQLGRRIAGGRGHYSLIGTPVQIADELQIWFEQGAADGFNVLVPHLP
FT                   GGLEDVAQLLVPELQRRGLFRTEYEGTTLRENLGLQRPAYGF"
FT   gene            382479..383414
FT                   /locus_tag="PSPTO_0350"
FT                   /old_locus_tag="PSPTO0350"
FT   CDS_pept        382479..383414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0350"
FT                   /old_locus_tag="PSPTO0350"
FT                   /product="sulfonate ABC transporter, periplasmic
FT                   sulfonate-binding protein, putative"
FT                   /note="similar to GP:4062504, and SP:P75853; identified by
FT                   sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53894"
FT                   /db_xref="GOA:Q88AN8"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AN8"
FT                   /protein_id="AAO53894.1"
FT                   /translation="MKSFTFIAAILAFSGLLNTASADEPDALRIGYQKGSITLVLAKEH
FT                   GLLEKRFAATKIKWIEFPAGPQMLEALNIGSLDIASTGDIPPIFAQVAGADLVYIGAEP
FT                   AKPQAETLLVRNESPLHSVAELKGRKVALQKGSSAHNVVLRVLNKAGLAFKDIQPIYLT
FT                   PADARAAFENGSVDAWAIWDPYYSIALNEGHSRLLANGEGLGLSGPFYTARREFAEKNG
FT                   AFVQQILDELTTADELTRTQRAESIQILARSMGLSEAVITQYLDHRPASPSLPITPEIV
FT                   RAQQATADLFYDNHLIPKRVDIQQAVWQKP"
FT   gene            383497..384534
FT                   /locus_tag="PSPTO_0351"
FT                   /old_locus_tag="PSPTO0351"
FT   CDS_pept        383497..384534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0351"
FT                   /old_locus_tag="PSPTO0351"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /note="similar to SP:Q46851, GB:M59829, SP:P34931,
FT                   SP:P48741, and PID:188492; identified by sequence
FT                   similarity; putative; see PMID:20190049 for expression
FT                   data; similar to SP:Q46851, GB:M59829, SP:P34931,
FT                   SP:P48741, and PID:18849, identified by sequence
FT                   similarity, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53895"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AN7"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53895.1"
FT                   /translation="MTYIAAENRYKDMPYRRTGRSGLVLPALSLGLWHNFGDSTPIDTQ
FT                   RAMLRTAFDLGINHFDLANNYGPPYGSAEINFGRLLREDFKRYRDELIISSKAGWDMWP
FT                   GPYGQGGGSRKYVLASLDQSLQRMGLDYVDIFYSHRFDPDTPLEETASALATAVQQGKA
FT                   LYIGISSYSGAKTREIAALLKEWKVPLLIHQPAYNLLNRWVEKDLLDATEELGAGVIAF
FT                   TALAQGLLSDKYLNGVPKDARVNRPGGGSLQASHLSEQNIAHVRALNEIAQRRGQSLAQ
FT                   MALAWTLRDPRVTSALIGASRPEQIIENVGALQNLAFSSEELAEIDSFAVEGGINLWEK
FT                   PSLAE"
FT   gene            complement(384711..386147)
FT                   /gene="ntrC"
FT                   /locus_tag="PSPTO_0352"
FT                   /old_locus_tag="PSPTO0352"
FT   CDS_pept        complement(384711..386147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrC"
FT                   /locus_tag="PSPTO_0352"
FT                   /old_locus_tag="PSPTO0352"
FT                   /product="nitrogen regulation protein NR(I)"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53896"
FT                   /db_xref="GOA:Q88AN6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AN6"
FT                   /protein_id="AAO53896.1"
FT                   /translation="MSRSETVWIVDDDRSIRWVLEKALQQEGMTTQSFDSADGVMSRLA
FT                   RQQPDVIISDIRMPGASGLDLLARIREQHPRLPVIIMTAHSDLDSAVASYQGGAFEYLP
FT                   KPFDVDEAVSLVKRANQHAQEQQGLDVAPTLTRTPEIIGEAPAMQEVFRAIGRLSHSNI
FT                   TVLINGESGTGKELVAHALHRHSPRSASPFIALNMAAIPKDLMESELFGHEKGAFTGAA
FT                   NLRRGRFEQADGGTLFLDEIGDMPADTQTRLLRVLADGEFYRVGGHTPVKVDVRIIAAT
FT                   HQNLETLVQAGKFREDLFHRLNVIRIHIPRMSDRREDIPTLAKHFLSRAAQELAVEPKL
FT                   LKAETEEYLKHLPWPGNVRQLENTCRWITVMASGREVHISDLPPELLSLPQDAAPVTNW
FT                   EQALRQWADQALSRGQSSLLDSAVPTFERIMIETALKHTAGRRRDAAVLLGWGRNTLTR
FT                   KIKELGMKVDGGDDDEADEG"
FT   gene            complement(386144..387229)
FT                   /gene="ntrB"
FT                   /locus_tag="PSPTO_0353"
FT                   /old_locus_tag="PSPTO0353"
FT   CDS_pept        complement(386144..387229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrB"
FT                   /locus_tag="PSPTO_0353"
FT                   /old_locus_tag="PSPTO0353"
FT                   /product="nitrogen regulation protein NtrB"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53897"
FT                   /db_xref="GOA:Q88AN5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AN5"
FT                   /protein_id="AAO53897.1"
FT                   /translation="MTISDALHRLLLDNLTTATILLNADLRLEYMNPAAEMLLAISGQR
FT                   SHGQFISELFTESAEALSSLRQAVEQAHPFTKREAMLTALTGQTLTVDYAVTPILSKGD
FT                   TLLLLEVHPRDRLLRITKEEAQLSKQETTKMLVRGLAHEIKNPLGGIRGAAQLLARELP
FT                   EESLKDYTNVIIEEADRLRNLVDRMLGSNKLPSLAMTNVHEVLERVCSLVEAESRGCIT
FT                   LVRDYDPSIPDVLIDREQMIQAVLNIVRNAMQAISGQNELRLGRITMRTRAMRQFTIGH
FT                   VRHRLVSKIEIIDNGPGIPAELQETIFYPMVSGRPDGTGLGLAITQNIISQHQGLIECD
FT                   SHPGHTTFSIFLPLEQGAAST"
FT   gene            complement(387189..387347)
FT                   /locus_tag="PSPTO_0354"
FT                   /old_locus_tag="PSPTO0354"
FT   CDS_pept        complement(387189..387347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0354"
FT                   /old_locus_tag="PSPTO0354"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53898"
FT                   /db_xref="GOA:Q88AN4"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AN4"
FT                   /protein_id="AAO53898.1"
FT                   /translation="MFFATSLIQHRMGGFAPAGAGLPAPALRDCNVPKEVNTIHDYQRR
FT                   AAQTVTG"
FT   gene            complement(387513..388145)
FT                   /locus_tag="PSPTO_0355"
FT                   /old_locus_tag="PSPTO0355"
FT   CDS_pept        complement(387513..388145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0355"
FT                   /old_locus_tag="PSPTO0355"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53899"
FT                   /db_xref="GOA:Q88AN3"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AN3"
FT                   /protein_id="AAO53899.1"
FT                   /translation="MNRHRIRSALVCWLLLMALPAAADVYTYIDAQGNRVFTDQPHKNA
FT                   KRVDIPPSNNMTGTPPTKTLKAHPASPAVQPMFHYQLLRILVPEPDATLVNPSGDLIVT
FT                   VTSEPVLQPGHSYRLLLDGVAVGQAGRSPVFPLSNVDRGTHQLSVEIFDEMGRVLEKTP
FT                   NQPFHLQRISLSQKRATHPCKDEDYGVRPECPLKDKPEPKSSILPFF"
FT   gene            complement(388142..388684)
FT                   /locus_tag="PSPTO_0356"
FT                   /old_locus_tag="PSPTO0356"
FT   CDS_pept        complement(388142..388684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0356"
FT                   /old_locus_tag="PSPTO0356"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53900"
FT                   /db_xref="GOA:Q88AN2"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AN2"
FT                   /protein_id="AAO53900.1"
FT                   /translation="MRQSLICLLLLISLPALAQIYKYTDANGNTAFSNQPPNGTKTEVV
FT                   ELPPLNSIEKQTPARPAVNSAPQNAPEPAQQQSQPLTRYDVLELTDLPTDEALRANNGT
FT                   FIIGVKVQPRLQQNHRLQLLLDGNLYGQPSNLPRFQVVNADRGEHSFAVVVKDGERIVQ
FT                   QSETITLTIQRVHLGKP"
FT   gene            complement(388763..389320)
FT                   /gene="aroH"
FT                   /locus_tag="PSPTO_0357"
FT                   /old_locus_tag="PSPTO0357"
FT   CDS_pept        complement(388763..389320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroH"
FT                   /locus_tag="PSPTO_0357"
FT                   /old_locus_tag="PSPTO0357"
FT                   /product="chorismate mutase"
FT                   /note="similar to GP:5353514; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53901"
FT                   /db_xref="GOA:Q88AN1"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR008240"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AN1"
FT                   /protein_id="AAO53901.1"
FT                   /translation="MRLLLATSLLTLTCMSSCFAFAAEQKPSAIEPLLQAISERLTIAD
FT                   QVALSKWDSGKAVEDPPREQQVISAAQARADEFKLNPDDVQRLFRAQIEANKQVQNSLL
FT                   AQWHAAGKAPDTPRLSLVDDIRPKLDRLQTQLLQAYAAFQPLRKSEDCKVQLDAALKRY
FT                   QTDAIHDQALVLATADLCAAKR"
FT   gene            complement(389541..391001)
FT                   /locus_tag="PSPTO_0358"
FT                   /old_locus_tag="PSPTO0358"
FT   CDS_pept        complement(389541..391001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0358"
FT                   /old_locus_tag="PSPTO0358"
FT                   /product="ISPsy6, transposase"
FT                   /note="identified by match to PFAM protein family HMM
FT                   PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53902"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q877Q7"
FT                   /protein_id="AAO53902.1"
FT                   /translation="MLRIERYRAFFVMAYIQGESRSQTSLFPVSLEELIPEDHLVRVID
FT                   LYVAKLDLVQLGFDKAIPKSTGRPAYDPADQLRLYLYGYFQRIRSSRRLEAECQRNIEV
FT                   MWLINRLKPDFKTIADFRKNNKPAFIATCRAFVRFCRTAGLIAGELVAIDGSKFQAVAS
FT                   SRRHVNLKQLKRQEEKLDKRIAQYLAELDEADKAETTDSIDRSAIKAALAQLEARQQDN
FT                   QSCQALMRSMGIEQFNTHESDARMMRTAKGPRVAYNVQTVVDAEHCLILHHEVTQDGDD
FT                   RKQLEPMAKAAKAELQQDELTVTADAGYSNGKQFQACEDASITAYVPPNRSKNPGSHEE
FT                   QLFERKDFIYEAGHDRFQCPAGKWLTLKQHNKGDRIYQAEVDDCANCALKTQCTRAQRR
FT                   YVSRHAHEEAFERMEQRMQAHPEMMANRRSIVEHPFGNLKQWLFGNGRFLLRQLEGTKA
FT                   EMALAVNAYNLKRAIKVLGVRHLMALMG"
FT   gene            complement(391090..392496)
FT                   /gene="glnA-1"
FT                   /locus_tag="PSPTO_0359"
FT                   /old_locus_tag="PSPTO0359"
FT   CDS_pept        complement(391090..392496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA-1"
FT                   /locus_tag="PSPTO_0359"
FT                   /old_locus_tag="PSPTO0359"
FT                   /product="glutamine synthetase, type I"
FT                   /note="identified by match to TIGR protein family HMM
FT                   TIGR01692; see PMID:20190049 for expression data;
FT                   identified by match to TIGR protein family HMM TIGR01692"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53903"
FT                   /db_xref="GOA:Q88AN0"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AN0"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53903.1"
FT                   /translation="MSKSVQLIKDHDVKWIDLRFTDTKGTQHHVTMPARDALEDDFFEV
FT                   GKMFDGSSISGWKGIEASDMILLPDDETAVLDPFTEEPTLILVCDIIEPSTMQGYDRDP
FT                   RAIARRAEEYLKSTGIGDTVFAGPEPEFFIFDEVKFKSDISGSMFKIYSEQGSWMSDQD
FT                   VEGGNKGHRPGIKGGYFPVPPFDHDHEIRTAMCNALEEMGQTVEVHHHEVATAGQNEIG
FT                   VKFNTLVKKADEVQTLKYVVHNVADAYGRTATFMPKPLYGDNGSGMHVHMSIAKDGKNT
FT                   FAGEGYAGLSDIALYFIGGIIKHGKALNGFTNPATNSYKRLVPGFEAPVMLAYSARNRS
FT                   ASIRIPYVNSPRGRRIEARFPDPAANPYLAFAALLMAGLDGIQNKIHPGDAADKNLYDL
FT                   PPEEAKEIPQVCGSLKEALEELDKGRAFLTKGGVFSDDFIDAYIALKSEEEIRVRTFVH
FT                   PLEYELYYSC"
FT   gene            392832..394286
FT                   /gene="thiI"
FT                   /locus_tag="PSPTO_0360"
FT                   /old_locus_tag="PSPTO0360"
FT   CDS_pept        392832..394286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiI"
FT                   /locus_tag="PSPTO_0360"
FT                   /old_locus_tag="PSPTO0360"
FT                   /product="thiamin biosynthesis protein ThiI"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P77718; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53904"
FT                   /db_xref="GOA:Q88AM9"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="InterPro:IPR026340"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88AM9"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53904.1"
FT                   /translation="MKLIVKVFPEITIKSPPVRKKFIRQLGKNIRTVLRELDADIVVGG
FT                   VWDNLEVETRLTDPKVLQGIRDRLSCMPGIANFLQVAEYPLGDMDDVVAKCKLHYADLL
FT                   PGTMFSVRCKRAGRHDFSSMDVEKYVGSQLRMQCGAAGIELKKPDLVVRMEIRDQRLFV
FT                   VHDQHKGMGGYPLGALEQTLVLMSGGFDSTVAAYQIMRRGLMAHFCFFNLGGRAHELGV
FT                   MEVAHFIWKKYGSSQRVLFVSVPFEEVLGEILQKVDNSHMGVVLKRMMLRAASAVADRL
FT                   EIDVLVTGEAISQVASQTLPNLSLIDAATDKLVLRPLVATHKQDIVDLATEIGTADFAR
FT                   HMPEYCGVISVNPKTNAKRNRVEYEEQQFDMAILEQALERAKLVSIDRVIDDLSRNIDI
FT                   EEVSQALAGQVIIDIRHPDAQEDQPLQVPGVEIQTLPFYALNSRFKALDDTRQYLLYCD
FT                   KGVMSRLHAHHLLSEGHANVRVYRPS"
FT   gene            394429..396249
FT                   /gene="typA"
FT                   /locus_tag="PSPTO_0361"
FT                   /old_locus_tag="PSPTO0361"
FT   CDS_pept        394429..396249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="PSPTO_0361"
FT                   /old_locus_tag="PSPTO0361"
FT                   /product="GTP-binding protein TypA"
FT                   /note="identified by match to PFAM protein family HMM
FT                   PF03144; see PMID:20190049 for expression data; identified
FT                   by match to PFAM protein family HMM PF03144"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53905"
FT                   /db_xref="GOA:Q88AM8"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AM8"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53905.1"
FT                   /translation="MIENLRNIAIIAHVDHGKTTLVDKLLRQSGTLERGELNDERVMDS
FT                   NDQEKERGITILAKNTAINWNGYHINIVDTPGHADFGGEVERVMSMVDSVLLLVDAQDG
FT                   PMPQTRFVTKKAFEAGLRPIVVINKVDRPGARPDWVLDQIFDLFDNLGATEEQLDFKVV
FT                   YASALNGIAGLDHTEMAEDMTPLYQSIVDNVPAPAVDRDGPFQMQISALDYNSFLGIIG
FT                   VGRIARGKVKPNTQVVAIDANGKRRNGRILKLMGHHGLHRVDVEEAAAGDIVCISGFEE
FT                   LFISDTLCDPQNVEAMKPLTVDEPTVSMTFQVNDSPFCGKEGKFVTSRNIKERLDKELL
FT                   YNVALRVEEGDTADKFKVSGRGELHLSVLIETMRREGFEMGVGRPEVIIRMVDGVKHEP
FT                   FENVTIDLPEESQGSIMEQIGIRKGDLTNMVPDGKGRVRLEYNIPARGLIGFRNEFLTL
FT                   TSGAGILTSIFDRYDVMKSGDMSGRQNGVLVSVATGKALTYSLETLQARGKLFLGHGED
FT                   VYEGQIVGINSRDNDLGVNPTKGKKLDNMRASGKDETIALVPPIRFTLEQALEFVQEDE
FT                   LCEVTPKSIRLRKKILGESERTRAAKKSGN"
FT   gene            complement(396350..397132)
FT                   /locus_tag="PSPTO_0362"
FT                   /old_locus_tag="PSPTO0362"
FT   CDS_pept        complement(396350..397132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0362"
FT                   /old_locus_tag="PSPTO0362"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GB:J00222, GB:S55273, SP:P01854, PID:184760, PID:2300106,
FT                   and PID:386807; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53906"
FT                   /db_xref="GOA:Q88AM7"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AM7"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53906.1"
FT                   /translation="MIPDQRRELMLRQLRKHQVLSVHQLMEMFDCSHMTIRRDIAQLEQ
FT                   EGRAYSVTGGVRIASQVHSEPSHQSKAVVELPHKQGMARLAAGLLHPDMTIYLDAGTST
FT                   LEIVPHIIALSGMTVVTNDFGVVNALADAAHVDVIHTGGLLDHPNRSSVGGLAAATLRQ
FT                   LATDVAFMSTSSWDLQRGTTTPSALKVEVKQAAMQSASQTVLVATSSKYGTFGMYKVAG
FT                   LDQFDTIISDAALAEAAADGIRKQRIELLLAPVGGRSK"
FT   gene            complement(397298..398071)
FT                   /gene="polS"
FT                   /locus_tag="PSPTO_0363"
FT                   /old_locus_tag="PSPTO0363"
FT   CDS_pept        complement(397298..398071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polS"
FT                   /locus_tag="PSPTO_0363"
FT                   /old_locus_tag="PSPTO0363"
FT                   /product="sorbitol dehydrogenase"
FT                   /note="similar to SP:Q59787, SP:P23157, GB:X55942, and
FT                   PID:46921; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53907"
FT                   /db_xref="GOA:Q88AM6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AM6"
FT                   /protein_id="AAO53907.1"
FT                   /translation="MKRLEGKSALITGSARGIGRSFAQAYIREGASVAIADINLERAQA
FT                   TAIELGPNAYAVSMDVTDQASIDQAIAAVVAQTGKLDILINNAALFDLAPIVDITRDSY
FT                   ERLFSINVAGTLFTLQAAAKQMIAQGHGGKIINMASQAGRRGEALVAVYCATKAAVISL
FT                   TQSAGLDLIRHGINVNAIAPGVVDGEHWDGVDAMFARYENRPRGEKKKLVGEQVPYGRM
FT                   GTADDLTGMAIFLASTDSEYVVAQTYNVDGGNWMS"
FT   gene            complement(398111..399427)
FT                   /locus_tag="PSPTO_0364"
FT                   /old_locus_tag="PSPTO0364"
FT   CDS_pept        complement(398111..399427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0364"
FT                   /old_locus_tag="PSPTO0364"
FT                   /product="sugar ABC transporter, periplasmic sugar-binding
FT                   protein, putative"
FT                   /note="similar to GP:2293414, GB:M77351, SP:P27756, and
FT                   PID:153736; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53908"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AM5"
FT                   /protein_id="AAO53908.1"
FT                   /translation="MNIHKALCLSAGVSVALISLAAQAAETVTIATVNNGDMIRMQRLS
FT                   KIFEQQHPDIKLNWVVLEENVLRQRLTTDIATQGGQFDVLTIGTYETPLWGAKQWLEPI
FT                   TDLAPEYDLEDIFPSVRQGLSVKNTLYALPFYGESTITYYRTDLFKQAGLSMPERPTWT
FT                   QLGEFAAKLHQPDKGVYGMCLRGKAGWGENIALLSTMANAFGARWFDEHWKPELNSPEW
FT                   ANAANFYVNTLKNYGPPGVSSNGFNETLALFNSGKCALWVDASVAGSFTTDKEQSKVVD
FT                   SVGFAPAPVEVTDKGSSWLYAWSLAIPATSRHKDAAKAFITWATSKAYIQLVAEKDGIT
FT                   NVPPGTRTSTYSEAYLKAAPFAKVTLQMMQHADPAQPSAKPVPYVGIQYVTIPEFQAIG
FT                   TSVGKLFSAAVTGQTTTEQALTAAQAVTEREMKRAGYPK"
FT   gene            399709..400608
FT                   /locus_tag="PSPTO_0365"
FT                   /old_locus_tag="PSPTO0365"
FT   CDS_pept        399709..400608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0365"
FT                   /old_locus_tag="PSPTO0365"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to PFAM protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53909"
FT                   /db_xref="GOA:Q88AM4"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AM4"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53909.1"
FT                   /translation="MPDSRAALFEQRPAELEVILPQPDHCFRWYEHDYPYSLARWNHHP
FT                   EFEIHLIRQGSGRLVAGDYIGEFGAGHVALICPDLPHDWIGDLAPGEHLAGRDVVLQFD
FT                   GAALLALRGTLPEVGDLQRLFEQARRGLEFTGKTAVQAAQLLEQIGPAQGLERLILFLQ
FT                   LVNTLMKAPTQDAHLLASACYAPTLDARSSERINKAFDYLLTELTSDVRLSVIAQRLDM
FT                   SDPGFSRFFKRTTGHCFIDLMRKLRVQRACRLLLQSEMSVSDICFEVGYANLSNFNRHF
FT                   RVEMQQTPSEYRRAAALV"
FT   gene            complement(400609..401868)
FT                   /locus_tag="PSPTO_0366"
FT                   /old_locus_tag="PSPTO0366"
FT   CDS_pept        complement(400609..401868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0366"
FT                   /old_locus_tag="PSPTO0366"
FT                   /product="Na+/H+ antiporter NhaP"
FT                   /note="identified by match to PFAM protein family HMM
FT                   PF04172"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53910"
FT                   /db_xref="GOA:Q88AM3"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AM3"
FT                   /protein_id="AAO53910.1"
FT                   /translation="MLELAAGFICLTSLLTYVNYRFIGLPPTIGVMVTALMFSLLLQGL
FT                   SFLGYPGLEDRVQQLIGQIDFGDLLMNWMLSFLLFAGALHVNLADLKSYRWPIGLLATF
FT                   GVLIATTVIGALAYWIFALFGWHVSPLYCLLFGALISPTDPIAVLGVLRTANASKPLKT
FT                   TIVGESLFNDGTAVVVFTVLLGIAQLGETPTVGETALLFVHEAVGGVLFGGLIGYAVYL
FT                   MIKSIEQYQIEVMLTLALVIGGSAMASELHVSGPIAMVVAGLIIGNLGRNLAMNDMTRR
FT                   YMDGFWELLDDMLNALLFALIGMELLLLPFSWQHLIAASLLAVAILLSRFVTVAPAILL
FT                   LRRWRKVPHGTIRILTWGGLRGGVSVALALALPNGPERDLLLSITYIVVLLSILFQGLT
FT                   IGKLVNAVTREPQAKDPAGH"
FT   gene            complement(402145..402474)
FT                   /locus_tag="PSPTO_0367"
FT                   /old_locus_tag="PSPTO0367"
FT   CDS_pept        complement(402145..402474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0367"
FT                   /old_locus_tag="PSPTO0367"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GP:12484570; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53911"
FT                   /db_xref="GOA:Q88AM2"
FT                   /db_xref="InterPro:IPR021245"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AM2"
FT                   /protein_id="AAO53911.1"
FT                   /translation="MRTAKSLLLALVILSPLSAFAYTTDEVKATTVIKEHQASVQKYAA
FT                   IHNKPMPEIKEYKYGMKLDVAKVIRKSPDLQTCSVMPKLMTYEDSKGKLNTVQYQILSG
FT                   CRNSQ"
FT   gene            complement(402612..402947)
FT                   /locus_tag="PSPTO_0368"
FT                   /old_locus_tag="PSPTO0368"
FT   CDS_pept        complement(402612..402947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0368"
FT                   /old_locus_tag="PSPTO0368"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53912"
FT                   /db_xref="GOA:Q88AM1"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AM1"
FT                   /protein_id="AAO53912.1"
FT                   /translation="MGVQRVGHQRHQPSDLVDRSALALSSVLTYCSALLLLFCSLKRNS
FT                   CARRILSAAMLAYSLPSSAKAAVADKAATAKTIDLISFIIITSWVCKGFLKSAVLVRDE
FT                   TSLCQGS"
FT   gene            403338..404663
FT                   /locus_tag="PSPTO_0369"
FT                   /old_locus_tag="PSPTO0369"
FT   CDS_pept        403338..404663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0369"
FT                   /old_locus_tag="PSPTO0369"
FT                   /product="outer membrane porin, OprD family"
FT                   /note="similar to GP:2645844, and SP:P32722; identified by
FT                   sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53913"
FT                   /db_xref="GOA:Q88AM0"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AM0"
FT                   /protein_id="AAO53913.1"
FT                   /translation="MTQLKTLSLALCSTLAGVAPAAVFADEQKEGFIEGSTLTVLNRNF
FT                   YMNRDHRNGESSPTGNGYSEAWAHGIIGRFQSGFTQGTFGVGVDAFAMIGIKLDTGDGR
FT                   NGGRSPFDVMPVDGDGSARDEYTKVGGSLKARAFDTVVNVGDVFPSTPVVAFGDSRLLP
FT                   ESFRGVTAINNSFEGLTLQGGRLHSMSQPVSSNMRDGFVTFYGGAVDSPWVAYFGGDYQ
FT                   ATDRLSLGLYTSRLKDAWDQKYASASYVLPLSDELSLTSSLNYYNATDEGKKLLGEFDN
FT                   DIWSAKVALQYGAHTLSLSHQRNQGDDDFDYLRQSDSIYLANSIQYSDFNSPKERSWMV
FT                   TYNLDMSTYGVPGLSFMTRYGKGTDADYSNANSTYMRRDAQGNPLTDQKRWERNIEAKY
FT                   IVQTGSLKDLSLRVRQANTRATAFESDLDEVRVIMEYPLSVL"
FT   regulatory      404752..404784
FT                   /bound_moiety="HrpL"
FT                   /note="PMID:17073300"
FT                   /inference="nucleotide motif:HMM2"
FT                   /regulatory_class="promoter"
FT   gene            404865..406241
FT                   /locus_tag="PSPTO_0370"
FT                   /old_locus_tag="PSPTO0370"
FT   CDS_pept        404865..406241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0370"
FT                   /old_locus_tag="PSPTO0370"
FT                   /product="MATE efflux family protein"
FT                   /note="identified by match to PFAM protein family HMM
FT                   PF03023"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53914"
FT                   /db_xref="GOA:Q88AL9"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AL9"
FT                   /protein_id="AAO53914.1"
FT                   /translation="MAVTKAVFTEGSVLRHVVFMTSTSATSLLSIFLIEVLTVVYIAML
FT                   RDDSLLAAFAVAKTLMFFIISMILGIAVAVSSTVSRALGSGVPDQARRLASSGLLLGII
FT                   ATVCCAVLELIFLDSAIQMLGGEGSSFTAAREYLWLTLPASVLVAVEQLCVQILRSAGF
FT                   GKQAMWTLLTATAAVAIADPLLIIVFDLGLAGAGVAYLISSLVSACLGFYYVHRVARLT
FT                   CRVSLTHLSGDISIIGRTAVPAVIGNLATPVGMAYVMAAMAPFGAQALAAIGVIDRVIQ
FT                   VAFCVVFALPGALIPILGQNLGAMNTARVSQAVKTTYGLLIGYGATTSLLLILLAEPLA
FT                   RLFHVSGEGLVVFSAFCRWGGLLWTLIGLQFIATSIFLSAGRPMYVTLFGWLRASLGTV
FT                   PFVWYGAQAFGSVGVMLGQLLGNTIVAFCACWVAHLLMKKRIGNKLDLTGNRSRHRGNS
FT                   "
FT   gene            406323..407510
FT                   /gene="iaaL"
FT                   /locus_tag="PSPTO_0371"
FT                   /old_locus_tag="PSPTO0371"
FT   CDS_pept        406323..407510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iaaL"
FT                   /locus_tag="PSPTO_0371"
FT                   /old_locus_tag="PSPTO0371"
FT                   /product="indoleacetate-lysine ligase"
FT                   /note="similar to SP:P18204, GB:J04031, SP:P11586, and
FT                   PID:307178; identified by sequence similarity; putative;
FT                   see PMID:20190049 for expression data; similar to
FT                   SP:P18204, GB:J04031, SP:P11586, and PID:307178, identified
FT                   by sequence similarity, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53915"
FT                   /db_xref="GOA:Q88AL8"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AL8"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53915.1"
FT                   /translation="MTAYDVEKEWSRISNTAAKTHQNNDFEGFTYQDFRTHVPIMDKEG
FT                   FAAQTERCLERNERNCLIGFTSGTSGNLKRCYYYYDCEVDEDSSRSNVFRSNGFIQPGD
FT                   RCANLFTINLFSALNNITTMMAGNCGAHVVSVGDITLLTKSHFEALNSIKLNVLLGVPS
FT                   TILQFIDAMQQHGVHIDIEKVVFNGEGLKTFQKKIIREAFGEQVSIVGVYGSSEGGILG
FT                   FTNSPCHTEYEFLSDKYFIEKEGDSILITSLTRENFTPLLRYRLGDTATLSLKGDKLYL
FT                   TDIQREDMSFNFMGNLIGLGIIQQAIKQTLGRTLEIQVHLSVTDARKELVTVFVQASEV
FT                   NEDERARIETAIADIPDINEAYQKDQGSVLVVRKDARDYAVSERGKMLYIIDRRN"
FT   gene            complement(407868..408890)
FT                   /locus_tag="PSPTO_0372"
FT                   /old_locus_tag="PSPTO0372"
FT   CDS_pept        complement(407868..408890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0372"
FT                   /old_locus_tag="PSPTO0372"
FT                   /product="ISPsy7, transposase"
FT                   /note="similar to GB:X77384, GB:U14965, GB:X75085,
FT                   SP:P42442, PID:474417, PID:475064, and PID:556616;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53916"
FT                   /db_xref="GOA:Q877P3"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q877P3"
FT                   /protein_id="AAO53916.1"
FT                   /translation="MKNGLKLLGIDIGKNSFHLIGHDAGGHQVLRKCFNRNRLLQFAAQ
FT                   IEPCTIAMESCGGSHWLARKLASLGHRVKLIAPQHVKPYVTGNKNDFIDAEAICEAASR
FT                   PRTHYVAVKTVEQQVLSVQHRLRESLVCHRTEAINRVHGFLLEFGIALPATKAAIAKVP
FT                   ELIDDSRSDLPLQFKRVMEHLLEDIHRLDTEIKACDAQIKQQLAQDDAGTRLMTIPGIG
FT                   PITASAFVADLGDASNFRASRDLSAFLGLVPRQFSTGGRPVLLGISKRGDRHLRTLLVQ
FT                   GSRALMIRIERRDDALGQWVRDLLARKHPNKVACALANKLARIVWAVLRRGSTYNASMI
FT                   "
FT   gene            complement(408969..411536)
FT                   /locus_tag="PSPTO_0373"
FT                   /old_locus_tag="PSPTO0373"
FT   CDS_pept        complement(408969..411536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0373"
FT                   /old_locus_tag="PSPTO0373"
FT                   /product="Rhs family protein"
FT                   /note="similar to GP:15130940, and SP:P16919; identified by
FT                   sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53917"
FT                   /db_xref="GOA:Q88AL7"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AL7"
FT                   /protein_id="AAO53917.1"
FT                   /translation="MFEAARLMDEIDHTSAMTGFVLGAIVGIAAVAYVSFTVATCGLGG
FT                   ILLGLAVGLAGNAIASLGESIGAAFSSAAGQIESGSPNVFINGRPAAFAIDSTAVCEKH
FT                   SPIVKVAEGSSNVFINGKPAARKGDKLTCGAKIGTGSNNVFIGGGTHRYLAVDDEVSAT
FT                   ARYTVDILLVVAGGAKAVGSIAKLGLQAGLKAAGPCALRFMGGIVLSDAIVRFGVAPLA
FT                   EKVLGGLHGNPVDTTTGRKLLIDEFDFSLPGRMPIEWTRFYASDLNVDSVLGKGWVLPW
FT                   EQSLRRKGSFLYLSDNQGRSVPFVTLDYNQRIYNAQEQLYLVRTNGGHYLVQTLDNVFY
FT                   YFGEVPDDNQPVPLERIENALGHFLHFVRSEDGVLTDICATGGQRVHLHYDEVSHRLST
FT                   VKRIVDGKAVETLVRYHYDSNGQLNGVYNRNGDSVRTFSYTDGLMTRHANALGLGCEYR
FT                   WEVLDDKPRVVEHWTSDGEHLHFDYDFEARQTRVTDVLGRCAEVTYNKDRRVIASTDFG
FT                   GEQYRIALDDTGNITGLTLPDGNQLGFEYDDLSRLTAETDPLGRTTRFKHHYKTTLVKQ
FT                   VTYPDGSTWQARYDDRGNLITEIDALGNKTEYYNGEDGLPHTITDATLKSKYLWWNSLA
FT                   QVERFQDCSGKSTHYRYDERHQLIAVTDALNNTTTLERKPGGEVLRIDHPDGSRERFTY
FT                   NAHGQVLTHTNGKDQTTHLARNARGLPVRRQDPKGLMVAYQYDKALRLVALTNENDATY
FT                   TFAYDHSDRLIEEKRIDQLTRRFSYNLGGHLTQVEETGYSEKGERPQRSTYFERDSIGR
FT                   LLARLNDDARQDFAYDDSDRLLSIQRKPTDSGRKLGVTAEKLE"
FT   gene            complement(411649..412236)
FT                   /locus_tag="PSPTO_0374"
FT                   /old_locus_tag="PSPTO0374"
FT   CDS_pept        complement(411649..412236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0374"
FT                   /old_locus_tag="PSPTO0374"
FT                   /product="protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53918"
FT                   /db_xref="GOA:Q88AL6"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AL6"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53918.1"
FT                   /translation="MTRPSLYDRISERRLANEALAREEAERAAAQRELDLIQAAIPVPQ
FT                   PLLDAPCSFNFGGFHFGFPEGFRCSAIEATVHVEGEPVVVSIQRRDVPEGANLAEAFAE
FT                   AVKALKPLHGEVRIIRHYETLLAGNAALGLDFHFREGFEERHGRLIGAIVPVADHNQRQ
FT                   WLSVGCVIDSEKPALTTWLLDFDSMLEGLTAS"
FT   gene            complement(412540..415701)
FT                   /locus_tag="PSPTO_0375"
FT                   /old_locus_tag="PSPTO0375"
FT   CDS_pept        complement(412540..415701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0375"
FT                   /old_locus_tag="PSPTO0375"
FT                   /product="cation efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53919"
FT                   /db_xref="GOA:Q88AL5"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AL5"
FT                   /protein_id="AAO53919.1"
FT                   /translation="MFERLIQFAIEQRIVVMLAVLLMAGLGIASYQKLPIDAVPDITNV
FT                   QVQINTSAPGFSPLETEQRVTFAIETNMAGLPGLQQTRSLSRSGLSQVTVIFEDGTDLF
FT                   FARQLVGERLQIAKDQLPEGVDAMMGPISTGLGEIFLWTVEARDGALKEDGTPYTPTDL
FT                   RVIQDWIIKPQLRNVPGVAEINTIGGFAKQYQIAPDPKKLAAYKLTLNDLVAALERNNA
FT                   NVGAGYIERGGEQLLIRAPGQLGTVDDIANIVIANVQGTPIRISSVAEVGIGKEMRSGA
FT                   ATENGREVVLGTVFMLIGENSRTVSQAVAAKLADINRTLPEGVEAVTVYDRTNLVEKAI
FT                   ATVKKNLIEGAILVIVILFLFLGNIRAALITAMVIPLAMLFTFTGMFTNKVSANLMSLG
FT                   ALDFGIIVDGAVVIVENAIRRLAHAQKKYGRMLTRSERFHEVFAAAREARRPLIFGQLI
FT                   IMVVYLPIFALTGVEGKMFHPMAFTVVIALLGAMILSVTFVPAAIAMFVTGKVKEEEGF
FT                   VMRTARQRYAPILSWVLSHRAIAFGMAFVLIVLSGFTASRMGSEFIPSLSEGDFALQAL
FT                   RVPGTSLSQSVDMQQRLEKAIIEKVPEVQRVFARTGTAEIAADPMPPNISDSYVMLKPQ
FT                   SEWPDPDKSRETLIADLQKAAASVPGSNYELSQPIQLRFNELVSGVRSDVAVKVFGDDM
FT                   NVLNQTAAKIAATLQKVPGASEVKVEQTTGLPVLTINIDRDKAARYGLNVADVQDAIAI
FT                   ALGGRQAGTLYEGDRRFDMVVRLSEQLRTDVDGLSSLLIPVPANASSQQISFIALSQVA
FT                   SLDLVLGPNQISRENGKRVVIVSANVRGRDLGSFVEEAGTTIDSGVQIPAGYWTNWGGQ
FT                   FEQLQSAAKRLQIVVPVALLLVLALLFMMFNNLKDGLLVFTGIPFALTGGVMALWLRDI
FT                   PLSISAGVGFIALSGVAVLNGLVMISFIRSLREEGRSLHDAINEGALTRLRPVLMTALV
FT                   ASLGFIPMALATGTGAEVQRPLATVVIGGILSSTALTLLVLPALYQWAHRREEEQEEDE
FT                   VKALK"
FT   gene            complement(415726..416994)
FT                   /locus_tag="PSPTO_0376"
FT                   /old_locus_tag="PSPTO0376"
FT   CDS_pept        complement(415726..416994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0376"
FT                   /old_locus_tag="PSPTO0376"
FT                   /product="cation efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53920"
FT                   /db_xref="GOA:Q88AL4"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AL4"
FT                   /protein_id="AAO53920.1"
FT                   /translation="MNNKRSIAIALAVVVIIGLGSLTVSQQMLPFAAETDASDKKPADK
FT                   EHGHESEDAHGDDDHASDPKKASAAAAEQPHEEEEEGHIELTAEQIKTAGIELATAEPR
FT                   QMSTTVTFPGEIRFDEDRTAHVVPRVSGVVESVKVDLGQAVKKGQVLAVIASQQISDQR
FT                   SELNAAQRRQELARLTLQREKKLWEDKISAEQDYLQARQDFQEADINLANARQKISAIG
FT                   ASLSPSAGNRYELIAPFDSMVVEKHLGIGEMVNEASNAFTLSDLSRVWATFGVAPRDLD
FT                   KVVVGRPVIVSAPDLNARVEGKIGYVGSLLGEQTRAAAVRVTLANPQGAWRPGLFVSVE
FT                   VAAEQSSVAVSVPDSAIQSIEEKPSVFVRNAEGFQLTPVTLGRRDGGHVEIVKGLAAGT
FT                   QVAAAGSFILKSELGKGSAEHAH"
FT   gene            complement(417062..418288)
FT                   /locus_tag="PSPTO_0377"
FT                   /old_locus_tag="PSPTO0377"
FT   CDS_pept        complement(417062..418288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0377"
FT                   /old_locus_tag="PSPTO0377"
FT                   /product="metal ion efflux outer membrane protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53921"
FT                   /db_xref="GOA:Q88AL3"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AL3"
FT                   /protein_id="AAO53921.1"
FT                   /translation="MRVGAFCLLLLPLVAPGVASAQGISLPQALEAAFAHNPELAAAQW
FT                   EIGVAEGDRQQAGLIPNPVLSWEVEDTRRDTSTTTVMLSQALELGGKRGARIEAAGKGQ
FT                   DAARLELEQRGNELRADVVQAFYAAARAQAGLELARQSRALAERGLHVAEGRVRAGKVS
FT                   PVEATRAQVQLAETDLLVRRAETLKINSNRELARATGSPTASFERLDYTDLSPGKSPSS
FT                   ARMMTALNQSAELRLAQTRIEQREAALGSERAKRIPDLTVSVGSQYSREERERVNVVGL
FT                   SMPLPLFDRNQGNVLAASRRADQSRDLRNAVELKLRTQTQSALDQWSTAAQEVESFNKV
FT                   ILPAAQSAVDTATRGFEMGKFGFLEVLDAQRTLISARSQYLESLATATEARVAIERIHG
FT                   DLNRFSFTP"
FT   gene            418542..419216
FT                   /locus_tag="PSPTO_0378"
FT                   /old_locus_tag="PSPTO0378"
FT   CDS_pept        418542..419216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0378"
FT                   /old_locus_tag="PSPTO0378"
FT                   /product="DNA-binding heavy metal response regulator"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53922"
FT                   /db_xref="GOA:Q88AL2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AL2"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53922.1"
FT                   /translation="MRILVVEDEPKTAEYMHQGLTESGYVVDIAATGLDGLYLAQHQAY
FT                   DVVILDVNLPEMDGWEVLSRLRKTVNTRIMMVTARGRLEEKVKGLEMGADDYLVKPFEF
FT                   PELLARVRTLMRRSEQTTTAKVLQVGDLELDQGRHRAFRGKQRIDLTTKEFALLHLLMR
FT                   HSGEVMSRTQIISLVWDMNFDCDTNVVEVSIRRLRAKIDDPFETKLIHTLRGVGYVLEV
FT                   RE"
FT   gene            419213..420604
FT                   /locus_tag="PSPTO_0379"
FT                   /old_locus_tag="PSPTO0379"
FT   CDS_pept        419213..420604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0379"
FT                   /old_locus_tag="PSPTO0379"
FT                   /product="heavy metal sensor histidine kinase"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53923"
FT                   /db_xref="GOA:Q88AL1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AL1"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53923.1"
FT                   /translation="MTPTRLSTRLGLTVTALIACLVLVMEMLAYMAISRQLDVRAEDSL
FT                   NEKFAQIEHSMSEGFLAIEDIVQYPHTLRDQIVGHDSYSLAVLDSSKPRQQLMMVGNEE
FT                   GRNLPIPDADRIPQGFQELQSVHGHKILMGYREIRLKTGQDILVRLSMDRESDSTLLHA
FT                   YLKSTFFILPLILLLVGFGVWWVVRRALRPLRAFRKVTALISARDLSHRMKIKGLPDEL
FT                   RDLAHAVNFMLHRLDGDVQQLAQFSDDLAHELRSPMNNLMGKAQVTLSRPRPSEEYKQA
FT                   LESCTEELERMSRMISQMLFLASVSQPAAPLPLEVIDLGEEAEKVAELFSSSAEDRDIT
FT                   LQVHVAAKVSGDKLMIQRAISNLLSNAIRHGLAGSVITITLDTHEDEVWLAVRNAGDGI
FT                   DAEHLPRLFDRFYRVHVSRARQQGGTGLGLAIVRSIMSLHEGQVTVQSEPGQFTTFNLI
FT                   FPRRV"
FT   gene            420719..421120
FT                   /locus_tag="PSPTO_0380"
FT                   /old_locus_tag="PSPTO0380"
FT   CDS_pept        420719..421120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0380"
FT                   /old_locus_tag="PSPTO0380"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53924"
FT                   /db_xref="GOA:Q88AL0"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AL0"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53924.1"
FT                   /translation="MTVAFWCVLVAILLPIICAGIAKFGSGKFGSGHNHDPRAFLDKLE
FT                   GFPRRAHAAQLNSFEVTPAFAAAVIIAHIAGNAQLVTIDVLAVLFITSRLLYIIFYLAD
FT                   LAALRSVVWLAGMGLIIALFGVSAFPAVS"
FT   gene            complement(421174..421584)
FT                   /locus_tag="PSPTO_0381"
FT                   /old_locus_tag="PSPTO0381"
FT   CDS_pept        complement(421174..421584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0381"
FT                   /old_locus_tag="PSPTO0381"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:606038; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53925"
FT                   /db_xref="GOA:Q88AK9"
FT                   /db_xref="InterPro:IPR009468"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AK9"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53925.1"
FT                   /translation="MQFLSPLILFTSCTLLATSLLAAEQAPPPSECLIKSQQISSQIQD
FT                   AKTEGNKAEQSGLEKALAEVNANCTETSLLKQREQKVLDAKREVSRRQTDLNKAMDKGD
FT                   PEKINKRKDKLAESRKELQEAQTDLEKVQSDD"
FT   gene            complement(421625..423310)
FT                   /locus_tag="PSPTO_0382"
FT                   /old_locus_tag="PSPTO0382"
FT   CDS_pept        complement(421625..423310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0382"
FT                   /old_locus_tag="PSPTO0382"
FT                   /product="DNA ligase, NAD-dependent, putative"
FT                   /note="similar to SP:O87703; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53926"
FT                   /db_xref="GOA:Q88AK8"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR020923"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88AK8"
FT                   /protein_id="AAO53926.1"
FT                   /translation="MLPALRLMTCALLTFFTTLSHASQCPDWSHARASSEITALQQQIA
FT                   SWDDSYHRQGLSQIPDELYDQSRQKLNDWRSCFAVSTPQANPLKTATGPLAHPVPHTGV
FT                   NKLADEKDVKAWLKGRTDLWIQPKVDGVAVTLVYDEGRLVQAISRGDGTQGQDWTPQAR
FT                   LIKAIPQQLPQPDSLILQGELYWRLTDHVQAASGSVNARSKVAGMLARQTISPQQADAI
FT                   GLFVWDWPDGPADMAQRLAGLQAMGFNHSVAYTHPLENHAQAADWREHWYRNPLPFATD
FT                   GVIMRQGQRPPAQRWQASAPYWIAAWKHPYAQALAEVRKVHFNIGRTGKIAPVLELTPV
FT                   RLDDRTVSRISAGSLSRWEKLDIRPGDHIAVSLAGLTIPRLDGVVSRAAERAEMSVPHA
FT                   SDYHESSCWQAAPGCESQFRARLVWLSGKKGLALPGVGPGTWDKLIESGHISGLLDWMT
FT                   LNHAELANIPGLAERSSDKLLDSLQTARERPFQTWLKAIGLPPAGNAKLPDNWHDLAER
FT                   SVEQWQAEPGIGPGRAAKLRAFFQDPHVQALSQQLQAQGISGFK"
FT   gene            complement(423533..424723)
FT                   /gene="metK"
FT                   /locus_tag="PSPTO_0383"
FT                   /old_locus_tag="PSPTO0383"
FT   CDS_pept        complement(423533..424723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="PSPTO_0383"
FT                   /old_locus_tag="PSPTO0383"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /note="similar to SP:P04384; identified by sequence
FT                   similarity; putative; see PMID:20190049 for expression
FT                   data; similar to SP:P04384, identified by sequence
FT                   similarity, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53927"
FT                   /db_xref="GOA:Q88AK7"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88AK7"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53927.1"
FT                   /translation="MSEYSLFTSESVSEGHPDKIADQISDAVLDAIIAEDKYARVACET
FT                   LVKTGVAIIAGEVSTSAWVDLEDIVRNVILDIGYNSSDVGFDGATCGVMNIIGKQSVDI
FT                   AQGVDRSKPEDQGAGDQGLMFGYASNETDVLMPAPITFSHQLVQRQAEARKSGLLPWLR
FT                   PDAKSQVTCRYENGKVVGVDAIVLSTQHNPDVSYKDLREGVMELIVKHVIPAHLLHKDT
FT                   QFHINPTGNFIIGGPVGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAGR
FT                   YVAKNIVAAGLAERCEIQVSYAIGVAQPTSISLNTFGTGKLSDDKIIKLVRDNFDLRPY
FT                   AITTMLDLLHPMYQATAAYGHFGRTPVEMTVGDDTFTAFTWEKTDRADALRAAAGL"
FT   gene            complement(424744..425739)
FT                   /locus_tag="PSPTO_0384"
FT                   /old_locus_tag="PSPTO0384"
FT   CDS_pept        complement(424744..425739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0384"
FT                   /old_locus_tag="PSPTO0384"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to TIGR protein family HMM TIGR00740"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53928"
FT                   /db_xref="GOA:Q88AK6"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AK6"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53928.1"
FT                   /translation="MNLRVPAIRHDACDDLSALCKAGGDPLRLNVLRALSNDSFGVLEL
FT                   AQIFAIGQSGMSHHLKVLAQADLVATRREGNAIFYRRALPHTDLPGGRLHAALLDEIDT
FT                   LGLPDDVQGRISLVHRQRALASQDFFARTAEKFRAQQDLIAGLAQYSESLLTLLDKLSF
FT                   GAQATALEVGPGDGGFLPELAQRFQQVIAMDSSPAMLELARGLCERRALANVELRLADA
FT                   LTDTKVSADCVVLNMVLHHFAAPAEALRQLADHVKPGGSLLVTELCSHDQSWAREACGD
FT                   LWLGFEQEDLARWAIAAGLVPGESLYVGLRNGFQIQVRHFQRPAGNTHHR"
FT   gene            425999..427996
FT                   /gene="tkt"
FT                   /locus_tag="PSPTO_0385"
FT                   /old_locus_tag="PSPTO0385"
FT   CDS_pept        425999..427996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tkt"
FT                   /locus_tag="PSPTO_0385"
FT                   /old_locus_tag="PSPTO0385"
FT                   /product="transketolase"
FT                   /note="similar to SP:P27302; identified by sequence
FT                   similarity; putative; see PMID:20190049 for expression
FT                   data; similar to SP:P2730, identified by sequence
FT                   similarity, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53929"
FT                   /db_xref="GOA:Q88AK5"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AK5"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53929.1"
FT                   /translation="MPSRRERANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWRDYL
FT                   KHNPTNPSFADRDRFIMSNGHGSMLVYSLLHLTGYDLSIDDLKNFRQLHSRTPGHPEFG
FT                   YTPGVETTTGPLGQGFANAVGFAAAEKTLAAQFNRPGHSIVDHHTYVFMGDGCMMEGIS
FT                   HEVASLAGTLQLGKLIAFYDDNGISIDGEVEGWFTDDTPKRFEAYGWQVIRNVDGHDAD
FT                   EIKTAIDTARKSDQPTLICCKTTIGFGSPNKQGKEESHGAPLGADEIALTRAALKWNHG
FT                   PFEIPADIYAEWNAKEKGLAVEAEWDQRFAAYSAAFPELANEFIRRMSGELPADFAEKS
FT                   AAYVAEVNAKGETIASRKASQNALSALGPLLPEILGGSADLAGSNLTIWKGCKSITGED
FT                   PNGNYLHYGVREFGMAAMMNGIALHGGFVPYGATFLIFMEYARNAVRMASLMKKRVIYV
FT                   FTHDSIGLGEDGPTHQPIEQLTSLRTTPNLDTWRPADAVESAVAWKYSLERNDGPSALI
FT                   FSRQNLTHQAREQQQIDAIARGGYVLRDCAAEPELILIATGSEVGLAVEAYEKLTAQGR
FT                   NVRVVSMPCTSVFEAQDAGYKQAVLPLQVSARIAIEAAHADYWYKYVGLEGRVIGMTTF
FT                   GESAPAPLLFEEFGFTLENVLSIAEELLED"
FT   gene            428140..429183
FT                   /gene="epd"
FT                   /locus_tag="PSPTO_0386"
FT                   /old_locus_tag="PSPTO0386"
FT   CDS_pept        428140..429183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="epd"
FT                   /locus_tag="PSPTO_0386"
FT                   /old_locus_tag="PSPTO0386"
FT                   /product="D-erythrose 4-phosphate dehydrogenase"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P11603, GB:M22404, and PID:188866; identified by
FT                   sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53930"
FT                   /db_xref="GOA:Q88AK4"
FT                   /db_xref="InterPro:IPR006422"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AK4"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53930.1"
FT                   /translation="MPQPRPYKVALNGYGRIGRCVVRALCERGTKAGFEVVAINDLADM
FT                   ASLEYLTRFDSTHGRFPGEVRVEGQYLHINDHRIKVLRSATPEGIDWAGLEVDLVLECS
FT                   GVYNTRDDGQRFLAAGAPRVLFSQPMASERDVDATVVFGINQQKMTGRELLVSAASCTT
FT                   NCSVPLLRLLDQAIGLEYITITTIHSAMNDQPVIDAYHHEDLRRTRSAFQSIIPVSTGL
FT                   ARGIERLLPELAGRIQAKAVRVPTVNVSCLDITLQTARDTDAVEINRILREAATSGPLK
FT                   GLLAYTELPHASCDFNHDPHSSIVDASQTRVSGPRLVNLLAWFDNEWGFANRMLDVADH
FT                   FLRVADQ"
FT   gene            429206..430369
FT                   /gene="pgk"
FT                   /locus_tag="PSPTO_0387"
FT                   /old_locus_tag="PSPTO0387"
FT   CDS_pept        429206..430369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="PSPTO_0387"
FT                   /old_locus_tag="PSPTO0387"
FT                   /product="phosphoglycerate kinase"
FT                   /note="identified by match to PFAM protein family HMM
FT                   PF00162; see PMID:20190049 for expression data; identified
FT                   by match to PFAM protein family HMM PF00162"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53931"
FT                   /db_xref="GOA:Q88AK3"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88AK3"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53931.1"
FT                   /translation="MTVLKMTDLDLQGKRVLIREDLNVPIKDGVVSSDARILASLPTIR
FT                   LALEKGAAVMVCSHLGRPTEGEFSAENSLKPVAEYLSKALGRDVPLVADYLDGVDVKAG
FT                   DIVLFENVRFNKGEKKNADELAQKYAALCDVFVMDAFGTAHRAEGSTHGVAKYAKVAAA
FT                   GPLLAAELEALGKALGAPAQPMAAIVAGSKVSTKLDVLNSLSAICDQLIVGGGIANTFL
FT                   AAAGHKVGKSLYEPDLLDTARAIAAKVSVPLPTDVVVAKEFAESATATVKLIADVADDD
FT                   MILDIGPQTAAHFAELLKSSGTILWNGPVGVFEFDQFGEGTKTLAKAIAESKAFSIAGG
FT                   GDTLAAIDKYGVADQISYISTGGGAFLEFVEGKVLPAVEMLEQRARA"
FT   gene            430397..430630
FT                   /locus_tag="PSPTO_0388"
FT                   /old_locus_tag="PSPTO0388"
FT   CDS_pept        430397..430630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0388"
FT                   /old_locus_tag="PSPTO0388"
FT                   /product="lipoprotein, putative"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53932"
FT                   /db_xref="GOA:Q88AK2"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AK2"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53932.1"
FT                   /translation="MVRALPWFLIAGLLAGCAGKPAADEVESDSQTQPLQLSCYQAGWQ
FT                   AETVPVIYKRGGPEVWDRYEFMPRKTGSVGCL"
FT   gene            430717..431043
FT                   /locus_tag="PSPTO_0389"
FT                   /old_locus_tag="PSPTO0389"
FT   CDS_pept        430717..431043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0389"
FT                   /old_locus_tag="PSPTO0389"
FT                   /product="lipoprotein, putative"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53933"
FT                   /db_xref="GOA:Q88AK1"
FT                   /db_xref="InterPro:IPR018660"
FT                   /db_xref="InterPro:IPR036328"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AK1"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53933.1"
FT                   /translation="MKGVIALGVFALLGGCSSMSTPQQNDPWNRWVCDSNAEVNWRYID
FT                   SAKKEVDVRLNQSDQVFRLKAEPGAASGTLYSNNVLAFVNKGSEGLIYWDATNDLIGRG
FT                   CKAR"
FT   gene            431157..432221
FT                   /gene="fba"
FT                   /locus_tag="PSPTO_0390"
FT                   /old_locus_tag="PSPTO0390"
FT   CDS_pept        431157..432221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /locus_tag="PSPTO_0390"
FT                   /old_locus_tag="PSPTO0390"
FT                   /product="fructose-bisphosphate aldolase, class II"
FT                   /note="similar to SP:O87796; identified by sequence
FT                   similarity; putative; see PMID:20190049 for expression
FT                   data; similar to SP:O87796, identified by sequence
FT                   similarity, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53934"
FT                   /db_xref="GOA:Q88AK0"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006412"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AK0"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53934.1"
FT                   /translation="MALISMRQMLDHAAEFGYGVPAFNVNNLEQMRAIMEAADKTDSPV
FT                   IVQASAGARKYAGAPFLRHLILAAIEEFPHIPVVMHQDHGTSPDICQRSIQLGFSSVMM
FT                   DGSLREDGKTPADYDYNVDVTRRVVAFAHACGVSVEGELGVLGSLETGMAGEEDGVGAE
FT                   GVLDHSQMLTDPEEAADFVKRTQVDALAIAIGTSHGAYKFTKPPTGDILAIERIKEIHK
FT                   RIPNTHLVMHGSSSVPQEWLKIINEFGGDIKETYGVPVEEIVEGIKHGVRKVNIDTDLR
FT                   LASTGAIREFMAKHPSEFDPRKYLAKTVSAMRDVCIARYEAFGTAGNASKIKPVSLDAM
FT                   FERYARGELDAKIN"
FT   gene            complement(432379..432798)
FT                   /locus_tag="PSPTO_0391"
FT                   /old_locus_tag="PSPTO0391"
FT   CDS_pept        complement(432379..432798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0391"
FT                   /old_locus_tag="PSPTO0391"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID: 20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53935"
FT                   /db_xref="GOA:Q88AJ9"
FT                   /db_xref="InterPro:IPR021378"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AJ9"
FT                   /inference="ab initio prediction:Easygene:1.2"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53935.2"
FT                   /translation="MIICGVEIKGSEAIFALATRQGGDIGHLPLATKKLALEDDDEAAN
FT                   VKVFASQLAGFVRENGVSHVVIKKRSKKGEFAGGPTTFKIETIFQLMSDCEVLLISPQT
FT                   INAQNKKHNFALPDTLNKYQHEAYKAACAGLMKSV"
FT   gene            complement(432854..433264)
FT                   /locus_tag="PSPTO_0393"
FT                   /old_locus_tag="PSPTO0393"
FT   CDS_pept        complement(432854..433264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0393"
FT                   /old_locus_tag="PSPTO0393"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53937"
FT                   /db_xref="GOA:Q88AJ7"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AJ7"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53937.1"
FT                   /translation="MKTFLLTLALMATAVTGVQAAQNPDASPCDGVDDDKQTLECSVYS
FT                   RTTAEELLKENFNNLLKRVQSQFVANKTQYNDFTSKLKTAQQAWEKLRDADCAVDVFPS
FT                   AAGSKAFTISENDCIARMSDERSEYLESIAQE"
FT   gene            433493..434470
FT                   /locus_tag="PSPTO_0394"
FT                   /old_locus_tag="PSPTO0394"
FT   CDS_pept        433493..434470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0394"
FT                   /old_locus_tag="PSPTO0394"
FT                   /product="renal dipeptidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53938"
FT                   /db_xref="GOA:Q88AJ6"
FT                   /db_xref="InterPro:IPR008257"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AJ6"
FT                   /protein_id="AAO53938.1"
FT                   /translation="MSPAELHADSIVIDGLIIAKWNRELFEDMRKGGLTMANCTVSVWE
FT                   GFQATINSICTSQKLMRENSDLVMPVHTTADIRKAKELGKTGILFGFQNAHAYEDQIGY
FT                   VEIFKQLGVGIVQMCYNTQNLVGTGCYERDGGLSGFGREIVAEMNRVGVMCDLSHVGSK
FT                   TSEEVILESKKPVCYSHCLPSGLKEHPRNKSDAELKFIADHGGFVGVTMFAPFLAKGIE
FT                   STIDDYAEAIEYVMNIVGEDAIGIGTDFTQGHGQDFFEYLTHDKGYARRLTSFGKIINP
FT                   LGIRTVGEFPNLTETLLRRGHPERVVRKIMGENWVNVLADVWGE"
FT   gene            434554..435084
FT                   /locus_tag="PSPTO_0395"
FT                   /old_locus_tag="PSPTO0395"
FT   CDS_pept        434554..435084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0395"
FT                   /old_locus_tag="PSPTO0395"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53939"
FT                   /db_xref="GOA:Q88AJ5"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AJ5"
FT                   /protein_id="AAO53939.1"
FT                   /translation="MAKIAPQLPIEVDSETGVWTSDALPMLYVPRHFFVNNHIGIEEVL
FT                   GADAYADILYKAGYKSAWHWCEKEAECHGLQGVAVFEHYMKRLSQRGWGLFRIQDIDIE
FT                   KGTASVKLEHSCFVYVYGKVGRKVDYMFTGWFAGAMDQILAASGSSIRTVAEQIYGGSE
FT                   EGHDDGLFVVKPL"
FT   gene            435100..437160
FT                   /locus_tag="PSPTO_0396"
FT                   /old_locus_tag="PSPTO0396"
FT   CDS_pept        435100..437160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0396"
FT                   /old_locus_tag="PSPTO0396"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53940"
FT                   /db_xref="GOA:Q88AJ4"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AJ4"
FT                   /protein_id="AAO53940.1"
FT                   /translation="MAFEAMFQPIQIGKLTIRNRVLSTAHAEVYATDGGMTTDRYVKYY
FT                   EEKAKGGIGLAICGGSSSVAIDSPQGWWKSVNLATDRIIPHFQNLADAMHKHGAKIMIQ
FT                   ITHMGRRSRWDGDHWPTLMSPSGIREPVHRATCKTIEPEEIWRVIGNYASAAARAKAGG
FT                   LDGVELSAVHQHMIDQFWSPRVNKRTDEWGGSFENRMRFGLEVIKAVRKEVGPDFCVGL
FT                   RICGDEFHPDGLSHEDMKQIAKYYDDTGLIDFLGVVGSGCDTHNTLANVIPNMSYPPEP
FT                   FLHLAAGIKEVVKAPVLHAQNIKDPNQATRILEGGYVDMVGMTRAHIADPHLIAKIKMG
FT                   QIDQIKQCVGANYCIDRQYQGLDVLCIQNAATSREYMGVPHIIEKSAGPKRKVVVVGAG
FT                   PAGMEAARVSAERGHDVTLFEKKAFIGGQITTASKAPQRDQIAGITRWFQLELARLKVD
FT                   LRLGTAADAATILDLRPDIVVLAVGGHPFLEQNEHWGAAEGLVVSSWDVLDGKVAPGKN
FT                   VLVYDTICEFTGMSVADFLADKGCQVEIVTDDIKPGVAIGGTSFPTYYRSMYPKEVIMT
FT                   GDMMLEKVYREGDKLVAVLENEYTGAKEERVVDQVVVENGVRPDEAIYYALKEGSRNKG
FT                   QIDIDALFAIEPQPSLSQPGDGYLLFRIGDCVAQRNTHAAIYDGLRLCKDF"
FT   gene            437235..439244
FT                   /locus_tag="PSPTO_0397"
FT                   /old_locus_tag="PSPTO0397"
FT   CDS_pept        437235..439244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0397"
FT                   /old_locus_tag="PSPTO0397"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53941"
FT                   /db_xref="GOA:Q88AJ3"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR021872"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AJ3"
FT                   /protein_id="AAO53941.1"
FT                   /translation="MQLKARTLKLAPEVNVMLDTLLPILLFSALALAALGAWRRVNMWR
FT                   MGRASRVDLLGGLLAMPKRYMVDLHHVVARDKYIANTHVATAGGAVASVVLAILVHGFG
FT                   LHNRVLGYALLLMTAVMFVGAVFVYRRRLNPPARLSKGPWMRLPKSLMAFSASFFLVTL
FT                   PVAGILPEHFGGWVLVAILGLGVLWGVSELFFGMTWGGPMKHAFAGALHLAWHRRAERF
FT                   GGGRSTGLKPLDLNDRTAPLGVEKPADFTWNQLLGFDACVQCGKCEAACPAFAAGQPLN
FT                   PKKLIQDMVVGLAGGTDAKFAGSPYPSLDGKGKPLGEHGGNPHQPIVNGLVDAETLWSC
FT                   TTCRACVEECPMMIEHVDAIVDMRRYLTLEKGATPNKGAQVLDNLIATDNPGGFAPGGR
FT                   MNWAADLNLDLLSVRKTVDVLFWVGDGAFDMRNQRTLRAFVKVLKAARVDFAVLGLEER
FT                   DSGDVARRLGDEATFQTLARRNIQTLAQYHFKRIVTCDPHSFHVLKNEYGALGGDYQVQ
FT                   HHSTFMAELVQRGTLNLSQHKGASVTYHDPCYLGRYNGEYEAPREVLRALGIEVREMQR
FT                   SGFRSRCCGGGGGAPITDIPGKQRIPDMRMDDIRQTAAEVVAVGCPQCTAMLEGVVEPR
FT                   PLIKDIAELVADALVEEVIPSPSVAAKREPAEVH"
FT   gene            439478..440464
FT                   /gene="etfA-1"
FT                   /locus_tag="PSPTO_0398"
FT                   /old_locus_tag="PSPTO0398"
FT   CDS_pept        439478..440464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="etfA-1"
FT                   /locus_tag="PSPTO_0398"
FT                   /old_locus_tag="PSPTO0398"
FT                   /product="electron transfer flavoprotein, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53942"
FT                   /db_xref="GOA:Q88AJ2"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AJ2"
FT                   /protein_id="AAO53942.1"
FT                   /translation="MPLHVIATPAFYINVVPDMVGGRLSSHDRDVLGLARQLAGAEGAV
FT                   LAVVFGEHKETAFDSAGVDRLLLLDGNESDGYSPEQRVQGLRAVDNQFGPQRWVFPDSR
FT                   TGGGELGRRFAASLGERPATRVWQVKGEHCTSRAGAGREDLVRPLARLMLADVECAEPV
FT                   SETRHEALPVELSTGAARSLSRIEDLGAVAVDPAVIPMAEAEFILSGGNGVKDWDLFHR
FT                   AALVLGATEGASRVAVDDGFMGRERQVGASGTWVTARVYLAVGISGAIQHLQGIGACDK
FT                   VIAINLDAGCDMIKRADLSVIGDGGEILTALVAAVQAWRNGEKRDAA"
FT   gene            440454..441251
FT                   /gene="etfB-1"
FT                   /locus_tag="PSPTO_0399"
FT                   /old_locus_tag="PSPTO0399"
FT   CDS_pept        440454..441251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="etfB-1"
FT                   /locus_tag="PSPTO_0399"
FT                   /old_locus_tag="PSPTO0399"
FT                   /product="electron transfer flavoprotein, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53943"
FT                   /db_xref="GOA:Q88AJ1"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AJ1"
FT                   /protein_id="AAO53943.1"
FT                   /translation="MRPDVPVDKHDVQIISLVSVGAHPTSGRARRAEQDARAVELGLQL
FT                   VGDNLQVLHAGNPAEPALRAYLGMGLSELHVLEQPDGADALAALTDYIRDSGAQMVLAG
FT                   SQAETGEGSGMLPFLLAEGLGWPLVTGLAEVESLSNGTALVLQALPRGQRRRLKVRLPF
FT                   LATVDNAAPAPRQSAYGPAQRGILDVDKIETVIDDLFTAQSLQPAKPRPKRLKVIKAKS
FT                   GADRMKAATAKASGGSGQVLKGLSPEQSAAAILKLLIDEGVVR"
FT   gene            complement(441859..443655)
FT                   /locus_tag="PSPTO_0400"
FT                   /old_locus_tag="PSPTO0400"
FT   CDS_pept        complement(441859..443655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0400"
FT                   /old_locus_tag="PSPTO0400"
FT                   /product="chitinase"
FT                   /note="similar to GP:4587115, and GP:14578848; identified
FT                   by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53944"
FT                   /db_xref="GOA:Q88AJ0"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AJ0"
FT                   /protein_id="AAO53944.1"
FT                   /translation="MLNPKIINQYKNKKVDAASDMPDIRGKNILMGFWHNWPSEPGQGY
FT                   QQGLFKEMQLTDIPEAYNVVAVAFMKGAGIPTFKPYNLSDEAFRAQVAALNAQGRAVLI
FT                   SLGGADAHIELHAGQEEPLAYEIIRLVEVYGFDGLDIDLEQAAITFADNRTVLPAALRM
FT                   VREHYETEGKHFIISMAPEFPYLRASKKLPALKEITTYFPILKEFVTFLESFRSGGAYL
FT                   AYINALEDIYDFIAPQYYNQGGDGIWVEELNLWVTQNNDAHKKAFLYYLTDSLIHGTRG
FT                   FTKIPADRLAIGLPTNNDAAATGYVINPQDVKDALQELKDAGNPIRGLMTWSVNWDAGK
FT                   DKTGKDYNWEFVNRYGYLTGGETPVPDKPPAPADLTLSWQTKDSVTLIWRLSEGAHPIR
FT                   VYNLFKNGTPVGDPTAPPFVDTDVSPGAVYDYQISATDIEGNTSDLSTVLTVYMDHDQP
FT                   PSAPTDLKATDITAYSVSLEWTAPSGPHRIKQYIVYRNRMRLITVTAPQTTYTDAGLTP
FT                   ETDYVYEISAQDKDDAVSAGSESLTVTTELDSGGNVTVWAPGVQYQAGNEVTHQGISYR
FT                   CLQSHKSIPEWSPELPGSASLW"
FT   gene            complement(443858..445090)
FT                   /locus_tag="PSPTO_0401"
FT                   /old_locus_tag="PSPTO0401"
FT   CDS_pept        complement(443858..445090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0401"
FT                   /old_locus_tag="PSPTO0401"
FT                   /product="iron-sulfur cluster-binding protein, Rieske
FT                   family"
FT                   /note="identified by match to PFAM protein family HMM
FT                   PF00848"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53945"
FT                   /db_xref="GOA:Q88AI9"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AI9"
FT                   /protein_id="AAO53945.1"
FT                   /translation="MLQNRERTYSLPQPFYSDDRLFEIDMQEIFHKEWLIAGMTCEIPT
FT                   KGNFLTLQIGKNPILVVRGPDGAVNAFHNVCRHRGSRLCTAEKGKVAKLVCHYHQWTYE
FT                   LDGRLLYAGTEMGDDFDMKQFGLKPVHVKTAGGYIFISLAENPPAIDEFLATLKHYMEP
FT                   YDMENTKVAVQTTLMEKANWKLVLENNRECYHCGGAHPELLKTLLEWDDVTDPRADQAF
FT                   KDHVAASAAAWDAEKIPYAHASFGLRNRIVRMPLLKGTVSMTMDGKVGCKKLMGRIQNP
FT                   ELGSMRILHLPHSWNHCMGDHIIVFTVWPISAQETMVSTKWIVHKDAVEGVDYDVARMR
FT                   QVWDATNDQDRRLAEENQRGINSTAYQPGPYSKTYEFGVVNFIDWYSARMLENLGAEPA
FT                   PYLKGVAVNHE"
FT   gene            445454..446554
FT                   /locus_tag="PSPTO_0402"
FT                   /old_locus_tag="PSPTO0402"
FT   CDS_pept        445454..446554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0402"
FT                   /old_locus_tag="PSPTO0402"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /note="similar to GP:15073802; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53946"
FT                   /db_xref="GOA:Q88AI8"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AI8"
FT                   /protein_id="AAO53946.1"
FT                   /translation="MSQSFLSPVTTQTWANGRHLVRVVKVIQETWDVRTFCFMADQPIM
FT                   FFFKPGQFVTLELEIDGVPIMRSYTISSSPSVPYSFSITVKRVPGGKVSNYLHDTLSEG
FT                   QELAVHGPVGLFNAIDFPNPKILYLSGGVGITPVMSMARWFYDTNANVDMVFVHSARSP
FT                   KDIIYHRELEHMASRIDNFSLHLVCEKHGLGEPWAGYRGYLNQKMLELMAPDFMDREVF
FT                   CCGPTPYMTAVKRLLQENGFNMAQYHEESFGATPPEARADAVEQAEIAADAPDVDAADL
FT                   HQVEFTDTGKSIRVAPGETVHAAAAKLGLMIPKACGMGICGTCKVMKLSGEVEMEHNGG
FT                   ITDEDVAEGYILSCCSVPKGDVRIEY"
FT   gene            complement(446683..446949)
FT                   /locus_tag="PSPTO_0403"
FT                   /old_locus_tag="PSPTO0403"
FT   CDS_pept        complement(446683..446949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0403"
FT                   /old_locus_tag="PSPTO0403"
FT                   /product="conserved domain protein"
FT                   /note="similar to GP:9951704; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53947"
FT                   /db_xref="GOA:Q88AI7"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AI7"
FT                   /protein_id="AAO53947.1"
FT                   /translation="MMHADLIDQEDLLGQLRALGFETPGGATAEQACAHAVCGLNAERA
FT                   TALRRLVEQLLSGSATLLPAVRQAIDQQLLPALAIYRQGQKGS"
FT   gene            447686..448522
FT                   /locus_tag="PSPTO_0404"
FT                   /old_locus_tag="PSPTO0404"
FT   CDS_pept        447686..448522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0404"
FT                   /old_locus_tag="PSPTO0404"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GB:J04111, SP:P05412, and PID:386839; identified by
FT                   sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53948"
FT                   /db_xref="GOA:Q88AI6"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AI6"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53948.1"
FT                   /translation="MNYRHAYHAGNHADVFKHLTLTRLIALMARKEQPFAYLDTHAGLG
FT                   LYDLKGDQATRTGEWLEGIGRLWNIPDLPALAADYLQVLHDMNPDGELRYYPGSPELAR
FT                   RLTRERERVLLNEKHPEDGRLLKENMKGDRRVAVHLGEGWHVPRALLPVAEKRAVMLID
FT                   PPFEQLDEMKRCAVALKETIGRMRQTVAAIWYPIKDPRLLRRFYQDLAETGAPKLLRVE
FT                   LYVHPLDTPASLNGSGLAIANPPWGLEEELRELMPYLAEKLGQTQGGWKMDWLIAE"
FT   gene            complement(448752..449399)
FT                   /gene="msrA"
FT                   /locus_tag="PSPTO_0405"
FT                   /old_locus_tag="PSPTO0405"
FT   CDS_pept        complement(448752..449399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /locus_tag="PSPTO_0405"
FT                   /old_locus_tag="PSPTO0405"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53949"
FT                   /db_xref="GOA:Q88AI5"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88AI5"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53949.1"
FT                   /translation="MTLRSEILVNKNVLPTAEQALPGRETPMTLPETHFVNGNPLLGPF
FT                   TSNVEFAIFGLGCFWGAERRLWQQEGVVSTVAGYAGGFTPNPTYEEVCSGLTGHTEVVL
FT                   VVYEPEKISYDSLLKVFWEAHNPTQGMRQGNDIGTQYRSVIYCTTPEQLAAAKASADAF
FT                   QAELSKAGLGGITTEIEEAPTVYFAETYHQQYLAKNPQGYCGLGGTGVCLPA"
FT   gene            complement(449550..452243)
FT                   /locus_tag="PSPTO_0406"
FT                   /old_locus_tag="PSPTO0406"
FT   CDS_pept        complement(449550..452243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0406"
FT                   /old_locus_tag="PSPTO0406"
FT                   /product="sensory box/GGDEF domain/EAL domain protein"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53950"
FT                   /db_xref="GOA:Q88AI4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AI4"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53950.1"
FT                   /translation="MKSQTDAAGRSAAEVVTQLPVPSRLGMLRFERLNEANWALLFLDP
FT                   NCEKQLGLPAVDLCALIGSPYASLMEPQARYQLHDDIQLQLASSPNYLIRYTLHSPKGP
FT                   LGLLEIGEAYKQHNRHLLRGYFMIVEDLVTDGESVTDSDLETRNSRLQIALELNQRAQR
FT                   DQFAHLERVRAQQDLILRLTRHRYTTANTLLEAAELITRSACDIYDVDHASIWNLNDKR
FT                   LEPITDYRRESGDYQTRTAIDISAYPTYLQALNTSRAIDASNIQTDPRTREMAISLRPG
FT                   ETRAVLDASIRIDGQVIGVLCLEQSGSTREWQSDEIAFAGELADQFAQVINNHNRRAAT
FT                   NALHLFQRAVEQSANAFLLVNCNGVVEYVNPSFTAITQYSSEEVSGNKLSELPALENLN
FT                   QLLLEANSSLTSSNSWQGEFKSRRKNLEPYWGQLSISKVYGDNRELTHYIGIYEDITQS
FT                   KLAQQRIERLAYTDNLTNLGNRPAFIRNLDERFARDTDTPMSLLLVDIDNFKRINDSLG
FT                   HQTGDKLLISLARRLRNTLSPTDVLARFASNEFAVLLDNTGQEAGQATASQVLATLDKP
FT                   MFVDNQLISVTGSVGLACAPLHGRDPQTLMKNAGLALHKAKANGKHQVQVFTEALNAEA
FT                   SYKLFVENNLRRALTQNELEVFYQPKLCLLTGRLLGMEALLRWNHPEKGMIRPDQFISV
FT                   AEETGLIIPIGKWVARQSCRMSKDLTAAGFGNLQVAINVSPKQFSDPELVSSIAAILKE
FT                   EQLDPSLLELELTEGLLLEATEDTRQQLDSLKKLGLSLAMDDFGTGYSSFSYLKKFPID
FT                   VIKIDRSFIRDIPDDEDDMEITSAVIAMAHNLKLKVVAEGIETAAQLAFLRRHRCDVGQ
FT                   GYLFDRPIPGEELIEKLTRYPRRPSA"
FT   gene            complement(452492..453880)
FT                   /locus_tag="PSPTO_0407"
FT                   /old_locus_tag="PSPTO0407"
FT   CDS_pept        complement(452492..453880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0407"
FT                   /old_locus_tag="PSPTO0407"
FT                   /product="drug resistance transporter, EmrB/QacA family"
FT                   /note="identified by match to TIGR protein family HMM
FT                   TIGR00894"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53951"
FT                   /db_xref="GOA:Q88AI3"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AI3"
FT                   /protein_id="AAO53951.1"
FT                   /translation="MDEKTLRWMPWVIAIAFFMQSLDGTILNTALPSMARSLAEDPLRM
FT                   QSVVIAYMLTIALLIPASGWIADRFGIKRIFFSAILLFSFGSLLCALSNSLTMLVAARI
FT                   IQGLGGALMVPIGRLIVLRAYPRSELVRIMGFITIPGLLGPLLGPTLGGWMVEYLSWHW
FT                   IFLINIPVGLLGCYAVKHFIPDLPGGGRTHFDGIGFILFGAAMVLITIALEGLGELHLP
FT                   HMRVVLLLFAGMGCLAAYWLRAGHIESPLFAPSLFRTRTFAVGIMGNLFARLGSGALPF
FT                   LVPLLLQVALGYSPSQAGMSMLPLAAAGMFAKTVARWLIEHLGYRVILTSNTLLLGILL
FT                   ASLALVDGQTPYWILLIHLGLLGAVNSLQFTAMNTVTLIDLDDASAASGNSLLSVVAQL
FT                   SLSLGVASAAALLGGFSEEVTSGEVSSVLGAFQLTFLSVGVLAMFAAGIFLQLPPKEVK
FT                   AAKA"
FT   gene            complement(453914..455239)
FT                   /locus_tag="PSPTO_0408"
FT                   /old_locus_tag="PSPTO0408"
FT   CDS_pept        complement(453914..455239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0408"
FT                   /old_locus_tag="PSPTO0408"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53952"
FT                   /db_xref="GOA:Q88AI2"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AI2"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53952.1"
FT                   /translation="MSHQQQFEALVAVLKAAISPTEHFTLAYDAEASDFIRFNHGQVRQ
FT                   AGRVQQVIATFKLINDGRHANLEVTLSGDSETDTQRLTDALQQLRETLPALAKDPYLLP
FT                   NTEAWQSSNVQDLPLPDSAQVVEQICELSGELDLVGFYAAGPLYRGFASSWGALGWHQA
FT                   NSFNFDWSLFHENGQAVKANYAGHHWNNEAFVRRFEQAREQLEFLGRPLHTLEPGQYRA
FT                   YLAPAAVDEIIGMLTWGGFSAQALASKRSPLQRLYDGDTRFSPLFNVEEHVSGSLSPAF
FT                   SREGYPRKDLTLIVDGQARERLVDSSSAAEYDLPANGADYGEGPSALDIAGGSLELDQV
FT                   LEKLGTGLYISNLWYLNFSDRAAARLTGMTRFATFWVEEGRIVAPVSTMRFDDSAYSLL
FT                   GSALEDLTRERELILQSSTYTQRQTGSIQLPGALVSHITFTL"
FT   gene            complement(455239..456681)
FT                   /locus_tag="PSPTO_0409"
FT                   /old_locus_tag="PSPTO0409"
FT   CDS_pept        complement(455239..456681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0409"
FT                   /old_locus_tag="PSPTO0409"
FT                   /product="TldD/PmbA family protein"
FT                   /note="similar to GB:U01216, SP:P16533, GB:M24197,
FT                   PID:397994, and SP:P55120; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53953"
FT                   /db_xref="GOA:Q88AI1"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AI1"
FT                   /protein_id="AAO53953.1"
FT                   /translation="MFDFSARLKQHFAALQSEAQFFSVRYVRRTGQRLCVRKNVAEPPS
FT                   LSSDEGAMLTVRLNGVEAYAATNDTSRQGLQAALQQAEALARRLAPHALLDLSEQAVST
FT                   ARADYLSPNMDQAFPPLSDCIGLLMAESSAVPKDERLVNWQAILGLETVEQIYLNSAGA
FT                   QLRQAQRFVFPGMSVTAYDGRDSQTRNLGGDNFGQQGGIEVLSSCGLIGSAARVADEAL
FT                   QLILAPNTPTGPRDLLLMPDQMVLQIHESIGHPLELDRILGDERNYAGTSFVKTSDFGS
FT                   LQYGSSLLNVTFDPDIPEQLASYAHDDDGTPANKQFLIRDGLLQRPLGGALSQYRSGLD
FT                   GVANSRACGWNRAPIDRMANLNIEPGDQSMDGLIGTIEHGILMSSNRSWSIDDARNKFQ
FT                   FGCEWGQLIENGELKGVVKNPNYRAISAQFWKNLSAVGDASTFKVLGTPNCGKGEPNQV
FT                   IRVGHASPACVFANVDVFGGDA"
FT   gene            complement(456805..457845)
FT                   /locus_tag="PSPTO_0410"
FT                   /old_locus_tag="PSPTO0410"
FT   CDS_pept        complement(456805..457845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0410"
FT                   /old_locus_tag="PSPTO0410"
FT                   /product="threonine aldolase, low-specificity"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:O50584; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53954"
FT                   /db_xref="GOA:Q88AI0"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR026273"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AI0"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53954.1"
FT                   /translation="MTDQSQQFASDNYSGICPEAWAAMEQANKGHQRAYGDDQWTARAS
FT                   DDFRRLFETDCEVFFAFNGTAANSLALSSLCQSYHSVICSETAHVETDECGAPEFFSNG
FT                   SKLLTARSPGGKLTPESIREVALKRQDIHYPKPRVVTLTQATEVGGVYQPEELKAISAT
FT                   CKELGLHLHMDGARFSNACAFLDASPAELTWKSGVDVLCFGGTKNGMAVGEAILFFDHD
FT                   LAVDFDYRCKQAGQLASKMRFLSAPWVGLLENDAWLKHARHANRCAQLLADLVKDIAGV
FT                   ELMFPVQANGVFLQLSEPAIAALTARGWRFYTFIGNGGARFMCSWDTEEDRVRELAADI
FT                   RLVMQG"
FT   gene            457946..458692
FT                   /locus_tag="PSPTO_0411"
FT                   /old_locus_tag="PSPTO0411"
FT   CDS_pept        457946..458692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0411"
FT                   /old_locus_tag="PSPTO0411"
FT                   /product="membrane protein, putative"
FT                   /note="similar to GP:13661672; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53955"
FT                   /db_xref="GOA:Q88AH9"
FT                   /db_xref="InterPro:IPR008875"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AH9"
FT                   /protein_id="AAO53955.1"
FT                   /translation="MDLSNPPFLPGRNKALDLLKWLAMLSMVLDHLRYVGWSIDFLYVP
FT                   GRFAFPWFCLAIAVNLSRRSAALVAPRVQWRYLGWLLAFAALSEIPYRLFMADATVLNV
FT                   MPTLLLGLLIAQGWQHRNVTTRVMAIVALLLAAVFQQHLMFGFAGVLLPLVFVLVLQKR
FT                   LWYAAFPAVFCLAGNAWSQMFAGAAWGDPVSVGSIIACALAPVLGIALLRTKPEFSVIP
FT                   MRRWAYAIYPLHFLVLLGVRVVLERV"
FT   gene            complement(458865..460061)
FT                   /locus_tag="PSPTO_0412"
FT                   /old_locus_tag="PSPTO0412"
FT   CDS_pept        complement(458865..460061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0412"
FT                   /old_locus_tag="PSPTO0412"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to PFAM protein family HMM PF03602"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53956"
FT                   /db_xref="GOA:Q88AH8"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041532"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AH8"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53956.1"
FT                   /translation="MSLPSLRLKANADRRLRAGHLWVYSNEIDVAATPLNGFAAGDQAL
FT                   LEAAGGKPLGIVAMSPNNLICARLLSRDIKLPLDKSLLVHRINVALSLRERLFDKPFYR
FT                   LVFGDSDLLPGLVVDRFGDILVVQLASATMENHKEDIIAALVQVIKPSGILFKNDSAAR
FT                   DAEGLNRYVETVFGLVPEWVALEENGVKFEAPVMAGQKTGWFYDHRMNRARIAPYVKGK
FT                   RVLDLYSYIGGWGIQAAAFGASDVTCVDASSFALDGVERNAALNGFAEKMTCIEGDVFE
FT                   ALKELKAGEERFDVIVADPPAFIKRKKDMKNGEGAYRRLNEQAMRLLSKDGILISASCS
FT                   MHLPEDDLQNILLTSARHLDRNIQLLERGGQGPDHPVHPAIAETRYIKSITCRLLPNS"
FT   gene            460408..461172
FT                   /locus_tag="PSPTO_0413"
FT                   /old_locus_tag="PSPTO0413"
FT   CDS_pept        460408..461172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0413"
FT                   /old_locus_tag="PSPTO0413"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:9946206, and GP:9946206; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53957"
FT                   /db_xref="GOA:Q88AH7"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AH7"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53957.1"
FT                   /translation="MPDPDLGAIARLIAQDPGLSGALLKIVNSAHYGLSNKIASIDKAV
FT                   NLLGSRTVINLINAQSIRGEMSDETIVALNRFWDTAQDVAMTSLTLAKRIGSQTVDESY
FT                   ALGLFHDCGIPLMLKRFPNYMPVLEDAYANAGPERRIVDTENSAFDTNHSVVGYYTAKS
FT                   WRLPAHITDAIANHHNALAIFEDDTSRNATLKNLLAPLKMAEHICQSYRVLGNQDEDHE
FT                   WESIGALVLDYVGLSEYDFEYLRESIRELGAR"
FT   gene            461218..462030
FT                   /gene="mutM"
FT                   /locus_tag="PSPTO_0414"
FT                   /old_locus_tag="PSPTO0414"
FT   CDS_pept        461218..462030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="PSPTO_0414"
FT                   /old_locus_tag="PSPTO0414"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P05523; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53958"
FT                   /db_xref="GOA:Q88AH6"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88AH6"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53958.1"
FT                   /translation="MPELPEVETTRRGIAPHLEGQRVSRVIVRDGRLRWPVPEDLDIRL
FT                   SGQRIVQVSRRAKYLLIQAEVGTLISHLGMSGNLRLVEAGLAALKHEHVDIELESGLAL
FT                   RYTDPRRFGAMLWSHDPHNHELLIRLGPEPLTDLFDGERLYERSRGKSIAVKPFIMDNA
FT                   VVVGVGNIYATEALFAAGIDPRREARGISRARYLKLAIEIKRILAYAIERGGTTLRDFI
FT                   GGDGKPGYFQQELFAYGRGGQPCKVCGTTLREIKLGQRASVYCPKCQR"
FT   gene            462120..462458
FT                   /locus_tag="PSPTO_0415"
FT                   /old_locus_tag="PSPTO0415"
FT   CDS_pept        462120..462458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0415"
FT                   /old_locus_tag="PSPTO0415"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53959"
FT                   /db_xref="GOA:Q88AH5"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AH5"
FT                   /protein_id="AAO53959.1"
FT                   /translation="MNPFRIFAATLALFIGLQALPAVAADITQGSGDPVYTIQNPPAFA
FT                   MIGDLLIARPLLIGATIIGTGLFVIAAPFAAAGGNLGATGKALVVDPGKAAFVRCLGCT
FT                   GDGYGKQQ"
FT   gene            complement(462467..462718)
FT                   /locus_tag="PSPTO_0416"
FT                   /old_locus_tag="PSPTO0416"
FT   CDS_pept        complement(462467..462718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0416"
FT                   /old_locus_tag="PSPTO0416"
FT                   /product="ferredoxin"
FT                   /note="similar to GP:1518927, GB:M23219, SP:P17583,
FT                   PID:145644, GB:U00096, PID:1657537, and PID:1786536;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53960"
FT                   /db_xref="GOA:Q88AH4"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AH4"
FT                   /protein_id="AAO53960.1"
FT                   /translation="MSLIITDDCINCDVCEPECPNEAISQGEEIYVINPNLCTECVGHY
FT                   DEPQCQQVCPVDCIPLDENHVESKEQLMDKYRIITSNV"
FT   gene            complement(462809..463288)
FT                   /locus_tag="PSPTO_0417"
FT                   /old_locus_tag="PSPTO0417"
FT   CDS_pept        complement(462809..463288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0417"
FT                   /old_locus_tag="PSPTO0417"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /note="similar to SP:Q9X980; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53961"
FT                   /db_xref="GOA:Q88AH3"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88AH3"
FT                   /protein_id="AAO53961.1"
FT                   /translation="MNRVLYPGTFDPITKGHGDLVERASRLFDQVVIAVAASPKKNPLF
FT                   PLEQRVELAREVTKHLPNVEVVGFSTLLAHFAKEQNANVFLRGLRAVSDFEYEFQLANM
FT                   NRQLAPDVESLFLTPSERYSFISSTLVREIATLGGDITKFVHPAVAQALTERFKR"
FT   gene            complement(463456..464883)
FT                   /locus_tag="PSPTO_0418"
FT                   /old_locus_tag="PSPTO0418"
FT   CDS_pept        complement(463456..464883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0418"
FT                   /old_locus_tag="PSPTO0418"
FT                   /product="coniferyl aldehyde dehydrogenase"
FT                   /note="similar to GP:10945819, and GP:6740923; identified
FT                   by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53962"
FT                   /db_xref="GOA:Q88AH2"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AH2"
FT                   /protein_id="AAO53962.1"
FT                   /translation="MLAETMPQHTDPSIEAMHRAFALQRAAFRANPMPSAAQRLQWLKS
FT                   LGEVLSLHRQDLIDAIGADFGQRSADETLLAELLPSLLGIADARKHVKRWMKPSRRRVG
FT                   LMFQPASAKVVYQPLGVIGVIVPWNYPLFLAIGPLIGALAAGNRVMLKLSESTPATGAL
FT                   LKRLLANVFPEDLVAVVLGEAETGMAFSRLPFDHLLFTGASSIGKHVMRAAAENLTPVT
FT                   LELGGKSPAIVSQDVPLQDAAERIAFGKTLNAGQTCIAPDYVLVPKDRLTGFVDAYTAA
FT                   VKRFYPTLIDNPDYTAIINQRQLLRLNHCLEDAENKGATIITLYEQGQDRRMPFSVLLD
FT                   VSDDMLVMQDEIFGPLLPVVPYHRIEDAYAYINQRPRPLALYYFGYDKAEQRQVLERTH
FT                   SGGVSINDTLMHAAQDDLPFGGVGPSGMGNYHGREGFLTFSQAKAVFTKQRLNTARLIY
FT                   PPYGKAIQRLVYKLFMR"
FT   gene            465161..465823
FT                   /locus_tag="PSPTO_0419"
FT                   /old_locus_tag="PSPTO0419"
FT   CDS_pept        465161..465823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0419"
FT                   /old_locus_tag="PSPTO0419"
FT                   /product="transcriptional reguator, TetR family"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:10945820; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53963"
FT                   /db_xref="GOA:Q88AH1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025722"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AH1"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53963.1"
FT                   /translation="MAPRTKTRERIVQASLELFNQQGERCITTNHIAAHMEISPGNLYY
FT                   HFANKQVIIAELFTQYETLVGSFLTLRTDRLPTIEDKRDYFLAMIDAMWRYRFLHQDLE
FT                   HLLTSDAELARRYRRFSYRCLMQAMNIYRGFIKAGILQMDESQIEWTSLNTWIVLTSWV
FT                   RFLCTNRENNAELNESAIRRGVYQVLMLESVFVAPQAREAFDALCETFHSSLPEALA"
FT   gene            465877..466734
FT                   /locus_tag="PSPTO_0420"
FT                   /old_locus_tag="PSPTO0420"
FT   CDS_pept        465877..466734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0420"
FT                   /old_locus_tag="PSPTO0420"
FT                   /product="rhodanese-like domain protein"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:2661707; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53964"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AH0"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53964.1"
FT                   /translation="MSIAQLISPERLAMRQKAPGLVILDCRFALEDADYGQRNYAQGHI
FT                   EGASFADLKRDLSGPAIKGKTGRHPLPEPGALLESIQAWGINADSDVVLYDDGPGMFAA
FT                   RAWWLLAWMGKREGVYLLDGGLKAWHAAGLPLSLDALNHEPGNFSGEPDMSMLLSGSRL
FT                   QSRLGRAEMTLIDARAEARFRGDVEPLDPVAGHIPGAQCAACTDNLGPDGRFLPPEQLR
FT                   QRFAEKLQGRPPESLVSYCGSGVTACHNLFALCLAGYPMGTLYAGSWSEWITDPTREIA
FT                   TGAG"
FT   gene            complement(466742..467755)
FT                   /locus_tag="PSPTO_0421"
FT                   /old_locus_tag="PSPTO0421"
FT   CDS_pept        complement(466742..467755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0421"
FT                   /old_locus_tag="PSPTO0421"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /note="similar to GB:Y00281, SP:P04843, and PID:36053;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53965"
FT                   /db_xref="GOA:Q88AG9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000952"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AG9"
FT                   /protein_id="AAO53965.1"
FT                   /translation="MPHANPFVPAVGMGNPHLQTLWGPLVRRPTLLARSRERLWLKDGD
FT                   FLDMDWHGPNDADAPLVLVLHGLTGSSNSPYVAGLQKAMAAKGWASVALNWRGCSGEPN
FT                   LLSRSYHSGASEDLAEVIAHLRLLRPLAALYAVGYSLGGNVLLKYLGESGKHSELLGAV
FT                   AVSVPFRLDECANRIGQGFSKVYQRHFMREMLTYIRDKQQRFQHEGLTEGLAELSALGS
FT                   LENMRTFWDFDGRVTAPLHGFVDATDYYRRASSRYYLGQIETPTLIIQSRDDPFVFPHS
FT                   LPEPGELSACTEFELHAKGGHVGFVDGSLRNPTYYLERRIPSWLSAAQERESARSS"
FT   gene            complement(467890..468183)
FT                   /locus_tag="PSPTO_0422"
FT                   /old_locus_tag="PSPTO0422"
FT   CDS_pept        complement(467890..468183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0422"
FT                   /old_locus_tag="PSPTO0422"
FT                   /product="virulence-associated protein, putative"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53966"
FT                   /db_xref="GOA:Q88AG8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AG8"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53966.1"
FT                   /translation="MEMFNPPHPGEILLEEVIPGLQTTITEFASHLGFARETLSRILHG
FT                   HAPVSPDLAVRLERAGISSARLWLGIQADYDLWQAEHREQPPIEPYVIANPG"
FT   gene            complement(468196..468474)
FT                   /locus_tag="PSPTO_0423"
FT                   /old_locus_tag="PSPTO0423"
FT   CDS_pept        complement(468196..468474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0423"
FT                   /old_locus_tag="PSPTO0423"
FT                   /product="proteic killer protein, putative"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53967"
FT                   /db_xref="InterPro:IPR007711"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AG7"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53967.1"
FT                   /translation="MIVSWRHKGLKAFFETGSSSGIRADHSKRLAHVLAVLNRARTPAN
FT                   VNMPGWRLHPLKGELEGFWSITINANWRIIFRFFDTDVELVDYLDYH"
FT   gene            complement(468737..469321)
FT                   /locus_tag="PSPTO_0424"
FT                   /old_locus_tag="PSPTO0424"
FT   CDS_pept        complement(468737..469321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0424"
FT                   /old_locus_tag="PSPTO0424"
FT                   /product="methyltransferase, putative"
FT                   /note="similar to GB:D00174, GB:M20781, GB:M20782,
FT                   GB:M20783, GB:M20784, GB:M20785, GB:M20786, GB:D00116,
FT                   GB:J02654, GB:M26072, SP:P08697, PID:177886, PID:178751,
FT                   PID:219408, and PID:219410; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53968"
FT                   /db_xref="GOA:Q88AG6"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AG6"
FT                   /protein_id="AAO53968.1"
FT                   /translation="MANPRPKGHNGLGQLRIIGGEWGSRRLTFPDAPGLRPTPDRVRET
FT                   LFNWLAPYIAGARVLDVFTGSGALFFEALSRGASMGLALDSNAAAIASLRQNLNALNCT
FT                   SGQVAQTDALRHLETATASPFDLVFLDPPFHQGLLASACTLLETQGWLAETAWIYTESE
FT                   TPPSTTGLPGSWRLHREKKAGQVYYALWQRG"
FT   gene            complement(469321..470814)
FT                   /locus_tag="PSPTO_0425"
FT                   /old_locus_tag="PSPTO0425"
FT   CDS_pept        complement(469321..470814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0425"
FT                   /old_locus_tag="PSPTO0425"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P22539, GB:M60111, GB:X59593, PID:147848, PID:396397,
FT                   PID:42975, GB:U00096, and PID:1790497; identified by
FT                   sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53969"
FT                   /db_xref="GOA:Q88AG5"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AG5"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53969.1"
FT                   /translation="MIKRNAPRHALLGLILAGSLGALVAQPVLADDAPVAEATQTTPAL
FT                   GSNLQTLKELDGKAPARRALKIQTWNTAEGTKVLFVESRELPMFDMRVIFAAGSSQDQK
FT                   SPGIALLTNAMLNEGVKGKDVSAIAQGFEGLGADFGNGSYRDMAVASLRSLSAVDKRDP
FT                   ALKLFGEVVGKPTFPADSLARLKNQLIDSLESQKQSPGAIGNKALFERLYGDHPYAHPS
FT                   EGNVKSINAITLAQLKAFHAKAYAAGNAVIALVGDLSRDEAQAIAAQVSASLPKGPALA
FT                   KVADPVEPKAGPTHIEFASNQTHLMLAQLGIDRNDPDYAALTVGNSVLGGGGFGSRLMT
FT                   EVREKRGLTYGVSSGFTAMQVAGPFMIGLQTRAEMSENTLKLVQDIVRNFLASGPTQKE
FT                   LDDVKRELTGSFPLTAASNSAIVGQLGAIGFYDLPLTYLEDYIAAAQSVTVEQVKAAMS
FT                   KHLSADKMVIVSVGPTVEQKPLPAPTDKPVRQPVGVPEH"
FT   gene            complement(470811..472163)
FT                   /locus_tag="PSPTO_0426"
FT                   /old_locus_tag="PSPTO0426"
FT   CDS_pept        complement(470811..472163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0426"
FT                   /old_locus_tag="PSPTO0426"
FT                   /product="peptidase, M16 family"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:9946224; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53970"
FT                   /db_xref="GOA:Q88AG4"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AG4"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53970.1"
FT                   /translation="MNALARRAAGLLLSTICLPLTALAADPQPTHEFTLDNGLKVVVRE
FT                   DHRAPVVVSQIWYKVGSSYETPGQTGLSHALEHMMFKGSSKTGPGESSLILRDLGAEEN
FT                   AFTSDDYTAYYQVLARDRLSVALELEADRMATLKLPADEFGREIEVIKEERRLRTDDKP
FT                   MGKAFERFKAMAYPASGYHTPTIGWMADLERMKVEELRHWYESWYTPNNATLVVVGDVQ
FT                   PDEVKALAERFFGPIPRRDVPPSKKPLELAEPGERKITLHVKTQLPSLIYGFNVPSVAT
FT                   AEDPRSANALRLIAALLDGGYSARIPTRLERGEELVSGASSRYDAFARGDSLFMISATP
FT                   NMQKKKTLADVEAGIWRLLDDLKTKAPSAEELERVRAQVIAGVVYERDSITSQATMIGE
FT                   LETVGLSWKLMDKELEDLQSVTPQDIQKAANTYFTRERLSVAHVLPEEKAK"
FT   gene            472419..473960
FT                   /gene="ftsY"
FT                   /locus_tag="PSPTO_0427"
FT                   /old_locus_tag="PSPTO0427"
FT   CDS_pept        472419..473960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="PSPTO_0427"
FT                   /old_locus_tag="PSPTO0427"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P10121; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53971"
FT                   /db_xref="GOA:Q88AG3"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AG3"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53971.1"
FT                   /translation="MFGSSDDKKTPAAAGEKKGLFGWLRKKPQQEAEPTPPESSPAQPE
FT                   PVIDQVIKTPLVEPSAAPQPAPESIPQADAPAPQINVEPGAPSPQPWLTLPVNEESVAL
FT                   SDEREPHVTPAIPLQGHVHVVPEPVVSEPVAYEPQAEPVADILPLSAQESVLVEPAAEP
FT                   APEPEPVAAQPVLQPVQPAQTVVPIIAPAAPAPVPEAEAGKVGFFARLKQGLSKTSASI
FT                   GEGMASLFLGKKAIDDDLLEEIETRLLTADVGVEATSVIIKSLTQKVARKQLTDAQALY
FT                   TSLQGELAAMLKPVEQPLVIKAEHKPFVILVVGVNGAGKTTTIGKLAKKLQLEGKKVML
FT                   AAGDTFRAAAVEQLQVWGERNHIPVIAQHTGADSASVIFDAVQAAKARGIDVLIADTAG
FT                   RLHTKDNLMEELKKVRRVIGKLDADAPHEVLLVLDAGTGQNAINQAKQFNQTVTLTGLA
FT                   LTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEAEPFVQALFAERERP"
FT   gene            473957..474628
FT                   /gene="ftsE"
FT                   /locus_tag="PSPTO_0428"
FT                   /old_locus_tag="PSPTO0428"
FT   CDS_pept        473957..474628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="PSPTO_0428"
FT                   /old_locus_tag="PSPTO0428"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:13377876, and SP:P10115; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53972"
FT                   /db_xref="GOA:Q88AG2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AG2"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53972.1"
FT                   /translation="MIRFEQVGKRYPNGHVGLHELSFRVRRGEFLFVTGHSGAGKSTLL
FT                   RLLLAMERPTTGKLMLAGQDLRQISNAQIPFLRRQIGVVFQNHQLLFDRTVFNNIALPL
FT                   QILGLSKPEIAKRVDSALERVALSDKSDLYPGDLSTGQQQRVGIARAIVHRPALLLADE
FT                   PTGNLDPRLAAEIMGVFEDINRLGTSVLIASHDLALIARMRHRMLTLQRGRLIGDGEAG
FT                   V"
FT   gene            474625..475659
FT                   /gene="ftsX"
FT                   /locus_tag="PSPTO_0429"
FT                   /old_locus_tag="PSPTO0429"
FT   CDS_pept        474625..475659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsX"
FT                   /locus_tag="PSPTO_0429"
FT                   /old_locus_tag="PSPTO0429"
FT                   /product="putative protein insertion permease FtsX"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P10122; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53973"
FT                   /db_xref="GOA:Q88AG1"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AG1"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53973.1"
FT                   /translation="MSATRSPKVSERVAPRAADPSPQKQKKPRHDHDDDGPDFSALLSA
FT                   WLESHRSSLLDSLRRLTKQPIGSFFTCLVMAIALSLPMGLSLLLSNVERLGGSWQRAAQ
FT                   ISIYLNLDASTTDGTRMRDEIKAMPGVADAEYISSEQALGEFKQQSGLGEALKELPENP
FT                   LPGVVLVTPDEVDKPALEALRTRLAGLPKVEQAQLDLVWVERLAAILKLGDRFVFGLTV
FT                   LLVSALLLVIGNTIRLHIENRRTEIEVIKLVGGTDSYVRRPFLYMGALYGFGAGILSWG
FT                   VLAYGLNWLNGAVVGLAGLYGSDFALAGVPTGDGLSLLLGAVLLGYIGAWIAVARHLRE
FT                   LAPR"
FT   gene            475778..476632
FT                   /gene="rpoH"
FT                   /locus_tag="PSPTO_0430"
FT                   /old_locus_tag="PSPTO0430"
FT   CDS_pept        475778..476632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH"
FT                   /locus_tag="PSPTO_0430"
FT                   /old_locus_tag="PSPTO0430"
FT                   /product="RNA polymerase sigma-32 factor"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:8885996; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53974"
FT                   /db_xref="GOA:Q88AG0"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AG0"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53974.1"
FT                   /translation="MTTSLQPAYALVPGANLEAYVHTVNSIPLLTPERERELAESLYYE
FT                   QDLDAARQMVLAHLRFVVHIARSYSGYGLAQADLIQEGNVGLMKAVKRFNPEMGVRLVS
FT                   FAVHWIKAEIHEFILRNWRIVKVATTKAQRKLFFNLRSQKKRLAWLNNDEVHRVAESLG
FT                   VEPREVREMESRLTGHDMAFDPAAEADDDSAFQSPANYLEDHRYDPARQLEDADWTDNS
FT                   TANLHQALDVLDERSRDILYQRWLAEEKATLHDLAQKYNVSAERIRQLEKSAMNKLKTS
FT                   IAA"
FT   gene            complement(476853..477563)
FT                   /gene="mtgA"
FT                   /locus_tag="PSPTO_0431"
FT                   /old_locus_tag="PSPTO0431"
FT   CDS_pept        complement(476853..477563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtgA"
FT                   /locus_tag="PSPTO_0431"
FT                   /old_locus_tag="PSPTO0431"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /note="similar to SP:Q48465, GB:L10333, GB:L10334,
FT                   GB:L10335, and PID:307311; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53975"
FT                   /db_xref="GOA:Q88AF9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88AF9"
FT                   /protein_id="AAO53975.1"
FT                   /translation="MLQIILRRLMKALLWFAAGSALVVLVLRWVPPPGTALMVERKVES
FT                   WFDGEPIDLQRDWEPWDKISNNLKIAVIAGEDQKFAEHWGFDVDAIQAAILHNEQGGSI
FT                   RGASTLSQQVSKNLFLWSGRSYLRKGLEAWFTMLIELLWSKERILEVYLNSVEWDEGIF
FT                   GAQAAAQHHFRTNASALSEQQASYLAAVLPNPRQWSASHPSGYVSRRAGWIRQQMRQLG
FT                   GDEYLQGLNSSRRW"
FT   gene            477644..478024
FT                   /locus_tag="PSPTO_0432"
FT                   /old_locus_tag="PSPTO0432"
FT   CDS_pept        477644..478024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0432"
FT                   /old_locus_tag="PSPTO0432"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to PFAM protein family HMM PF04241"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53976"
FT                   /db_xref="GOA:Q88AF8"
FT                   /db_xref="InterPro:IPR006696"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AF8"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53976.1"
FT                   /translation="MLRSFLMLAAFFGFTGVALGAFAAHGLKERLSAEYLAVFHTGVLY
FT                   QLIHALALLGVAVLATHIPGRLINFAGFSFAIGILLFSGSLYALTLTGISKLGIITPFG
FT                   GLAFLFGWSMLGLAAWRLGSAP"
FT   gene            478133..478333
FT                   /gene="thiS"
FT                   /locus_tag="PSPTO_0433"
FT                   /old_locus_tag="PSPTO0433"
FT   CDS_pept        478133..478333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /locus_tag="PSPTO_0433"
FT                   /old_locus_tag="PSPTO0433"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to TIGR protein family HMM TIGR01683"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53977"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AF7"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53977.1"
FT                   /translation="MRIQLNGESFELPDGETVTALLTRLDLAGRRVAVELNLDIVPRSQ
FT                   HVSTVLREGDQVEVVHAIGGG"
FT   gene            478385..479179
FT                   /gene="thiG"
FT                   /locus_tag="PSPTO_0434"
FT                   /old_locus_tag="PSPTO0434"
FT   CDS_pept        478385..479179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="PSPTO_0434"
FT                   /old_locus_tag="PSPTO0434"
FT                   /product="thiazole biosynthesis protein ThiG"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P30139; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53978"
FT                   /db_xref="GOA:Q88AF6"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88AF6"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53978.1"
FT                   /translation="MSDVRSDKPFVLAGRTFESRLLVGTGKYIDMEQTRLAIEASGAEI
FT                   VTVAVRRTNLGQNPGEPNLLDVLPPDRYTILPNTAGCFDAVEAVRTCRLSRELLDGRNL
FT                   VKLEVLADQKTLFPNVIETLKAAEILVKDGFDVMVYTSDDPIIARQLAEIGCIAIMPLA
FT                   GLIGSGLGICNPYNLQIILEETKVPVLVDAGVGTASDATIAMELGCEAVLMNSAIAHAQ
FT                   QPVMMAEAMKHAVIAGRLAYLAGRMPRKLYASASSPLDGLIK"
FT   gene            479190..479924
FT                   /locus_tag="PSPTO_0435"
FT                   /old_locus_tag="PSPTO0435"
FT   CDS_pept        479190..479924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0435"
FT                   /old_locus_tag="PSPTO0435"
FT                   /product="methyltransferase, putative"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:Q9I6B3; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53979"
FT                   /db_xref="GOA:Q88AF5"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88AF5"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53979.1"
FT                   /translation="MTDTHVPPPELPAAEEGEERPHRRIKSFVMRAGRMTEGQQRGLDQ
FT                   GRPLFGLSLTDTPVDFDQVFGRSAPRTLEIGFGMGHSLLEMAAASPEQDFIGVEVHYPG
FT                   VGAMLNGVLTQGLTNVRVYDCDAIEVLNRCIADNSLDRLMLFFPDPWHKSRHHKRRIVQ
FT                   PEFAALVRSKLKVGGVFHMATDWGPYAEYMLEVMSVAPGYRNQAEDNQYVPRPAERPIT
FT                   KFERRGEKLGHGVWDLKFEKVD"
FT   gene            complement(479967..481025)
FT                   /locus_tag="PSPTO_0436"
FT                   /old_locus_tag="PSPTO0436"
FT   CDS_pept        complement(479967..481025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0436"
FT                   /old_locus_tag="PSPTO0436"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53980"
FT                   /db_xref="GOA:Q88AF4"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AF4"
FT                   /protein_id="AAO53980.1"
FT                   /translation="MKFAPKLLAVALCAGLASQAFAATQLKHWPEPAAKALDAMIAANA
FT                   NKGNYAVFDMDNTSYRFDLEESLLPYMENKGLITRETLDPSLKLIPFKDTAEHKESLFS
FT                   YYYRLCELDDMVCYPWVAQVFSGFTLQELKGYVDELMALKKPIPATYYDGDTVKQLNVE
FT                   PPRVFTGQTELYNKLMENGIEVYVMTAASEELVRMVAADPKYGYNVKPQNVIGVTTLLK
FT                   DRKTGELTTARKQITAGKYDAKSNMGLELTPYLWTPATWMAGKQAAILTYIDQWKKPVL
FT                   VGGDTPTSDGYMLFHSVDVSKGGVHLWINRKDKYMTQLNGMIKANAEAQAKEKLPVTAD
FT                   KNWVIVKPDEIQ"
FT   gene            complement(481216..481728)
FT                   /gene="folA"
FT                   /locus_tag="PSPTO_0437"
FT                   /old_locus_tag="PSPTO0437"
FT   CDS_pept        complement(481216..481728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="PSPTO_0437"
FT                   /old_locus_tag="PSPTO0437"
FT                   /product="dihydrofolate reductase"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53981"
FT                   /db_xref="GOA:Q88AF3"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AF3"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53981.1"
FT                   /translation="MKTHLPLSLIAALGENRVIGVDNSMPWHLPGDFKYFKATTLGKPI
FT                   IMGRKTWDSLGRPLPGRLNLVVSRQTDLQLEGAEVFPSLDAAVVRAEQWAQEQGVDEVM
FT                   LIGGAQLYAQGLAQADRLYLTRVALSPEGDAWFPEFDTAQWALVSNAENAAVDEKPAYS
FT                   FEVWERV"
FT   gene            481854..483233
FT                   /locus_tag="PSPTO_0438"
FT                   /old_locus_tag="PSPTO0438"
FT   CDS_pept        481854..483233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0438"
FT                   /old_locus_tag="PSPTO0438"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53982"
FT                   /db_xref="GOA:Q88AF2"
FT                   /db_xref="InterPro:IPR021296"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AF2"
FT                   /protein_id="AAO53982.1"
FT                   /translation="MTALTPLDTLWLTEAVRLREQQAGALDDQEANRRARAAGGDLTAR
FT                   ITHRALGLAERDGMLAALHRWKQGARLALIVLAVLAVISGAGLAFAAMGDGQAPVNVFW
FT                   ALGSLLGLNLMLLASWALGLIFAGRSNTGLGRLWLWLSEKLARDAQAAQLAPALVLLLQ
FT                   RKRLNRWVLGLMVNSLWLLALISALVVLLMLMATRRYGFVWETTILSSDTFVSLTQTLG
FT                   TLPAWLGFSVPDETMIRASGNGALSIENARQAWAAWLVGVLLVYGILPRLLLAVFCLWR
FT                   WKRGRAALRLDLELPEYLELRERLMPSSERLGVNDAEPAALHQVQSNAGAAESDGALLV
FT                   AIELDDQQVWPPQLPSGVADAGVLDSRESRQKLLEQLAHYPPARLVIACDPRRSPDRGS
FT                   LALIAELARCAGATRLWLLPAPAGQTLDPERLDDWHVALDQLQLSRTNSAPLNWLETGH
FT                   D"
FT   gene            483226..484614
FT                   /locus_tag="PSPTO_0439"
FT                   /old_locus_tag="PSPTO0439"
FT   CDS_pept        483226..484614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0439"
FT                   /old_locus_tag="PSPTO0439"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53983"
FT                   /db_xref="GOA:Q88AF1"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR021871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AF1"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53983.1"
FT                   /translation="MTEMDNAPAIKLAVVGHTNVGKTSLLRTLTGDVSFGEVSHRPSTT
FT                   RHVEGARLSVDGQALLELYDTPGLEDAIALLDYLERLDRPGERLDGPARLARFLEGSEA
FT                   RQRFEQEAKVMRQLLASDAGLYVIDAREPVLAKYRDELAVLASCGKPLLPVLNFVSARE
FT                   HREPEWREALSRLGLHALVRFDSVAPPEDGGRRLYESLALLLESARPRLERLIEDQQQQ
FT                   RQARKHSAARLIAELLIDCAACRRSVETLPEQERQAVEALRQAVRQREQHCVEALLKLY
FT                   AFRKDDVSTSDLPLMDGRWGDDLFNPETLKLMGVRVGGGVAAGAAAGAGVDLMVGGVTL
FT                   GAAALVGALAGGALLTARSYGGRLLGKLKGRRELTVDDAVLRLLALRQGHLLLALGVRG
FT                   HAAIHSMELTTPQDKTWRKGKIPEPLSRARAHPQWSTLNPHPKPNQGERQEAIDELASV
FT                   VLQD"
FT   gene            484957..485550
FT                   /gene="betI"
FT                   /locus_tag="PSPTO_0440"
FT                   /old_locus_tag="PSPTO0440"
FT   CDS_pept        484957..485550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betI"
FT                   /locus_tag="PSPTO_0440"
FT                   /old_locus_tag="PSPTO0440"
FT                   /product="regulatory protein BetI"
FT                   /note="similar to GP:7228269, and SP:P17446; identified by
FT                   sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53984"
FT                   /db_xref="GOA:Q88AF0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017757"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88AF0"
FT                   /protein_id="AAO53984.1"
FT                   /translation="MPKVGMQPIRRQQLIQATLTAVDQVGMGDASIALIARLAGVSNGI
FT                   ISHYFQDKNGLIAATMRHLMNALIQNVRERRQALTEDSPRAHLQVIIEGNFDASQVSGP
FT                   AMKTWLAFWATSMHHPSLHRLQRINDHRLYSNLCCQFRRTLPLEQARNAARGLAALIDG
FT                   LWLRGALSGDAFDTEQAQRIAYEYMDFQLAKSAS"
FT   gene            485655..487127
FT                   /gene="betB"
FT                   /locus_tag="PSPTO_0441"
FT                   /old_locus_tag="PSPTO0441"
FT   CDS_pept        485655..487127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betB"
FT                   /locus_tag="PSPTO_0441"
FT                   /old_locus_tag="PSPTO0441"
FT                   /product="betaine aldehyde dehydrogenase BADH"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53985"
FT                   /db_xref="GOA:Q88AE9"
FT                   /db_xref="InterPro:IPR011264"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88AE9"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53985.1"
FT                   /translation="MARFELQKLYIDGGYVDASNTETFDSINPANGEVLAKIQRASKED
FT                   VERAVVAAEKGQKIWAAMTAVERSRILRRAVDILRERNDELAALETLDTGKAISETRYV
FT                   DIVTGADVLEYYAGLVPAIEGEQIPLRDSSFVYTRREPLGVVAGIGAWNYPIQIALWKS
FT                   APALAAGNAMIFKPSEVTSLTTLKLAEIYTEAGVPNGVFNVLTGSGREVGTWITEHPRI
FT                   EKVSFTGGTDTGKKVMASASSSSLKEVTMELGGKSPLIVFDDADLDRAADIAMMANFYS
FT                   SGQVCTNGTRVFVPNALKGEFEAKILERVKRIRPGNPEDENINFGPLVSFEHMESVLGY
FT                   IAKGKEQGARLLCGGDRLTGGVFDKGAFVAATVFTDCTDEMTIVREEIFGPVMSILGYD
FT                   TEDEVVRRANDTDFGLAAGIVTRDLNRAHRVIHLLEAGICWINAWGESAAQMPVGGYKQ
FT                   SGVGRENGISSLAQYTRIKSVQIELGDYASVF"
FT   gene            487139..487240
FT                   /locus_tag="PSPTO_0442"
FT                   /old_locus_tag="PSPTO0442"
FT   CDS_pept        487139..487240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0442"
FT                   /old_locus_tag="PSPTO0442"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53986"
FT                   /db_xref="GOA:Q88AE8"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AE8"
FT                   /protein_id="AAO53986.1"
FT                   /translation="MARDKPQADAIKSGLPHPIFTSIAWLLLLAAQA"
FT   gene            487268..488974
FT                   /gene="betA"
FT                   /locus_tag="PSPTO_0443"
FT                   /old_locus_tag="PSPTO0443"
FT   CDS_pept        487268..488974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betA"
FT                   /locus_tag="PSPTO_0443"
FT                   /old_locus_tag="PSPTO0443"
FT                   /product="choline dehydrogenase"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53987"
FT                   /db_xref="GOA:Q88AE7"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR011533"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88AE7"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53987.1"
FT                   /translation="MTTQSEYDYIIIGAGSAGNTLAARLTEDAGVTVLLLEAGGPDYRL
FT                   DFRTQMPAALAFPLQGRRYNWAYETEPEPHMDNRRMECGRGKGLGGSSLINGMCYIRGN
FT                   AMDYDGWAKEPGLEDWSYLDCLPYFRKAETRDIGPNDYHGGEGPVSVTTPKAGNNPLFH
FT                   AMVEAGVQAGFPRTDDLNGYQQEGFGPMDRTVTPKGRRASTARGYLDEAKKRDTLSIVT
FT                   HALTDRILFEGKRAVGVAYLVGDSDTRIEVRARKEVLLCGGAIASPQILQRSGVGPAEV
FT                   LNKLDIPVVHDLPGVGQNLQDHLEMYLQYACTQPVSLYPSLKWWNQPAIGAEWMFLGTG
FT                   IGASNQFEAGGFIRSSEAFEWPNIQYHFLPVAINYNGTKGVQEHGFQAHVGSMRSPSRG
FT                   RVHVKSKDPREYPSILFNYMASDQDWQEFRDGIRLTREIMQQPALDPYRGREISPGIDV
FT                   QSDEALDQFVREHAETAYHPSCSCKMGTDEMAVVDGQGRVHGMQNLRVVDASIMPIITT
FT                   GNLNAPTIMIAEKIADKIRGRQPLPRSTADYFVAGDKPARGKPLREISHQA"
FT   gene            489138..489656
FT                   /locus_tag="PSPTO_0444"
FT                   /old_locus_tag="PSPTO0444"
FT   CDS_pept        489138..489656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0444"
FT                   /old_locus_tag="PSPTO0444"
FT                   /product="RNA polymerase sigma-70 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53988"
FT                   /db_xref="GOA:Q88AE6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AE6"
FT                   /protein_id="AAO53988.1"
FT                   /translation="MSSVPSAHSEIVGALYRDHRGWLLAWLRRNVACPQRAQDLSQDTF
FT                   VRLLGRDELQLPREPRAFLATIAKGLMFDYFRRAALEQAYLGELLQVPEAEQPSPEEQL
FT                   LILEDLKAIDRMLGTLSSKARAAFLYNRLDGLSHGEIAERLGVSVSRVRQYLAQAVRQC
FT                   YVALYGEPT"
FT   gene            489653..490645
FT                   /locus_tag="PSPTO_0445"
FT                   /old_locus_tag="PSPTO0445"
FT   CDS_pept        489653..490645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0445"
FT                   /old_locus_tag="PSPTO0445"
FT                   /product="regulatory protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53989"
FT                   /db_xref="GOA:Q88AE5"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="InterPro:IPR032623"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AE5"
FT                   /protein_id="AAO53989.1"
FT                   /translation="MNTRPVSARVLDAAIEWQLNMDGNSGSEADRAELARWLAADEEHA
FT                   RAWSQLGMVNQRFVLPAGPARKALQQSPVSLRRSVRKLGGGLAGVFMACGLALFVGDRY
FT                   LPMDYWLADQRTATGEQREVRLADNTLIRLNTHSAIDVRFDAQQRRIILQDGEILVQTG
FT                   NHDDPRPFIVETADGNMRALGTRFLVRREADGTLLSVLQSAVVAQPRNAPGEQVLHEGQ
FT                   QIRLTGSGFGTLLALPSGADAWTRGMLVVDNARLADMLAELGRYRAGHVGVDPKVADLR
FT                   ITGSFPLADTDLALKALLPTLPVQIEQHTQWWVTVLARDEQAAANPAKP"
FT   gene            490766..491899
FT                   /locus_tag="PSPTO_0446"
FT                   /old_locus_tag="PSPTO0446"
FT   CDS_pept        490766..491899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0446"
FT                   /old_locus_tag="PSPTO0446"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to PFAM protein family HMM
FT                   PF01309"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53990"
FT                   /db_xref="GOA:Q88AE4"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AE4"
FT                   /protein_id="AAO53990.1"
FT                   /translation="MKSQTVRRWSIVHTWNSLICTLFLLMLAITGLPLIFHHEIDHLLG
FT                   DAPHYKEMPADTPHLNLEQLARAAEAHRPGEVMQYFGWDDEDPNGVMAITAATAGTEPN
FT                   SSHTFALDARTGEALEMPSANGGFMMVMLRLHVDMYAELPGKLLLAFMGLLFVVAIVSG
FT                   TVLYSPFMRKLEFGQVRVNKSTRTRWLDLHNLIGVVTLTWALVVGVTGVISACADLLIA
FT                   SWRNDALASMIAPYKDAPPLTQRAAPTRLLEIAESAAPGMQADFIAFPGTRFSSEHHYA
FT                   VFLKGNTHLTAHLATPVLIDAQTLQVTAVVERPWYMDALGMSQPLHFGDYGGMPMKVLW
FT                   AVLDVLTIIVLGSGVYLWWVRRRVARSVSAVQAQVAQ"
FT   gene            491896..492078
FT                   /locus_tag="PSPTO_0447"
FT                   /old_locus_tag="PSPTO0447"
FT   CDS_pept        491896..492078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0447"
FT                   /old_locus_tag="PSPTO0447"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53991"
FT                   /db_xref="GOA:Q88AE3"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AE3"
FT                   /protein_id="AAO53991.1"
FT                   /translation="MSARPSRFWKTFAIPGVIAVLTATGLFAALLGDGWWDTLAWLAMG
FT                   SASVFSVRGLLARRG"
FT   gene            492163..492777
FT                   /locus_tag="PSPTO_0448"
FT                   /old_locus_tag="PSPTO0448"
FT   CDS_pept        492163..492777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0448"
FT                   /old_locus_tag="PSPTO0448"
FT                   /product="glutathione S-transferase, putative"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P32105; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53992"
FT                   /db_xref="GOA:Q88AE2"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034343"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AE2"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53992.1"
FT                   /translation="MTLYFNAASPFARKVMVMLHETGQLDRVQLQPTVLTPVSPSAELN
FT                   EDNPAGKLPALRLADGNVIHDSRVILDYLDHQHVGQPLIPREGSARWRRLTLASLADAV
FT                   LDAAVLIRYETALRPQEKHWDQWLDNQQQKIERSLSYFERDAITELSSSFDVASISVAA
FT                   ALGYLDFRQPELRWRNTYPRLANWYLEVSQRPSMLATQPPA"
FT   gene            493002..493517
FT                   /locus_tag="PSPTO_0449"
FT                   /old_locus_tag="PSPTO0449"
FT   CDS_pept        493002..493517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0449"
FT                   /old_locus_tag="PSPTO0449"
FT                   /product="ISPsy8, transposase OrfA"
FT                   /note="similar to GP:17428452; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53993"
FT                   /db_xref="GOA:Q877K7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:Q877K7"
FT                   /protein_id="AAO53993.1"
FT                   /translation="MAKYSEQFKLTVVKAYLAGNIGFRKVSSQFSIDSSLLRRWVANYK
FT                   SHGHTGHRKPGLRYSEAFKRSVLEHKREHGLSLRQTAAHFGIGDPGQIVIWEQQHYSND
FT                   LAPYVPKRRKSVAMPKKPYPTAPVIDDDTQKTRDQLMAELEYLRMENAYLKKLEELKEQ
FT                   QRRQKKKP"
FT   gene            493574..494353
FT                   /locus_tag="PSPTO_0450"
FT                   /old_locus_tag="PSPTO0450"
FT   CDS_pept        493574..494353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0450"
FT                   /old_locus_tag="PSPTO0450"
FT                   /product="ISPsy8, transposase OrfB"
FT                   /note="similar to GP:17428451; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53994"
FT                   /db_xref="GOA:Q877J0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q877J0"
FT                   /protein_id="AAO53994.1"
FT                   /translation="MARSTFYYQVQVQSRPDPDAALKQEVERIYHEERGLYGARRITAV
FT                   IRNSGTLVNKKVVERLMAELGLRSVVRPKKYRSYKGTVGKIAPNLLERNFTAQRPNQKW
FT                   VTDVTEFKVANRKLYLSPVMDLYNGEIVAYELSTRPCFELVTSMLDKALQQLQDEPKLV
FT                   MHSDQGWQYQHAQYRQKLAAKGVKQSMSRKGNCLDNAAMESFFGTLKSEFFYLKRFESI
FT                   EELTAGLEEYIRYYNHDRIKLKLGGLSPVKYRTQAAS"
FT   gene            complement(494461..494964)
FT                   /locus_tag="PSPTO_0451"
FT                   /old_locus_tag="PSPTO0451"
FT   CDS_pept        complement(494461..494964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0451"
FT                   /old_locus_tag="PSPTO0451"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:9946323; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53995"
FT                   /db_xref="GOA:Q88AE1"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AE1"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53995.1"
FT                   /translation="MKPILALLSLLALPVMAAEPTLYGRYENIKVLEIGQTFKAKMDTG
FT                   ALTASLSAKDIELFQRDGDDWVRFRLATKGADDKVYEHKVSRISKIKGRAEGDDEDDEG
FT                   INPAKRPVVDLELCLGNKKRTVEVNLVDRSHFNFPLLIGAKALREFGAAINPARRYTAD
FT                   EPDC"
FT   gene            495158..496057
FT                   /locus_tag="PSPTO_0452"
FT                   /old_locus_tag="PSPTO0452"
FT   CDS_pept        495158..496057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0452"
FT                   /old_locus_tag="PSPTO0452"
FT                   /product="acyltransferase family protein"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to TIGR protein family HMM TIGR00530"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53996"
FT                   /db_xref="GOA:Q88AE0"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AE0"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53996.1"
FT                   /translation="MRRLLTGCFVAILLLINTLVLIGPLLIFALLKLLFRGRMRDRCST
FT                   GAMWVAETWAEIDKLIFAWCVPTQWDIRGDKGLRSDTSYLVISNHQSWVDIPALIQALN
FT                   RRTPFFKFFLKKELIWVPLLGLAWWGLDYPFMKRYSKAFLAKHPELKGKDLEITQAACE
FT                   LFKRQPVTIVNYLEGTRFTPAKHAAQASPYASLLKPKAGGVAFVLAAMGEQLDAILDVT
FT                   VVYPGSSIPGFWDMLCGQVAKVIVDIQTRELDPALWQGDYENDPVFREKVQAWVNQLWV
FT                   EKDARIAALRRESAAGTP"
FT   gene            complement(496037..496756)
FT                   /locus_tag="PSPTO_0453"
FT                   /old_locus_tag="PSPTO0453"
FT   CDS_pept        complement(496037..496756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0453"
FT                   /old_locus_tag="PSPTO0453"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53997"
FT                   /db_xref="GOA:Q88AD9"
FT                   /db_xref="InterPro:IPR021302"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AD9"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53997.1"
FT                   /translation="MLGSPPCLPELIPTDEITACLQRVGNKPLLLTVKPCALSPTHGRF
FT                   EFDKGDAMKTARGMALVTLMALAASPAFAFNLNDAANAVSNATGGNQKATAAPEAAGLL
FT                   NMLGSQLNVTPEQAVGGTGALLGLAKNKLTSADYSQLSKSVPGLEQLSGTSALESLGGA
FT                   NGLGSLLGGNSANNSMLNSALGNVQNMNDVNTAFKALGMDSTMVSQFAPLILQYLGQQG
FT                   ASGSALQSLSGLWGAGS"
FT   gene            496831..497829
FT                   /locus_tag="PSPTO_0454"
FT                   /old_locus_tag="PSPTO0454"
FT   CDS_pept        496831..497829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0454"
FT                   /old_locus_tag="PSPTO0454"
FT                   /product="conserved domain protein"
FT                   /note="similar to GP:11967898, and GP:1070029; identified
FT                   by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53998"
FT                   /db_xref="GOA:Q88AD8"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AD8"
FT                   /protein_id="AAO53998.1"
FT                   /translation="MSSANPVVLCTYHYDATDRLADCSPAEQDSTRLFYQKSLLATQIQ
FT                   GQIQHTLLRTDEYLLARLSVENNQSNCALLATDQQQSVIAAQSLAFAYTPYGHRQPSTG
FT                   PMNLPGFTGERVDPVTGHYLLGNGYRAFNPVLMRFNSPDSLSPFGEGGLNAYAYCEGDP
FT                   VNGVDPSGHVRWFFRRSSNTQPNAPQISLVRRSSVIANTPSGTPAPHRSVDPALGQNVA
FT                   LRTSAQLGPMSRQLSTDLANPSAGSLPSMSRLPSVAPPTYSSSQLGIHDSDIYDPPPQY
FT                   TLFESSVPSTGPSGANANNSRIAPVPTRPISNVVSRVRDAVQDLRNRGMDY"
FT   gene            complement(497858..499057)
FT                   /gene="fdhA-1"
FT                   /locus_tag="PSPTO_0455"
FT                   /old_locus_tag="PSPTO0455"
FT   CDS_pept        complement(497858..499057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdhA-1"
FT                   /locus_tag="PSPTO_0455"
FT                   /old_locus_tag="PSPTO0455"
FT                   /product="glutathione-independent formaldehyde
FT                   dehydrogenase"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P46154, GB:X64318, GB:U26173, GB:S79880, PID:1237118,
FT                   and PID:30956; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAO53999"
FT                   /db_xref="GOA:Q88AD7"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014184"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AD7"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO53999.1"
FT                   /translation="MSGNRGVVYLGAGKVEVQSIPFPKMEDPRGKRIEHGVILRVVSTN
FT                   ICGSDQHMVRGRTTAQTGLVLGHEITGEVLEAGRDVEHLKVGDLVSVPFNVACGRCRSC
FT                   KEQNTGVCLTVNPARPGGAYGYVDMGDWVGGQAEYVLVPYADFNLLKLPDRDAAMEKIR
FT                   DLTCLSDILPTGYHGAVTAGVGPGSTVYVAGAGPVGLAAAASARLLGAAVVIVGDVNPT
FT                   RLIHAKAQGFEIADLSQDTPLHEQIAALLGEPEVDCAIDAVGFEARGHGHAGAQAEAPA
FT                   TVLNSLMGVVRVAGKIGIPGLYVTEDPGAVDAAAKMGSLSIRLGLGWAKSHSFHTGQTP
FT                   VMKYNRQLMQAIMWDRIKIADVVGVEVISLDDAPRGYGEFDAGVPKKFVIDPHGLFGGV
FT                   "
FT   gene            complement(499114..499971)
FT                   /gene="purU-1"
FT                   /locus_tag="PSPTO_0456"
FT                   /old_locus_tag="PSPTO0456"
FT   CDS_pept        complement(499114..499971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purU-1"
FT                   /locus_tag="PSPTO_0456"
FT                   /old_locus_tag="PSPTO0456"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:Q46339; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54000"
FT                   /db_xref="GOA:Q88AD6"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AD6"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54000.1"
FT                   /translation="MSRAPDTWILTADCPSMLGTVDAVTRFLFEQGCYVTEHHSFDDRL
FT                   SGRFFIRVEFRQPDAFDEQAFREGLTERGETFGMIFELTAPNYRPKVVIMVSKADHCLN
FT                   DLLYRQRINQLSMDVVAVVSNHPDLEPLAGWHGIPYYHFPLDPNDKPAQEAKVWQVIEE
FT                   SGAELVILARYMQVLSPELCRKLDGKAINIHHSLLPGFKGAKPYHQAYEKGVKLVGATA
FT                   HYINNDLDEGPIIAQGVEVVDHSHYPEDLIAKGRDIEGLTLARAVGYHIERRVFLNANR
FT                   TVVL"
FT   gene            complement(500142..500774)
FT                   /gene="soxG-1"
FT                   /locus_tag="PSPTO_0457"
FT                   /old_locus_tag="PSPTO0457"
FT   CDS_pept        complement(500142..500774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxG-1"
FT                   /locus_tag="PSPTO_0457"
FT                   /old_locus_tag="PSPTO0457"
FT                   /product="sarcosine oxidase, gamma subunit"
FT                   /note="similar to SP:Q46338, GB:U11053, GB:U17298,
FT                   GB:L36130, SP:P41145, PID:532060, PID:595933, PID:596070,
FT                   PID:598185, and PID:722618; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54001"
FT                   /db_xref="GOA:Q88AD5"
FT                   /db_xref="InterPro:IPR006280"
FT                   /db_xref="InterPro:IPR007375"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AD5"
FT                   /protein_id="AAO54001.1"
FT                   /translation="MSTANVYQQRPTTDVKAESPLFHASLDSLIGKGRASPGVFLREKK
FT                   LLGHLTLRGDAHDQAFAAGVHKALGMELPAALMLVINGESSLQWLGPDEWLLIVPSGEE
FT                   FAAEQKLREALAGLHIAIVNVSGGQSILELTGPKVRQVLMKSTSYDVHPDNFPVGKAVG
FT                   TVFAKSQLVIRRTGEETWELLIRRSFSDYWWLWLQDASAEYGLSIQA"
FT   gene            complement(500811..503831)
FT                   /gene="soxA-1"
FT                   /locus_tag="PSPTO_0458"
FT                   /old_locus_tag="PSPTO0458"
FT   CDS_pept        complement(500811..503831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxA-1"
FT                   /locus_tag="PSPTO_0458"
FT                   /old_locus_tag="PSPTO0458"
FT                   /product="sarcosine oxidase, alpha subunit"
FT                   /note="similar to SP:Q46337; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54002"
FT                   /db_xref="GOA:Q88AD4"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006277"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041117"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AD4"
FT                   /protein_id="AAO54002.1"
FT                   /translation="MSQSNRLPNGGRINRSKVLNFTFNGQTYQGFEGDSLASALLANGV
FT                   EIIGRSFKYSRPRGIFAAGSEEPNAVLQIGATEATQIPNVRATQQALYSGLVATSTNGW
FT                   PSVNTDVMGILGKVGGKLMPPGFYYKTFMYPQSFWMTYEKYIRKAAGLGRSPTENDPDS
FT                   YDAMNQHCDVLIVGAGPAGLAAALAASRSGARVIIADEQEEFGGSLLDSRESLDGKPAA
FT                   EWVATVVAELKSLRNVTLLPRATVNGYHDHNFLTIHERLTDHLGDRAPIGMVRQRMHRV
FT                   RAKRVVLAAGTHERPLVYGNNDVPGNMLAGAISTYVRRYGVAPGKKLVLSTNNDHAYRV
FT                   ALDWLDASLHVVAIADARHNPRGPLVEEARAKGIRILTGSAVIEARGSKRVSAARVAAI
FT                   DLKTHSVTSPGEWLECDLVASSGGYSPIVHLASHLGGKPVWREDILGFVPGEAPQKRIC
FT                   VGGVNGVYSLADSLADGFEGGVRAASEAGFKIVEGVMPKALSRAEEPTLALFQVPHEKG
FT                   TARAPKQFVDFQNDVTAAAIELATREGFESVEHVKRYTALGFGTDQGKLGNVNGLAIAA
FT                   RSLNVSIPEMGTTMFRPNYTPVTFGAIAGRHCKHIFEPVRFTALHAWHIRNGAEFEDVG
FT                   QWKRPWYFPKNGEDLPAAVARECKAVRDSVGLLDASTLGKIDIQGPDAREFLNRIYTNA
FT                   WTKLDVGKARYGLMCKEDGMVFDDGVTACLADNHFLMTTTTGGAARVLQWLEIYQQTEW
FT                   PDLKVYFTSVTDHWATLTLSGPNSRKLLSEVTDIDLGREAFPFMTWKEGLVAGVPARVF
FT                   RISFTGELSYEVNIQADYAMGVLEKIAEAGKQYNLTPYGTETMHVLRAEKGFIIVGQDT
FT                   DGSMTPDDLNMGWCVGRTKPFSWIGWRGMNREDCVREQRKQLVGLKPIDSTQWLPEGAQ
FT                   LVFDTRQAIPMSMVGHVTSSYAHNSLGYSFAMGVVKGGLNRIGEHVFAPLADGSVIEAE
FT                   IVSSVFFDPKGERQNVE"
FT   gene            complement(503828..504124)
FT                   /gene="soxD-1"
FT                   /locus_tag="PSPTO_0459"
FT                   /old_locus_tag="PSPTO0459"
FT   CDS_pept        complement(503828..504124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxD-1"
FT                   /locus_tag="PSPTO_0459"
FT                   /old_locus_tag="PSPTO0459"
FT                   /product="sarcosine oxidase, delta subunit"
FT                   /note="similar to SP:Q46336, GB:U11053, GB:U17298,
FT                   GB:L36130, SP:P41145, PID:532060, PID:595933, PID:596070,
FT                   PID:598185, and PID:722618; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54003"
FT                   /db_xref="GOA:Q88AD3"
FT                   /db_xref="InterPro:IPR006279"
FT                   /db_xref="InterPro:IPR038561"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AD3"
FT                   /protein_id="AAO54003.1"
FT                   /translation="MLHIFCPHCGELRSEEEFHPSGQAHIPRPLDPAACTDEQWGDYMF
FT                   FRDNPRGLHHELWIHAAGCRQYFNMTRNTVTYEILETYPIGSKPQFTDQGEKA"
FT   gene            complement(504140..505390)
FT                   /gene="soxB-1"
FT                   /locus_tag="PSPTO_0460"
FT                   /old_locus_tag="PSPTO0460"
FT   CDS_pept        complement(504140..505390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxB-1"
FT                   /locus_tag="PSPTO_0460"
FT                   /old_locus_tag="PSPTO0460"
FT                   /product="sarcosine oxidase, beta subunit"
FT                   /note="similar to GP:14023472, and SP:P40875; identified by
FT                   sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54004"
FT                   /db_xref="GOA:Q88AD2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006278"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AD2"
FT                   /protein_id="AAO54004.1"
FT                   /translation="MQHYSGFGLLKHSLSHHENWQRMWRTPTPKKVYDVVIVGGGGHGL
FT                   ATAYYLAKEHGITNVAVVEKGWLGGGNTARNTTIVRSNYLWDESAHLYEHAMKLWEGLS
FT                   QDLNYNVMFSQRGVYNLCHTLQDMRDSERRVSANRLNGVDGELLNSKQVAEEIPYLDCS
FT                   KNTRYPIIGATVQRRGGVARHDAVAWGFARAADALGVDLIQQTEVIGFRKENGVCIGVE
FT                   TNKGFIGAKRVGVVTAGNSGHMAKLAGFRLPIESHPLQALVSEPIKPIIDSVIMSNAVH
FT                   GYISQSDKGDLVIGAGIDSWVGYGQRGSYPVIEHTIQAIVEMFPVLSRVRMNRQWGGIV
FT                   DTTPDACPIISKTPVPNMFFNCGWGTGGFKATPGSGNVFAASLAKGEMHPLAKPFSIDR
FT                   FHNGALIDEHGAAAVAH"
FT   gene            complement(505408..506661)
FT                   /gene="glyA-1"
FT                   /locus_tag="PSPTO_0461"
FT                   /old_locus_tag="PSPTO0461"
FT   CDS_pept        complement(505408..506661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA-1"
FT                   /locus_tag="PSPTO_0461"
FT                   /old_locus_tag="PSPTO0461"
FT                   /product="serine hydroxymethyltransferase"
FT                   /note="similar to SP:P00477; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54005"
FT                   /db_xref="GOA:Q88AD1"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88AD1"
FT                   /protein_id="AAO54005.1"
FT                   /translation="MFSKQDQIQGYDDALLSAMNAEEQRQEDHIELIASENYTSKRVMQ
FT                   AQGSGLTNKYAEGYPGKRYYGGCEHVDKVEQLAIERARQLFGADYANVQPHSGSQANAA
FT                   VYLALLQAGDTVLGMSLAHGGHLTHGAKVSFSGKLYNAVQYGIDTTTGLIDYDEVERIA
FT                   VECQPKMLIAGFSAYSKTLDFPRFRAIADKVGAYLFVDMAHVAGLVAAGLYPNPLPYAD
FT                   VVTTTTHKTLRGPRGGLILAKANEELEKKFNSAVFPGGQGGPLMHVIAAKAVCFKEAME
FT                   PGFKTYQQQVIDNAQAMAQVFITRGFDVVSGGTDNHLFLVSLIRQGLTGKEADAALGRA
FT                   HITVNKNSVPNDPQSPFVTSGLRIGTPAVTTRGFKVTQCIELAGWICDILDNLGAADVE
FT                   ANVASQVAALCADFPVYR"
FT   gene            complement(506918..508096)
FT                   /locus_tag="PSPTO_0462"
FT                   /old_locus_tag="PSPTO0462"
FT   CDS_pept        complement(506918..508096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0462"
FT                   /old_locus_tag="PSPTO0462"
FT                   /product="glycine/betaine/L-proline ABC transporter,
FT                   ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54006"
FT                   /db_xref="GOA:Q88AD0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022473"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AD0"
FT                   /protein_id="AAO54006.1"
FT                   /translation="MSIIKFDKVDVIFSKDPREALKLLDEGLTRDQILKKTGQIVGVEN
FT                   ASLDIEKGEICVLMGLSGSGKSSLLRCINGLNTVSRGSLFVEHEGSQINIANCSAAELK
FT                   MMRTKRIAMVFQKFALMPWLTVRENISFGLEMQGRPEKERRKLVDEKLELVGLTQWRNK
FT                   KPDELSGGMQQRVGLARALAMDADILLMDEPFSALDPLIRQGLQDELLALQSKLSKTIV
FT                   FVSHDLDEALKLGSRIAIMKDGRIVQYSVPEQIVLNPADEYVRTFVAHTNPLNVLCGRS
FT                   LMRTVDECTQVNGSVCLDPSGDSWLDLAEGNVIKGARQGAAPLDLQNWTPGQDVGTLDR
FT                   RPTLVHSNIGMRDALQIRYQTGNKLVLQDGEKVVGILGDTELYHALLGKNHG"
FT   gene            complement(508093..508938)
FT                   /locus_tag="PSPTO_0463"
FT                   /old_locus_tag="PSPTO0463"
FT   CDS_pept        complement(508093..508938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0463"
FT                   /old_locus_tag="PSPTO0463"
FT                   /product="glycine/betaine/L-proline ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54007"
FT                   /db_xref="GOA:Q88AC9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR017784"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AC9"
FT                   /protein_id="AAO54007.1"
FT                   /translation="MLTDQKIPLGEYIAAFVDWLTANGADYFDAIASTLEMMIHGFTFA
FT                   LTWFNPFVLIGLIAALAHFIQRKWGLTVFVILSFLLILNLHYWQETMETLAQVLFATLV
FT                   CVVIGVPLGIIAAHKPLFYTIIRPLLDLMQTVPTFVYLIPTLTLFGLGVVPGLISTVVF
FT                   AIAAPIRLTYLGIRDVPQELLDAGKAFGSSRRQLLTRIELPYAMPSIAAGITQCIMLSL
FT                   SMVVIAALVGADGLGKPVVNALNTADIALGFEAGLAIVLLAIMLDRICKQPEAKVGSDA
FT                   "
FT   gene            complement(509006..509953)
FT                   /locus_tag="PSPTO_0464"
FT                   /old_locus_tag="PSPTO0464"
FT   CDS_pept        complement(509006..509953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0464"
FT                   /old_locus_tag="PSPTO0464"
FT                   /product="glycine betaine/L-proline ABC transporter,
FT                   periplasmic substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54008"
FT                   /db_xref="GOA:Q88AC8"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AC8"
FT                   /protein_id="AAO54008.1"
FT                   /translation="MKGSKSLLLAATLCMPVLAQAAEPEACHTVNFSDVGWTDITVTTA
FT                   VTSAVLESLGYKTKTTMISVPVTYKSLADGKNMDVFLGNWMPTMENDIKPYREAGTVET
FT                   VRANLENAKYTLAVPQALYDKGLHDFADITKFKKELGGKIYGIEPGNDGNRLIQSMIDK
FT                   NAFGLKDAGFKVVESSEAAMLSQVDRAVKRKNDVVFLGWEPHPMNTRFKMKYLTGGDDF
FT                   FGPNYGQATIYTNTRKGYSQECSNVGQLLKNLSFTLEMESTLMGNVLDDKTKPDAAAKA
FT                   WIKKNPQVLDTWLAGVTTVDGKPGLEAAKAKLTQ"
FT   gene            510737..511840
FT                   /locus_tag="PSPTO_0465"
FT                   /old_locus_tag="PSPTO0465"
FT   CDS_pept        510737..511840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0465"
FT                   /old_locus_tag="PSPTO0465"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to TIGR protein family HMM
FT                   TIGR01383"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54009"
FT                   /db_xref="GOA:Q88AC7"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AC7"
FT                   /protein_id="AAO54009.1"
FT                   /translation="MTSFNQGAQPQNRAPQSIGFLLLDNFTLISLASAVEPLRMANQLS
FT                   GRELYRWTTLSVDGSQVWASDGLQITPDAAMHKAQALDTVIVCGGVGIQRTVTREHVSW
FT                   LQSQARQSRRLGAVCTGSWALACAGLLDGFDCSVHWECLASMQEAFPRVSMSTRLFTLD
FT                   RNRFTSSGGTAPLDMMLHLISRDHGRELSAAISEMFVYERIRNEQDHQRVPLKHMLGTN
FT                   QPKLQEIVALMEANLEEPIDLDELAVYVAVSRRQLERLFQKYLHCSPSRYYLKLRLIRA
FT                   RQLLKQTPMSIIEVASVCGFVSTPHFSKCYREYFGIPPRDERVGSNTAQQVAMMPIPQA
FT                   LVLAPLSGPLSALSQARNESTFASVRL"
FT   gene            complement(512022..513647)
FT                   /locus_tag="PSPTO_0466"
FT                   /old_locus_tag="PSPTO0466"
FT   CDS_pept        complement(512022..513647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0466"
FT                   /old_locus_tag="PSPTO0466"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54010"
FT                   /db_xref="GOA:Q88AC6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AC6"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54010.1"
FT                   /translation="MSLRNMNIAPRAFLGFAIIGTLMLILGVFALSQMNKIRGATEDLA
FT                   NGNVPSIKSLDRFAEVSIRLRVLSYRLLVNRDPETQQKTIDLLAMRNKQITDAQAIYEK
FT                   LISDPDERNLYGQYVQLLGQYRQLEERLKTLTRANKIEELQSLLNNELLSNSDQMNVVL
FT                   GKLVEINTAQLNQVKKDASREYDSAFNMVIGLLIAATLLTIVFAWMLIKSITTPIATAL
FT                   HAAETIAKGNLTQPIQIDGSDEAGRLLLAMKTMQDKLRDTLQGISGSATQLASAAEELN
FT                   AVTDESARGLVQQNNEIEQAATAVNEMTSAVEEVARNAVSTSQASRNAATSAGDGRDLV
FT                   QETVSAIERMSGDVKGTAELIINLATESRDIGKVLDVIRGLADQTNLLALNAAIEAARA
FT                   GEAGRGFAVVADEVRALAHRTQQSTSEIERMIGSIQSGTEQAVSSMRNSTERAESTLNI
FT                   AKGAGMALNTINVAVEEINERNMVIASAAEEQAQVAREVDRNLVNIRDLSAQSTSGANQ
FT                   TSAASTELSRLAVDLNSMVSRFAL"
FT   gene            complement(513782..513937)
FT                   /locus_tag="PSPTO_0467"
FT                   /old_locus_tag="PSPTO0467"
FT   CDS_pept        complement(513782..513937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0467"
FT                   /old_locus_tag="PSPTO0467"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54011"
FT                   /db_xref="GOA:Q88AC5"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AC5"
FT                   /protein_id="AAO54011.1"
FT                   /translation="MTTYSESGSCCSSDRPELRQMRTANEQNDITLTALNAVFSRVCAD
FT                   FCHIPK"
FT   gene            514044..514301
FT                   /locus_tag="PSPTO_0468"
FT                   /old_locus_tag="PSPTO0468"
FT   CDS_pept        514044..514301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0468"
FT                   /old_locus_tag="PSPTO0468"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54012"
FT                   /db_xref="GOA:Q88AC4"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AC4"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54012.1"
FT                   /translation="MKFAREIKMLEASLSQLEQLVGDLVQQNQTLQDTNAQLGAELAKA
FT                   KDENENLQLSLMEQEEKQGSTAARIQALVDRATSASAVGA"
FT   gene            514298..514600
FT                   /locus_tag="PSPTO_0469"
FT                   /old_locus_tag="PSPTO0469"
FT   CDS_pept        514298..514600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0469"
FT                   /old_locus_tag="PSPTO0469"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54013"
FT                   /db_xref="GOA:Q88AC3"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AC3"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54013.1"
FT                   /translation="MNVDGNGVTVLSILGNEYSVKAPAGEDLTLMKAAAMLNASLADTK
FT                   RKYPTLIGDRLLVLAALNLCSQQIELEQLHKVELKRYREQVDATVDVIAKTISQG"
FT   gene            complement(514680..515393)
FT                   /locus_tag="PSPTO_0470"
FT                   /old_locus_tag="PSPTO0470"
FT   CDS_pept        complement(514680..515393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0470"
FT                   /old_locus_tag="PSPTO0470"
FT                   /product="exonuclease, putative"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54014"
FT                   /db_xref="GOA:Q88AC2"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AC2"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54014.1"
FT                   /translation="MNLFEWLKPRPKKVPLDAHQLKRIKQLPVCAKLSDKPLRQQRWVV
FT                   LDLETSGLNMNRDQVLSIGAVVIEDGAIDLGQQFERTLLRVDHKLSPAVLIHGLAPSAI
FT                   AAGSEPVEALLDFMEFVGDSPILGFHAPFDQHMLARALKESLDYRLQHAFFDAAEIAPM
FT                   LCEQANLRHAGLDDWTQFFGLHAEERHNASADALVTAELALILFSHARRQQIDSTLRLA
FT                   ESLGQWRRRKQSHSF"
FT   gene            complement(515390..517258)
FT                   /locus_tag="PSPTO_0471"
FT                   /old_locus_tag="PSPTO0471"
FT   CDS_pept        complement(515390..517258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0471"
FT                   /old_locus_tag="PSPTO0471"
FT                   /product="nucleotidyltransferase, putative"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54015"
FT                   /db_xref="GOA:Q88AC1"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005105"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR018821"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AC1"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54015.1"
FT                   /translation="MQFLQKFPPFNQMENAHLAYLVEQCQLRFYAADESIIKPGDGPVE
FT                   HFYIVKQGRIVGERPHSAKRGTETTFEITTGECFPLAALLGERATRTEHLAAEDTFCLQ
FT                   LNKQAFIKLFALSTTFRDFALRGVSSLLDQVNQQVQQRAAETLGTQYSLNTRLGELAMR
FT                   HPVMCSPDMPMRDAVKLMHEQQVGSIVIVDEQQAPLGIFTLRDLREAVADVNADFSAPV
FT                   KNTMSPSPFHLSPDASAFDAAIAMTGRHIAHVCLVRDGRLCGVVSERDLFSLQRVDLVH
FT                   LARTIRNAPRIEALAGLRGDIVQLVDRMLAHGASSTQITQIITLLNDHTVCRVIELTLA
FT                   EKGDPGVPFSWLCFGSEGRREQTLHTDQDNGILFEASDATEAEQIRTLLLPIAERINQS
FT                   LAQCGFTLCKGNIMAGNPDLCLSRLEWSRRFSAFIREATPENLLASSIYFDLRVVWGDE
FT                   SGGGQLRRGILDQVADNRLFQRMMAENALRQRPPVGRFKDFVLARKGSEKDTLDLKTEG
FT                   LTPFVDGARLLALANGIGVNNTQERLRQLVEREVIDPLDGAAYEEAYHFIQQTRMQQHQ
FT                   LQSRQNLAYSNRIDPDTLNHLDRRILRESFRQAQRLQMSLTMRYQL"
FT   gene            517608..518000
FT                   /locus_tag="PSPTO_0472"
FT                   /old_locus_tag="PSPTO0472"
FT   CDS_pept        517608..518000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0472"
FT                   /old_locus_tag="PSPTO0472"
FT                   /product="response regulator"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54016"
FT                   /db_xref="GOA:Q88AC0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AC0"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54016.1"
FT                   /translation="MLSPDRGAPQRVLIVDDDSDARELLAEILSLNDISCMTAPGGDSA
FT                   LKMIQTRQSIGLLITDLRMAPFDGLDLIRKVRESDRAELPIIIVSGDANVRDAIDAMHL
FT                   SVVDFLLKPLNTKQLVKLVKRELGMS"
FT   gene            complement(518079..521327)
FT                   /pseudo
FT                   /gene="hopAS1"
FT                   /locus_tag="PSPTO_0473"
FT                   /note="PSPTO0473; this region contains an authentic point
FT                   mutation causing a premature stop and is not the result of
FT                   a sequencing artifact; identified by similarity to the
FT                   C-terminal regions of HopAS1 in Pseudomonas syringae
FT                   phaseolicola"
FT   gene            complement(521328..522167)
FT                   /gene="hopAS1"
FT                   /locus_tag="PSPTO_0474"
FT                   /old_locus_tag="PSPTO0474"
FT   CDS_pept        complement(521328..522167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hopAS1"
FT                   /locus_tag="PSPTO_0474"
FT                   /old_locus_tag="PSPTO0474"
FT                   /product="type III effector HopAS1"
FT                   /note="This region contains an authentic point mutation
FT                   causing a premature stop and is not the result of a
FT                   sequencing artifact; identified by sequence similarity to
FT                   the N-terminal regions of HopAS1 in Pseudomonas syringae
FT                   phaseolicola; previously known as ORF01152 (PMID11854524;
FT                   Fouts et al, 2002)"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54018"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AB8"
FT                   /protein_id="AAO54018.1"
FT                   /translation="MTLRINTRSATPVVPLETGSTSQPTPPPVTARATEPPPVANPAAP
FT                   KSAPGVQQAHGLKTRIAGKLSERQTNFSLGIPGTGRTLNRPLRSGIPEEGEQVSNEESH
FT                   DPLLKEAHELQRMVESALTHLKAAPTSLWERPAPSTVRRITTKIFPWLKPAPLREVASN
FT                   GSNAKTKIKINSQQSPETIAAAVKELSTRLDHQSKVLATATHALVAAREHLESLEQATP
FT                   PSSTEPLDHARARVQQADSTTRLASQQLRELIQGTDVLQLGALSEGQDQVEQKAEFS"
FT   gene            complement(522206..522316)
FT                   /locus_tag="PSPTO_5616"
FT   CDS_pept        complement(522206..522316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_5616"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to gene downstream of PSPPH4735"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_5616"
FT                   /db_xref="EnsemblGenomes-Tr:ABD93120"
FT                   /db_xref="UniProtKB/TrEMBL:Q1XFZ9"
FT                   /protein_id="ABD93120.1"
FT                   /translation="MPPRQFEEVSPSAATALRTRFTHHRMRSVDYYHHLY"
FT   regulatory      complement(522444..522475)
FT                   /bound_moiety="HrpL"
FT                   /note="PMID:17073300"
FT                   /inference="nucleotide motif:HMM2"
FT                   /experiment="microarray and/or RT-PCR"
FT                   /regulatory_class="promoter"
FT   gene            complement(522512..522943)
FT                   /locus_tag="PSPTO_0475"
FT                   /old_locus_tag="PSPTO0475"
FT   CDS_pept        complement(522512..522943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0475"
FT                   /old_locus_tag="PSPTO0475"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54019"
FT                   /db_xref="GOA:Q88AB7"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AB7"
FT                   /protein_id="AAO54019.1"
FT                   /translation="MKSPSKRIIFLAAYITIAGSIWAASEWWEIGLAERLSDPYISPGG
FT                   CYRVELFKPFWVLPMMFHTMPDPNEGVPREWLPWWGYPAFFRLYDHRTGELISETEIHD
FT                   LESAGGPMSWGGGSGMVYAGMIPIGPNVPDCIGDQPATH"
FT   gene            complement(522940..523386)
FT                   /locus_tag="PSPTO_0476"
FT                   /old_locus_tag="PSPTO0476"
FT   CDS_pept        complement(522940..523386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0476"
FT                   /old_locus_tag="PSPTO0476"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54020"
FT                   /db_xref="GOA:Q88AB6"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AB6"
FT                   /protein_id="AAO54020.1"
FT                   /translation="MKSPSTHIIFLATFITTAGSLWAASEYWEKGLAESLNEPDISPGG
FT                   CYRVETFKPFWILPMMFHRKANPYKDHSPKWLPWWGYPAFFRLYDHRTGKLISETEIYD
FT                   LESAGGPMSWGGGSGMVYAGMIPIGPNVPDCRGDRPATRAAPQE"
FT   gene            complement(523383..523826)
FT                   /locus_tag="PSPTO_0477"
FT                   /old_locus_tag="PSPTO0477"
FT   CDS_pept        complement(523383..523826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0477"
FT                   /old_locus_tag="PSPTO0477"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54021"
FT                   /db_xref="GOA:Q88AB5"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AB5"
FT                   /protein_id="AAO54021.1"
FT                   /translation="MKISARKIQFLSAYFLIALSLWAASQWWEKGLAERSGDPIVSPDG
FT                   CYRLETFKPFWVLPNMFHRKPHPDEDVPPKWFPLWGYPGFYRLYDNRNGELISENKIYD
FT                   LETAGWGIDWGEESGFVYAGMILIGPNVSDCIGDRSSHVTNQK"
FT   gene            complement(523823..524749)
FT                   /locus_tag="PSPTO_0478"
FT                   /old_locus_tag="PSPTO0478"
FT   CDS_pept        complement(523823..524749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0478"
FT                   /old_locus_tag="PSPTO0478"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54022"
FT                   /db_xref="GOA:Q88AB4"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AB4"
FT                   /protein_id="AAO54022.1"
FT                   /translation="MSLNDFQRTNAVGPDTYFALPQGVSRTYAPLDTPPKQVIIENLAL
FT                   SRIPGAMRNMGWDTAAALLQRWFDSPGWEMPADWKKPETQPDPMSLSPEQCDEDIVKME
FT                   WAMQFERCRTAIAVAESRLTTPNALLRLKKLLKKQGWHGSAPFKLGSTLMTARQIDVSS
FT                   QVNFTEFGGAWDALDDMYGALGTATLKVGVVGEVFTKEHPITQQAQHYFRVEHLGFYIR
FT                   DHYDFNGFQYLGTWTEDRVLTKAETVIAVTPQGNLIIRLKEGPFAAIANNHFRKYRDNT
FT                   SNGGDFFIYSDVLWKKADPFIDLEIPI"
FT   gene            complement(524756..525322)
FT                   /locus_tag="PSPTO_0479"
FT                   /old_locus_tag="PSPTO0479"
FT   CDS_pept        complement(524756..525322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0479"
FT                   /old_locus_tag="PSPTO0479"
FT                   /product="conserved domain protein"
FT                   /note="similar to GP:17427973; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54023"
FT                   /db_xref="GOA:Q88AB3"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AB3"
FT                   /protein_id="AAO54023.1"
FT                   /translation="MNRLAIVVGDMTDHGGHVMTGSESHIIDGFPTAHVGCDVICPLHG
FT                   PTKIISGQNDYLVEGQPLALEGDLTTCGARLVSCQQNFFLVEREFSSEPTPVTPPMKRA
FT                   YTPVVLAQSCTSSTSRQNRIVCDERFQMLTHQHNRLGHLDYVLLEHNQYTARGTLDEHG
FT                   HSRKHGSSSPSTLQFAASAPWPVME"
FT   gene            complement(525681..527858)
FT                   /gene="glcB-1"
FT                   /locus_tag="PSPTO_0480"
FT                   /old_locus_tag="PSPTO0480"
FT   CDS_pept        complement(525681..527858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcB-1"
FT                   /locus_tag="PSPTO_0480"
FT                   /old_locus_tag="PSPTO0480"
FT                   /product="malate synthase G"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54024"
FT                   /db_xref="GOA:Q88AB2"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006253"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR023310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88AB2"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54024.1"
FT                   /translation="MTEYVQVGDLQVARVLFDFVQNEATPGTGVDAGAFWAGADQLIHD
FT                   LAPKNKALLAQRDELQAQIDAWHQSRAGQAHDASAYKAFLQEIGYLLPEAADFQITTQN
FT                   VDEEIATMAGPQLVVPVMNARFALNASNARWGSLYDALYGTDAISEEGGAEKGKGYNKV
FT                   RGDKVIAFARAFLDQAAPLAAGSHVDSTAYKLIDGRLVISLKGGSNTGLRDDAQLVGFQ
FT                   GDASAPFAVLFKHNGLHFELQIDAASPVGQTDPAGVKDIVMEAALTTIMDCEDSIAAVD
FT                   ADDKVVVYRNWLGLMKGDLVESVSKGGETFTRTMNPDRVYTTPQGGEVTLHGRSLLFIR
FT                   NVGHLMTIDAILDKHGNEVPEGILDGLLTSLAAIHNLNGNNTRSNSRSGSMYIVKPKMH
FT                   GPQEAAFTNELFGRIEQVLGLPRNTLKVGIMDEERRTTVNLKACIQAASERVVFINTGF
FT                   LDRTGDEIHTSMEAGPVVRKAQMKAEKWISAYENSNVDIGLKCGLQGRAQIGKGMWAMP
FT                   DLMAAMLEQKIAHPLAGANTAWVPSPTAAALHALHYHKVDVFARQAELAQREQASVDDI
FT                   LTIPLALNTDWTPEQVQNELDNNAQGILGYVVRWIDQGVGCSKVPDINDIGLMEDRATL
FT                   RISSQHMTNWLRHGIVTETQVLESLKRMAPVVDRQNANDPLYRPLSPDFDSNIAFQAAV
FT                   ELVIEGTRQPNGYTEPVLHRRRREFKAKNRV"
FT   gene            528181..528699
FT                   /locus_tag="PSPTO_0481"
FT                   /old_locus_tag="PSPTO0481"
FT   CDS_pept        528181..528699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0481"
FT                   /old_locus_tag="PSPTO0481"
FT                   /product="ACT domain protein"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54025"
FT                   /db_xref="GOA:Q88AB1"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR016867"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AB1"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54025.1"
FT                   /translation="MDHLVVTLVAPDKPGQVERIAQCIAEHGGNWLESRMSRMAGQFAG
FT                   ILKVGVEPQQYDDLIKALNALSAYGIRMLLADSAVETSDTTQLISMKLVGNDRPGIVRD
FT                   ITRLLAGQGVNVEHLITDVTPAPMSSELLFHADAVLGVPVGLSLDDLQAGLETLADDLM
FT                   VELVLGGEE"
FT   gene            complement(528719..529069)
FT                   /locus_tag="PSPTO_0482"
FT                   /old_locus_tag="PSPTO0482"
FT   CDS_pept        complement(528719..529069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0482"
FT                   /old_locus_tag="PSPTO0482"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to PFAM protein family HMM
FT                   PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54026"
FT                   /db_xref="GOA:Q88AB0"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039554"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AB0"
FT                   /protein_id="AAO54026.1"
FT                   /translation="MNKGQTAQSSTQKEQIMNQHIGSDFDDFLAEQGFAEEVSAAALKR
FT                   VISWQIAEVMKQQKVTKKALAERMHTSRTAVDRALDQNDPGMTLATLASAARALGQRVE
FT                   VRLVPEQEAKRA"
FT   gene            complement(529381..530268)
FT                   /gene="rarD-1"
FT                   /locus_tag="PSPTO_0483"
FT                   /old_locus_tag="PSPTO0483"
FT   CDS_pept        complement(529381..530268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rarD-1"
FT                   /locus_tag="PSPTO_0483"
FT                   /old_locus_tag="PSPTO0483"
FT                   /product="rarD protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54027"
FT                   /db_xref="GOA:Q88AA9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AA9"
FT                   /protein_id="AAO54027.1"
FT                   /translation="MQAANPRRGYILGLSAYTIWGLFPLYFKAIAAVPAIEIIIHRALW
FT                   SALFGLIVLMFWKHPGWWRDLRNNPQRLAVLALSGTLIAANWIVYVWAVNNGRMLEASL
FT                   GYYINPLVNVLLGMLLLGERLRRLQWVAVVLAATGVAQQVWHVGSLPWISLALALTFAF
FT                   YGLIRKKAPVAALPGLVVETWMLVPLALIWLTLNPTAVTAQAEFWTTTQAIWLAAAGPV
FT                   TLIPLVCFNAAARHLPFTTLGFLQYIAPTLVLLLAVLLYGEHLTTSTIITFAFIWAGLA
FT                   VYSVDIWLKSRGRR"
FT   gene            complement(530394..531368)
FT                   /locus_tag="PSPTO_0484"
FT                   /old_locus_tag="PSPTO0484"
FT   CDS_pept        complement(530394..531368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0484"
FT                   /old_locus_tag="PSPTO0484"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to PFAM protein family HMM PF01636"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54028"
FT                   /db_xref="GOA:Q88AA8"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AA8"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54028.1"
FT                   /translation="MAHPFATLTPDLVLDAVESIGFLSDARILALNSYENRVYQVGIED
FT                   GQPLIAKFYRPQRWTNEAILEEHSFTFELVDVEVPVVAPMVHNGETLFEHAGFRFTLFP
FT                   RRGGRAPEPGNLDQLYRLGQLLGRIHAVGSTKPFAHREALGVKNFGNDSVNYLLENNCI
FT                   PRSLLPAYESVARDLLKRVEDVYAATPHTNIRMHGDCHPGNMMCRDEMFHIVDLDDCRL
FT                   GPAVQDIWMMLAGDRQERLGQLSELMDGYNEFHDFDSRELALIEPLRALRLMHYSAWLA
FT                   RRWDDPAFPHSFPWFGTERYWGDHILALREQMAALNEEPLKLF"
FT   gene            531564..532583
FT                   /locus_tag="PSPTO_0485"
FT                   /old_locus_tag="PSPTO0485"
FT   CDS_pept        531564..532583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0485"
FT                   /old_locus_tag="PSPTO0485"
FT                   /product="transcriptional repressor, LacI family"
FT                   /note="similar to GP:290603, and SP:P25551; identified by
FT                   sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54029"
FT                   /db_xref="GOA:Q88AA7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AA7"
FT                   /protein_id="AAO54029.1"
FT                   /translation="MTDLKDVARLAGVSRATAARAFASPKVVRIETRERVFAAARELGF
FT                   RPNRLGRQLRLQTTNLIGVIVPNLLNPVFAEQFQAMERAARARGYNLLLATTDYSAERE
FT                   SAVVEELLRQRVDGLVLTVTDAEHNRVLESLVSEDTPFVLAYHQTDNEDYSAVSVDNRA
FT                   GMALATQYLIDAGHQRIAMVAGPVMQSDRARLRYEGYRDAMNERGLEARPVIEMPAHTN
FT                   AEFAALEPLLRGPNAPSALVCSNDLLAISLIAELRRHGWGVPERLSVIGFDGIALGTQM
FT                   HPTLCSVVQPIAELAHTVIEQLLARIAGAAAASHCLPCHIRPGESTQPYQEMLHVQPQ"
FT   gene            532567..533568
FT                   /locus_tag="PSPTO_0486"
FT                   /old_locus_tag="PSPTO0486"
FT   CDS_pept        532567..533568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0486"
FT                   /old_locus_tag="PSPTO0486"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54030"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AA6"
FT                   /protein_id="AAO54030.1"
FT                   /translation="MFSLSKTLAALLLCSAASLAQAAETAICYNCPPEWADWGTQLKAI
FT                   ADSTSVQVPLDNKNSGQALAQIVAEQAAPVADVVYYGVTFGLQAQKAGVVDTYKPKHWD
FT                   DIPAGLKDPQGHWFAIHSGTLGIMVNVDALGGLPVPQSWADLLKPEYKGMVGYLDPSSA
FT                   FVGYVSAVAINQAMGGSLDNFGPAIDYFQKLAKNSPIVPKQTAYARALSGELPILVDYD
FT                   FNAYRARYKDKANVAFVIPKEGTIGVPYVMSMVAKAPHRANAEKVLDFVLSDAGQALWA
FT                   KAYLRPVRSKMPADVAAQFLPDSDYARAGVVDYQRMAAVQEAFAARYLREVK"
FT   gene            533568..534437
FT                   /locus_tag="PSPTO_0487"
FT                   /old_locus_tag="PSPTO0487"
FT   CDS_pept        533568..534437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0487"
FT                   /old_locus_tag="PSPTO0487"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54031"
FT                   /db_xref="GOA:Q88AA5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AA5"
FT                   /protein_id="AAO54031.1"
FT                   /translation="MPASPEHALALRKDGFFRLRLRPTAAVALAPAMAVLLAFWLLPLT
FT                   HLILLGAQGTDGNGSGYWQVLSSAQYLGSLAQTCLLALVVTLVALLIGGISGVFLARNH
FT                   FFGRSALVALLTFPLAFPGVVVGFLVILLAGRQGIFAALGLQLAGERWVFAYSLIGLFI
FT                   GYLYFSIPRVILTVMAACESLDRSLEEAAHSLGAGHWRVVCDVIVPGLAPALVSCGAIC
FT                   FATSMGAFGTAFTLGTRLNVTPVAIYNVFTNYANFTVAAALSVILGLVTWAVLLLARRM
FT                   VGKSGVAL"
FT   gene            534434..535228
FT                   /locus_tag="PSPTO_0488"
FT                   /old_locus_tag="PSPTO0488"
FT   CDS_pept        534434..535228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0488"
FT                   /old_locus_tag="PSPTO0488"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54032"
FT                   /db_xref="GOA:Q88AA4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AA4"
FT                   /protein_id="AAO54032.1"
FT                   /translation="MKRSPLFAAQLAFTLLVCAFMLVPVVLSLLAGVTRNYFLGLSSGL
FT                   TFDWLVQVWQGYSPTVWLSLQLAVACAICVCLVGVPAAYALVRMNNRFSRAFEELMVLP
FT                   VAMPGLASALALLLTYGQFGSFRSSWLFILVGHVLFTLPFLVRPVMAVMQRQQLPVLEE
FT                   AAASLGAGPIKRFFSVVVPNCRAGILAGVLMVVTLSLGEFNLTWMLHTPMTKTLPVGLA
FT                   DSYASARLEVASAYTLLFLLLIVPLLIALQAISARLARGESR"
FT   gene            535225..536268
FT                   /locus_tag="PSPTO_0489"
FT                   /old_locus_tag="PSPTO0489"
FT   CDS_pept        535225..536268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0489"
FT                   /old_locus_tag="PSPTO0489"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54033"
FT                   /db_xref="GOA:Q88AA3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AA3"
FT                   /protein_id="AAO54033.1"
FT                   /translation="MSGTTIRLKGCRKAFADGTVAVQDLHLTIEPGETLAILGPSGCGK
FT                   TTTLRLIAGLERPDVGQVLFDDQDVTRLPIERRDVGMVFQNYALFPNLDVAGNIVYGLK
FT                   IRGLSAAECNKRCDELLELVGLTGHGNRRVNELSGGQRQRVALARALAPRPRVLLLDEP
FT                   LAALDAQLRERLRSELDQLLRGLGITSVFVTHDQGEAMALGDRILVMEKGCVSQLATPR
FT                   EIYQRPANAFVAGFVGNLNAFSVVARTSSGLTVSGGELPWNGADMPGTVYCRPEHLRLV
FT                   PGHGHLQSHLQGRLVGQFFQGAQSRLLVDVGGPQPLLVDSTDNVIYPANAAIGLSVEPQ
FT                   QLFTLHS"
FT   gene            536293..537126
FT                   /locus_tag="PSPTO_0490"
FT                   /old_locus_tag="PSPTO0490"
FT   CDS_pept        536293..537126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0490"
FT                   /old_locus_tag="PSPTO0490"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="similar to GP:14027950; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54034"
FT                   /db_xref="GOA:Q88AA2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR042281"
FT                   /db_xref="InterPro:IPR042283"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AA2"
FT                   /protein_id="AAO54034.1"
FT                   /translation="MNRPFLIAQISDLHLKADGRLTYGVVDTLGALRRAVAHINASKQR
FT                   PDIVVISGDLVDFGREDEYAVLKPELERLQMPFYLVPGNHDDRENLLAAFADQVYLPLA
FT                   ASGPLDWVVEQYPLRLIGMDTTIPGEHGGRLDYCQLDWLNAQLSRRPDVPTVIVLHHPP
FT                   FITGIGHMDREPFGNASALERVIAQHPQVERLLCGHLHRPMQRRFGGSVASICPGTSHQ
FT                   IVLDLDEAAPAHFNLEPAGYVLHRWDPEQGLVSHNAVFGDYEGPYPFYDEGGLID"
FT   gene            complement(537253..539169)
FT                   /locus_tag="PSPTO_0491"
FT                   /old_locus_tag="PSPTO0491"
FT   CDS_pept        complement(537253..539169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0491"
FT                   /old_locus_tag="PSPTO0491"
FT                   /product="Tat (twin-arginine translocation) pathway signal
FT                   sequence domain protein"
FT                   /note="identified by match to TIGR protein family HMM
FT                   TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54035"
FT                   /db_xref="GOA:Q88AA1"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AA1"
FT                   /protein_id="AAO54035.1"
FT                   /translation="MKLLEENQTTDLENMVGASRAGLTRRGFISAGALCGAAMFLGGNI
FT                   LSRTVLANSVSAASGALLGFESIPTATADSISLPKGYTSSVLISWGQPLQANGPAFDPS
FT                   GKGTAQAQEVQFGDNNDGMCLFPMPGHKDRALMAINNEYTNYRYLFDHGKEPQSAEEVQ
FT                   KALAAEGVSVIEVQQKQGKWQFVQDSRYNRRVHGNTPIKLSGPAAGHDWLKTDADKGGT
FT                   HALGTFQNCSSGQTPWGTYLTCEENFTDCFGSSNPEQKFDAGMKRYGVVAASKEINWHP
FT                   HDPRFDVAKNPNEVNRHGWVVEIDPFDPKSTPVKRTALGRFKHENAAFTQTKGGRAVVY
FT                   MGDDERGEFIYKFISRDKIDHQNPKANRDLLDHGTLYVAQFDAGDSNPDHPKGKGQWIE
FT                   LTHGKNGLDAAASFNNQAEVLIHARLAASVVKATRMDRPEWIVVSPKDGQVYCTLTNNI
FT                   KRGDEGQPVGGPNPRAKNQYGQILRWSEEGSNASAMAFDWDLFVVAGNPAVHAGTPQAG
FT                   SSNINAQNMFNSPDGLSFDEAGRLWIQTDGDSSNKGDFAGMGNNQMLCADPASGEIRRF
FT                   LVGPVGCEITGISFAPDYKTMFIGIQHPGENGGSTFPEHLPNGKPRSSVMVITREDGGV
FT                   IGA"
FT   gene            complement(539251..540015)
FT                   /locus_tag="PSPTO_0492"
FT                   /old_locus_tag="PSPTO0492"
FT   CDS_pept        complement(539251..540015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0492"
FT                   /old_locus_tag="PSPTO0492"
FT                   /product="molybdate transport regulator ModE, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54036"
FT                   /db_xref="GOA:Q88AA0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR003725"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR016462"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q88AA0"
FT                   /protein_id="AAO54036.1"
FT                   /translation="MSLPPSLTQHMVRRPQRIALLQHIAEQGSITRAAKSAGLSYKAAW
FT                   DAIDELNNLAQKPLVERSVGGRGGGGAKLSVEGERVLRLYQRVQALQAQVLETAENSSD
FT                   LDLLNRLTLRTSARNQLLGRIAAITRQGHHDQVRLQLADEVFIEAQVTHDSTRDLGLEV
FT                   GTDAVALIKAGWLELHAQHVEVTNGNNCLVGQIESVIDADDGPSEVRIKLPSGLTLCAL
FT                   ATPAHLQAQQLKTGVTVQAGFAASFVLLGIPT"
FT   gene            complement(540207..540941)
FT                   /locus_tag="PSPTO_0493"
FT                   /old_locus_tag="PSPTO0493"
FT   CDS_pept        complement(540207..540941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0493"
FT                   /old_locus_tag="PSPTO0493"
FT                   /product="competence protein ComF, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54037"
FT                   /db_xref="GOA:Q88A99"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A99"
FT                   /protein_id="AAO54037.1"
FT                   /translation="MRCQPSYDRQVYIWLKNKQTCLLCDERSEVPAPICVPCEAELPWL
FT                   GEQCEYCALPLPVFGLSCGQCSKRPPAFAQVVAPWLYEFPIDSLITRFKHNRKWPMGRL
FT                   LAELCGQFLQHRFDEGLPRPDYLLPVPLANKRLRQRGYNQAGMLAGWLGKQLQLPVDEQ
FT                   HVVRSRETAAQQGLDAKARKRNLRGAFALIDPDWVHGKHLALVDDVLTTGSTAEVIARL
FT                   LNSAGARRVDVYCLARTPKPGD"
FT   gene            541032..542090
FT                   /gene="bioB"
FT                   /locus_tag="PSPTO_0494"
FT                   /old_locus_tag="PSPTO0494"
FT   CDS_pept        541032..542090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioB"
FT                   /locus_tag="PSPTO_0494"
FT                   /old_locus_tag="PSPTO0494"
FT                   /product="biotin synthetase"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54038"
FT                   /db_xref="GOA:Q88A98"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88A98"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54038.1"
FT                   /translation="MSASTTATLRHDWTLAEVRALFVQPFNDLLFQAQTLHRAHFDANR
FT                   VQVSTLLSIKTGACPEDCKYCPQSGHYNTGLEKEKLLEVQKVLEEAARAKSIGSTRFCM
FT                   GAAWKHPSAKDMPYVLEMVKGVKAMGLETCMTLGRLDQEQTEALATAGLDYYNHNLDTS
FT                   PEFYGSIITTRTYGERLQTLAYVRDAGMKICSGGILGMGESLDDRAGLLIQLANLPEHP
FT                   ESVPINMLVKVAGTPLENAEDVDPFDFIRMLAVARILMPQSHVRLSAGREAMNEQMQAL
FT                   AFFAGANSIFYGDKLLTTANPQADKDMLLFSRLGIKPEAGEGHADEVHQAAIEQALVEQ
FT                   QSSAMFYDAASA"
FT   gene            542154..543344
FT                   /gene="bioF"
FT                   /locus_tag="PSPTO_0495"
FT                   /old_locus_tag="PSPTO0495"
FT   CDS_pept        542154..543344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioF"
FT                   /locus_tag="PSPTO_0495"
FT                   /old_locus_tag="PSPTO0495"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54039"
FT                   /db_xref="GOA:Q88A97"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022834"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88A97"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54039.1"
FT                   /translation="MSFDLRTRLDARRTAHLYRQRPLLQSPQGPHVIVDGQPLLAFCNN
FT                   DYMGLANHPEVIAAWQAGAERWGVGGGASHLVIGHSTPHHELEEALAELTGRPRALLFS
FT                   NGYMANLGAVTALVGQGDTVLEDRLNHASLLDAGLLSGARFSRYLHNDAGSLNARLEKA
FT                   VGDTLVVTDGVFSMDGDIADLPALAQAAKAKGAWLMVDDAHGFGPLGANGAGIVEHFGL
FT                   SMEDVPVLVGTLGKSFGTSGAFVAGSEELIETLIQFARPYIYTTSQPPALACATLKSLQ
FT                   LLRSEHWRREHLASLIGQFRRGAEQLGLQLMDSFTPIQPIMIGDAGRALRLSQLLRERG
FT                   LLVTAIRPPTVPAGSARLRVTLSAAHSEADVQLLLEALEQCYPLLDASESTEPVHA"
FT   gene            543337..544068
FT                   /gene="bioH"
FT                   /locus_tag="PSPTO_0496"
FT                   /old_locus_tag="PSPTO0496"
FT   CDS_pept        543337..544068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioH"
FT                   /locus_tag="PSPTO_0496"
FT                   /old_locus_tag="PSPTO0496"
FT                   /product="bioH protein"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54040"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A96"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54040.1"
FT                   /translation="MRDRLILLPGWGLGVSPLEPLAAALRGLDEHLRVEIEPLPDIDSC
FT                   EVPDWLDELDANLPDNAWLGGWSLGGMLAAELAARRGEGCCGLLTLASNACFVTQGGWP
FT                   NAMPAQDFDAFLAGCSVDPDATLKRFSLLCTQGAQDPRGLARLLKAGAPHSSKTALVDG
FT                   LKILQQLDTRSALQTYRGPQLHLFAGLDAFVPAEAAGDLLAVLPDVEVGLIEQASHAFL
FT                   LENPHAVAAAIQAFLHESGDD"
FT   gene            544061..544870
FT                   /gene="bioC"
FT                   /locus_tag="PSPTO_0497"
FT                   /old_locus_tag="PSPTO0497"
FT   CDS_pept        544061..544870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioC"
FT                   /locus_tag="PSPTO_0497"
FT                   /old_locus_tag="PSPTO0497"
FT                   /product="biotin synthesis protein BioC"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54041"
FT                   /db_xref="GOA:Q88A95"
FT                   /db_xref="InterPro:IPR011814"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A95"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54041.1"
FT                   /translation="MTDLSHPKPPSVLPDKRQVAASFSRAAGSYDSVAELQRSVGSELL
FT                   SRLPAGFTPSPWLDLGCGTGYFSRALARTFSQSEGIALDIAEGMLRHAQPLGGAQHFVA
FT                   GDAERLPLRDERCELIFSSLAVQWCADFAAVLSEAHRVLSPGGVFAFASLCVGTLYELR
FT                   DSWRAVDGQVHVNRFRHEDDYRQLCAASGLRVRSLEVRPQVLHYPDVRSLTHELKALGA
FT                   HNLNPGRHNGLTGRERILGMVQAYEGFRQPAGLPATYQVVYAVLEKA"
FT   gene            544902..545582
FT                   /gene="bioD"
FT                   /locus_tag="PSPTO_0498"
FT                   /old_locus_tag="PSPTO0498"
FT   CDS_pept        544902..545582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioD"
FT                   /locus_tag="PSPTO_0498"
FT                   /old_locus_tag="PSPTO0498"
FT                   /product="dethiobiotin synthetase"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54042"
FT                   /db_xref="GOA:Q88A94"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A94"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54042.1"
FT                   /translation="MSAAYFITGTDTDAGKTTVAAGLLHAARLKGLSTAAGKPVASGCV
FT                   MTAEGLRNSDALALQTECSIELDYDEVNPLAFAPAIAPHLAALEAGVTLTVDSLLQPMR
FT                   HILNKQADFTLIEGAGGWRVPLAGEHNLSDLAIALGLPVILVVGVRLGCINHAVLTAEA
FT                   IARDGLHLAGWVANVIDAQTSRLEENLATLRERLPAPCLGRVPRLSEASAENVAHYLDV
FT                   QLLN"
FT   gene            545737..546033
FT                   /locus_tag="PSPTO_0499"
FT                   /old_locus_tag="PSPTO0499"
FT   CDS_pept        545737..546033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0499"
FT                   /old_locus_tag="PSPTO0499"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:9946369, and GP:9946369; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54043"
FT                   /db_xref="GOA:Q88A93"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A93"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54043.1"
FT                   /translation="MQITMNNTLYPGLSAMQVGQGRVDQAATQIASSNIEVSGRSQSSD
FT                   FQLENLRSVDRSQRSDLSSNIVELNAGKNQIEAGVAVQKASDEALGTLIDTYA"
FT   gene            546382..548187
FT                   /locus_tag="PSPTO_0500"
FT                   /old_locus_tag="PSPTO0500"
FT   CDS_pept        546382..548187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0500"
FT                   /old_locus_tag="PSPTO0500"
FT                   /product="acyl-CoA dehydrogenase family protein"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54044"
FT                   /db_xref="GOA:Q88A92"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A92"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54044.1"
FT                   /translation="MPDYKAPLRDIRFVRDELLGYEAHYQSLPACHDATPDMVDAILEE
FT                   GAKFCEQVLAPLNRVGDTEGCTWSESGVKTPSGFKQAYKQFVEGGWPSLAHDVAHGGQG
FT                   LPESLGLAVSEMVGEANWSWGMYPGLSHGAMNTISEHGTPEQQDAYLTKLVSGEWTGTM
FT                   CLTESHCGTDLGMLRTKAEPQADGTYKVTGTKIFISAGEHDMADNIVHIVLARLPDAPA
FT                   GTKGISLFIVPKFLSAADGGVGERNAVNCGSIEHKMGIHGNATCVMNFDGATGYLIGPP
FT                   NKGLNCMFTFMNTARLGTALQGLAHAEVAFQGGLKYARDRLQMRSLTGPKAPEKAADPI
FT                   IVHPDVRRMLLTMKAFAEGTRAMVYFTAKQVDIVKYSEDPEQKKSADALLAFMTPIAKA
FT                   FMTEVGFEAANHGVQIYGGHGFIAEWGMEQNVRDSRISMLYEGTTGIQALDLLGRKVLM
FT                   TQGEALKGFTKIVHKFCQSNEGNEGVQEFVTPLAALNKEWGELTLKVGMAAIKDREEVG
FT                   AASVDYIMYSGYACLAYFWADMARLAAEKLAAGTADEAFYRAKIQTARFYFQRILPRTR
FT                   THVAAILSGAGNLMDMKEEDFGLAY"
FT   gene            complement(548376..549170)
FT                   /gene="hopU1"
FT                   /locus_tag="PSPTO_0501"
FT                   /old_locus_tag="PSPTO0501"
FT   CDS_pept        complement(548376..549170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hopU1"
FT                   /locus_tag="PSPTO_0501"
FT                   /old_locus_tag="PSPTO0501"
FT                   /product="type III effector HopU1"
FT                   /note="previously known as HopPtoS2 (PMID12032338;
FT                   Petnicki-Ocwieja et al, 2002)"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54045"
FT                   /db_xref="GOA:Q88A91"
FT                   /db_xref="InterPro:IPR003540"
FT                   /db_xref="PDB:3U0J"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A91"
FT                   /protein_id="AAO54045.1"
FT                   /translation="MNINRQLPVSGSERLLTPDVGVSRQACSERHYSTGQDRHDFYRFA
FT                   ARLHVDAQCFGLSIDDLMDKFSDKHFRAEHPEYRDVYPEECSAIYMHTAQDYSSHLVRG
FT                   EIGTPLYREVNNYLRLQHENSGREAEIDNHDEKLSPHIKMLSSALNRLMDVAAFRGTVY
FT                   RGIRGDLDTIARLYHLFDTGGRYVEPAFMSTTRIKDSAQVFEPGTPNNIAFQISLKRGA
FT                   DISGSSQAPSEEEIMLPMMSEFVIEHASALSEGKHLFVLSQI"
FT   gene            complement(549423..550037)
FT                   /gene="hopF2"
FT                   /locus_tag="PSPTO_0502"
FT                   /old_locus_tag="PSPTO0502"
FT   CDS_pept        complement(549423..550037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hopF2"
FT                   /locus_tag="PSPTO_0502"
FT                   /old_locus_tag="PSPTO0502"
FT                   /product="type III effector HopF2"
FT                   /note="This gene has an isoleucine start. Previously known
FT                   as HolPtoAD (PMID11872842; Guttman et al, 2002) and HopPtoF
FT                   (PMID11854524; Fouts et al, 2002); see PMID:20190049 for
FT                   expression data; similar to GP:7677395; identified by
FT                   sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54046"
FT                   /db_xref="GOA:Q88A90"
FT                   /db_xref="InterPro:IPR015226"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A90"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54046.1"
FT                   /translation="MGNICGTSGSRHVYSPSHTQRITSAPSTSTHVGGDTLTSIHQLSH
FT                   SQREQFLNMHDPMRVMGLDHDTELFRTTDSRYIKNDKLAGNPQSMASILMHEELRPNRF
FT                   ASHTGAQPHEARAYVPKRIKATDLGVPSLNVMTGSLARDGIRAYDHMSDNQVSVKMRLG
FT                   DFLERGGKVYADASSVADDGETSQALIVTLPKGQKVPVERV"
FT   gene            complement(550174..550569)
FT                   /gene="shcF"
FT                   /locus_tag="PSPTO_0503"
FT                   /old_locus_tag="PSPTO0503"
FT   CDS_pept        complement(550174..550569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="shcF"
FT                   /locus_tag="PSPTO_0503"
FT                   /old_locus_tag="PSPTO0503"
FT                   /product="type III chaperone protein ShcF"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54047"
FT                   /db_xref="GOA:Q88A89"
FT                   /db_xref="InterPro:IPR010261"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A89"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54047.1"
FT                   /translation="MKNAFDLLVEGLAKDYNMPPLPDKKHIDEVYCFEFQSGMNVKVYQ
FT                   DEFRWVYFTADVGTFQDSSIDTLNYALQLNNFSLRKPFLTFGMTKEKNGVLHTRTPLIE
FT                   VDNVQMRRIFEELIGVAGEIRKTLKLK"
FT   regulatory      complement(550602..550634)
FT                   /bound_moiety="HrpL"
FT                   /note="PMID:17073300"
FT                   /inference="nucleotide motif:HMM2"
FT                   /experiment="microarray and/or RT-PCR"
FT                   /regulatory_class="promoter"
FT   gene            552012..553307
FT                   /locus_tag="PSPTO_0505"
FT                   /old_locus_tag="PSPTO0505"
FT   CDS_pept        552012..553307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0505"
FT                   /old_locus_tag="PSPTO0505"
FT                   /product="GGDEF domain protein"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54048"
FT                   /db_xref="GOA:Q88A88"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A88"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54048.1"
FT                   /translation="MRPSAARLSHFLPSLGLLVAGFAAAYVKDLNVFLTSLFNVLPTLV
FT                   LLLGGAYCCVYRRQRELFLMVTVYIAYYLLDTQTDFYRDNGKVREDAAVIFHLVCLLLP
FT                   VLFGLYAAWEERTHLFQDLVARLAVLIAVGSVALGLEQSYPVELQVWLADIRWPALHGS
FT                   WMSLIQLSYAMFLLSFAVLIWQYLEKPRPLHAAQIVGLLGLFWALPKTFILPFTLNILC
FT                   SQVMLMIAAAVAHEAYQMAFRDELTGLPGRRALNERMQRLGRNYVLAMSDVDHFKKFND
FT                   THGHDVGDQVLRLVASKLSKITNGGGRAYRYGGEEFAIVFAAKTIDECMPHLEAIRETI
FT                   ANYAIQLRNKDSRPQDDQQGRQRRSGAHEASVSVTVSIGVAERQPEHRTPEEVLKSADQ
FT                   ALYAAKGAGRNCVVAYGQLNRRGAVRTTEAAH"
FT   gene            553477..555255
FT                   /locus_tag="PSPTO_0506"
FT                   /old_locus_tag="PSPTO0506"
FT   CDS_pept        553477..555255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0506"
FT                   /old_locus_tag="PSPTO0506"
FT                   /product="acyl-CoA dehydrogenase family protein"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54049"
FT                   /db_xref="GOA:Q88A87"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A87"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54049.1"
FT                   /translation="MADYKAPLRDMRFVLNEVFEVSRLWAQLPELAETVDAETVDAILE
FT                   EAGKVTSKTIAPLSRNGDEEGCHWKDTVVTTPAGFPEAYRIYAEGGWVGVGGDPVFGGM
FT                   GMPKIVSAQVEEMINSASLAFGLYAMLTSGACVSINTHATEALKAKFLPNMYSGVWAGS
FT                   MCLTEAHAGTDLGMIRTKAEPQTDGAYTITGSKIFITGGEHDLTENIIHLVLAKLPDAP
FT                   AGPKGISLFLVPKFMVGDDGSLGARNTVSCGSIEHKMGIQASATCVMNFDDAVGYLIGE
FT                   PNKGLAAMFTMMNYERLGVGIQGLASGVQSYQNAVEYAVDRLQSRAPTGAQNKDKAADP
FT                   IIVHPDVRRMLLTMKAFNEGGRAFSSYVALQLDIAKFSEDDAARKRADDLAALLTPVAK
FT                   AFLSDIGLETTVHGQQVFGGHGYIREWGQEQLVRDVRITQIYEGTNGIQALDLVGRKIV
FT                   GSNGALYQLFSDEVRQFIDTSDSSLGEFTRPLTAALNMLDELTGWVLDRSRSNPNEIGA
FT                   ASVEYLHLFGYTAYAYMWAMMAKAAFGKEQQDDFYASKLGTARFYFARLLPRIHSLDAS
FT                   VRAGSESLFLLEASQF"
FT   gene            555344..555465
FT                   /locus_tag="PSPTO_5647"
FT   ncRNA           555344..555465
FT                   /locus_tag="PSPTO_5647"
FT                   /product="rsmY"
FT                   /note="PMID:20190049"
FT                   /inference="nucleotide motif:RFAM:RF00195"
FT                   /experiment="RNA sequencing"
FT                   /ncRNA_class="scRNA"
FT   gene            555671..555832
FT                   /locus_tag="PSPTO_0507"
FT                   /old_locus_tag="PSPTO0507"
FT   CDS_pept        555671..555832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0507"
FT                   /old_locus_tag="PSPTO0507"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54050"
FT                   /db_xref="GOA:Q88A86"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A86"
FT                   /protein_id="AAO54050.1"
FT                   /translation="MDIIRIIFAILLPPVGVFMQVGFAGAFWLNILLTLLGYIPGIIHA
FT                   IYIIVSRK"
FT   gene            complement(555873..557705)
FT                   /locus_tag="PSPTO_0508"
FT                   /old_locus_tag="PSPTO0508"
FT   CDS_pept        complement(555873..557705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0508"
FT                   /old_locus_tag="PSPTO0508"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54051"
FT                   /db_xref="GOA:Q88A85"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A85"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54051.1"
FT                   /translation="MTETHASSQNLPDTLTAAQAVAAGVDFAELDVSSAGLFWNEYRPE
FT                   DGACRIWHWYANSKHCLTPQGFSVRSRVYEYGGGSFCLADDAVVFVNERDQQLYRQALD
FT                   ASVPVALTQGDKRYGGVFFSNGQVLAVEEDHNTHRLVAINLADGQRVLLAEGADFYASP
FT                   IVSANGKRLAWIEWQRPHQPWTRSRLMCAAKQDDGQWGVAVCIAGDGAEESLQQPRFDA
FT                   RSRLYCLTDRAGFWQPWGETPSGFAALPAASADHASAPWQLGSCTWLPINDGYLASWSQ
FT                   DGSGVLGLCQADGSTEDFSVGYSRFRSLAVDEEFVYCIAASAVSTAAVLAISRADHSVH
FT                   VLAGGGSPLPAELISRPQALCYPSGGAEAYGYFYPAMTGAQKPPLVVFIHGGPTSACYP
FT                   VLDPRIQYWTHRGFAVADLNYRGSSGYGRAYRQGLHLTWGVADVQDACAVVTHLAERGL
FT                   IDEQQAFIRGGSAGGYTTLCALAFEDVFRAGASLYGVSDPVALAKATHKFEGDYLDWLI
FT                   GDPVTDIERYEARTPLLHANLISVPVIFFQGELDAVVVPEQTRAMLKALQDNGIKAEGH
FT                   FYPDEHHGFRKAHNQADALEKEWRFYRDVLDQAV"
FT   gene            complement(557668..558837)
FT                   /gene="pqqE"
FT                   /locus_tag="PSPTO_0509"
FT                   /old_locus_tag="PSPTO0509"
FT   CDS_pept        complement(557668..558837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqqE"
FT                   /locus_tag="PSPTO_0509"
FT                   /old_locus_tag="PSPTO0509"
FT                   /product="coenzyme PQQ synthesis protein E"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54052"
FT                   /db_xref="GOA:Q88A84"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR011843"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88A84"
FT                   /protein_id="AAO54052.1"
FT                   /translation="MSDIAPAAHSPYIPPTPEVGLPLWLLAELTYRCPLQCPYCSNPLD
FT                   FARQGQELTTEQWFKVMQEAREMGAAQIGFSGGEPLVRQDLAELIAEARRLGFYTNLIT
FT                   SGIGLTEEKIIAFKKAGLDHIQISFQASDEQVNNMLAGSKKAFAQKLEMAKAVKKHGYP
FT                   MVLNFVTHRHNIDRIDKIIELCLALEADFVELATCQFYGWAHLNRVGLLPTKDQLVRAE
FT                   AVTNEYRDQLAAQDHPCKLIFVTPDYYEERPKACMNGWGNIFLTVTPDGTALPCHGARQ
FT                   MPIQFPNVREHSMQHIWYDSFGFNRFRGYDWMPEPCRSCDEKEKDFGGCRCQAFMLTGD
FT                   AANADPVCSKSYHHGIITQARDESETATQTIEELAFRNDRNSRLIAKSS"
FT   gene            complement(558830..559126)
FT                   /gene="pqqD"
FT                   /locus_tag="PSPTO_0510"
FT                   /old_locus_tag="PSPTO0510"
FT   CDS_pept        complement(558830..559126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqqD"
FT                   /locus_tag="PSPTO_0510"
FT                   /old_locus_tag="PSPTO0510"
FT                   /product="coenzyme PQQ synthesis protein D"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54053"
FT                   /db_xref="GOA:Q88A83"
FT                   /db_xref="InterPro:IPR008792"
FT                   /db_xref="InterPro:IPR022479"
FT                   /db_xref="InterPro:IPR041881"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88A83"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54053.1"
FT                   /translation="MKHEIKHDPAFRALTPKWHHGYRFQYEPAQKAHVVLYPEGMIKLN
FT                   DSASLIGGLIDGERTIAAIIAELQREFPNIPELGMDVDDFMKVAKEKYWIDLV"
FT   gene            complement(559123..559878)
FT                   /gene="pqqC"
FT                   /locus_tag="PSPTO_0511"
FT                   /old_locus_tag="PSPTO0511"
FT   CDS_pept        complement(559123..559878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqqC"
FT                   /locus_tag="PSPTO_0511"
FT                   /old_locus_tag="PSPTO0511"
FT                   /product="coenzyme PQQ synthesis protein C"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54054"
FT                   /db_xref="GOA:Q88A82"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR011845"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR039068"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88A82"
FT                   /protein_id="AAO54054.1"
FT                   /translation="MSEATALSPAEFEQALRAKGAYYHIYHPFHVAMYEGRATREQIQG
FT                   WVANRFYYQVNIPLKDAAILANCPDREIRREWIQRLLDHDGAPGEDGGIEAWLRLGEAV
FT                   GLDPDQLRSQELVLPGVRFAVDAYVNFARRANWQEAASSSLTELFAPQIHQSRLDSWPQ
FT                   HYPWIDPTGYEYFRTRLGQARRDVEHGLAITLQHYTTYEGQQRMLEILQFKLDILWSML
FT                   DAMSMAYELNRPPYHSVTDQKVWHKGITP"
FT   gene            complement(559887..560798)
FT                   /gene="pqqB"
FT                   /locus_tag="PSPTO_0512"
FT                   /old_locus_tag="PSPTO0512"
FT   CDS_pept        complement(559887..560798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqqB"
FT                   /locus_tag="PSPTO_0512"
FT                   /old_locus_tag="PSPTO0512"
FT                   /product="coenzyme PQQ synthesis protein B"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54055"
FT                   /db_xref="GOA:Q88A81"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011842"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88A81"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54055.1"
FT                   /translation="MYIQILGSAAGGGFPQWNCNCVNCAGFRDGSLRAQARTQSSIALS
FT                   DDGVNWVLCNASPDIRAQLQGFAPMQPGRALRDTGISAIVLMDSQIDHTTGLLSLREGC
FT                   PHQVWCTDMVHEDLSTGFPLFEMLKHWNGGLNWNRIELQGSFVIPACPNLRFTPFPLRS
FT                   AAPPYSPHRFDPHPGDNIGLLVEDTRTGGKLFYAPGLGKVDEALAEKMRDADCLLVDGT
FT                   MWDDDEMQRRGVGTRTGREMGHLAQNGPGGMLDVLEGFPEQRKVLIHINNTNPILDEDS
FT                   PERAELVRRNVEVAFDGMSIEL"
FT   gene            complement(560896..560970)
FT                   /gene="pqqA"
FT                   /locus_tag="PSPTO_0513"
FT                   /old_locus_tag="PSPTO0513"
FT   CDS_pept        complement(560896..560970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqqA"
FT                   /locus_tag="PSPTO_0513"
FT                   /old_locus_tag="PSPTO0513"
FT                   /product="coenzyme PQQ synthesis protein A"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P27503; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54056"
FT                   /db_xref="GOA:Q88A80"
FT                   /db_xref="InterPro:IPR011725"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88A80"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54056.1"
FT                   /translation="MSWTKPAYTDLRIGFEVTMYFASR"
FT   gene            complement(561106..563445)
FT                   /gene="pqqF"
FT                   /locus_tag="PSPTO_0514"
FT                   /old_locus_tag="PSPTO0514"
FT   CDS_pept        complement(561106..563445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqqF"
FT                   /locus_tag="PSPTO_0514"
FT                   /old_locus_tag="PSPTO0514"
FT                   /product="coenzyme PQQ synthesis protein F"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54057"
FT                   /db_xref="GOA:Q88A79"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="InterPro:IPR011844"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88A79"
FT                   /protein_id="AAO54057.1"
FT                   /translation="MDALMPAPQSADLRRITLANGLSVALCHDSRLKRSAASLRVAAGS
FT                   HDAPLAWPGLAHFLEHLFFLGTERFQAGENLMTFVQRHGGQVNASTRERTTDFFFELPQ
FT                   TAFAQGLERLCDMLARPRMTVADQLREREVLHAEFIAWRGDANARDQLRLLAAVNPQHP
FT                   LRGFHAGNRYSLSVPNPAFQQALQNFYQRFYQAAQMTLCLSGPQSLAELETLANTHGAL
FT                   FASGTKVRQHAPAPLMKHPTSLEHIDEQKHLLFACEHLPAKADEAVAFLCHWLNAAQPG
FT                   GLIATLIERGLIESLNATPLYQFDGQLLLDIELNANRPSASTIKSLLLSWLRFFKTQWP
FT                   ALIEEYQRLEQRRLQMSGALTLAHHHCRELPAQLSDQGADALRELLEQLTSNALIGSAP
FT                   VDNLDSTLAEWRLPAPNPFLESIAEDSPEAALYLRWELPSAQPTLWQMLNTRLTPLIED
FT                   ARQAGVNLTFSAYGNYWQIQLNGLRAPMVAVIEHALQRLRHAAPGPLTHAGQASEPLIP
FT                   VRQLLKHLADHYLISKQAQTTGDLHTVWKHSRWISFASGFCAASQLQLNTALNATPGTR
FT                   QTDVPTLPAIRLGKRWSSEASSSSENAVLVFCPAPTASVEDEAAWRLLAHLLQAPFYQR
FT                   LRVELQLGYAVFSGIRQIAGRTGLLFGVQSPTCSADQLFQHIEAFIGRLPALIRTADLP
FT                   EQIRVLSAQFDPANMPDQQQADIHWQAYLAGHRAHHSQALQRALSNLDTHSLLATANQL
FT                   IDAAGGWLIVASRPASAAVPLSLPER"
FT   gene            563660..564175
FT                   /locus_tag="PSPTO_0515"
FT                   /old_locus_tag="PSPTO0515"
FT   CDS_pept        563660..564175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0515"
FT                   /old_locus_tag="PSPTO0515"
FT                   /product="ISPsy8, transposase OrfA"
FT                   /note="similar to GP:17428452; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54058"
FT                   /db_xref="GOA:Q877K7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:Q877K7"
FT                   /protein_id="AAO54058.1"
FT                   /translation="MAKYSEQFKLTVVKAYLAGNIGFRKVSSQFSIDSSLLRRWVANYK
FT                   SHGHTGHRKPGLRYSEAFKRSVLEHKREHGLSLRQTAAHFGIGDPGQIVIWEQQHYSND
FT                   LAPYVPKRRKSVAMPKKPYPTAPVIDDDTQKTRDQLMAELEYLRMENAYLKKLEELKEQ
FT                   QRRQKKKP"
FT   gene            564232..565011
FT                   /locus_tag="PSPTO_0516"
FT                   /old_locus_tag="PSPTO0516"
FT   CDS_pept        564232..565011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0516"
FT                   /old_locus_tag="PSPTO0516"
FT                   /product="ISPsy8, transposase OrfB"
FT                   /note="similar to GP:17428451; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54059"
FT                   /db_xref="GOA:Q877J0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q877J0"
FT                   /protein_id="AAO54059.1"
FT                   /translation="MARSTFYYQVQVQSRPDPDAALKQEVERIYHEERGLYGARRITAV
FT                   IRNSGTLVNKKVVERLMAELGLRSVVRPKKYRSYKGTVGKIAPNLLERNFTAQRPNQKW
FT                   VTDVTEFKVANRKLYLSPVMDLYNGEIVAYELSTRPCFELVTSMLDKALQQLQDEPKLV
FT                   MHSDQGWQYQHAQYRQKLAAKGVKQSMSRKGNCLDNAAMESFFGTLKSEFFYLKRFESI
FT                   EELTAGLEEYIRYYNHDRIKLKLGGLSPVKYRTQAAS"
FT   gene            complement(565108..565914)
FT                   /locus_tag="PSPTO_0517"
FT                   /old_locus_tag="PSPTO0517"
FT   CDS_pept        complement(565108..565914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0517"
FT                   /old_locus_tag="PSPTO0517"
FT                   /product="hydrolase, carbon-nitrogen family"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54060"
FT                   /db_xref="GOA:Q88A78"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A78"
FT                   /protein_id="AAO54060.1"
FT                   /translation="MRIALYQCPPLPLDISGNLARLEQQAVSAAAQGANVLICPEMFLT
FT                   GYNIGAQAVSELAQAHDGSAATRIAAIAKANGIAILYGYPERDTDQQVYNAVQLIDEHG
FT                   VSLCNYRKTHLFSELDRSMFSAGADYFPVVELNGWRLGMLICYDVEFPENTRRLALAGA
FT                   ELILVPTANMAPYDFVCDVTVRARAFENHCYVVYANYCGSEGEIRYCGLSSLCAPDGSR
FT                   PLLAGQDEGLLVGTLDKALLAQARTVNDYFVDRRPELYTSLTRARD"
FT   gene            complement(565932..567566)
FT                   /locus_tag="PSPTO_0518"
FT                   /old_locus_tag="PSPTO0518"
FT   CDS_pept        complement(565932..567566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0518"
FT                   /old_locus_tag="PSPTO0518"
FT                   /product="lysine monoxygenase, putative"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54061"
FT                   /db_xref="GOA:Q88A77"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A77"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54061.1"
FT                   /translation="MFGPDFPFAFDDWIEHPKGLGSIPAEHHGAEVAIIGAGIAGLVAA
FT                   YELMKMGLKPVVYEASKMGGRLRSQEFEGAKGIVAELGGMRFPVSSTAFFHYVDKLGLE
FT                   SRPFPNPLTAASGSTVIDLEGTTYYAQMLSDLPALFQEVADAWADALESGSQFGDIQQA
FT                   IRDRDVPRLKELWNKLVPLWDDRTFYDFVATSKAFAKLSFYHREVFGQVGFGTGGWDSD
FT                   FPNSMLEIFRVVMTNCDEHQHLIVGGVQQVPVGLWSHVPERCTHWPKGTSLSSLHRGAP
FT                   RPGVKRIARAEDGSFAVTDNWGDTRQYAAVLTTCQSWLLTTQIECEESLFSQKMWMALD
FT                   RTRYMQSSKTFVMVDRPFWKDKDPQTGRDLMSMTLTDRLTRGTYLFDNGDDKPGVICLS
FT                   YSWMSDALKMLPQPIEKRVKLALDALKKIYPKVDIAARIIGDPITVSWEADPHFLGAFK
FT                   GALPGHYRYNQRMYAHFMQQDMPSEQRGMFIAGDDVSWTPAWVEGAVQTSLNAVWGIMN
FT                   HFGGKTHAENPGPGDVFHEIGPITLAD"
FT   gene            complement(567763..568203)
FT                   /locus_tag="PSPTO_0519"
FT                   /old_locus_tag="PSPTO0519"
FT   CDS_pept        complement(567763..568203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0519"
FT                   /old_locus_tag="PSPTO0519"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54062"
FT                   /db_xref="GOA:Q88A76"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A76"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54062.1"
FT                   /translation="MLDEIDQKLIAALQINARESVAMLARQLGIARTTVTSRLARLESS
FT                   KVITGYGVRLAQRVVNGGLQAYVGITVQPRSGKEVLRRLSAMAQVQQLCAVSGEFDYVA
FT                   WLRTDSPEQLDQLLDLIGSVDGVEKTTTSIILSSKIDRGQPV"
FT   gene            complement(568236..569312)
FT                   /locus_tag="PSPTO_0520"
FT                   /old_locus_tag="PSPTO0520"
FT   CDS_pept        complement(568236..569312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0520"
FT                   /old_locus_tag="PSPTO0520"
FT                   /product="membrane protein, putative"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:17430601; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54063"
FT                   /db_xref="GOA:Q88A75"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A75"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54063.1"
FT                   /translation="MTNSRSAFIPSWLRPVLRPLLDPYRRYRHARLIHAARIAVGLLVT
FT                   ILLTTGLNLPHGEWASVTMLIVIGGLQHHGNIGKKSVERAYGTLIGAGLGLIVVVQQGY
FT                   LEMPLLTYAMMSVLCGFFAYHAIGKGGYTALLSAITLFIVAGHGYNPISDGLWRTVDIL
FT                   IGIALALAFSFALPLYAVFSWRYNLASGLRDCAKVYGRIVQGQPVTADEHLKLTARLNA
FT                   TMLQLRSLLPSVSKEVKMSMVELDAIQGHFRMCLSTLEILANIRPADLDKVAGESLKAS
FT                   LDGDYRQIRRQLIGMARALQTGATERLIRTPETTETPAVQPVIPAELMGYHLMTQQLAQ
FT                   NLDGLQARLAKTAKRWKF"
FT   gene            569661..569945
FT                   /locus_tag="PSPTO_0521"
FT                   /old_locus_tag="PSPTO0521"
FT   CDS_pept        569661..569945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0521"
FT                   /old_locus_tag="PSPTO0521"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to PFAM protein family HMM
FT                   PF02954"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54064"
FT                   /db_xref="GOA:Q88A74"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A74"
FT                   /protein_id="AAO54064.1"
FT                   /translation="MRIALLVKQARLQQGVRQIDLAERLGITLRTFRRIEAGSADGVSL
FT                   RDFMLVVWGLGVSERLFQGLRDDESFSVEQLEAADRKRVRLPRNRPEDF"
FT   gene            569945..571171
FT                   /locus_tag="PSPTO_0522"
FT                   /old_locus_tag="PSPTO0522"
FT   CDS_pept        569945..571171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0522"
FT                   /old_locus_tag="PSPTO0522"
FT                   /product="conserved domain protein"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54065"
FT                   /db_xref="GOA:Q88A73"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A73"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54065.1"
FT                   /translation="MAQAYIYMECPVSGQTLTLGKLTIQSGVGTFQYSPDAVQENIWVP
FT                   DPFRYPLSARSYSVTKNGGVPGFIDDAMPDGWGERLLHRVEKGPLDSIQLLLKSPNGDR
FT                   AGNIMAGAARVPQDGLGQTPPKALHARGLDHFIDTCEAIYDSQLTAEQLEILKVRDQRS
FT                   SAGGARPKRTYLFDKKLILAKPRDKFDHYDLPSVEHACMTFAGLKGLQAANTSLYRSER
FT                   INTLLVERFDRFFEERTGRFRRLPMLSGLTLLDAEWKARSHPDWQYAALADELYRRGAP
FT                   DQDRRELYRRMAYNVLVGNADDHPRNHAVIWKDSTWRLSPMYDVLPILDQGPAQVLAMS
FT                   VGIEGPRLNRGNLLSQHSHFALNKSQAEAVLDEVASWEAELHDYYSQFLAGAELDAAVT
FT                   ATSGARLKR"
FT   gene            complement(571196..572326)
FT                   /locus_tag="PSPTO_0523"
FT                   /old_locus_tag="PSPTO0523"
FT   CDS_pept        complement(571196..572326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0523"
FT                   /old_locus_tag="PSPTO0523"
FT                   /product="Fic family protein"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:3378295; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54066"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR025230"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A72"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54066.1"
FT                   /translation="MSEHLWIWQQPDWPFFSWDEERIAPLLRACAKAQGQLLGMSGAVA
FT                   GDTGMQEVLDTLLQNIITSSAIEGEQLNVGSVRSSLARRLGIADKGKLSPRSEGLAELM
FT                   LDAIRGHAQALDLQRLYDWHRWLFTAEDNSVSGRILAGQLRGDDPMQVVSGRLDRPKVH
FT                   FEAPPRPVLSRQLDDFIDWFATSQNDQRLDPFIRAGIAHFWFLTLHPFDDGNGRLTRAL
FT                   TDLALAQGDQQAIRLFAMSASILDDRTGYYRVLEASQKSTTDITQWLEWFLRTLLSSIE
FT                   HALARIERVLAKTRFWQLHTRDGLSAEQVKVLNRLLDGGERGFEEGLSAAQYQAVAKVS
FT                   KATATRHLSALLANNCLVRLPGGGRSTRYQINWSAL"
FT   regulatory      572473..572504
FT                   /bound_moiety="HrpL"
FT                   /note="PMID:17073300"
FT                   /inference="nucleotide motif:HMM2"
FT                   /experiment="microarray and/or RT-PCR"
FT                   /regulatory_class="promoter"
FT   gene            572573..573871
FT                   /locus_tag="PSPTO_0524"
FT                   /old_locus_tag="PSPTO0524"
FT   CDS_pept        572573..573871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0524"
FT                   /old_locus_tag="PSPTO0524"
FT                   /product="peptidase, M20/M25/M40 family"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to PFAM protein family HMM PF01546"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54067"
FT                   /db_xref="GOA:Q88A71"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017150"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A71"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54067.1"
FT                   /translation="MKKCIALLLTLVVCEGALAGTARDEQNITSYIDSHGTEQIALLEK
FT                   LVNINSGTDNVEGVVKVGNLIKPELEALGFETAWHDLPSAMNHAGSLVAVHDGSKSAKR
FT                   ILLIGHLDTVFPQTSRFQTFAYLDGGKKAKGPGVIDDKGGVVTMLYALQALKHSGALEK
FT                   MNISVVLIGDEELAAKPTEISREWLIAEAKRSDIALGFEFALSPNQLITERRGLSEWFL
FT                   TSTGIDKHSATIFQPETGFGAMYESARVLDEIRQKLSNEQGLTINPGLILGGSTAVEDS
FT                   ASGQGTASGRKTTVARITSVHGDLRFSSEDQRASAETRMKDIASHPLPQTNSDLKIKAI
FT                   MPVMADRESNRQLLAAYSQVSQDLDGPALESAPSAERGGADISYVNKYVTASLDGLGAW
FT                   GAGAHSENETIELGSLPVVTKRAAIFLSRYGNQ"
FT   gene            complement(574042..574635)
FT                   /locus_tag="PSPTO_0525"
FT                   /old_locus_tag="PSPTO0525"
FT   CDS_pept        complement(574042..574635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0525"
FT                   /old_locus_tag="PSPTO0525"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54068"
FT                   /db_xref="GOA:Q88A70"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A70"
FT                   /protein_id="AAO54068.1"
FT                   /translation="MRTLYISIIVASAVLASGCTINQTVTPVQLSQDLAPEICMIPAKG
FT                   LREGFNTTYVRLLTEKGFHTRQIPPGSSPSSCPLTTTYIGTWSWDVAIYMSYADIRVYQ
FT                   FGQQVGQAEYDSRWGGGRVIDKFINAEKKITEMTNQLFPKGAAGLKGAQGSNSVAGTSP
FT                   LTKEAYQQQQLDLLKHQSLPYAEYQKRYKQIMAE"
FT   gene            complement(574681..574893)
FT                   /locus_tag="PSPTO_0526"
FT                   /old_locus_tag="PSPTO0526"
FT   CDS_pept        complement(574681..574893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0526"
FT                   /old_locus_tag="PSPTO0526"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54069"
FT                   /db_xref="GOA:Q88A69"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A69"
FT                   /protein_id="AAO54069.1"
FT                   /translation="MHHKDLGDNTSELTYTFNLRLRPRWLGWMFDSLINRLFEIETRRR
FT                   FAAMAKYLAGEHGQMPSNQDGTMNQ"
FT   gene            complement(575375..577327)
FT                   /locus_tag="PSPTO_0527"
FT                   /old_locus_tag="PSPTO0527"
FT   CDS_pept        complement(575375..577327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0527"
FT                   /old_locus_tag="PSPTO0527"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54070"
FT                   /db_xref="GOA:Q88A68"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A68"
FT                   /protein_id="AAO54070.1"
FT                   /translation="MKFDQCLFGYDDGHRLLASSLPLGTETSFLTELSDLAPGTIFNQS
FT                   EGYWTGLPVPGISRYVLMRTWPAPEMSRPGCVWTHALLLEPALFESIEDLSVLQAFAIR
FT                   PKGLVDKERYREPLTHDVSQLVQSPKSVDIAILKRLLLSLYTGGSPSIEVESPGQLDAP
FT                   LFAVWSQQWPRLRRNLRFQTAASRAPRSTGSMRFDITVELALTITTPSRDGVKDLPWLE
FT                   SAALDVQEGTAGTLRPFLWRYGRDVRRQRGSFLPLAEIKAIDTEGTHDSGERLIEIVTT
FT                   SFSTLDDAQHLKQDLVDGNLAPVAQPQLLQLVLSGAGRAVFPMPTCSGISKLIDLWPER
FT                   RKEMLSLIEITVDAVDPIGQSVFDLLTRGTQESLTWLLTQASSQTRKRIMRENPGLLLA
FT                   DWFLDLESPAVIELLPLIPEKLPGVDALLAKLLMRNDRTLAEVAFEHFPILMAGQIVLA
FT                   AGGASTHVADVWWQKLRQNPAVLLQPEVLRFVSRMSQLYAMAEILGWLTPSVVAAGPAL
FT                   WAPILSKASNDLPTEQADTLYSFLVGIAISSGDSSGILLVEKLFDVIHEQLLASRLSDS
FT                   ARDLLEDLLPDVGWIRRWDVALRFRVAIANAYVRFRWPPQSYAKLGNTRRIRRMLVDAA
FT                   SDVPGGKHYAEAADD"
FT   gene            complement(577324..578211)
FT                   /locus_tag="PSPTO_0528"
FT                   /old_locus_tag="PSPTO0528"
FT   CDS_pept        complement(577324..578211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0528"
FT                   /old_locus_tag="PSPTO0528"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54071"
FT                   /db_xref="GOA:Q88A67"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A67"
FT                   /protein_id="AAO54071.1"
FT                   /translation="MNASFVIMGLPASGKTTFLAALWHLVESGETECRLVMDHFRGDFT
FT                   YLNNIADAWRNFKKVPRTSQTGDTDVTIYLHDRVTGARGTALFPDLAGEIFDLQVEERR
FT                   CRREFVEQADAEDGILFFINADVKEDGLSIIDLNARLPKDAAGNISGLELPQELGEVGT
FT                   PVKVPEWEPKFLPAQVRVVQLLSDLLRPPFTHRSRKLAFMISAWDLVRDQGHSPEQWLA
FT                   KNMPLVDQFLRTNGMSFTYQVYGISAQGVRLDDDVAVDDATKIVPSRRVQIVRHDGEGH
FT                   DLTAPLVWLMSAEE"
FT   gene            complement(578208..579008)
FT                   /locus_tag="PSPTO_0529"
FT                   /old_locus_tag="PSPTO0529"
FT   CDS_pept        complement(578208..579008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0529"
FT                   /old_locus_tag="PSPTO0529"
FT                   /product="protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54072"
FT                   /db_xref="GOA:Q88A66"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A66"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54072.1"
FT                   /translation="MLLRWRKASIVTIVGERNGGKTTLVAQLYEQFLRGPFAETLFSHS
FT                   LSLQGFERKSFQSRAEYGADNPDTPRTSAQDGLTFFHIAVSDETSLERTDLLISERAGE
FT                   SYRDVRDRPELAANLIEIRKASTIVLILDGERVAQPRMRAGVFASVRTITRALVESGGI
FT                   DPQTQIQLVTTKFDLLKGDAAADALEALATFEANLTALLEGRFLLTTFRTAARDPDGNV
FT                   APASGMDRLLRSWILPPHKSYLDDPKLPALVSEFDRLLLRGSHS"
FT   gene            complement(579598..580119)
FT                   /locus_tag="PSPTO_0530"
FT                   /old_locus_tag="PSPTO0530"
FT   CDS_pept        complement(579598..580119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0530"
FT                   /old_locus_tag="PSPTO0530"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:16610020, and GP:9112285; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54073"
FT                   /db_xref="GOA:Q88A65"
FT                   /db_xref="InterPro:IPR008687"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A65"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54073.1"
FT                   /translation="MNIHLGAELKASWTDYCLALGKSPGTAIKAAIEQQLAHAATSEPR
FT                   TYQQIAETPTSEPKQRFEILLTASEKAAIKERSRTERCSMRRWIVDAIRVGLTHEPQFG
FT                   MSEIDALGESNYQLLALGRNLNQVARRLNEGEYEPVTLERIEALSELIRKHTGVVSQAI
FT                   RASLERWDIE"
FT   gene            580669..581433
FT                   /locus_tag="PSPTO_0531"
FT                   /old_locus_tag="PSPTO0531"
FT   CDS_pept        580669..581433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0531"
FT                   /old_locus_tag="PSPTO0531"
FT                   /product="type IV secretion system protein, putative"
FT                   /note="similar to GP:5929870, and GP:8163888; identified by
FT                   sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54074"
FT                   /db_xref="InterPro:IPR014158"
FT                   /db_xref="InterPro:IPR023220"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A64"
FT                   /protein_id="AAO54074.1"
FT                   /translation="MDLFKCLARMGKQPLRITAAFSSLMCAQQGFAQIPVTVTSQVTES
FT                   PMTIAEFASNSTRWGQQVQQMASQIDQMKQQYGAITGSRGLGRVFDDPQLREYLPQEWQ
FT                   AVYDSVKSGGYSGLDGRAEMIYADNKVFDACQSFAQDEQRAACQAQAVKPSQDKAFALD
FT                   AYDQAKGRLRQLDQLMGQIDKTQDPKGIAELQGRIAAEQAMIQNEQTKLQMFQMVAQAE
FT                   DKVQEQRQRELNAQILDKRGFKTRTMLNLGGN"
FT   gene            581917..582171
FT                   /locus_tag="PSPTO_0532"
FT                   /old_locus_tag="PSPTO0532"
FT   CDS_pept        581917..582171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0532"
FT                   /old_locus_tag="PSPTO0532"
FT                   /product="lipoprotein, putative"
FT                   /note="similar to GP:21112693; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54075"
FT                   /db_xref="GOA:Q88A63"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A63"
FT                   /protein_id="AAO54075.1"
FT                   /translation="MITSRWLVLFSLLLTGCGADEPVRSVDWYKAHNAERATQISECER
FT                   DPGRLALTPNCVNAKQAENELRLAERGFRKRETLDLKEP"
FT   gene            582174..583040
FT                   /locus_tag="PSPTO_0533"
FT                   /old_locus_tag="PSPTO0533"
FT                   /note="This region contains a match to at least one other
FT                   gene that is not full length,and is not the result of a
FT                   sequencing artifact; type IV secretion system protein,
FT                   truncation; similar to GP:8163889; identified by sequence
FT                   similarity; putative"
FT   gene            583081..584058
FT                   /locus_tag="PSPTO_0534"
FT                   /old_locus_tag="PSPTO0534"
FT   CDS_pept        583081..584058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0534"
FT                   /old_locus_tag="PSPTO0534"
FT                   /product="ISPssy, transposase"
FT                   /note="similar to GP:13094159, and GP:4514540; identified
FT                   by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54076"
FT                   /db_xref="GOA:Q877U1"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:Q877U1"
FT                   /protein_id="AAO54076.1"
FT                   /translation="MKQMTFADAEYAGKRKHTRRERFLIEMDQVVPWKGLIALIEPHYP
FT                   KGEGGRPAYPLMAMLRIHLMQNWFGYSDPAMEEALYETTILRQFAGLSLDRIADETTIL
FT                   NFRRLLEKHELAGGILQVINGYLGDRGLMLRQGTVVDATIIHAPSSTKNKDGKRDPEMH
FT                   QTKKGNQYFFGMKAHIGVDAESGLVHSLVGTAANVADVTQVDQLLHGEETYVSGDAGYT
FT                   GVDKRAEHQDRQMIWSIAARPSRYKKHGEKSLIARVYRKIEFTKAQLRAKVEHPFRVIK
FT                   RQFGYTKVRFRGLAKNTAQQATLFALSNLWMVRKRLLAMGEVRL"
FT   gene            complement(584780..586021)
FT                   /locus_tag="PSPTO_0535"
FT                   /old_locus_tag="PSPTO0535"
FT   CDS_pept        complement(584780..586021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0535"
FT                   /old_locus_tag="PSPTO0535"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /note="similar to SP:P16470, GB:U02082, and PID:484102;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54077"
FT                   /db_xref="GOA:Q88A62"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A62"
FT                   /protein_id="AAO54077.1"
FT                   /translation="MWAHHTQSRALRGFRVSGWLCTNTVLWSKGTKSVQCWCASTPLES
FT                   FQMATLVKTPSGTWKALIRKTGWPTVAKTFRTKRDAEDWSRRTEDEMVRGVYIQRSGSE
FT                   RMTLEAALKRYLSDITPTKKPTTQRGETSKAKKLIEHLGKYSLAALSADIIAGYRDKRL
FT                   NEPSRGGTISNNTVRLELALLSHLYTVAIQEWGLGLTFNPVLNIRKPSPGDGRDRRLSP
FT                   EEERLLLAAVNRHSNPMLGWIVCIALETGMRSSEISSLRRPQVDLAKRVIRLSDTKNDG
FT                   SRTVPLSKRATEVFKAAMDNPVRPIDCNLVFFGEPGKDGKRRPYTFTKIWGQLKKKLDL
FT                   PDFRFHDLRHEAVSRLVEGGLSDQEVSAISGHKSMQMLKRYTHLRAEDLVARLDRIGSA
FT                   PQTQGRNRSKSEKK"
FT   gene            complement(586008..586084)
FT                   /gene="tRNA-Met-1"
FT                   /locus_tag="PSPTO_t02"
FT                   /old_locus_tag="PSPTOt02"
FT   tRNA            complement(586008..586084)
FT                   /gene="tRNA-Met-1"
FT                   /locus_tag="PSPTO_t02"
FT                   /old_locus_tag="PSPTOt02"
FT                   /product="tRNA-Met"
FT                   /note="codon recognized: AUG"
FT   gene            complement(586100..588589)
FT                   /locus_tag="PSPTO_0536"
FT                   /old_locus_tag="PSPTO0536"
FT   CDS_pept        complement(586100..588589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0536"
FT                   /old_locus_tag="PSPTO0536"
FT                   /product="sensory box/GGDEF domain/EAL domain protein"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54078"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR012226"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A61"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54078.1"
FT                   /translation="MAGLMIDISDREALRLSEGRFASVFAQCPDAMIIASLIDGHIMDA
FT                   NQAFVEHTGLSIEEVIGKTPTELDLWAVPGIGPKVLQQLQTGNIHNLEIPFRRKNGRTF
FT                   SGLMSAQPFDQGSTPAVLVVVRDITALKQAQQQLQLSEEKFAKAFHAAPDGLAITRQQD
FT                   GMLLEVNEGFCRITGYSERHCLEHSTFDLGIWADLSERSRLIEQLKQHGVVHGFRARLR
FT                   NVNGSIRVCELSSHPLLISGDACLLTISRDITESQLMQEKLHLAATVFESTAEGVLITD
FT                   TDQRISAVNRAFTEITGYSESEAIGQTPRLLASGQHDSAFYASMWHQLTAEGHWQGEIS
FT                   NRRKNGELYPSWLTVSAVRNKENLLTHFVAVFADISSLKHAQARLDYQAHHDPLTGLPN
FT                   RTLFESRLQSALLHSEESGSLGAVLFLDLDRFKHINDSLGHPVGDLLLKGIAHRLKETL
FT                   RDIDTVARLGGDEFIVLLPGLLQPSDAKAIANKLLACFSTPFEAGEHELYISPSIGSCV
FT                   FPTDGTDVATLVKNADAAMYRSKAQGRNRVESYTRDLTEQASERIALEQELRRALDRNQ
FT                   LSLAYQPKISLLTQTLVGAEALIRWSHPTFGEVPPEHFIPLAEENGMILQIGDWVLEQA
FT                   CRQMGAWRKTCTPFGPMSVNLAGAQLRQPNLVERIEQLLTDNGLVPDCLQLEITENFIM
FT                   SQTQDALAVLHKLKQLGVQLAIDDFGTGYSSLSYLKRLPLDILKIDQSFIRGLPEDTHD
FT                   AAIVRAIIALGRSMQLTVIAEGVETHEQQQFLSEEGCEQIQGYIISLPLQPDEFSERFL
FT                   LTNLSDVSDSTAAKPPL"
FT   gene            complement(588846..590696)
FT                   /gene="rpoD"
FT                   /locus_tag="PSPTO_0537"
FT                   /old_locus_tag="PSPTO0537"
FT   CDS_pept        complement(588846..590696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoD"
FT                   /locus_tag="PSPTO_0537"
FT                   /old_locus_tag="PSPTO0537"
FT                   /product="RNA polymerase sigma-70 factor"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54079"
FT                   /db_xref="GOA:Q88A60"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A60"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54079.1"
FT                   /translation="MSGKAQQQSRIKELITLGREQKYLTYAEVNDHLPEDISDPEQVED
FT                   IIRMINDMGIPVHESAPDADALMLADADTDEAAAEEAAAALAAVETDIGRTTDPVRMYM
FT                   REMGTVELLTREGEIEIAKRIEEGIREVMGAIAHFPGTVDHILSEYTRVTSEGGRLSDV
FT                   LSGYIDPDDGIAPPAEVPPPVDPKAVKAEGADDDEEESADSSDEEDEVESGPDPVIAQQ
FT                   RFGAVSDQMEITRKALKKFGRDDKHAIAELVALAELFMPIKLVPKQFEGLVERVRGALE
FT                   RLRAQERAIMQLCVRDARMPRADFLRQFPGHEVDESWTDGLAKGKGKYAEAIGRLQPDI
FT                   QRCQQKLSALEEETGLKIAEIKDINRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTN
FT                   RGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVH
FT                   MIETINKLNRISRQMLQEMGREPTPEELGERMEMPEDKIRKVLKIAKEPISMETPIGDD
FT                   EDSHLGDFIEDSTMQSPIDVATVESLKEATREVLSGLTAREAKVLRMRFGIDMNTDHTL
FT                   EEVGKQFDVTRERIRQIEAKALRKLRHPTRSEHLRSFLDE"
FT   gene            complement(590764..592722)
FT                   /gene="dnaG"
FT                   /locus_tag="PSPTO_0538"
FT                   /old_locus_tag="PSPTO0538"
FT   CDS_pept        complement(590764..592722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaG"
FT                   /locus_tag="PSPTO_0538"
FT                   /old_locus_tag="PSPTO0538"
FT                   /product="DNA primase"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54080"
FT                   /db_xref="GOA:Q88A59"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013173"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A59"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54080.1"
FT                   /translation="MAGLIPQSFIDDLLNRTDIVDVVSSRVQLKKAGKNYSACCPFHKE
FT                   KTPSFSVSPDKQFYYCFGCGAGGNALGFIMDHDNLDFPQAVEDLAKAAGMEVPREQGVK
FT                   GQKPRQPTDSPLYPLLNAASEFYRQALKSHPSRKAAVDYLKGRGLSGEIARDFGLGFAP
FT                   PGWDNLYKHLSSDSLQQKVMIDAGLLIENAETGKRYDRFRDRVMFPIRDSRGRIIAFGG
FT                   RVLGDDKPKYLNSPETPVFHKGQELYGLFEARKFNRNLDEIIVVEGYMDVIALAQQGLR
FT                   NAVATLGTATSEEHLKRLFRVVPNVLFCFDGDQAGRNAAWRALEAALPNLQDGRRARFL
FT                   FLPEGEDPDTLVRSEGTDAFKARINQHAQPLADYFFEQLTKESDPRSLEGKAHMATLAA
FT                   PLIDKVPGANLRILMRQRLSEITGLTGEAVSQLVQSAPADAPPSYDPYVDYDAMPDFAD
FT                   YQPQGGYEAQQEWTPKKAGGPNQKKWDNNKSWGKKGKRQEFEPRTPRVPTAVEPPMQAA
FT                   LRTLLHHPELAEKVENASHFAAEDQSNAQLLVALIEARQKNPSLRSLQLIARWHGTEQG
FT                   RLLRALAEKEWLIETDNLEQQFFDTITSLSARQRERSLDHLISKARQTELSAEEKIQLR
FT                   ELLNRNVPAQNPTSTGA"
FT   gene            complement(593192..593407)
FT                   /gene="rpsU"
FT                   /locus_tag="PSPTO_0539"
FT                   /old_locus_tag="PSPTO0539"
FT   CDS_pept        complement(593192..593407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="PSPTO_0539"
FT                   /old_locus_tag="PSPTO0539"
FT                   /product="ribosomal protein S21"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54081"
FT                   /db_xref="GOA:Q88A58"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88A58"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54081.1"
FT                   /translation="MPAVKVKENEPFDVALRRFKRSCEKAGVLAEVRSREFYEKPTSER
FT                   KRKAAAAVKRHAKKVQREQRRAVRLY"
FT   gene            593605..594630
FT                   /gene="gcp"
FT                   /locus_tag="PSPTO_0540"
FT                   /old_locus_tag="PSPTO0540"
FT   CDS_pept        593605..594630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /locus_tag="PSPTO_0540"
FT                   /old_locus_tag="PSPTO0540"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54082"
FT                   /db_xref="GOA:Q88A57"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88A57"
FT                   /protein_id="AAO54082.1"
FT                   /translation="MLVLGLETSCDETGVALYDSERGLLADALFSQIDLHRAYGGVVPE
FT                   LASRDHVKRMLPLIRQTLAEADCVATDIDAIAYTAGPGLVGALLVGASCAQALAFAWDI
FT                   PALGVHHMEGHLLAPMLEENPPQFPFVALLVSGGHTQLVRVDGIGQYELLGETLDDAAG
FT                   EAFDKTAKMMGMQYPGGPEISKAALQGVPGRFVFPRPMTDRPGLAFSFSGLKTSALNTW
FT                   QQCQSAGDDSEQTRCDIALAFQQAVVETLTIKCKRALKQTGLKSLVIAGGVSANKALRV
FT                   SLESMLGELRGHVYYARPEFCTDNGAMIAFAGCQRLQAGQKEDLSISVQARWPMEQLSG
FT                   L"
FT   gene            complement(594683..595261)
FT                   /locus_tag="PSPTO_0541"
FT                   /old_locus_tag="PSPTO0541"
FT   CDS_pept        complement(594683..595261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0541"
FT                   /old_locus_tag="PSPTO0541"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54083"
FT                   /db_xref="GOA:Q88A56"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88A56"
FT                   /protein_id="AAO54083.1"
FT                   /translation="MVSMFWLLATFAYLLGSLSFAILLSRLSGSPDPRASGSGNAGATN
FT                   MLRLAGKKLAVLTLLGDLCKGLIPVVLAGAWGLDPSQQGWIGVCAVLGHLFPLYFRFRG
FT                   GKGVATAAGVLLGLYPPAAALAIAAWLLTLYLTRTSSLAALIATPLTLPLLAWQEPHAL
FT                   LPMSVLTLLIVWRHRGNLRDLLAGRERHF"
FT   gene            595327..595680
FT                   /gene="folB-1"
FT                   /locus_tag="PSPTO_0542"
FT                   /old_locus_tag="PSPTO0542"
FT   CDS_pept        595327..595680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB-1"
FT                   /locus_tag="PSPTO_0542"
FT                   /old_locus_tag="PSPTO0542"
FT                   /product="dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54084"
FT                   /db_xref="GOA:Q88A55"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A55"
FT                   /protein_id="AAO54084.1"
FT                   /translation="MDRVFIEGLEVDTVIGAYDWERGIRQCLRLDLSFAWDNRPAAAGD
FT                   DLSKALDYASVSTRIQAFAEQAQFQLVETFAERLAEVLMSEFNVPWLHLKLTKPGAVAA
FT                   AAGVGVEIERGCR"
FT   gene            595671..596195
FT                   /gene="folK-1"
FT                   /locus_tag="PSPTO_0543"
FT                   /old_locus_tag="PSPTO0543"
FT   CDS_pept        595671..596195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK-1"
FT                   /locus_tag="PSPTO_0543"
FT                   /old_locus_tag="PSPTO0543"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54085"
FT                   /db_xref="GOA:Q88A54"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A54"
FT                   /protein_id="AAO54085.1"
FT                   /translation="MSLTRIFLGLGSNIERERHLHAGLDALDGFLSDISCSPVFESHAV
FT                   GIKSGPFFNLVVSALTDLPLTELDRRLKFIEADNGRYAPDRVGLPLDIDVLLYGEQVGN
FT                   FDGLILPRAEILKNAFVLRPLALIAPERLHPGVGLSFSKLWADAQIDQQLWPVAFEWRG
FT                   VGLTPEDLLRS"
FT   gene            complement(596465..597694)
FT                   /gene="cca"
FT                   /locus_tag="PSPTO_0544"
FT                   /old_locus_tag="PSPTO0544"
FT   CDS_pept        complement(596465..597694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cca"
FT                   /locus_tag="PSPTO_0544"
FT                   /old_locus_tag="PSPTO0544"
FT                   /product="tRNA nucleotidyltransferase"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54086"
FT                   /db_xref="GOA:Q88A53"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR012006"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88A53"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54086.1"
FT                   /translation="MQIYKVGGAVRDRLLGQPVTDIDWVVVGASTEDMLVKGYRPVGTD
FT                   FPVFLHPLTNEEYALARTERKSGVGYGGFVFHASPDVTLEQDLIRRDLTINAMAEDKDG
FT                   NLTDPYNGQQDLEARVLRHVSPAFAEDPLRVLRVARFAARYAGHGFTVAPETLELMRQL
FT                   SESGELKALTAERSWKEISRALMEDQPQVFIQVLHDCGALSELMPEVEALFGVPQPAAH
FT                   HPEIDTGVHVLSVLEQSAIHKHPLTVRWACLLHDLGKGLTPESEWPRHIAHEHTGLRLI
FT                   KAVNERFRVPRDCQELALLVGQYHTHGHRALELKPSTLLELLHSFDVYRRPQRFEEFIA
FT                   ACEMDARGRHGFEQRSYPQADYLRGAAHAARTVSVQPLLEKGLKGKELGDALKNERLKA
FT                   LKTYKAGHVA"
FT   gene            complement(597792..599354)
FT                   /locus_tag="PSPTO_0545"
FT                   /old_locus_tag="PSPTO0545"
FT   CDS_pept        complement(597792..599354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0545"
FT                   /old_locus_tag="PSPTO0545"
FT                   /product="SpoVR like family protein"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to PFAM protein family HMM PF04293"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54087"
FT                   /db_xref="GOA:Q88A52"
FT                   /db_xref="InterPro:IPR007390"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A52"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54087.1"
FT                   /translation="MTAREQKRQPLSTGSEWTFELIRAYDREIGRIAERYALDTYPNQI
FT                   EVITAEQMMDAYASVGMPLGYHHWSYGKHFLSTEKSYSRGQMGLAYEIVINSDPCIAYL
FT                   MEENTICMQALVVAHACYGHNSFFKGNYLFRTWTDASSIIDYLVFAKQYIMQCEERHGI
FT                   DAVEDLLDSCHALMNYGVDRYKRPYPISAEEERRRQKDREEHLQRQINDLWRTIPKNAD
FT                   KSSKEDNARFPAEPQENILYFIEKHAPLLEPWQREVVRIVRKIAQYFYPQRQTQVMNEG
FT                   WATFWHYTLMNDLYDEGLVTDGFMMEFLQSHTSVIYQPGFDSPYYSGINPYTLGFAMYQ
FT                   DIRRMCEHPTDEDRQWFPEIAGTDWLTAIKFAMSSFKDESFILQYLSPKVIRDLKLFSI
FT                   MDDDQKEDLLVPAIHDENGYRTIREILAAQYNLGNREPNVQIYSIDRRGDRSLTLRHQQ
FT                   HNRKPLGDSTDEVLKHLHRLWGFDIHLETLQGDQLIKTHHVPPKGEHADGEYPRLDMAV
FT                   VHL"
FT   gene            complement(599351..600622)
FT                   /locus_tag="PSPTO_0546"
FT                   /old_locus_tag="PSPTO0546"
FT   CDS_pept        complement(599351..600622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0546"
FT                   /old_locus_tag="PSPTO0546"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   match to PFAM protein family HMM PF04285"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54088"
FT                   /db_xref="GOA:Q88A51"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88A51"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54088.1"
FT                   /translation="MSYVIDRRLNGKNKSTVNRQRFLRRYRDHIKKAVEEAVSRRSITD
FT                   MEHGEQISIPGRDIDEPVLHHGRGGKQTVVHPGNKEFTTGEHIARPQGGAGGKGPGKAG
FT                   NSGEGMDEFSFQITQEEFLEFMFEDLELPNLVKRNLTGTDTFKTVRAGISNEGNPSRIN
FT                   IIRTLRSAHARRIALSGSSRAKLREATSELERIKREEPDNFGDIQALEVEIDRLKARIR
FT                   RVPYLDTFDLKYNLLVKQPNPSSKAVMFCLMDVSGSMTQATKDIAKRFFILLYLFLKRN
FT                   YDKIDVVFIRHHTSAREVDEEEFFYSRETGGTIVSSALKLMQEIMAARYPSSDWNIYAA
FT                   QASDGDNWNDDSPICREILTKQIMPFVQYYTYVEITPREHQALWYEYERIGDDFADTFA
FT                   QQQLVSAGDIYPVFRELFQRRLVS"
FT   gene            complement(600744..602666)
FT                   /locus_tag="PSPTO_0547"
FT                   /old_locus_tag="PSPTO0547"
FT   CDS_pept        complement(600744..602666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0547"
FT                   /old_locus_tag="PSPTO0547"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P77391; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54089"
FT                   /db_xref="GOA:Q88A50"
FT                   /db_xref="InterPro:IPR010650"
FT                   /db_xref="InterPro:IPR013153"
FT                   /db_xref="InterPro:IPR016230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A50"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54089.1"
FT                   /translation="MSIFSHFKDRFESTRQEELSLQEYLELCKQDRSAYASAAERLLLA
FT                   IGEPELVDTSANSRLSRIFSNKVIRRYPAFADFHGMEECIDQIVSYFRHAAQGLEEKKQ
FT                   ILYLLGPVGGGKSSLAEKLKQLIEKVPFYAIKGSPVFESPLGLFNASEDGAILEEDFGI
FT                   PRRYLSTIMSPWATKRLAEFGGDISQFKVVKLYPSVLNQIAVAKTEPGDENNQDISALV
FT                   GKVDIRKLEEFPQNDADAYSYSGALCRANQGLMEFVEMFKAPIKVLHPLLTATQEGNYN
FT                   STEGLGAIPFTGILLAHSNESEWHSFRNNKKNEAFIDRIYIVKVPYCLRVSDEIKIYDK
FT                   LLFNSSLAKAHCAPDTLKMLAQFTTLSRLKEPDNSNIYSKMRVYDGENLKDTDPKAKSI
FT                   QEYRDSAGVDEGMNGLSTRFAFKILSKVFNFDPHEIAANPVHLLYVLEQQIEQEQFPAE
FT                   TRERYLRFIKEYLAPRYIEFIGKEIQTAYLESYSEYGQNIFDRYVLYADFWIQDQEYRD
FT                   PETGEILNRVALNEELEKIEKPAGISNPKDFRNEIVNFVLRARANNNGKNPIWLSYEKL
FT                   RVVIEKKMFSNTEDLLPVISFNAKASKEDQQKHNDFVTRMVERGYTDKQVRLLSEWYLR
FT                   VRKSQ"
FT   gene            complement(602952..603272)
FT                   /locus_tag="PSPTO_0548"
FT                   /old_locus_tag="PSPTO0548"
FT   CDS_pept        complement(602952..603272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0548"
FT                   /old_locus_tag="PSPTO0548"
FT                   /product="rhodanese-like domain protein"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54090"
FT                   /db_xref="GOA:Q88A49"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88A49"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54090.1"
FT                   /translation="MTEFKRIPPEQAQALRAQGAVLVDVRDAQAFQSNHIPDSQHLDNH
FT                   SIADFIANADLDKPLVVVCYHGNSSQSAAAYLVGQGFSDVYSVDGGFERWRSTFPEETA
FT                   QG"
FT   gene            complement(603269..604171)
FT                   /gene="apaH"
FT                   /locus_tag="PSPTO_0549"
FT                   /old_locus_tag="PSPTO0549"
FT   CDS_pept        complement(603269..604171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaH"
FT                   /locus_tag="PSPTO_0549"
FT                   /old_locus_tag="PSPTO0549"
FT                   /product="bis(5'-nucleosyl)-tetraphosphatase, symmetrical"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54091"
FT                   /db_xref="GOA:Q88A48"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88A48"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54091.1"
FT                   /translation="MAVYAVGDLQGCLEPLQCLLEHVRFDPVQDRLWLVGDLVNRGPQS
FT                   LQTLRYLYSIRESLVCVLGNHDLHLLAVARKNELLKKGDTLREILEAPDRDELLRWVRQ
FT                   QKLMHYDAERNIAMVHAGIAPQWSVKKALKQAAEVEHALQDDQLYGAFLDGMYGNEPAK
FT                   WNNDLQGVTRLRVITNYFTRMRFCTSDGKLDLKSKEGVGTAIPGYAPWFSHQNRKTRDV
FT                   KIIFGHWAALEGRCDEPGVFALDSGCVWGGAMTLLNVDTLERHQCNCDAVGNAATGIIA
FT                   SAQPGNAHIQQIPAQEPKQ"
FT   gene            complement(604171..604551)
FT                   /gene="apaG"
FT                   /locus_tag="PSPTO_0550"
FT                   /old_locus_tag="PSPTO0550"
FT   CDS_pept        complement(604171..604551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaG"
FT                   /locus_tag="PSPTO_0550"
FT                   /old_locus_tag="PSPTO0550"
FT                   /product="apaG protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54092"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88A47"
FT                   /protein_id="AAO54092.1"
FT                   /translation="MSDSRYKVDVSVVTRFLAEQSQPEQNRFAFAYTITVHNNGELPAK
FT                   LLSRHWIITDGDGHVEEVRGEGVVGQQPLIKVGQSHTYSSGTVMTTQVGNMQGSYQMLA
FT                   EDGKRFDAVIEPFRLAVPGSLH"
FT   gene            complement(604665..605471)
FT                   /gene="ksgA"
FT                   /locus_tag="PSPTO_0551"
FT                   /old_locus_tag="PSPTO0551"
FT   CDS_pept        complement(604665..605471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="PSPTO_0551"
FT                   /old_locus_tag="PSPTO0551"
FT                   /product="dimethyladenosine transferase"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54093"
FT                   /db_xref="GOA:Q88A46"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88A46"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54093.1"
FT                   /translation="MTEQFQHRARKRFGQNFLHDAGVIDKILRAIRAKPEDRLLEIGPG
FT                   QGALTEGLLNSGAQLDVVELDKDLIPILNSQFASQPNFNLHQGDALKFDFNTLGAEPRS
FT                   LRVVGNLPYNISTPLIFHLLQNASLIRDMHFMLQKEVVERMAAGPGGGDWGRLSIMVQY
FT                   HCRVEHLFNVGPGAFNPPPKVDSAIVRLVPYETLPHPAKDHRVLERVVREAFNQRRKTL
FT                   RNTLKLLLSSDEITASGVDGSLRPEQLDLAAFVRLADTLSEKVLTE"
FT   gene            complement(605468..606457)
FT                   /gene="pdxA"
FT                   /locus_tag="PSPTO_0552"
FT                   /old_locus_tag="PSPTO0552"
FT   CDS_pept        complement(605468..606457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="PSPTO_0552"
FT                   /old_locus_tag="PSPTO0552"
FT                   /product="pyridoxal phosphate biosynthetic protein PdxA"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54094"
FT                   /db_xref="GOA:Q88A45"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88A45"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54094.1"
FT                   /translation="MKPKRFALTPGEPAGIGPDLCLLLATQPQPYPLIAITSRDLLTQR
FT                   AAQLGVAVSLLDVTPETLPDQPAPAGSLYVWHTPLAAPVETGVLNKANAAFVLQTLTRA
FT                   GQGCLDGLFSGMITAPVHKGVINDGGIAFSGHTEFLAELTHTEQVVMMLATGDLRVALV
FT                   TTHLPLREVADAITADRLERVTRILHADLVNKFGIAHPRILVCGLNPHAGESGHLGREE
FT                   IDIIEPTLERLRSEGLDLRGPLPADTLFTPKYLEHCDAVLAMYHDQGLPVLKYKGFGAA
FT                   VNVTLGLPIIRTSVDHGTALDLAGSANIDTGSLRVALQTAYQMAETHS"
FT   gene            complement(606454..607740)
FT                   /gene="surA"
FT                   /locus_tag="PSPTO_0553"
FT                   /old_locus_tag="PSPTO0553"
FT   CDS_pept        complement(606454..607740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surA"
FT                   /locus_tag="PSPTO_0553"
FT                   /old_locus_tag="PSPTO0553"
FT                   /product="peptidyl-prolyl cis-trans isomerase SurA"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54095"
FT                   /db_xref="GOA:Q88A44"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88A44"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54095.1"
FT                   /translation="MLGALLLSGAVHAAVQPLDSVVAIVDNDVIMKSQMDQRVREVQQT
FT                   IAKRGSGVPPAADLQPQVLDRLILENLQLQMGERSGIRVSDDELNQAIGTIAQRNNMSV
FT                   EQFRAALAHDGLSYEDAREQVRREMIISRVRQRRVAERIQVSEQEVKNFLASDQGKAQL
FT                   SEEFHLANILIATPDSASSDAIQAAAVKAKSIYDQLKKGADFAKIAATTSSSENALEGG
FT                   DMGWRKAAQLPPPFGDMLSSMPIGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHV
FT                   RHILIKPSEIRSEEATKLLAQKIYERIENGEDFATLAKSFSEDPGSALNGGDLNWVDPN
FT                   SLVPEFRDVMSSTPQGELSKPFKTAYGWHVLEVLGRRATDATGQARDQQALSVLRNRKY
FT                   DEELQTWLRQIRDEAYVEIKLPGATQAAQ"
FT   gene            complement(607757..610474)
FT                   /locus_tag="PSPTO_0554"
FT                   /old_locus_tag="PSPTO0554"
FT   CDS_pept        complement(607757..610474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0554"
FT                   /old_locus_tag="PSPTO0554"
FT                   /product="organic solvent tolerance protein, putative"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P31554; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54096"
FT                   /db_xref="GOA:Q88A43"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88A43"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54096.1"
FT                   /translation="MQPLATQFVVAAEQYDCSVSASGAWNCAPKSTAAAVELPPRPVHS
FT                   TASVSSNGTVTSESSSSGEQVAGPQLVTEAKGKGLKSRSADYSHLDWVPREKLTAAQLA
FT                   ETGPYCSGAYVEPIRPGMDDKTPMKDAPMFVGAKASRYEQEAQVATLAGDVVLRQGSMQ
FT                   VQAQEAALHQAENRGELNGDVRLRDNGALIVGDKAELQLDTGEARVDNAEYVLHKSNIR
FT                   GNALYAKRAENAIIRLKDGTYTTCEPNSNAWTLKGNNITLNPATGFGTATNVTLRVKDI
FT                   PVLYTPYIYFPIDDRRQSGFLPPTIAAGGDNGFTLVTPYYFNLAPNYDATLYPRYMADR
FT                   GLLMEGEFRYLTKGSEGQFGGAYLNDENDDRKLQSDYDKTRWMINWHHKGGLDTRWLTQ
FT                   VDYTDISDPYYFQDLETDQIGVKRTDFLNQQGSLTYRGDSYSAVFNAQAYKLATVANVT
FT                   PYNRLPQLTLNGTLPYNPEGLKFDYQTEAVRFDRDLRTGTFVDENGNFESRLDNNISGL
FT                   DRANGDRLNLAPSVSLPMNWSYGFLTPKVKYVYTQYDLSLDGTGKSQLAASGGTFDSSV
FT                   NRSVPIFSVDSGLYFDRNTNWFGKDYRQTLEPRLFYLYVPEKDQTDIPAFDTSESTFSY
FT                   SSLFRDNRFTGSDRIGDENKLSLGITNRWIEDNGFERQRFAIGQAIYFSDRKVQLPGVS
FT                   FADRDDAKANVSPYALEYEYRFNRDWRFNSDFNWDPDSKSTRSGSAMFHYQPEAEPNKI
FT                   VNFGYRYRNDQIRYDESTGRWIVGGGDYGRPGDPNYVKDYYKIQQHDFSVIWPIVPQWS
FT                   LISRWQYDYNRERTIEAFGGFEYDNCCWKMRLVNRYWIDYDEFSQAAPQNEKGDRGIFL
FT                   QIVLKGLGGVTGAKVDSFLDKGIQGYREREDQAF"
FT   gene            610670..611695
FT                   /locus_tag="PSPTO_0555"
FT                   /old_locus_tag="PSPTO0555"
FT   CDS_pept        610670..611695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0555"
FT                   /old_locus_tag="PSPTO0555"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:4545243, and GP:4545243; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54097"
FT                   /db_xref="GOA:Q88A42"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A42"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54097.1"
FT                   /translation="MSDQDIRLQSLKVWLDEQLPALFAAQNWGAVPPATLTAASSDASF
FT                   RRYFRWEGGARTFIVMDAPPPQENCKPFVDIAHLLEKSGINVPKIYAEDLTQGFLLLND
FT                   LGRQTYLDVIDADNADGLFAEAIEALLAFQQLPMDAPLPSYDEALLRRELELFPEWYVK
FT                   RHLGVEMDEAQLADWQQVSQLLINSALAQPKVLVHRDYMPRNLMISEPNPGVLDFQDAV
FT                   YGPVTYDVTCLFKDAFLSWPQERVSDWLRTYWDQARTLGIPVQEDFAAFERASDLMGVQ
FT                   RHLKVIGIFARICHRDGKPRYLADVPRFFAYIEAVLSKRPELAQLGQLLTSLQQPAETA
FT                   V"
FT   gene            611814..612446
FT                   /locus_tag="PSPTO_0556"
FT                   /old_locus_tag="PSPTO0556"
FT   CDS_pept        611814..612446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0556"
FT                   /old_locus_tag="PSPTO0556"
FT                   /product="nucleotidyltransferase family protein"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54098"
FT                   /db_xref="GOA:Q88A41"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A41"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54098.1"
FT                   /translation="MRPLTLHTPKPLVRAGGIPLIEYHLNALRAAGFHQLVINHAWLGQ
FT                   QIEDYLGDGQRFDLSIRYSAEGQPLETGGGIQRALPLLGAEPFVVVNGDVWTDYDFGAL
FT                   RMPLAGLAHLVLIDNPAHHPTGDFSLVDGQVRDDDSAGLRLTYSGIAILHPQLFADCEP
FT                   GAFKLAPLLREAMHQGLVTGEHFKGRWVDVGTHERLAEVEQLLAETR"
FT   gene            612447..613214
FT                   /locus_tag="PSPTO_0557"
FT                   /old_locus_tag="PSPTO0557"
FT   CDS_pept        612447..613214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0557"
FT                   /old_locus_tag="PSPTO0557"
FT                   /product="DnaJ-like protein DjlA, putative"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54099"
FT                   /db_xref="GOA:Q88A40"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A40"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54099.1"
FT                   /translation="MLWPGTLIGAGVGYTIASIPGAMLGALLGQALDRRLKLQSWAHLR
FT                   ERLGGRAAIPEDELLFVLLGRLAKSDGRVVASHIQQARAEMRRINLKEADQLRAINAFK
FT                   RGRDGADGLRTYLRGLQGQSDIAEDMLRACWRMAWADGKASRVKRELIGVWGMWLGWSQ
FT                   QQVEALAADHDPMKRAPLSSGDDYMGAMALLGIKPDTDPLSIKRAYRRLLSRHHPDKIA
FT                   GSGANAQQVRVATEKTSELHNAYRVVKARRGFA"
FT   gene            complement(613245..614243)
FT                   /locus_tag="PSPTO_0558"
FT                   /old_locus_tag="PSPTO0558"
FT   CDS_pept        complement(613245..614243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0558"
FT                   /old_locus_tag="PSPTO0558"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54100"
FT                   /db_xref="GOA:Q88A39"
FT                   /db_xref="InterPro:IPR022529"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A39"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54100.1"
FT                   /translation="MEYPMSYTFRATFPALFLSLMLPCALPALAADPAPAKDAAAQAPV
FT                   ERAPLLSRSQEDAIALERQLPREDQQQLQAGDESFLALWKPANTDAPQGAVIILPGDAE
FT                   SPDWPDTVGPLRRKFPDVGWSSLSITLPDAQDNTLLPREPDAAAGDANAAKPEETPKDA
FT                   AAKAPDPAAEAEALAAVATAKAAADEERNKAQAELIFARIESAISFAQQNKARNIVLLG
FT                   HSSGAYWAARFLNERPSPAVQKLVMVAAREPVDAAPSLLAMVPGLKIKTADFIYKNPED
FT                   QAAKARLQASKRAKGPGFTQIGLINIVGNEETEQEQMFRRIRGWVEAKEEK"
FT   gene            614343..616358
FT                   /locus_tag="PSPTO_0559"
FT                   /old_locus_tag="PSPTO0559"
FT   CDS_pept        614343..616358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0559"
FT                   /old_locus_tag="PSPTO0559"
FT                   /product="sensory box histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54101"
FT                   /db_xref="GOA:Q88A38"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A38"
FT                   /protein_id="AAO54101.1"
FT                   /translation="MIIRLLRTGFIGCMALLLMVHMANTQADEPQSPALAQLSPAQRGW
FT                   LDQHGPLRVGLVLRAPYAQFDQRLQQLSGANVDLMNALAATLPVELLWRNFVDQASLEK
FT                   ALSNGEIDVAPGLMQTPAGLRLWLFSDPYLRVSQLLIGERDGSTAVDLEKLDSLSRVAV
FT                   RMPSATADYLRSNFPHLNLQGVPLERQALQLLLSQQARYAVVDEAQLSRLLREPEFAGL
FT                   AVVGDTGLPQLLRVASRRDAPELAAIVSEALRAVPAKELEQLHARWMPLTPSHFSESTK
FT                   LWKNLCILLLVMLLACFAIVIWQRRQQQALEQELLAGREHLARRVASEEALRLAQFSID
FT                   QSTVGILWVNWDSRVRYANRAVESMLGYAPGQVVERPLIDFEPDLHMDRWLNLWKNARS
FT                   SEDSAQVFETHCLRADGSLLPADVSLSFLRFRDAEYLVVFLSDVSERRRAHDQLRELSA
FT                   HLESVREEEKARIAREVHDELGQMLTVLKLETSMCELAYADLDPGLSERLDSMKRLISQ
FT                   LFQLVRDVATALRPPILDAGIASAIEWQARRFEARTQIPCLVQVPDNLPALSDARATGM
FT                   FRILQEALTNVMRHAQAHTVEISLTLQDGMMCMTVADDGQGFVVESGRAVSFGLVGMRE
FT                   RVLMLGGRLELDSEAGEGTTLRAYIPLDPTAQERSQ"
FT   gene            616355..616984
FT                   /locus_tag="PSPTO_0560"
FT                   /old_locus_tag="PSPTO0560"
FT   CDS_pept        616355..616984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0560"
FT                   /old_locus_tag="PSPTO0560"
FT                   /product="DNA-binding response regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54102"
FT                   /db_xref="GOA:Q88A37"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A37"
FT                   /protein_id="AAO54102.1"
FT                   /translation="MIRVLVAEDHTIVREGIKQLIGLARDLQVVGEASNGEQLLETLRH
FT                   VACEVVLLDISMPGVNGLEAIPRIRALTHPPAILVLSMHNEAQMAARALKVGAAGYATK
FT                   DSDPALLLTAIRRVAAGGRYIDPDLADRMVFEVGLTDSRPLHSLLSEREFSVFERLAQG
FT                   ANVNDIAQQLALSSKTISTHKARLMQKMKLNSLADLVKYAMEHKLL"
FT   gene            617232..617405
FT                   /locus_tag="PSPTO_0561"
FT                   /old_locus_tag="PSPTO0561"
FT   CDS_pept        617232..617405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0561"
FT                   /old_locus_tag="PSPTO0561"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54103"
FT                   /db_xref="GOA:Q88A36"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A36"
FT                   /protein_id="AAO54103.1"
FT                   /translation="MRNDNLNHDHYRAALRVGMLFWTLRVLFCDAERHPLYSHQRVRND
FT                   QTSPTCSIAPSL"
FT   gene            617525..618649
FT                   /locus_tag="PSPTO_0562"
FT                   /old_locus_tag="PSPTO0562"
FT   CDS_pept        617525..618649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0562"
FT                   /old_locus_tag="PSPTO0562"
FT                   /product="polyamine ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54104"
FT                   /db_xref="GOA:Q88A35"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A35"
FT                   /protein_id="AAO54104.1"
FT                   /translation="MSDVDTSAGASDVLVSFRGVQKSYDGEALIVKDLNLDIRKGEFLT
FT                   LLGPSGSGKTTSLMMLAGFETPTAGEILLGGRAINNVPPHKRDIGMVFQNYALFPHMTV
FT                   AENLAFPLSVRGMSKTDVGEKVKKALGMVQLDTFAHRYPAQLSGGQQQRVALARALVFE
FT                   PQLVLMDEPLGALDKQLREHMQMEIKHLHQRLGVTVVYVTHDQGEALTMSDRVAVFHQG
FT                   EIQQIAPPRSLYEEPKNTFVANFIGENNRLNGRLVSQDGDRCVVELERGEKVHALAINV
FT                   GRPGGPVTLSIRPERINLNGRSESCVNRFSGRVAEFIYLGDHVRVRLEVAGKTDFFVKQ
FT                   PIAELDPTLSVGDVVPIGWQVEHVRALDPLQQEH"
FT   gene            618732..619766
FT                   /locus_tag="PSPTO_0563"
FT                   /old_locus_tag="PSPTO0563"
FT   CDS_pept        618732..619766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0563"
FT                   /old_locus_tag="PSPTO0563"
FT                   /product="polyamine ABC transporter, periplasmic
FT                   polyamine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54105"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A34"
FT                   /protein_id="AAO54105.1"
FT                   /translation="MLKSLKFTAITLGLMCAAQAMAATDLTVISFGGANKAAQEKAFYA
FT                   PWEKAGNGKIIAGEYNGEMAKVKTMVDTKSVSWDLVEVESPELARGCDEDMFEELDPKL
FT                   LGNAADFVPGAITTCGAGFFVWSTVLAYNADKVASAPSGWVDFWDTKKFPGKRGLRKGA
FT                   KYTLEFALMADGVAPKDVYKVLASKDGQDRAFKKLDELKPNIQWWEAGAQPPQYLASGD
FT                   VVMSSAYNGRIAAVQKESNLKVVWTGGVYDFDAWAIPKGSKNADAAKKFIAFMLSPEQQ
FT                   KTYSQNIAYGPANTQAVKLLDKETLQNMPTTPENIKDQVQMDVAFWTDNGESLEQRFTA
FT                   WAAK"
FT   gene            619844..621091
FT                   /locus_tag="PSPTO_0564"
FT                   /old_locus_tag="PSPTO0564"
FT   CDS_pept        619844..621091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0564"
FT                   /old_locus_tag="PSPTO0564"
FT                   /product="polyamine ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54106"
FT                   /db_xref="GOA:Q88A33"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A33"
FT                   /protein_id="AAO54106.1"
FT                   /translation="MAIAVPLTEGASPTLKQRLARAERVNRWKAQALIAPLVIFLLLVF
FT                   LVPIAALLYKSVGNPEVVTALPTTVVEVQKWDGKGLPPESVYKALSLDLAETRKNSTLG
FT                   DLSKRLNMELAGYRSLLSKTARALPFKTEPASYKEALEALDERWGDPAYWQAVRRNTSS
FT                   VTPYYLLAAVDHRVDDLGEVAPATPDQAIYLDIFARTFWMGLVITAICLVLAYPLAYLL
FT                   ANLPARQSNLLMILVLLPFWSSILVRVAAWIVLLQSSGLINSALLAMGIIDKPLELVFN
FT                   RVGVYISMVHIMLPFMILPIYSVMKNISPTYMRAAISLGCHPFASFWRVYFPQTYAGIG
FT                   AGCLLVFILSIGYYITPALLGSPNDQMVSYFVAFYTNTSINWGMATALGGLLLLATIVL
FT                   YLIYSWLVGASRLRLS"
FT   gene            621103..621924
FT                   /locus_tag="PSPTO_0565"
FT                   /old_locus_tag="PSPTO0565"
FT   CDS_pept        621103..621924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0565"
FT                   /old_locus_tag="PSPTO0565"
FT                   /product="polyamine ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54107"
FT                   /db_xref="GOA:Q88A32"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A32"
FT                   /protein_id="AAO54107.1"
FT                   /translation="MLNAYTSPIERIWYYALRILCALILLFLVLPVLVIVPLSFNSGSF
FT                   LVYPLQGFSLQWYQDFFNSAEWMRALKNSMIVAPAATLLAMGFGTLAAIGLTRGNFPGK
FT                   ALVMALVISPMVVPVVIVGVASYLFFAPLGLGNSYTSLILVHAVLGVPFVIITVSATLQ
FT                   GFNHNLVRAAASLGASPLTAFRRVTLPLIAPGVISGALFAFATSFDEVVVTLFLAGPEQ
FT                   ATLPRQMFSGIRENLSPTIAAAATLLIGFSVLLLLVLEWLRGRSEKLRTAQ"
FT   gene            622080..622754
FT                   /gene="rpe"
FT                   /locus_tag="PSPTO_0566"
FT                   /old_locus_tag="PSPTO0566"
FT   CDS_pept        622080..622754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /locus_tag="PSPTO_0566"
FT                   /old_locus_tag="PSPTO0566"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54108"
FT                   /db_xref="GOA:Q88A31"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A31"
FT                   /experiment="peptide sequencing"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54108.1"
FT                   /translation="MQPFVIAPSILSADFARLGEEVDNVLSSGADFVHFDVMDNHYVPN
FT                   LTIGPMVCSALRKYGVTAPIDVHLMVSPVDRIIGDFIEAGATYITFHPEATQHIDRSLQ
FT                   LIREGGCKAGLVFNPATPLNLLEYVMDKVDMILLMSVNPGFGGQKFIPGTLNKLREARA
FT                   LIDASGRDIRLEIDGGVNVNNIREIAAAGADTFVAGSAIFNAPDYREVIEKMRAELALS
FT                   RA"
FT   gene            622769..623569
FT                   /gene="gph-1"
FT                   /locus_tag="PSPTO_0567"
FT                   /old_locus_tag="PSPTO0567"
FT   CDS_pept        622769..623569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gph-1"
FT                   /locus_tag="PSPTO_0567"
FT                   /old_locus_tag="PSPTO0567"
FT                   /product="phosphoglycolate phosphatase"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54109"
FT                   /db_xref="GOA:Q88A30"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q88A30"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54109.1"
FT                   /translation="MFAGKLPKLIMFDLDGTLVDSVPDLAVAVDTMLAELGRPTAGLES
FT                   VRAWVGNGAPVLVRRALANNLDHSGVDEALAERGLDIFMRAYAEKHEFTVVYPGVRETL
FT                   KWLQKMGVEMALITNKPERFVAPLLDEMKLGRFFRWIIGGDTMPQKKPDPAALFFVMKM
FT                   AGVPASQSLFVGDSRSDVQAAKAAGVACVALSYGYNHGRPIAEENPAMVIDDLRRLIPG
FT                   CLDLDAEILLPDIKRPSSRESIVVVTRKLWMKVIKALARWRWRA"
FT   gene            623639..625120
FT                   /gene="trpE"
FT                   /locus_tag="PSPTO_0568"
FT                   /old_locus_tag="PSPTO0568"
FT   CDS_pept        623639..625120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpE"
FT                   /locus_tag="PSPTO_0568"
FT                   /old_locus_tag="PSPTO0568"
FT                   /product="anthranilate synthase, component I"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54110"
FT                   /db_xref="GOA:Q88A29"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A29"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54110.1"
FT                   /translation="MNREEFLRLAADGYNRIPLARETLADFDTPLSIYLKLADQPNSYL
FT                   LESVQGGEKWGRYSIIGLPCRTVMRVHGHHVSVTHDGVEIESLDVEDPLDFVETFKARY
FT                   NVPTIAGLPRFNGGLVGYFGYDCVRYVEKRLANCPNPDPLGVPDILLMVSDAVVVFDNL
FT                   AGKMHAIVLVDPAQQDAYDSGAALLDELMHKLRQPITPRRGLDLDRPPAADPVFRSSFT
FT                   QNDYETAVDTIKQYILAGDVMQVVPSQRMSIDFAAAPIDLYRALRCFNPTPYMYFFNFG
FT                   DFHVVGSSPEVLVRVEDNLITVRPIAGTRPRGATEEADRALEEDLLSDHKEIAEHLMLI
FT                   DLGRNDVGRVSGIGTVKLTEKMVIERYSNVMHIVSNVTGELKSGLTAMDALRAILPAGT
FT                   LSGAPKIRAMEIIDELEPVKRGVYGGAVGYMAWNGNMDTAIAIRTAVIKNGELHVQAGG
FT                   GIVADSVPALEWEETLNKRRAMFRAVALASQTAEG"
FT   misc_feature    625118..647483
FT                   /note="PYOCIN001; Putative bacteriocin; Pyocin F-like;
FT                   Possible F-type Pyocin. Integrated between trpE and trpG
FT                   genes like P. aeruginosa pyocin. NO capsid or head genes.
FT                   Tail genes have best hits to Lambdoid phages like Coliphage
FT                   P27. Note that HopPtoH and HopPtoC are just outside of this
FT                   region."
FT   gene            complement(625342..627264)
FT                   /locus_tag="PSPTO_0569"
FT                   /old_locus_tag="PSPTO0569"
FT   CDS_pept        complement(625342..627264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0569"
FT                   /old_locus_tag="PSPTO0569"
FT                   /product="autotransporting lipase, GDSL family"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54111"
FT                   /db_xref="GOA:Q88A28"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR008265"
FT                   /db_xref="InterPro:IPR017186"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A28"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54111.1"
FT                   /translation="MTKTSRCWPFAACLLSLACGTATAGPYSTMVVFGDSLADAGQFPD
FT                   TAGPRGSTLRFTNRVGPTYQDGSGEVFNLNSSTLIGRMLNVSAGDLAASTSPVNAALGQ
FT                   ADGNNWAVGGYRTDQILDSINSQSTVVDPNSGTLLRSRTGYLPANSFRADPNALYYLTG
FT                   GGNDFLQGRVLSASSAGQAANRLADSALALQQAGARYIMVWLLPDIGQTPALSGTPLAS
FT                   ATSALSAVFNQQLVSRLAQIDAQVIPLNVPLLISETLAAPARFGFDPNENLVATCFSGD
FT                   SCRESAANGRSSATPDPSRVFFNDRVHPTEAGQRLLADYAYSLLSAPWEISLLPEMANG
FT                   TLRMHQDELRAQWLSDWGNWQGVGQWQSIIAAGGQKMDFDAQDSSANADGRGYNLTIGG
FT                   SYRFAEHWRTGVVAGAYRQNLEAGARDSDYKLNSYIATAFVQYQANHWWGDLAVSGGKL
FT                   DYENAERKFALGVSEGQEKGDTDGELWAVSGRVGFDIAGAASRWHLSPFVSADYAHIDV
FT                   DGYSEKGNRSTALTFSDQTRKSRRAGVGLQGKFEVTPTTQLWAEVAREREFETDQQNVT
FT                   MALNSVQSVDFTLEGYTPQRDLNRATFGVSQKLTQDLTLRGNYNWRKNDDVTQQGVNVA
FT                   LSMSF"
FT   gene            complement(627371..627637)
FT                   /locus_tag="PSPTO_0570"
FT                   /old_locus_tag="PSPTO0570"
FT   CDS_pept        complement(627371..627637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0570"
FT                   /old_locus_tag="PSPTO0570"
FT                   /product="transcriptional regulator PrtN, putative"
FT                   /note="see PMID:20190049 for expression data"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54112"
FT                   /db_xref="GOA:Q88A27"
FT                   /db_xref="InterPro:IPR020518"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A27"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54112.1"
FT                   /translation="MQTTGSHGMNEILDQLRKEFATPCPSLSAVRERYFSHLSNDRNLL
FT                   RKINAGRIALKVSRTGGTRQGHPFVYLHDLANYLSDIVTNRAA"
FT   gene            complement(628136..628783)
FT                   /locus_tag="PSPTO_0571"
FT                   /old_locus_tag="PSPTO0571"
FT   CDS_pept        complement(628136..628783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0571"
FT                   /old_locus_tag="PSPTO0571"
FT                   /product="repressor protein c2"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:13517579, and SP:P03035; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54113"
FT                   /db_xref="GOA:Q88A26"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A26"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54113.1"
FT                   /translation="MNRKWYEVARQVMETQEISQEEMAERMGVTPGAVGHWLNGKREPK
FT                   IEVINRLLGELGLPILATSIPSSEPGMQNVAPTVQPSRFYRYPVISWVEAGGWSEAVEP
FT                   YPAGYSDTFEISDYKAKGRAFWLVVRGDSMTAPAGQSIPEGMLILVDTGIEPTAGKLVI
FT                   AKLPESNEATFKKLVEDAGRYFLKPLNPAYPTLPVTEDCKLIGVIRQMTMRL"
FT   gene            629847..630677
FT                   /locus_tag="PSPTO_0572"
FT                   /old_locus_tag="PSPTO0572"
FT   CDS_pept        629847..630677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0572"
FT                   /old_locus_tag="PSPTO0572"
FT                   /product="bacteriocin, putative"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   SP:P05820; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54114"
FT                   /db_xref="GOA:Q88A25"
FT                   /db_xref="InterPro:IPR028056"
FT                   /db_xref="PDB:4FZL"
FT                   /db_xref="PDB:4FZM"
FT                   /db_xref="PDB:4FZN"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A25"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54114.1"
FT                   /translation="MPIELPPTYITPYPEISAGGNGTYRGQDLSSGQSFPRGMQNPVAT
FT                   VLLLQGDLYCSPNCLATFQDQARRDSFGIQSKVALKTFAAADQREAEGRDLRTAYNEIA
FT                   TDIGRSQQINENIIKYPPGNHVLSGGLMTPFHALAHGMFGLGAPLTFPIQNVGLNVDIR
FT                   GIPDVMNVIQSARPVGTSSLDVNFAYDVGKDSNASWLTLGNITLRLVGTIDKNASGAWT
FT                   FSGEIRAFNDVYDANPSNHRGWLGENLTSLLSAVPFTSYSIEIPGSLPVTVSGN"
FT   gene            631257..631727
FT                   /locus_tag="PSPTO_0573"
FT                   /old_locus_tag="PSPTO0573"
FT   CDS_pept        631257..631727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0573"
FT                   /old_locus_tag="PSPTO0573"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54115"
FT                   /db_xref="GOA:Q88A24"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A24"
FT                   /protein_id="AAO54115.1"
FT                   /translation="MRLNTDMTRTAISGLGICRGFFVSGVPMDPTDLGPGTATWLGGTG
FT                   TILLGGFLWLRKFLSRDATDRAMDNADIGTVRRLNELLDSERQARKEAEARSDQFARER
FT                   NELAAAVGRMEGKIEALTSHIVQLTDKVTTQSAEIARLRSKLGGANDAQMRN"
FT   gene            631705..632046
FT                   /locus_tag="PSPTO_0574"
FT                   /old_locus_tag="PSPTO0574"
FT   CDS_pept        631705..632046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0574"
FT                   /old_locus_tag="PSPTO0574"
FT                   /product="lipoprotein, putative"
FT                   /note="identified by match to PFAM protein family HMM
FT                   PF02987"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54116"
FT                   /db_xref="GOA:Q88A23"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A23"
FT                   /protein_id="AAO54116.1"
FT                   /translation="MMHRCAIDFIARHWWRRLEIWLIAVLLIAGCLMLGFQAGQWSASA
FT                   EHTRQLAEVRDAYDAALGKRDRRLDRLAETTTQAADKVETAASIASQAAHAANRAADKA
FT                   DEALGKANQ"
FT   gene            632092..632682
FT                   /locus_tag="PSPTO_0575"
FT                   /old_locus_tag="PSPTO0575"
FT   CDS_pept        632092..632682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0575"
FT                   /old_locus_tag="PSPTO0575"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GP:18152374, and GP:18152374; identified
FT                   by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54117"
FT                   /db_xref="GOA:Q88A22"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A22"
FT                   /protein_id="AAO54117.1"
FT                   /translation="MKITPIVAHLQATCPTFAGRISAGIDWAAVALGDQLAHPSAYVIA
FT                   TGDVATANDLQNVIRQNITDQIDIVVVLDSDDKRGQQASDQLHAVRAELWRALVGWNAD
FT                   RDYDAMQYTGGALVQISGARVTYRFGFAAQFQLGRSTSDQPAETWHEAYLDGLPGFTGA
FT                   TLEMDCVDPADPNLKSPGPDGRLEAKFTAEVTP"
FT   gene            632679..632867
FT                   /locus_tag="PSPTO_0576"
FT                   /old_locus_tag="PSPTO0576"
FT   CDS_pept        632679..632867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0576"
FT                   /old_locus_tag="PSPTO0576"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GP:19483748, and GP:15979295; identified
FT                   by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54118"
FT                   /db_xref="GOA:Q88A21"
FT                   /db_xref="InterPro:IPR024400"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A21"
FT                   /protein_id="AAO54118.1"
FT                   /translation="MTQRITVVPAEGRTVPDPEAGDLLPVEGRQVAFNAWWQRRQNDGD
FT                   ITIQTEQTPTTYQAFTA"
FT   gene            632886..634382
FT                   /locus_tag="PSPTO_0577"
FT                   /old_locus_tag="PSPTO0577"
FT   CDS_pept        632886..634382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0577"
FT                   /old_locus_tag="PSPTO0577"
FT                   /product="tail sheath protein, putative"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GB:Z23169, and PID:313353; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54119"
FT                   /db_xref="GOA:Q88A20"
FT                   /db_xref="InterPro:IPR007067"
FT                   /db_xref="InterPro:IPR020287"
FT                   /db_xref="InterPro:IPR035089"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A20"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54119.1"
FT                   /translation="MAISFNNIPSDVRVPLFYAEMDNTAANSASASMRRLIVAQVNDDV
FT                   SGPELGSLVLVPSVALAKNIGGQGSMLAAMYEIWRKADPTGEVWCLPLLNTEGVKAGAT
FT                   ITLTGAATEAGLLNLYVGGARVQATVVNGATAAQAATALSVKINATPDLPIKAVVEAGV
FT                   LTLSCKWSGASGNDIHLEFNRLGKTNGEVIPAGLTAAVTAMTGGVGTPDQLKALAALGD
FT                   EPFEFLCMPWTDTSTLDAWKAAMDDSTGRWSWARQLYGHVYSAKRGTVGTLVAAGQLRN
FT                   DQHITIQGVETGVPQPVWLQAAALAARTAVFISADSSRPTQSGTMPGLDPAPASQRFTL
FT                   TERESLLRYGIATAYYEGGYVRIQRSITTYQKNAYGQADNSYLDSETMHQSAFIIRRLQ
FT                   GIITSKYGRHKLASDGTRFGAGQPIITPSTIRGELIAQYARLQEEGHVENAEVFAQHLI
FT                   VERDGNDPSRVNVMFPPDYINGLRVFALLNQFRLQYDEAA"
FT   gene            634443..634790
FT                   /locus_tag="PSPTO_0578"
FT                   /old_locus_tag="PSPTO0578"
FT   CDS_pept        634443..634790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0578"
FT                   /old_locus_tag="PSPTO0578"
FT                   /product="conserved protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:18152376, and GP:18152376; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54120"
FT                   /db_xref="GOA:Q88A19"
FT                   /db_xref="InterPro:IPR019596"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A19"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54120.1"
FT                   /translation="MGQKVAGTCYIKVDGTQLTIIGGGEAPLTNVKRDTVVPGYYKEVD
FT                   KAAWLKFQALHTADLPIKLLTTGVDMTITCEFSNGKIYVLSGAYLVEDPISKADDGAID
FT                   FKFEGSQGSWQ"
FT   gene            634787..635083
FT                   /locus_tag="PSPTO_0579"
FT                   /old_locus_tag="PSPTO0579"
FT   CDS_pept        634787..635083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0579"
FT                   /old_locus_tag="PSPTO0579"
FT                   /product="sigma factor domain protein"
FT                   /note="see PMID:20190049 for expression data; similar to
FT                   GP:19483751, and SP:P37929; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54121"
FT                   /db_xref="GOA:Q88A18"
FT                   /db_xref="InterPro:IPR019289"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A18"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54121.1"
FT                   /translation="MSEVIDLASPIEAHGETLSQVTFRRPTAQEARAIKALPYKIDKNE
FT                   DVSLDLDVAAKYIAVCAGIPPSSVNQMDLCDINTLSWKVASFFMAAASATLKD"
FT   gene            635214..637358
FT                   /locus_tag="PSPTO_0580"
FT                   /old_locus_tag="PSPTO0580"
FT   CDS_pept        635214..637358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0580"
FT                   /old_locus_tag="PSPTO0580"
FT                   /product="tail tape measure protein"
FT                   /note="similar to GP:18152378; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54122"
FT                   /db_xref="GOA:Q88A17"
FT                   /db_xref="InterPro:IPR010090"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A17"
FT                   /protein_id="AAO54122.1"
FT                   /translation="MADTIRTLITGVDQLSPTLATIRNNVKGLETSLGAIELGKAITDN
FT                   ALAGPLIAGVKAAIGFETSMAGVKRSVTFETPQQFQQMGSDILDLSERLPESANGIAAI
FT                   VAAGAKANVPREELTGFASDAVKMGVAFDQTAAESGDMMASWRSSFQMTQPQVAALSEK
FT                   INVLGGNNLEKKIATMVTAMGPLGPVAGLASGQLAAMGATLASVDVPADVAASGMKRFM
FT                   QSLTEGGAAKAGAFEALQLDVNQLTQGMQSDPSGTIEKVLTAVSSVDPDKQSDVITQLF
FT                   GAESLGAITPLLANLDVLRSNLAKVGEGVQNSGTLEKEFADNSQTTATAIKEMTNRVDR
FT                   LGINIGSMFLPAMNQAMAVIGPMISQVAALAAEHPGVIKGVVAAAIAFGVLQVAVMTAT
FT                   TAMSVLSAVMGLSPLGLIVRGLALAAGLLIANWSTVAPYFQAVWEAIRGPAMALWDVLK
FT                   AVFAWTPIGMIVANWQPLSEFFAALWDVIKVLATPFSDFLQTLFSWTPLGMVVANWQPI
FT                   SEYFAGLWESIKTAAQPFTDALAMMFSFSPLGMVIEKWAPIKAWFADLWADIKPFIDPI
FT                   MSWFGGDGDKSLLKSATEKVNQFAEEQRVRNAGPGGGTGAFLAANAVDASRSQQQQLNL
FT                   ATGVPPTSQLLSAPNFPAPGNLLLQQGAAGAGARLEGELNIRFENAPPGMRPGQVQSNQ
FT                   PGLTISPNVGYRTLGAGAGL"
FT   gene            637355..639178
FT                   /locus_tag="PSPTO_0581"
FT                   /old_locus_tag="PSPTO0581"
FT   CDS_pept        637355..639178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0581"
FT                   /old_locus_tag="PSPTO0581"
FT                   /product="DNA circulation protein, putative"
FT                   /note="similar to GP:19483753; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54123"
FT                   /db_xref="GOA:Q88A16"
FT                   /db_xref="InterPro:IPR009826"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A16"
FT                   /protein_id="AAO54123.1"
FT                   /translation="MSTWRDSLLPASFRGVGFFIEKAVVPVGRKGQLHEFPQRDEPYFE
FT                   SLGKQAQVHTLTAFIVGRDCFEKRDNLLQALEKDGAGELVHPWLGRMQVQVGQCSVTHT
FT                   LIEGGMVRLDLVFYPANPLKFPVSTLNTRRQLLGASASLLDSALRRYRSVMAVVDAVRI
FT                   NVQALRSALSGVFATIQRQFAPFMAIYSDVTALVHSLVNAPLTVSTLFTTFFASFDGDS
FT                   RRSRRANGSSSVSGASTTTGSGSSVGGGSGAGSGGSSGSGSGSSTSISLASSSGSSGGS
FT                   SDLETVPYPDAPFQGDPWHFSRPLGDGFIGQLSSRTALRAISAYLRTLAVAEEFWGMPT
FT                   DRAEASALLALPVHPTLALLRPERPIWFPATTDFDGDREAIESSMRGLVARVKTARPDD
FT                   ELIAFASPIFVSMERCVEVSLVRWSQAEESSIADADLAAHLEEFWADGWMLRSASPEPL
FT                   STTTVFASPPLDRLMEDQCKAWPLAAPLGIDRLGYLQHDLYPGRLFLPTLPSTDQAELT
FT                   PRGGQLEIKVDEQVIADLCYWNAGWGTARPMQFSGNCGTALTSRGRCYREGEDALEGAV
FT                   RSFYLWEVKTLHRSNTFEPFNQTLTTGAMFV"
FT   gene            639401..640042
FT                   /locus_tag="PSPTO_0582"
FT                   /old_locus_tag="PSPTO0582"
FT   CDS_pept        639401..640042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0582"
FT                   /old_locus_tag="PSPTO0582"
FT                   /product="protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54124"
FT                   /db_xref="GOA:Q88A15"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A15"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="AAO54124.1"
FT                   /translation="MNLAIVDEFTMDLEYGYLRSKFDETNTPYQSVFLSAQSQMWIFSA
FT                   YELMRTWREKISKYLKAADNGGLPLKLKELQKPLGYENFTVQKRIEEINLLIEKPELIE
FT                   TMRDDLKRTQMLFTQMELLRMSLAKHQMRKRPSAAVQAPTVGYMNRWCGSLEYQINSGQ
FT                   MIICNLSRRDIADGIRAIPAMTIPSDDDLDSFEAAMRGASDDELKSMFQN"
FT   gene            complement(640284..640973)
FT                   /locus_tag="PSPTO_0583"
FT                   /old_locus_tag="PSPTO0583"
FT   CDS_pept        complement(640284..640973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPTO_0583"
FT                   /old_locus_tag="PSPTO0583"
FT                   /product="protein of unknown function"
FT                   /note="see PMID:20190049 for expression data; identified by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:PSPTO_0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAO54125"
FT                   /db_xref="GOA:Q88A14"
FT                   /db_xref="UniProtKB/TrEMBL:Q88A14"
FT                   /experiment="RNA sequencing"
FT                   /protein_id="