(data stored in ACNUC7421 zone)

EMBL: AE016879

ID   AE016879; SV 1; circular; genomic DNA; STD; PRO; 5227293 BP.
XX
AC   AE016879; AE017024-AE017041;
XX
PR   Project:PRJNA309;
XX
DT   01-JAN-2006 (Rel. 86, Created)
DT   23-JUN-2016 (Rel. 129, Last updated, Version 9)
XX
DE   Bacillus anthracis str. Ames, complete genome.
XX
KW   .
XX
OS   Bacillus anthracis str. Ames
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus;
OC   Bacillus cereus group.
XX
OS   Bacillus phage lambda Ba01
OC   Viruses; unclassified bacterial viruses.
XX
OS   Bacillus phage lambda Ba04
OC   Viruses; unclassified bacterial viruses.
XX
OS   Bacillus phage lambda Ba03
OC   Viruses; unclassified bacterial viruses.
XX
OS   Bacillus phage lambda Ba02
OC   Viruses; unclassified bacterial viruses.
XX
RN   [1]
RP   1-5227293
RX   DOI; 10.1038/nature01586.
RX   PUBMED; 12721629.
RA   Read T.D., Peterson S.N., Tourasse N., Baillie L.W., Paulsen I.T.,
RA   Nelson K.E., Tettelin H., Fouts D.E., Eisen J.A., Gill S.R.,
RA   Holtzapple E.K., Okstad O.A., Helgason E., Rilstone J., Wu M.,
RA   Kolonay J.F., Beanan M.J., Dodson R.J., Brinkac L.M., Gwinn M., DeBoy R.T.,
RA   Madpu R., Daugherty S.C., Durkin A.S., Haft D.H., Nelson W.C.,
RA   Peterson J.D., Pop M., Khouri H.M., Radune D., Benton J.L., Mahamoud Y.,
RA   Jiang L., Hance I.R., Weidman J.F., Berry K.J., Plaut R.D., Wolf A.M.,
RA   Watkins K.L., Nierman W.C., Hazen A., Cline R., Redmond C., Thwaite J.E.,
RA   White O., Salzberg S.L., Thomason B., Friedlander A.M., Koehler T.M.,
RA   Hanna P.C., Kolsto A.B., Fraser C.M.;
RT   "The genome sequence of Bacillus anthracis Ames and comparison to closely
RT   related bacteria";
RL   Nature 423(6935):81-86(2003).
XX
RN   [2]
RP   1-5227293
RA   Read T.D., Peterson S.N., Tourasse N., Baillie L.W., Paulsen I.T.,
RA   Nelson K.E., Tettelin H., Fouts D.E., Madupu R., Eisen J.A., Gill S.R.,
RA   Holtzapple E., Okstad O.A., Rilstone J., Wu M., Kolonay J.F., Beanan M.J.,
RA   Dodson R.J., Brinkac L.M., Gwinn M.L., DeBoy R.T., Daugherty S.C.,
RA   Durkin A.S., Haft D.H., Nelson W.C., Peterson J.D., Pop M., Khouri H.M.,
RA   Radune D., Benton J.L., Mahamoud Y., Jiang L., Hance I., Helgason E.,
RA   Weidman J.F., Berry K., Plaut R.D., Wolf A.M., Watkins K.L., Nierman W.C.,
RA   Hazen A., Cline R.T., Redmond C., Thwaite J.E., White O., Salzberg S.L.,
RA   Thomason B., Friedlander A.M., Koehler T.M., Hanna P.C., Kolsto A.-B.,
RA   Fraser C.M.;
RT   ;
RL   Submitted (26-MAR-2003) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr., Rockville, MD
RL   20850, USA
XX
RN   [3]
RC   Protein update by submitter
RP   1-5227293
RA   Joardar V., Shrivastava S., Brinkac L.M., Harkins D.M., Durkin A.S.,
RA   Sutton G.;
RT   ;
RL   Submitted (19-OCT-2009) to the INSDC.
RL   The J. Craig Venter Institute, 9704 Medical Center Dr, Rockville, MD 20850,
RL   USA
XX
DR   MD5; 18b794dbe120b0c42c5bd553ef4a3d68.
DR   BioSample; SAMN02603432.
DR   EnsemblGenomes-Gn; BA_5739.
DR   EnsemblGenomes-Gn; BA_5740.
DR   EnsemblGenomes-Gn; BA_5741.
DR   EnsemblGenomes-Gn; BA_5742.
DR   EnsemblGenomes-Gn; BA_5743.
DR   EnsemblGenomes-Gn; BA_5744.
DR   EnsemblGenomes-Gn; BA_5745.
DR   EnsemblGenomes-Gn; BA_5746.
DR   EnsemblGenomes-Gn; BA_5747.
DR   EnsemblGenomes-Gn; BA_5748.
DR   EnsemblGenomes-Gn; BA_5749.
DR   EnsemblGenomes-Gn; BA_5750.
DR   EnsemblGenomes-Gn; BA_5751.
DR   EnsemblGenomes-Gn; BA_5752.
DR   EnsemblGenomes-Gn; BA_5753.
DR   EnsemblGenomes-Gn; BA_5754.
DR   EnsemblGenomes-Gn; BA_5755.
DR   EnsemblGenomes-Gn; BA_5756.
DR   EnsemblGenomes-Gn; BA_5757.
DR   EnsemblGenomes-Gn; BA_5758.
DR   EnsemblGenomes-Gn; BA_5759.
DR   EnsemblGenomes-Gn; BA_5760.
DR   EnsemblGenomes-Gn; BA_5761.
DR   EnsemblGenomes-Gn; BA_5762.
DR   EnsemblGenomes-Gn; BA_5763.
DR   EnsemblGenomes-Gn; BA_5764.
DR   EnsemblGenomes-Gn; BA_5765.
DR   EnsemblGenomes-Gn; BA_5766.
DR   EnsemblGenomes-Gn; BA_5767.
DR   EnsemblGenomes-Gn; BA_5768.
DR   EnsemblGenomes-Gn; BA_5769.
DR   EnsemblGenomes-Gn; BA_5770.
DR   EnsemblGenomes-Gn; BA_5771.
DR   EnsemblGenomes-Gn; BA_5772.
DR   EnsemblGenomes-Gn; BA_5773.
DR   EnsemblGenomes-Gn; BA_5774.
DR   EnsemblGenomes-Gn; BA_5775.
DR   EnsemblGenomes-Gn; BA_5776.
DR   EnsemblGenomes-Gn; BA_5777.
DR   EnsemblGenomes-Gn; BA_5778.
DR   EnsemblGenomes-Gn; BA_5779.
DR   EnsemblGenomes-Gn; BA_5780.
DR   EnsemblGenomes-Gn; BA_5781.
DR   EnsemblGenomes-Gn; BA_5782.
DR   EnsemblGenomes-Gn; BA_5783.
DR   EnsemblGenomes-Gn; BA_5784.
DR   EnsemblGenomes-Gn; BA_5785.
DR   EnsemblGenomes-Gn; BA_5786.
DR   EnsemblGenomes-Gn; BA_5787.
DR   EnsemblGenomes-Gn; BA_5788.
DR   EnsemblGenomes-Gn; BA_5789.
DR   EnsemblGenomes-Gn; BA_5790.
DR   EnsemblGenomes-Gn; BA_5791.
DR   EnsemblGenomes-Gn; BA_5792.
DR   EnsemblGenomes-Gn; BA_5793.
DR   EnsemblGenomes-Gn; BA_5794.
DR   EnsemblGenomes-Gn; BA_5795.
DR   EnsemblGenomes-Gn; BA_5796.
DR   EnsemblGenomes-Gn; BA_5797.
DR   EnsemblGenomes-Gn; BA_5798.
DR   EnsemblGenomes-Gn; BA_5799.
DR   EnsemblGenomes-Gn; BA_5800.
DR   EnsemblGenomes-Gn; BA_5801.
DR   EnsemblGenomes-Gn; BA_5802.
DR   EnsemblGenomes-Gn; BA_5803.
DR   EnsemblGenomes-Gn; BA_5804.
DR   EnsemblGenomes-Gn; BA_5805.
DR   EnsemblGenomes-Gn; BA_5806.
DR   EnsemblGenomes-Gn; BA_5807.
DR   EnsemblGenomes-Gn; BA_5808.
DR   EnsemblGenomes-Gn; BA_5809.
DR   EnsemblGenomes-Gn; BA_5810.
DR   EnsemblGenomes-Gn; BA_5811.
DR   EnsemblGenomes-Gn; BA_5812.
DR   EnsemblGenomes-Gn; BA_5813.
DR   EnsemblGenomes-Gn; BA_5814.
DR   EnsemblGenomes-Gn; BA_5815.
DR   EnsemblGenomes-Gn; BA_5816.
DR   EnsemblGenomes-Gn; BA_5817.
DR   EnsemblGenomes-Gn; BA_5818.
DR   EnsemblGenomes-Gn; BA_5819.
DR   EnsemblGenomes-Gn; BA_5820.
DR   EnsemblGenomes-Gn; BA_5821.
DR   EnsemblGenomes-Gn; BA_5822.
DR   EnsemblGenomes-Gn; BA_5823.
DR   EnsemblGenomes-Gn; BA_5824.
DR   EnsemblGenomes-Gn; BA_5825.
DR   EnsemblGenomes-Gn; BA_5826.
DR   EnsemblGenomes-Gn; BA_5827.
DR   EnsemblGenomes-Gn; BA_5828.
DR   EnsemblGenomes-Gn; BA_5829.
DR   EnsemblGenomes-Gn; BA_5830.
DR   EnsemblGenomes-Gn; BA_5831.
DR   EnsemblGenomes-Gn; BA_5832.
DR   EnsemblGenomes-Gn; BA_5833.
DR   EnsemblGenomes-Gn; BA_5834.
DR   EnsemblGenomes-Gn; BA_5835.
DR   EnsemblGenomes-Gn; BA_5836.
DR   EnsemblGenomes-Gn; BA_5837.
DR   EnsemblGenomes-Gn; BA_5838.
DR   EnsemblGenomes-Gn; BA_5839.
DR   EnsemblGenomes-Gn; BA_5840.
DR   EnsemblGenomes-Gn; BA_5841.
DR   EnsemblGenomes-Gn; BA_5842.
DR   EnsemblGenomes-Gn; BA_5843.
DR   EnsemblGenomes-Gn; BA_5844.
DR   EnsemblGenomes-Gn; BA_5845.
DR   EnsemblGenomes-Gn; BA_5846.
DR   EnsemblGenomes-Gn; BA_5847.
DR   EnsemblGenomes-Gn; BA_5848.
DR   EnsemblGenomes-Gn; BA_5849.
DR   EnsemblGenomes-Gn; BA_5850.
DR   EnsemblGenomes-Gn; BA_5851.
DR   EnsemblGenomes-Gn; BA_5852.
DR   EnsemblGenomes-Gn; BA_5853.
DR   EnsemblGenomes-Gn; BA_5854.
DR   EnsemblGenomes-Gn; BA_5855.
DR   EnsemblGenomes-Gn; BA_5856.
DR   EnsemblGenomes-Gn; BA_5857.
DR   EnsemblGenomes-Gn; BA_5858.
DR   EnsemblGenomes-Gn; BA_5859.
DR   EnsemblGenomes-Gn; BA_5860.
DR   EnsemblGenomes-Gn; BA_5861.
DR   EnsemblGenomes-Gn; BA_5862.
DR   EnsemblGenomes-Gn; BA_5863.
DR   EnsemblGenomes-Gn; BA_5864.
DR   EnsemblGenomes-Gn; BA_5865.
DR   EnsemblGenomes-Gn; BA_5866.
DR   EnsemblGenomes-Gn; BA_5867.
DR   EnsemblGenomes-Gn; BA_5868.
DR   EnsemblGenomes-Gn; BA_5869.
DR   EnsemblGenomes-Gn; BA_5870.
DR   EnsemblGenomes-Gn; EBG00001010937.
DR   EnsemblGenomes-Gn; EBG00001010938.
DR   EnsemblGenomes-Gn; EBG00001010939.
DR   EnsemblGenomes-Gn; EBG00001010940.
DR   EnsemblGenomes-Gn; EBG00001010941.
DR   EnsemblGenomes-Gn; EBG00001010942.
DR   EnsemblGenomes-Gn; EBG00001010943.
DR   EnsemblGenomes-Gn; EBG00001010944.
DR   EnsemblGenomes-Gn; EBG00001010945.
DR   EnsemblGenomes-Gn; EBG00001010946.
DR   EnsemblGenomes-Gn; EBG00001010947.
DR   EnsemblGenomes-Gn; EBG00001010948.
DR   EnsemblGenomes-Gn; EBG00001010949.
DR   EnsemblGenomes-Gn; EBG00001010950.
DR   EnsemblGenomes-Gn; EBG00001010951.
DR   EnsemblGenomes-Gn; EBG00001010952.
DR   EnsemblGenomes-Gn; EBG00001010953.
DR   EnsemblGenomes-Gn; EBG00001010954.
DR   EnsemblGenomes-Gn; EBG00001010955.
DR   EnsemblGenomes-Gn; EBG00001010956.
DR   EnsemblGenomes-Gn; EBG00001010957.
DR   EnsemblGenomes-Gn; EBG00001010958.
DR   EnsemblGenomes-Gn; EBG00001010959.
DR   EnsemblGenomes-Gn; EBG00001010960.
DR   EnsemblGenomes-Gn; EBG00001010961.
DR   EnsemblGenomes-Gn; EBG00001010962.
DR   EnsemblGenomes-Gn; EBG00001010963.
DR   EnsemblGenomes-Gn; EBG00001010964.
DR   EnsemblGenomes-Gn; EBG00001010965.
DR   EnsemblGenomes-Gn; EBG00001010966.
DR   EnsemblGenomes-Gn; EBG00001010967.
DR   EnsemblGenomes-Gn; EBG00001010968.
DR   EnsemblGenomes-Gn; EBG00001010969.
DR   EnsemblGenomes-Gn; EBG00001010970.
DR   EnsemblGenomes-Gn; EBG00001010971.
DR   EnsemblGenomes-Gn; EBG00001010972.
DR   EnsemblGenomes-Gn; EBG00001010973.
DR   EnsemblGenomes-Gn; EBG00001010974.
DR   EnsemblGenomes-Gn; EBG00001010975.
DR   EnsemblGenomes-Gn; EBG00001010976.
DR   EnsemblGenomes-Gn; EBG00001010977.
DR   EnsemblGenomes-Gn; EBG00001010978.
DR   EnsemblGenomes-Gn; EBG00001010979.
DR   EnsemblGenomes-Gn; EBG00001010980.
DR   EnsemblGenomes-Gn; EBG00001010981.
DR   EnsemblGenomes-Gn; EBG00001010982.
DR   EnsemblGenomes-Gn; EBG00001010983.
DR   EnsemblGenomes-Gn; EBG00001010984.
DR   EnsemblGenomes-Gn; EBG00001010985.
DR   EnsemblGenomes-Gn; EBG00001010986.
DR   EnsemblGenomes-Gn; EBG00001010987.
DR   EnsemblGenomes-Gn; EBG00001010988.
DR   EnsemblGenomes-Gn; EBG00001010989.
DR   EnsemblGenomes-Gn; EBG00001010990.
DR   EnsemblGenomes-Gn; EBG00001010991.
DR   EnsemblGenomes-Gn; EBG00001010992.
DR   EnsemblGenomes-Gn; EBG00001010993.
DR   EnsemblGenomes-Gn; EBG00001010994.
DR   EnsemblGenomes-Gn; EBG00001010995.
DR   EnsemblGenomes-Gn; EBG00001010996.
DR   EnsemblGenomes-Gn; EBG00001010997.
DR   EnsemblGenomes-Gn; EBG00001010998.
DR   EnsemblGenomes-Gn; EBG00001010999.
DR   EnsemblGenomes-Gn; EBG00001011000.
DR   EnsemblGenomes-Gn; EBG00001011001.
DR   EnsemblGenomes-Gn; EBG00001011002.
DR   EnsemblGenomes-Gn; EBG00001011003.
DR   EnsemblGenomes-Gn; EBG00001011004.
DR   EnsemblGenomes-Gn; EBG00001011005.
DR   EnsemblGenomes-Gn; EBG00001011006.
DR   EnsemblGenomes-Gn; EBG00001011007.
DR   EnsemblGenomes-Gn; EBG00001011008.
DR   EnsemblGenomes-Gn; EBG00001011009.
DR   EnsemblGenomes-Gn; EBG00001011010.
DR   EnsemblGenomes-Gn; EBG00001011011.
DR   EnsemblGenomes-Gn; EBG00001011012.
DR   EnsemblGenomes-Gn; EBG00001011013.
DR   EnsemblGenomes-Gn; EBG00001011014.
DR   EnsemblGenomes-Gn; EBG00001011015.
DR   EnsemblGenomes-Gn; EBG00001011016.
DR   EnsemblGenomes-Gn; EBG00001011017.
DR   EnsemblGenomes-Gn; EBG00001011018.
DR   EnsemblGenomes-Gn; EBG00001011019.
DR   EnsemblGenomes-Gn; EBG00001011020.
DR   EnsemblGenomes-Gn; EBG00001011021.
DR   EnsemblGenomes-Gn; EBG00001011022.
DR   EnsemblGenomes-Gn; EBG00001011023.
DR   EnsemblGenomes-Gn; EBG00001011024.
DR   EnsemblGenomes-Gn; EBG00001011025.
DR   EnsemblGenomes-Gn; EBG00001011026.
DR   EnsemblGenomes-Gn; EBG00001011027.
DR   EnsemblGenomes-Gn; EBG00001011028.
DR   EnsemblGenomes-Gn; EBG00001011029.
DR   EnsemblGenomes-Gn; EBG00001011030.
DR   EnsemblGenomes-Gn; EBG00001011031.
DR   EnsemblGenomes-Gn; EBG00001011032.
DR   EnsemblGenomes-Gn; EBG00001011033.
DR   EnsemblGenomes-Gn; EBG00001011034.
DR   EnsemblGenomes-Gn; EBG00001011035.
DR   EnsemblGenomes-Gn; EBG00001011036.
DR   EnsemblGenomes-Gn; EBG00001011037.
DR   EnsemblGenomes-Gn; EBG00001011038.
DR   EnsemblGenomes-Gn; EBG00001011039.
DR   EnsemblGenomes-Gn; EBG00001011040.
DR   EnsemblGenomes-Gn; EBG00001011041.
DR   EnsemblGenomes-Gn; EBG00001011042.
DR   EnsemblGenomes-Gn; EBG00001011043.
DR   EnsemblGenomes-Gn; EBG00001011044.
DR   EnsemblGenomes-Gn; EBG00001011045.
DR   EnsemblGenomes-Gn; EBG00001011046.
DR   EnsemblGenomes-Gn; EBG00001011047.
DR   EnsemblGenomes-Gn; EBG00001011048.
DR   EnsemblGenomes-Gn; EBG00001011049.
DR   EnsemblGenomes-Gn; EBG00001011050.
DR   EnsemblGenomes-Gn; EBG00001011051.
DR   EnsemblGenomes-Gn; EBG00001011052.
DR   EnsemblGenomes-Gn; EBG00001011053.
DR   EnsemblGenomes-Gn; EBG00001011054.
DR   EnsemblGenomes-Gn; EBG00001011055.
DR   EnsemblGenomes-Gn; EBG00001011056.
DR   EnsemblGenomes-Gn; EBG00001011057.
DR   EnsemblGenomes-Gn; EBG00001011058.
DR   EnsemblGenomes-Gn; EBG00001011059.
DR   EnsemblGenomes-Gn; EBG00001011060.
DR   EnsemblGenomes-Gn; EBG00001011061.
DR   EnsemblGenomes-Gn; EBG00001011062.
DR   EnsemblGenomes-Gn; EBG00001011063.
DR   EnsemblGenomes-Gn; EBG00001011064.
DR   EnsemblGenomes-Gn; EBG00001011065.
DR   EnsemblGenomes-Gn; EBG00001011066.
DR   EnsemblGenomes-Gn; EBG00001011067.
DR   EnsemblGenomes-Gn; EBG00001011068.
DR   EnsemblGenomes-Gn; EBG00001011069.
DR   EnsemblGenomes-Gn; EBG00001011070.
DR   EnsemblGenomes-Gn; EBG00001011071.
DR   EnsemblGenomes-Gn; EBG00001011072.
DR   EnsemblGenomes-Gn; EBG00001011073.
DR   EnsemblGenomes-Gn; EBG00001011074.
DR   EnsemblGenomes-Gn; EBG00001011075.
DR   EnsemblGenomes-Gn; EBG00001011076.
DR   EnsemblGenomes-Gn; EBG00001011077.
DR   EnsemblGenomes-Gn; EBG00001011078.
DR   EnsemblGenomes-Gn; EBG00001011079.
DR   EnsemblGenomes-Gn; EBG00001011080.
DR   EnsemblGenomes-Gn; EBG00001011081.
DR   EnsemblGenomes-Gn; EBG00001011082.
DR   EnsemblGenomes-Gn; EBG00001011083.
DR   EnsemblGenomes-Gn; EBG00001011084.
DR   EnsemblGenomes-Gn; EBG00001011085.
DR   EnsemblGenomes-Gn; EBG00001011086.
DR   EnsemblGenomes-Gn; EBG00001011087.
DR   EnsemblGenomes-Gn; EBG00001011088.
DR   EnsemblGenomes-Gn; EBG00001011089.
DR   EnsemblGenomes-Gn; EBG00001011090.
DR   EnsemblGenomes-Gn; EBG00001011091.
DR   EnsemblGenomes-Gn; EBG00001011092.
DR   EnsemblGenomes-Gn; EBG00001011093.
DR   EnsemblGenomes-Gn; EBG00001011094.
DR   EnsemblGenomes-Gn; EBG00001011095.
DR   EnsemblGenomes-Gn; EBG00001011096.
DR   EnsemblGenomes-Gn; EBG00001011097.
DR   EnsemblGenomes-Gn; EBG00001011098.
DR   EnsemblGenomes-Gn; EBG00001011099.
DR   EnsemblGenomes-Gn; EBG00001011100.
DR   EnsemblGenomes-Gn; EBG00001011101.
DR   EnsemblGenomes-Gn; EBG00001011102.
DR   EnsemblGenomes-Gn; EBG00001011103.
DR   EnsemblGenomes-Gn; EBG00001011104.
DR   EnsemblGenomes-Tr; BA_5739-1.
DR   EnsemblGenomes-Tr; BA_5740-1.
DR   EnsemblGenomes-Tr; BA_5741-1.
DR   EnsemblGenomes-Tr; BA_5742-1.
DR   EnsemblGenomes-Tr; BA_5743-1.
DR   EnsemblGenomes-Tr; BA_5744-1.
DR   EnsemblGenomes-Tr; BA_5745-1.
DR   EnsemblGenomes-Tr; BA_5746-1.
DR   EnsemblGenomes-Tr; BA_5747-1.
DR   EnsemblGenomes-Tr; BA_5748-1.
DR   EnsemblGenomes-Tr; BA_5749-1.
DR   EnsemblGenomes-Tr; BA_5750-1.
DR   EnsemblGenomes-Tr; BA_5751-1.
DR   EnsemblGenomes-Tr; BA_5752-1.
DR   EnsemblGenomes-Tr; BA_5753-1.
DR   EnsemblGenomes-Tr; BA_5754-1.
DR   EnsemblGenomes-Tr; BA_5755-1.
DR   EnsemblGenomes-Tr; BA_5756-1.
DR   EnsemblGenomes-Tr; BA_5757-1.
DR   EnsemblGenomes-Tr; BA_5758-1.
DR   EnsemblGenomes-Tr; BA_5759-1.
DR   EnsemblGenomes-Tr; BA_5760-1.
DR   EnsemblGenomes-Tr; BA_5761-1.
DR   EnsemblGenomes-Tr; BA_5762-1.
DR   EnsemblGenomes-Tr; BA_5763-1.
DR   EnsemblGenomes-Tr; BA_5764-1.
DR   EnsemblGenomes-Tr; BA_5765-1.
DR   EnsemblGenomes-Tr; BA_5766-1.
DR   EnsemblGenomes-Tr; BA_5767-1.
DR   EnsemblGenomes-Tr; BA_5768-1.
DR   EnsemblGenomes-Tr; BA_5769-1.
DR   EnsemblGenomes-Tr; BA_5770-1.
DR   EnsemblGenomes-Tr; BA_5771-1.
DR   EnsemblGenomes-Tr; BA_5772-1.
DR   EnsemblGenomes-Tr; BA_5773-1.
DR   EnsemblGenomes-Tr; BA_5774-1.
DR   EnsemblGenomes-Tr; BA_5775-1.
DR   EnsemblGenomes-Tr; BA_5776-1.
DR   EnsemblGenomes-Tr; BA_5777-1.
DR   EnsemblGenomes-Tr; BA_5778-1.
DR   EnsemblGenomes-Tr; BA_5779-1.
DR   EnsemblGenomes-Tr; BA_5780-1.
DR   EnsemblGenomes-Tr; BA_5781-1.
DR   EnsemblGenomes-Tr; BA_5782-1.
DR   EnsemblGenomes-Tr; BA_5783-1.
DR   EnsemblGenomes-Tr; BA_5784-1.
DR   EnsemblGenomes-Tr; BA_5785-1.
DR   EnsemblGenomes-Tr; BA_5786-1.
DR   EnsemblGenomes-Tr; BA_5787-1.
DR   EnsemblGenomes-Tr; BA_5788-1.
DR   EnsemblGenomes-Tr; BA_5789-1.
DR   EnsemblGenomes-Tr; BA_5790-1.
DR   EnsemblGenomes-Tr; BA_5791-1.
DR   EnsemblGenomes-Tr; BA_5792-1.
DR   EnsemblGenomes-Tr; BA_5793-1.
DR   EnsemblGenomes-Tr; BA_5794-1.
DR   EnsemblGenomes-Tr; BA_5795-1.
DR   EnsemblGenomes-Tr; BA_5796-1.
DR   EnsemblGenomes-Tr; BA_5797-1.
DR   EnsemblGenomes-Tr; BA_5798-1.
DR   EnsemblGenomes-Tr; BA_5799-1.
DR   EnsemblGenomes-Tr; BA_5800-1.
DR   EnsemblGenomes-Tr; BA_5801-1.
DR   EnsemblGenomes-Tr; BA_5802-1.
DR   EnsemblGenomes-Tr; BA_5803-1.
DR   EnsemblGenomes-Tr; BA_5804-1.
DR   EnsemblGenomes-Tr; BA_5805-1.
DR   EnsemblGenomes-Tr; BA_5806-1.
DR   EnsemblGenomes-Tr; BA_5807-1.
DR   EnsemblGenomes-Tr; BA_5808-1.
DR   EnsemblGenomes-Tr; BA_5809-1.
DR   EnsemblGenomes-Tr; BA_5810-1.
DR   EnsemblGenomes-Tr; BA_5811-1.
DR   EnsemblGenomes-Tr; BA_5812-1.
DR   EnsemblGenomes-Tr; BA_5813-1.
DR   EnsemblGenomes-Tr; BA_5814-1.
DR   EnsemblGenomes-Tr; BA_5815-1.
DR   EnsemblGenomes-Tr; BA_5816-1.
DR   EnsemblGenomes-Tr; BA_5817-1.
DR   EnsemblGenomes-Tr; BA_5818-1.
DR   EnsemblGenomes-Tr; BA_5819-1.
DR   EnsemblGenomes-Tr; BA_5820-1.
DR   EnsemblGenomes-Tr; BA_5821-1.
DR   EnsemblGenomes-Tr; BA_5822-1.
DR   EnsemblGenomes-Tr; BA_5823-1.
DR   EnsemblGenomes-Tr; BA_5824-1.
DR   EnsemblGenomes-Tr; BA_5825-1.
DR   EnsemblGenomes-Tr; BA_5826-1.
DR   EnsemblGenomes-Tr; BA_5827-1.
DR   EnsemblGenomes-Tr; BA_5828-1.
DR   EnsemblGenomes-Tr; BA_5829-1.
DR   EnsemblGenomes-Tr; BA_5830-1.
DR   EnsemblGenomes-Tr; BA_5831-1.
DR   EnsemblGenomes-Tr; BA_5832-1.
DR   EnsemblGenomes-Tr; BA_5833-1.
DR   EnsemblGenomes-Tr; BA_5834-1.
DR   EnsemblGenomes-Tr; BA_5835-1.
DR   EnsemblGenomes-Tr; BA_5836-1.
DR   EnsemblGenomes-Tr; BA_5837-1.
DR   EnsemblGenomes-Tr; BA_5838-1.
DR   EnsemblGenomes-Tr; BA_5839-1.
DR   EnsemblGenomes-Tr; BA_5840-1.
DR   EnsemblGenomes-Tr; BA_5841-1.
DR   EnsemblGenomes-Tr; BA_5842-1.
DR   EnsemblGenomes-Tr; BA_5843-1.
DR   EnsemblGenomes-Tr; BA_5844-1.
DR   EnsemblGenomes-Tr; BA_5845-1.
DR   EnsemblGenomes-Tr; BA_5846-1.
DR   EnsemblGenomes-Tr; BA_5847-1.
DR   EnsemblGenomes-Tr; BA_5848-1.
DR   EnsemblGenomes-Tr; BA_5849-1.
DR   EnsemblGenomes-Tr; BA_5850-1.
DR   EnsemblGenomes-Tr; BA_5851-1.
DR   EnsemblGenomes-Tr; BA_5852-1.
DR   EnsemblGenomes-Tr; BA_5853-1.
DR   EnsemblGenomes-Tr; BA_5854-1.
DR   EnsemblGenomes-Tr; BA_5855-1.
DR   EnsemblGenomes-Tr; BA_5856-1.
DR   EnsemblGenomes-Tr; BA_5857-1.
DR   EnsemblGenomes-Tr; BA_5858-1.
DR   EnsemblGenomes-Tr; BA_5859-1.
DR   EnsemblGenomes-Tr; BA_5860-1.
DR   EnsemblGenomes-Tr; BA_5861-1.
DR   EnsemblGenomes-Tr; BA_5862-1.
DR   EnsemblGenomes-Tr; BA_5863-1.
DR   EnsemblGenomes-Tr; BA_5864-1.
DR   EnsemblGenomes-Tr; BA_5865-1.
DR   EnsemblGenomes-Tr; BA_5866-1.
DR   EnsemblGenomes-Tr; BA_5867-1.
DR   EnsemblGenomes-Tr; BA_5868-1.
DR   EnsemblGenomes-Tr; BA_5869-1.
DR   EnsemblGenomes-Tr; BA_5870-1.
DR   EnsemblGenomes-Tr; EBT00001535988.
DR   EnsemblGenomes-Tr; EBT00001535991.
DR   EnsemblGenomes-Tr; EBT00001535994.
DR   EnsemblGenomes-Tr; EBT00001535997.
DR   EnsemblGenomes-Tr; EBT00001536000.
DR   EnsemblGenomes-Tr; EBT00001536003.
DR   EnsemblGenomes-Tr; EBT00001536006.
DR   EnsemblGenomes-Tr; EBT00001536010.
DR   EnsemblGenomes-Tr; EBT00001536013.
DR   EnsemblGenomes-Tr; EBT00001536016.
DR   EnsemblGenomes-Tr; EBT00001536022.
DR   EnsemblGenomes-Tr; EBT00001536025.
DR   EnsemblGenomes-Tr; EBT00001536029.
DR   EnsemblGenomes-Tr; EBT00001536033.
DR   EnsemblGenomes-Tr; EBT00001536037.
DR   EnsemblGenomes-Tr; EBT00001536041.
DR   EnsemblGenomes-Tr; EBT00001536045.
DR   EnsemblGenomes-Tr; EBT00001536049.
DR   EnsemblGenomes-Tr; EBT00001536053.
DR   EnsemblGenomes-Tr; EBT00001536059.
DR   EnsemblGenomes-Tr; EBT00001536063.
DR   EnsemblGenomes-Tr; EBT00001536065.
DR   EnsemblGenomes-Tr; EBT00001536070.
DR   EnsemblGenomes-Tr; EBT00001536075.
DR   EnsemblGenomes-Tr; EBT00001536080.
DR   EnsemblGenomes-Tr; EBT00001536084.
DR   EnsemblGenomes-Tr; EBT00001536086.
DR   EnsemblGenomes-Tr; EBT00001536089.
DR   EnsemblGenomes-Tr; EBT00001536093.
DR   EnsemblGenomes-Tr; EBT00001536097.
DR   EnsemblGenomes-Tr; EBT00001536100.
DR   EnsemblGenomes-Tr; EBT00001536102.
DR   EnsemblGenomes-Tr; EBT00001536104.
DR   EnsemblGenomes-Tr; EBT00001536108.
DR   EnsemblGenomes-Tr; EBT00001536111.
DR   EnsemblGenomes-Tr; EBT00001536117.
DR   EnsemblGenomes-Tr; EBT00001536121.
DR   EnsemblGenomes-Tr; EBT00001536126.
DR   EnsemblGenomes-Tr; EBT00001536132.
DR   EnsemblGenomes-Tr; EBT00001536136.
DR   EnsemblGenomes-Tr; EBT00001536140.
DR   EnsemblGenomes-Tr; EBT00001536145.
DR   EnsemblGenomes-Tr; EBT00001536150.
DR   EnsemblGenomes-Tr; EBT00001536154.
DR   EnsemblGenomes-Tr; EBT00001536159.
DR   EnsemblGenomes-Tr; EBT00001536163.
DR   EnsemblGenomes-Tr; EBT00001536168.
DR   EnsemblGenomes-Tr; EBT00001536172.
DR   EnsemblGenomes-Tr; EBT00001536177.
DR   EnsemblGenomes-Tr; EBT00001536182.
DR   EnsemblGenomes-Tr; EBT00001536187.
DR   EnsemblGenomes-Tr; EBT00001536194.
DR   EnsemblGenomes-Tr; EBT00001536198.
DR   EnsemblGenomes-Tr; EBT00001536203.
DR   EnsemblGenomes-Tr; EBT00001536208.
DR   EnsemblGenomes-Tr; EBT00001536212.
DR   EnsemblGenomes-Tr; EBT00001536215.
DR   EnsemblGenomes-Tr; EBT00001536221.
DR   EnsemblGenomes-Tr; EBT00001536228.
DR   EnsemblGenomes-Tr; EBT00001536232.
DR   EnsemblGenomes-Tr; EBT00001536235.
DR   EnsemblGenomes-Tr; EBT00001536239.
DR   EnsemblGenomes-Tr; EBT00001536242.
DR   EnsemblGenomes-Tr; EBT00001536247.
DR   EnsemblGenomes-Tr; EBT00001536253.
DR   EnsemblGenomes-Tr; EBT00001536261.
DR   EnsemblGenomes-Tr; EBT00001536264.
DR   EnsemblGenomes-Tr; EBT00001536268.
DR   EnsemblGenomes-Tr; EBT00001536270.
DR   EnsemblGenomes-Tr; EBT00001536273.
DR   EnsemblGenomes-Tr; EBT00001536275.
DR   EnsemblGenomes-Tr; EBT00001536278.
DR   EnsemblGenomes-Tr; EBT00001536280.
DR   EnsemblGenomes-Tr; EBT00001536285.
DR   EnsemblGenomes-Tr; EBT00001536288.
DR   EnsemblGenomes-Tr; EBT00001536291.
DR   EnsemblGenomes-Tr; EBT00001536294.
DR   EnsemblGenomes-Tr; EBT00001536297.
DR   EnsemblGenomes-Tr; EBT00001536301.
DR   EnsemblGenomes-Tr; EBT00001536304.
DR   EnsemblGenomes-Tr; EBT00001536308.
DR   EnsemblGenomes-Tr; EBT00001536313.
DR   EnsemblGenomes-Tr; EBT00001536317.
DR   EnsemblGenomes-Tr; EBT00001536322.
DR   EnsemblGenomes-Tr; EBT00001536331.
DR   EnsemblGenomes-Tr; EBT00001536336.
DR   EnsemblGenomes-Tr; EBT00001536343.
DR   EnsemblGenomes-Tr; EBT00001536350.
DR   EnsemblGenomes-Tr; EBT00001536355.
DR   EnsemblGenomes-Tr; EBT00001536359.
DR   EnsemblGenomes-Tr; EBT00001536363.
DR   EnsemblGenomes-Tr; EBT00001536368.
DR   EnsemblGenomes-Tr; EBT00001536372.
DR   EnsemblGenomes-Tr; EBT00001536376.
DR   EnsemblGenomes-Tr; EBT00001536379.
DR   EnsemblGenomes-Tr; EBT00001536382.
DR   EnsemblGenomes-Tr; EBT00001536388.
DR   EnsemblGenomes-Tr; EBT00001536394.
DR   EnsemblGenomes-Tr; EBT00001536400.
DR   EnsemblGenomes-Tr; EBT00001536405.
DR   EnsemblGenomes-Tr; EBT00001536409.
DR   EnsemblGenomes-Tr; EBT00001536412.
DR   EnsemblGenomes-Tr; EBT00001536415.
DR   EnsemblGenomes-Tr; EBT00001536419.
DR   EnsemblGenomes-Tr; EBT00001536431.
DR   EnsemblGenomes-Tr; EBT00001536434.
DR   EnsemblGenomes-Tr; EBT00001536437.
DR   EnsemblGenomes-Tr; EBT00001536440.
DR   EnsemblGenomes-Tr; EBT00001536443.
DR   EnsemblGenomes-Tr; EBT00001536446.
DR   EnsemblGenomes-Tr; EBT00001536463.
DR   EnsemblGenomes-Tr; EBT00001536470.
DR   EnsemblGenomes-Tr; EBT00001536476.
DR   EnsemblGenomes-Tr; EBT00001536485.
DR   EnsemblGenomes-Tr; EBT00001536493.
DR   EnsemblGenomes-Tr; EBT00001536500.
DR   EnsemblGenomes-Tr; EBT00001536504.
DR   EnsemblGenomes-Tr; EBT00001536508.
DR   EnsemblGenomes-Tr; EBT00001536513.
DR   EnsemblGenomes-Tr; EBT00001536517.
DR   EnsemblGenomes-Tr; EBT00001536522.
DR   EnsemblGenomes-Tr; EBT00001536528.
DR   EnsemblGenomes-Tr; EBT00001536532.
DR   EnsemblGenomes-Tr; EBT00001536538.
DR   EnsemblGenomes-Tr; EBT00001536541.
DR   EnsemblGenomes-Tr; EBT00001536546.
DR   EnsemblGenomes-Tr; EBT00001536550.
DR   EnsemblGenomes-Tr; EBT00001536555.
DR   EnsemblGenomes-Tr; EBT00001536560.
DR   EnsemblGenomes-Tr; EBT00001536566.
DR   EnsemblGenomes-Tr; EBT00001536571.
DR   EnsemblGenomes-Tr; EBT00001536576.
DR   EnsemblGenomes-Tr; EBT00001536580.
DR   EnsemblGenomes-Tr; EBT00001536583.
DR   EnsemblGenomes-Tr; EBT00001536590.
DR   EnsemblGenomes-Tr; EBT00001536594.
DR   EnsemblGenomes-Tr; EBT00001536599.
DR   EnsemblGenomes-Tr; EBT00001536602.
DR   EnsemblGenomes-Tr; EBT00001536607.
DR   EnsemblGenomes-Tr; EBT00001536615.
DR   EnsemblGenomes-Tr; EBT00001536621.
DR   EnsemblGenomes-Tr; EBT00001536625.
DR   EnsemblGenomes-Tr; EBT00001536631.
DR   EnsemblGenomes-Tr; EBT00001536635.
DR   EnsemblGenomes-Tr; EBT00001536638.
DR   EnsemblGenomes-Tr; EBT00001536642.
DR   EnsemblGenomes-Tr; EBT00001536648.
DR   EnsemblGenomes-Tr; EBT00001536651.
DR   EnsemblGenomes-Tr; EBT00001536655.
DR   EnsemblGenomes-Tr; EBT00001536659.
DR   EnsemblGenomes-Tr; EBT00001536663.
DR   EnsemblGenomes-Tr; EBT00001536667.
DR   EnsemblGenomes-Tr; EBT00001536669.
DR   EnsemblGenomes-Tr; EBT00001536674.
DR   EnsemblGenomes-Tr; EBT00001536678.
DR   EnsemblGenomes-Tr; EBT00001536682.
DR   EnsemblGenomes-Tr; EBT00001536685.
DR   EnsemblGenomes-Tr; EBT00001536689.
DR   EnsemblGenomes-Tr; EBT00001536693.
DR   EnsemblGenomes-Tr; EBT00001536699.
DR   EnsemblGenomes-Tr; EBT00001536706.
DR   EnsemblGenomes-Tr; EBT00001536710.
DR   EnsemblGenomes-Tr; EBT00001536714.
DR   EnsemblGenomes-Tr; EBT00001536717.
DR   EnsemblGenomes-Tr; EBT00001536723.
DR   EnsemblGenomes-Tr; EBT00001536729.
DR   EnsemblGenomes-Tr; EBT00001536733.
DR   EnsemblGenomes-Tr; EBT00001536739.
DR   EuropePMC; PMC1182639; 16051850.
DR   EuropePMC; PMC1201184; 16041044.
DR   EuropePMC; PMC1352193; 16391023.
DR   EuropePMC; PMC1475869; 16600039.
DR   EuropePMC; PMC1479350; 16600037.
DR   EuropePMC; PMC2258589; 18083867.
DR   EuropePMC; PMC2632007; 19074389.
DR   EuropePMC; PMC3039983; 21340017.
DR   EuropePMC; PMC3064363; 21383169.
DR   EuropePMC; PMC3147385; 21622797.
DR   EuropePMC; PMC3265652; 22178763.
DR   EuropePMC; PMC4149570; 25171339.
DR   EuropePMC; PMC427776; 15184171.
DR   EuropePMC; PMC4505593; 25825488.
DR   EuropePMC; PMC4595212; 26445214.
DR   EuropePMC; PMC5411500; 28314726.
DR   EuropePMC; PMC549560; 15698474.
DR   EuropePMC; PMC6245597; 30458766.
DR   GOA; P59873.
DR   GOA; P60534.
DR   GOA; P60540.
DR   GOA; Q6HYJ1.
DR   GOA; Q6I3T8.
DR   GOA; Q6I4Q2.
DR   InterPro; IPR008179; HisE.
DR   InterPro; IPR020095; PsdUridine_synth_TruA_C.
DR   InterPro; IPR023952; IolE.
DR   InterPro; IPR030823; IolE/MocC.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00516; ylbH.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01410; BsrC.
DR   RFAM; RF01411; BsrF.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01764; yjdF.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01820; RsaE.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; AE016879.
DR   SILVA-SSU; AE016879.
DR   UniProtKB/Swiss-Prot; P59873; TRUB_BACAN.
DR   UniProtKB/Swiss-Prot; P60534; HIS2_BACAN.
DR   UniProtKB/Swiss-Prot; P60540; HIS3_BACAN.
DR   UniProtKB/Swiss-Prot; Q6HYJ1; IOLE_BACAN.
DR   UniProtKB/Swiss-Prot; Q6I3T8; TRUA2_BACAN.
DR   UniProtKB/Swiss-Prot; Q6I4Q2; TRUA1_BACAN.
XX
CC   On or before Dec 29, 2005 this sequence version replaced
CC   gi:30253516, gi:30253828, gi:30254178, gi:30254612, gi:30255149,
CC   gi:30255837, gi:30256523, gi:30256827, gi:30257133, gi:30257422,
CC   gi:30257731, gi:30258016, gi:30258352, gi:30258653, gi:30259002,
CC   gi:30259317, gi:30259630, gi:30259939.
XX
FH   Key             Location/Qualifiers
FH
FT   source          order(1..447282,484668..3456504,3507047..3745622,
FT                   3789666..4841730,4858490..5227293)
FT                   /organism="Bacillus anthracis str. Ames"
FT                   /focus
FT                   /strain="Ames"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:198094"
FT   source          447283..484667
FT                   /organism="Bacillus phage lambda Ba01"
FT                   /mol_type="genomic DNA"
FT                   /proviral
FT                   /note="putative prophage; Putative lysogenic prophage
FT                   region; Best Hits not completed; putative attL/R"
FT                   /db_xref="taxon:229343"
FT   source          3456505..3507046
FT                   /organism="Bacillus phage lambda Ba04"
FT                   /mol_type="genomic DNA"
FT                   /proviral
FT                   /note="Putative prophage; Putative lysogenic prophage
FT                   region. Best Hits not completed. Putative attL/R; Putative
FT                   attL occurs within, but close to the terminus of the 3' end
FT                   of ORF03960, a good house-keeping gene"
FT                   /db_xref="taxon:229346"
FT   source          3745623..3789665
FT                   /organism="Bacillus phage lambda Ba03"
FT                   /mol_type="genomic DNA"
FT                   /proviral
FT                   /note="Putative prophage; Putative lysogenic prophage
FT                   region; Best Hits not completed; Putative attL/R"
FT                   /db_xref="taxon:229345"
FT   source          4841731..4858489
FT                   /organism="Bacillus phage lambda Ba02"
FT                   /mol_type="genomic DNA"
FT                   /proviral
FT                   /note="Putative prophage; Putative lysogenic prophage
FT                   region; Best Hits not completed; Putative attL/R"
FT                   /db_xref="taxon:229344"
FT   gene            407..1747
FT                   /gene="dnaA"
FT                   /locus_tag="BA_0001"
FT                   /old_locus_tag="BA0001"
FT   CDS_pept        407..1747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="BA_0001"
FT                   /old_locus_tag="BA0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by similarity to EGAD:14548; match to
FT                   protein family HMM PF00308; match to protein family HMM
FT                   PF08299; match to protein family HMM TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24059"
FT                   /db_xref="GOA:Q81W35"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81W35"
FT                   /protein_id="AAP24059.1"
FT                   /translation="MENISDLWNSALKELEKKVSKPSYETWLKSTTAHNLKKDVLTITA
FT                   PNEFARDWLESHYSELISETLYDLTGAKLAIRFIIPQSQAEEEIDLPPAKPNAAQDDSN
FT                   HLPQSMLNPKYTFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHA
FT                   IGHYVIEHNPNAKVVYLSSEKFTNEFINSIRDNKAVDFRNKYRNVDVLLIDDIQFLAGK
FT                   EQTQEEFFHTFNALHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETR
FT                   IAILRKKAKAEGLDIPNEVMLYIANQIDSNIRELEGALIRVVAYSSLINKDINADLAAE
FT                   ALKDIIPNSKPKIISIYDIQKAVGDVYQVKLEDFKAKKRTKSVAFPRQIAMYLSRELTD
FT                   SSLPKIGEEFGGRDHTTVIHAHEKISKLLKTDTQLQKQVEEINDILK"
FT   gene            1926..3065
FT                   /gene="dnaN1"
FT                   /locus_tag="BA_0002"
FT                   /old_locus_tag="BA0002"
FT   CDS_pept        1926..3065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN1"
FT                   /locus_tag="BA_0002"
FT                   /old_locus_tag="BA0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by similarity to EGAD:16050; match to
FT                   protein family HMM PF00712; match to protein family HMM
FT                   PF02767; match to protein family HMM PF02768; match to
FT                   protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24060"
FT                   /db_xref="GOA:A0A2P0H8N2"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H8N2"
FT                   /protein_id="AAP24060.1"
FT                   /translation="MRFSIQKDYLVRSVQDVMKAVSFRTTIPILTGIKVVATEEGVTLT
FT                   GSDADISIESFIPVEEDGKEIVEVKQSGSIVLQAKYFSEIVKKLPKETVEISVENHLMT
FT                   KITSGKSEFNLNGLDSAEYPLLPQIEEHHVFKIPTDLLKHMIRQTVFAVSTSETRPILT
FT                   GVNWKVYNSELTCIATDSHRLALRKAKIEGIVDEFQANVVIPGKSLNELSKILDESEEM
FT                   VDIVITEYQVLFRTKHLLFFSRLLEGNYPDTTRLIPAESKTDIFVNTKEFLQAIDRASL
FT                   LARDGRNNVVKLSTLEQAMLEISSNSPEIGKVVEEVQCEKVDGEELKISFSAKYMMDAL
FT                   KALDSTEIKISFTGAMRPFLIRTVNDESIIQLILPVRTY"
FT   gene            3193..3405
FT                   /locus_tag="BA_0003"
FT                   /old_locus_tag="BA0003"
FT   CDS_pept        3193..3405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0003"
FT                   /old_locus_tag="BA0003"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:13382; match to
FT                   protein family HMM TIGR02988"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24061"
FT                   /db_xref="GOA:A0A1J9WPQ2"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9WPQ2"
FT                   /protein_id="AAP24061.1"
FT                   /translation="MKRIKISTEYITLGQFLKLADVIDTGGAVKWFLQEYEVYVNQELE
FT                   NRRGRKLYANDIIEIPGSGSFQVQS"
FT   gene            3418..4545
FT                   /gene="recF"
FT                   /locus_tag="BA_0004"
FT                   /old_locus_tag="BA0004"
FT   CDS_pept        3418..4545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="BA_0004"
FT                   /old_locus_tag="BA0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="identified by similarity to EGAD:12641; match to
FT                   protein family HMM PF02463; match to protein family HMM
FT                   TIGR00611"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24062"
FT                   /db_xref="GOA:Q6I535"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6I535"
FT                   /protein_id="AAP24062.1"
FT                   /translation="MFISEIQLKNYRNYEKLELSFEDKVNVIIGENAQGKTNLMEAIYV
FT                   LAMAKSHRTSNDRELIRWDEDFGQIKGKLQKRNSSLSLELNISKKGKKAKLNQLEQQKL
FT                   SQYIGVMNVVMFAPEDLNLVKGSPQVRRRFLDMELGQIAPVYLYELSQYQKVLTQRNHL
FT                   LKKMQGNSKNEETMLDVFTLQLIEHGTKILRKRFEFLHLLQEWAAPIHRGISRGLEELE
FT                   IVYKPSVDVSESMDLSKIKEVYYESFQSVKQREIFRGTTLIGPHRDDLQFFVNSKNVQV
FT                   FGSQGQQRTTALSLKLAEIELIYSEVKEYPILLLDDVLSELDDYRQSHLLNTIQGKVQT
FT                   FVTTTSVDGIEHETLKEAKTIHVTNGTVDCEIDRA"
FT   gene            4584..6506
FT                   /gene="gyrB"
FT                   /locus_tag="BA_0005"
FT                   /old_locus_tag="BA0005"
FT   CDS_pept        4584..6506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="BA_0005"
FT                   /old_locus_tag="BA0005"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by similarity to EGAD:14605; match to
FT                   protein family HMM PF00204; match to protein family HMM
FT                   PF00986; match to protein family HMM PF01751; match to
FT                   protein family HMM PF02518; match to protein family HMM
FT                   TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24063"
FT                   /db_xref="GOA:Q9X3Y6"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9X3Y6"
FT                   /protein_id="AAP24063.1"
FT                   /translation="MEQKQMQENSYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLV
FT                   WEIVDNSIDEALAGYCDEINVSIEEDNSIRVTDNGRGIPVGIQEKMGRPAVEVIMTVLH
FT                   AGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHREGKIHYQKYERGIPVADLKVIG
FT                   DTDQTGTITRFKPDPEIFQETTVYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEF
FT                   HYEGGIKSYVEHLNRSKQPIHEEPVYVEGSKDGIQVEVSLQYNEGYTNNIYSFTNNIHT
FT                   YEGGTHEVGFKTALTRVINDYGRKNSILKDADSNLTGEDVREGLTAIVSIKHPNPQFEG
FT                   QTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVEKGTMAARARVAAKKARELTR
FT                   RKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIIN
FT                   VEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLT
FT                   FFYRYMRQIIEHGYIYIAQPPLFKVQQGKKIQYAYNEKELEKILAELPAQPKPGIQRYK
FT                   GLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYV
FT                   KNLDI"
FT   gene            6595..9066
FT                   /gene="gyrA"
FT                   /locus_tag="BA_0006"
FT                   /old_locus_tag="BA0006"
FT   CDS_pept        6595..9066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="BA_0006"
FT                   /old_locus_tag="BA0006"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by similarity to EGAD:20636; match to
FT                   protein family HMM PF00521; match to protein family HMM
FT                   PF03989; match to protein family HMM TIGR01063"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24064"
FT                   /db_xref="GOA:A0A347ZXI7"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZXI7"
FT                   /protein_id="AAP24064.1"
FT                   /translation="MSDNQQQARIREINISHEMRTSFLDYAMSVIVSRALPDVRDGLKP
FT                   VHRRVLYAMNDLGITADKAYKKSARIVGEVIGKYHPHGDSAVYETMVRMAQDFSQRYML
FT                   VDGHGNFGSVDGDSAAAMRYTEARMSKISMELIRDISKNTIDYQDNYDGSEREPIVLPA
FT                   RFPNLLVNGTTGIAVGMATNIPPHQLGEVIDGVLALSHNPDITIAELMECIPGPDFPTA
FT                   GLILGRSGIRRAYETGRGSIILRAKVEIEEKSNGKQSIIVTELPYQVNKARLIEKIAEL
FT                   VRDKKIEGITDLRDESDRNGMRIVMEVRRDANANVLLNNLYKHTALQTSFGINMLSLVN
FT                   GEPQVLNLKQNLYHYLEHQKVVIRRRTAYELEKAEARAHILEGLRIALDHLDEVITLIR
FT                   SSKTAEIAKQGLMERFGLSEKQAQAILDMRLQRLTGLEREKIEQEYQDLMKLIAELKAI
FT                   LADEEKVLEIIREELTEVKERFNDKRRTEITIGGMESIEDEDLIPEQNIAITLTHNGYI
FT                   KRLPASTYKTQNRGGRGVQGMGTNDDDFVEHLLTTSTHDHILFFTNKGKVYRTKGYEIP
FT                   EYSRTAKGIPIINLLGVDKGEWINAIIPIREFGDDEFLFFTTKQGISKRTPLSSFANIR
FT                   TNGLIAISLREEDEVISVRLTSGDKDIIVGTSNGMLIRFNEQDVRSMGRNAAGVKAITL
FT                   GEEDQVVGMEIVEEDVNVLIVTKNGYGKRTPIDEYRLQSRGGKGLKTCNITDKNGKLVA
FT                   VKSVTGEEDIMLITAAGVIIRMPVDQISQMGRNTQGVRLIRLEDEQEVATVAKAQKDDE
FT                   EETSEEVSSEE"
FT   gene            9335..10841
FT                   /gene="rrsA"
FT                   /locus_tag="BA_5739"
FT   rRNA            9335..10841
FT                   /gene="rrsA"
FT                   /locus_tag="BA_5739"
FT                   /product="16S ribosomal RNA"
FT   gene            10992..11068
FT                   /locus_tag="BA_5740"
FT   tRNA            10992..11068
FT                   /locus_tag="BA_5740"
FT                   /product="tRNA-Ile"
FT   gene            11077..11152
FT                   /locus_tag="BA_5741"
FT   tRNA            11077..11152
FT                   /locus_tag="BA_5741"
FT                   /product="tRNA-Ala"
FT   gene            11247..14154
FT                   /gene="rrlA"
FT                   /locus_tag="BA_5742"
FT   rRNA            11247..14154
FT                   /gene="rrlA"
FT                   /locus_tag="BA_5742"
FT                   /product="23S ribosomal RNA"
FT   gene            14203..14318
FT                   /gene="rrfA"
FT                   /locus_tag="BA_5743"
FT   rRNA            14203..14318
FT                   /gene="rrfA"
FT                   /locus_tag="BA_5743"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(14353..15352)
FT                   /pseudo
FT                   /locus_tag="BA_0007"
FT                   /old_locus_tag="BA0007"
FT                   /note="conserved hypothetical protein, authentic
FT                   frameshift; an automated process has identified a potential
FT                   problem with this gene model; it may contain one or more
FT                   premature stops and/or frameshifts"
FT   gene            15468..16931
FT                   /gene="guaB"
FT                   /locus_tag="BA_0008"
FT                   /old_locus_tag="BA0008"
FT   CDS_pept        15468..16931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="BA_0008"
FT                   /old_locus_tag="BA0008"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="identified by match to protein family HMM PF00478;
FT                   match to protein family HMM PF00571; match to protein
FT                   family HMM TIGR01302"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24065"
FT                   /db_xref="GOA:A0A3P1TI55"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TI55"
FT                   /protein_id="AAP24065.1"
FT                   /translation="MWESKFVKEGLTFDDVLLVPAKSDVLPREVSVKTVLSESLQLNIP
FT                   LISAGMDTVTEADMAIAMARQGGLGIIHKNMSIEQQAEQVDKVKRSESGVISDPFFLTP
FT                   EHQVYDAEHLMGKYRISGVPVVNNLDERKLVGIITNRDMRFIQDYSIKISDVMTKEQLI
FT                   TAPVGTTLSEAEKILQKYKIEKLPLVDNNGVLQGLITIKDIEKVIEFPNSAKDKQGRLL
FT                   VGAAVGVTADAMTRIDALVKASVDAIVLDTAHGHSQGVIDKVKEVRAKYPSLNIIAGNV
FT                   ATAEATKALIEAGANVVKVGIGPGSICTTRVVAGVGVPQLTAVYDCATEARKHGIPVIA
FT                   DGGIKYSGDMVKALAAGAHVVMLGSMFAGVAESPGETEIYQGRQFKVYRGMGSVGAMEK
FT                   GSKDRYFQEGNKKLVPEGIEGRVPYKGPLADTVHQLVGGLRAGMGYCGAQDLEFLRENA
FT                   QFIRMSGAGLLESHPHHVQITKEAPNYSL"
FT   gene            17045..18352
FT                   /gene="dacA"
FT                   /locus_tag="BA_0009"
FT                   /old_locus_tag="BA0009"
FT   CDS_pept        17045..18352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacA"
FT                   /locus_tag="BA_0009"
FT                   /old_locus_tag="BA0009"
FT                   /product="serine-type D-Ala-D-Ala carboxypeptidase DacA"
FT                   /EC_number="3.4.16.4"
FT                   /note="identified by similarity to EGAD:12442; match to
FT                   protein family HMM PF00768; match to protein family HMM
FT                   PF07943"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24066"
FT                   /db_xref="GOA:A0A2P0H8N0"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H8N0"
FT                   /protein_id="AAP24066.1"
FT                   /translation="MFCKRFIALVTMLTLVCSMLLPYSNASAETGSALNIEAGAAILVE
FT                   ANSGKILYQKNADELLSIASMTKMMSEYLVHEAVDKGKFKWDQKIKVSEYAYKVSQDAS
FT                   LSNVALENGGSYTVKELYEAMAIFSANGATIALAEAIAGKEVDFVKMMNDKSKELGLKN
FT                   YKFVNSTGLTNKDLKGMHPEGTTADEENKMSAKDVATLAQHLIKDYPKVLDTAKIPKKE
FT                   FRPEKEKFAMSNWNWMLKGLVKEYDGVDGLKTGSTPEAGDCFTGTVERNGMRFISVVIK
FT                   TSSHTARFDETKKLYDYGFANFEMKQMYKKGSSVKGQETVRVENAKDKDVAVQTKQAIS
FT                   LPVPKGSKEVYKTELKESSKGQEAPIKKGAALGQMVITPKDTNDPGFLTGKSLQVDLVT
FT                   TSEVEEANWFTRAMRGIGSFFSGIWNSAVDTVKGWF"
FT   gene            18514..19401
FT                   /locus_tag="BA_0010"
FT                   /old_locus_tag="BA0010"
FT   CDS_pept        18514..19401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0010"
FT                   /old_locus_tag="BA0010"
FT                   /product="pyridoxal 5'-phosphate synthase, synthase subunit
FT                   Pdx1"
FT                   /note="identified by match to protein family HMM PF01680;
FT                   match to protein family HMM TIGR00343"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24067"
FT                   /db_xref="GOA:Q81W27"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81W27"
FT                   /protein_id="AAP24067.1"
FT                   /translation="MTNVTGTERVKRGMAEMQKGGVIMDVINAEQAKIAEEAGAVAIMA
FT                   LERVPADIRAAGGVSRMADPTIVEEVMGAVSIPVMAKCRIGHLVEARVLESLGVDYIDE
FT                   SEVLTPADEVYHLNKRDYTVPFVCGCRDIGEAARRIAEGASMLRTKGEPGTGNIVEAVR
FT                   HMRQVNAEIRQVASLREDELMTYAKNTGAPYEVLLEIKRLGRLPVVNFAAGGVATPADA
FT                   ALMMQLGADGVFVGSGIFKSENPAKFARAIVEATTHYEDYELIASLSKGLGNAMKGIEI
FT                   STLLPEQRMQERGW"
FT   gene            19420..20010
FT                   /gene="pdxT"
FT                   /locus_tag="BA_0011"
FT                   /old_locus_tag="BA0011"
FT   CDS_pept        19420..20010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxT"
FT                   /locus_tag="BA_0011"
FT                   /old_locus_tag="BA0011"
FT                   /product="pyridoxal 5'-phosphate synthase, glutaminase
FT                   subunit Pdx2"
FT                   /EC_number="2.6.-.-"
FT                   /note="identified by similarity to SP:P37528; match to
FT                   protein family HMM PF01174; match to protein family HMM
FT                   PF07685; match to protein family HMM TIGR03800"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24068"
FT                   /db_xref="GOA:Q81W26"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81W26"
FT                   /protein_id="AAP24068.1"
FT                   /translation="MVKIGVLGLQGAVREHVKSVEASGAEAVVVKRIEQLEEIDGLILP
FT                   GGESTTMRRLIDKYDFMEPLRTFAKSGKPMFGTCAGMILLAKTLIGYDEAHIGAMDITV
FT                   ERNAFGRQKDSFEAALSIKGVGEDFVGVFIRAPYVVDVADDVEVLSTHGDRMVAVKQGP
FT                   FLAASFHPELTDDHRVTAYFVEMVKEAKMKKVV"
FT   gene            20338..21612
FT                   /gene="serS"
FT                   /locus_tag="BA_0012"
FT                   /old_locus_tag="BA0012"
FT   CDS_pept        20338..21612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="BA_0012"
FT                   /old_locus_tag="BA0012"
FT                   /product="serine--tRNA ligase"
FT                   /EC_number="6.1.1.11"
FT                   /note="identified by similarity to SP:P37464; match to
FT                   protein family HMM PF00587; match to protein family HMM
FT                   PF02403; match to protein family HMM TIGR00414"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24069"
FT                   /db_xref="GOA:Q81W25"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81W25"
FT                   /protein_id="AAP24069.1"
FT                   /translation="MLDIKFLRTNFEEVKAKLQHRGEDLTDFGRFEELDTRRRELLVQT
FT                   EELKSKRNEVSQQISVLKREKKDAEALILEMREVGEKVKDLDNELRTVEEDLERLMLSI
FT                   PNIPHESAPVGETEDDNVVARTWGEVKEFAFEPKPHWDLATDLGILDFERAGKVTGSRF
FT                   VFYKGAGARLERALISFMLDLHTDEHGYEEVLPPYMVNRASMTGTGQLPKFEEDAFRIE
FT                   SEDYFLIPTAEVPVTNMHRDEILNKEQLPIRYAAFSSCFRSEAGSAGRDTRGLIRQHQF
FT                   NKVELVKFVKPEDSYEELEKLTNDAERVLQLLELPYRVMSMCTGDLGFTAAKKYDIEVW
FT                   IPSYGTYREISSCSNFEAFQARRANIRFRREPNGKPEHVHTLNGSGLAIGRTVAAILEN
FT                   YQQEDGTIIIPEVLRPYMGGKTVIK"
FT   gene            21769..21861
FT                   /locus_tag="BA_5744"
FT   tRNA            21769..21861
FT                   /locus_tag="BA_5744"
FT                   /product="tRNA-Ser"
FT   gene            21869..22420
FT                   /locus_tag="BA_0013"
FT                   /old_locus_tag="BA0013"
FT   CDS_pept        21869..22420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0013"
FT                   /old_locus_tag="BA0013"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24070"
FT                   /db_xref="GOA:A0A384KA52"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR024256"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KA52"
FT                   /protein_id="AAP24070.1"
FT                   /translation="MTTAHISGDWRTRYQHVTSFYFKTNHKVWCKDIMSLLHTHIPMII
FT                   FIDMKGVNMDLIIQTFPLDGKTLYYVQCPVCKNNRILNSGANVSRIISDDTFRKLCGCT
FT                   CDVKQTATKVEAPKKVKKEAVKKEAAPKRTGKVLTAVINGKEMTVKEIAEAYDISTSTV
FT                   RQRINAGKSESEIIAPTKKK"
FT   gene            complement(22456..23124)
FT                   /locus_tag="BA_0014"
FT                   /old_locus_tag="BA0014"
FT   CDS_pept        complement(22456..23124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0014"
FT                   /old_locus_tag="BA0014"
FT                   /product="deoxynucleoside kinase family protein"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by match to protein family HMM PF01712"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24071"
FT                   /db_xref="GOA:A0A347ZXJ5"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZXJ5"
FT                   /protein_id="AAP24071.1"
FT                   /translation="MNLRQKYDIPNDAVITIAGTVGVGKSTMTTALANALGYRTSFEKV
FT                   DSNPYLDKFYADFTRWSFHLQVYFLAERFKEQKRIFEYGGGFVQDRSIYEDTGIFAKMH
FT                   HEKGTMTETDYETYKGLFDAMVMTPYFPHPDLLIYLEGSFDDIVDRIQERGRPMEQQTP
FT                   IEYWKEMHGRYENWINNFNSCPVLRLNINEYDILKDGDSIEPIIKKIGHFLKQTRKLVK
FT                   "
FT   gene            complement(23127..23762)
FT                   /locus_tag="BA_0015"
FT                   /old_locus_tag="BA0015"
FT   CDS_pept        complement(23127..23762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0015"
FT                   /old_locus_tag="BA0015"
FT                   /product="deoxynucleoside kinase family protein"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by match to protein family HMM PF01712"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24072"
FT                   /db_xref="GOA:A0A347ZXJ6"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZXJ6"
FT                   /protein_id="AAP24072.1"
FT                   /translation="MTGVPFITVEGPIGVGKTSLAKEISTHMQLHLLKEIVDENPFLGK
FT                   FYEDIDEWSFQTEMFFLCNRYKQLEDINIKYLNQRKPVVADYHIFKNVIFASRTLKDSQ
FT                   YDKYMQIYRILTQDMPVPNVIVYLTASLETLQRRIAMRGREFEKNMDPNYLLQLTKDYE
FT                   TAMDAFKKDHPDIPVLKFNGDDMDFVKNPDDLNVILSALQNTLLKESK"
FT   gene            complement(23888..24427)
FT                   /locus_tag="BA_0016"
FT                   /old_locus_tag="BA0016"
FT   CDS_pept        complement(23888..24427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0016"
FT                   /old_locus_tag="BA0016"
FT                   /product="isochorismatase family protein"
FT                   /note="identified by match to protein family HMM PF00857"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24073"
FT                   /db_xref="GOA:A0A347ZXJ7"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZXJ7"
FT                   /protein_id="AAP24073.1"
FT                   /translation="MKNTALLIIDMINDFQFSHGPILAKKCEMITNPILQLKKTMKSFG
FT                   YPIIYINDHYQLWRSDIDQLITHCTNEYSENIIHKIAPSSDDYIFIKPHYSAFYETPLN
FT                   SLLGYLKIENLILTGVAGNICILFTANDAHMRNYTLYVPQDCIASNHDQDNLHALKIME
FT                   TTLKANIVPSSQIKFN"
FT   gene            24405..24545
FT                   /locus_tag="BA_0017"
FT                   /old_locus_tag="BA0017"
FT   CDS_pept        24405..24545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0017"
FT                   /old_locus_tag="BA0017"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24074"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0PQM8"
FT                   /protein_id="AAP24074.1"
FT                   /translation="MSKAVFFICNPLSFFLGWIEFVKVIPCVVNGNKCTLFVMKGLCYG
FT                   T"
FT   gene            24535..25035
FT                   /locus_tag="BA_0018"
FT                   /old_locus_tag="BA0018"
FT   CDS_pept        24535..25035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0018"
FT                   /old_locus_tag="BA0018"
FT                   /product="cytidine/deoxycytidylate deaminase zinc-binding
FT                   domain protein"
FT                   /note="identified by match to protein family HMM PF00383"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24075"
FT                   /db_xref="GOA:A0A347ZXJ8"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZXJ8"
FT                   /protein_id="AAP24075.1"
FT                   /translation="MERDQDIYFMQLAIEEAKKAEAIQEVPIGAVIVLNGEVISAAHNL
FT                   RETEQRSIAHAELLAIDEACKKLGTWRLEDATLYVTLEPCPMCAGGIVLSRVKRVVYGA
FT                   GDPKGGCAGTLMNLLTDERFNHQCEVVAGVLEEECGTLLTNFFRELRKKRKAIKKLEKS
FT                   NEN"
FT   gene            25512..27200
FT                   /gene="dnaX"
FT                   /locus_tag="BA_0019"
FT                   /old_locus_tag="BA0019"
FT   CDS_pept        25512..27200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="BA_0019"
FT                   /old_locus_tag="BA0019"
FT                   /product="DNA polymerase III, gamma and tau subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM TIGR02397"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24076"
FT                   /db_xref="GOA:A0A347ZXJ9"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZXJ9"
FT                   /protein_id="AAP24076.1"
FT                   /translation="MSYQALYRTWRPQKFEDVVGQKHVTKTLQNALLQEKVSHAYLFSG
FT                   PRGTGKTTIAKVFAKAINCEHAPVAEPCNECPSCLGITQGSISDVLEIDAASNNGVDEI
FT                   RDIRDKVKYAPSAVEYKVYIIDEVHMLSMGAFNALLKTLEEPPGHVIFILATTEPHKIP
FT                   PTIISRCQRFEFRKISVNDIVERLSTVVTNEGTQVEDEALQIVARAAEGGMRDALSLID
FT                   QAISYSDERVTTEDVLAVTGSVSQQYLGNLVECIRENDVSRALRIIDEMMGKGKDPVRF
FT                   MEDFIYYYRDMLLYQTSPQLEHMLERVMVDEQFRMLSEEMQPEVIYEIIHTLSKGQQEM
FT                   KWTNHPRIFLEVVMVQLCQQFMMQANGADRLQAIMNRMQQLEKELEQVKKNGVPVGVQQ
FT                   EVKETRAAPKPVRTGSMKIPVGRVNEVLKQAKRQDLEQLKAVWGELLGRLKAYNKVAFA
FT                   VLLENSEPVAASDDTYVLAFQYEIHCKMASENREAMDTVEQALFELLSKKLNMIAIPKS
FT                   EWGKIREDFLKREGGSSEESPEKKEDPLIEEAIKLVGQELIEIKE"
FT   gene            27223..27552
FT                   /locus_tag="BA_0020"
FT                   /old_locus_tag="BA0020"
FT   CDS_pept        27223..27552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0020"
FT                   /old_locus_tag="BA0020"
FT                   /product="DNA-binding protein, YbaB/EbfC family"
FT                   /note="identified by similarity to EGAD:19844; match to
FT                   protein family HMM PF02575; match to protein family HMM
FT                   TIGR00103"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24077"
FT                   /db_xref="GOA:Q81W17"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81W17"
FT                   /protein_id="AAP24077.1"
FT                   /translation="MMRGGMGNMNNMMKQMQKMQKEMAKAQEELGEKTVEGTAGGGMIT
FT                   VIANGHKQILEVKVKEEVVDPEDIEMLQDLVLAATNDALKKADELSNSTMGKFTKGLNL
FT                   PGGMF"
FT   gene            27567..28163
FT                   /gene="recR"
FT                   /locus_tag="BA_0021"
FT                   /old_locus_tag="BA0021"
FT   CDS_pept        27567..28163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="BA_0021"
FT                   /old_locus_tag="BA0021"
FT                   /product="recombination protein RecR"
FT                   /note="identified by match to protein family HMM PF01751;
FT                   match to protein family HMM PF02132; match to protein
FT                   family HMM TIGR00615"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24078"
FT                   /db_xref="GOA:Q81W16"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81W16"
FT                   /protein_id="AAP24078.1"
FT                   /translation="MHYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLDMKEDDVLGFAK
FT                   ALVNAKRDLAYCSVCGHITDRDPCYICNDSHRDQSVVCVVQEPKDVIAMEKMKEYQGVY
FT                   HVLRGAISPMGGIGPEDINIPQLLKRLHDETVQEVILATNPNIEGEATAMYISRLLKPT
FT                   GIKVTRIAHGLPVGGDLEYADEVTLSKALEGRREV"
FT   gene            28178..28399
FT                   /locus_tag="BA_0022"
FT                   /old_locus_tag="BA0022"
FT   CDS_pept        28178..28399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0022"
FT                   /old_locus_tag="BA0022"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:14978"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24079"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H8N6"
FT                   /protein_id="AAP24079.1"
FT                   /translation="MFFQKKGKLRKEYDDNLIVLLEKVKNEWLRQKRMVEQSVEPSQDV
FT                   LCSLKIAEAKYFFLLKEAKRRPVKMEQW"
FT   gene            28614..28883
FT                   /gene="bofA"
FT                   /locus_tag="BA_0024"
FT                   /old_locus_tag="BA0024"
FT   CDS_pept        28614..28883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bofA"
FT                   /locus_tag="BA_0024"
FT                   /old_locus_tag="BA0024"
FT                   /product="sigma-k factor processing regulatory protein
FT                   BofA"
FT                   /note="identified by similarity to SP:P24282; match to
FT                   protein family HMM PF07441; match to protein family HMM
FT                   TIGR02862"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24080"
FT                   /db_xref="GOA:A0A2A8L1E7"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A8L1E7"
FT                   /protein_id="AAP24080.1"
FT                   /translation="MNSTIIIVGILALVFIFLVFGVSSKPLRFIGKALFHVTLGVALLF
FT                   IVNVVGTYFDFHIPINLGTATITSLLGLPGVAALVVIKLYIMPR"
FT   gene            29129..30635
FT                   /gene="rrsB"
FT                   /locus_tag="BA_5745"
FT   rRNA            29129..30635
FT                   /gene="rrsB"
FT                   /locus_tag="BA_5745"
FT                   /product="16S ribosomal RNA"
FT   gene            30786..30862
FT                   /locus_tag="BA_5746"
FT   tRNA            30786..30862
FT                   /locus_tag="BA_5746"
FT                   /product="tRNA-Ile"
FT   gene            30871..30946
FT                   /locus_tag="BA_5747"
FT   tRNA            30871..30946
FT                   /locus_tag="BA_5747"
FT                   /product="tRNA-Ala"
FT   gene            31041..33948
FT                   /gene="rrlB"
FT                   /locus_tag="BA_5748"
FT   rRNA            31041..33948
FT                   /gene="rrlB"
FT                   /locus_tag="BA_5748"
FT                   /product="23S ribosomal RNA"
FT   gene            33997..34112
FT                   /gene="rrfB"
FT                   /locus_tag="BA_5749"
FT   rRNA            33997..34112
FT                   /gene="rrfB"
FT                   /locus_tag="BA_5749"
FT                   /product="5S ribosomal RNA"
FT   gene            34303..34482
FT                   /locus_tag="BA_0025"
FT                   /old_locus_tag="BA0025"
FT   CDS_pept        34303..34482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0025"
FT                   /old_locus_tag="BA0025"
FT                   /product="putative csfB protein"
FT                   /note="identified by similarity to EGAD:13971"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24081"
FT                   /db_xref="GOA:A0A1J9VVX9"
FT                   /db_xref="InterPro:IPR019700"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9VVX9"
FT                   /protein_id="AAP24081.1"
FT                   /translation="MKSQNEVCIVCETERKEGIYVYNNLICYECEKDMVNTETDDPKYI
FT                   YYLKQLRKLEVSYF"
FT   gene            34554..35975
FT                   /locus_tag="BA_0026"
FT                   /old_locus_tag="BA0026"
FT   CDS_pept        34554..35975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0026"
FT                   /old_locus_tag="BA0026"
FT                   /product="Orn/Lys/Arg decarboxylase family protein"
FT                   /note="identified by similarity to SP:P21885; match to
FT                   protein family HMM PF01276; match to protein family HMM
FT                   PF03711"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24082"
FT                   /db_xref="GOA:A0A347ZXK5"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZXK5"
FT                   /protein_id="AAP24082.1"
FT                   /translation="MNQNRIPLYEALIEFKERRRLSFHVPGHKNGLNFPQEVVEEFKDI
FT                   LSIDVTELSGLDDLHSPFECIDEAQQLLADVYGVNKSYFLINGSTVGNLAMILSCCGEH
FT                   DIVLVQRNCHKSIINGLKLAGANPIFLDPWIDEAYNVPVGIHDEIIKEAIEKYPNAKAL
FT                   ILTHPNYYGMGMDLEASIAYAHTHKIPVLVDEAHGAHFCLGGAFPQSALAYGADMVVHS
FT                   AHKTLPAMTMGSYLHINSRLVKEEKVSTYLSMLQSSSPSYPIMASLDIARFTIARIKEK
FT                   GHDEIVEFLQEFKEELSTIPQIAILQYPLQDGLKITVQTRCRLSGYELQSVFEKVGIYT
FT                   EMADPYNVLFILPLQVNKKYMKAIEMIRVALQYYEVKDKTESIRYTYKGEISPLPYTYK
FT                   QLEEYETKVVPIEEAVGMVAAEMVIPYPPGIPLIMYGERITSGHKEQIMYLEKAGARFQ
FT                   GSRKYMKVYDIESRF"
FT   gene            35977..36603
FT                   /gene="tmk"
FT                   /locus_tag="BA_0027"
FT                   /old_locus_tag="BA0027"
FT   CDS_pept        35977..36603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="BA_0027"
FT                   /old_locus_tag="BA0027"
FT                   /product="dTMP kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="identified by match to protein family HMM PF02223;
FT                   match to protein family HMM TIGR00041"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24083"
FT                   /db_xref="GOA:Q81W11"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81W11"
FT                   /protein_id="AAP24083.1"
FT                   /translation="MKGLFVTIEGPEGSGKTTLIQSLLPYFEQKEQKVMATREPGGIAI
FT                   SEDIRTILHKQEYTMMEARTEALLYAAARRQHLVEKVMPALNEDYLVLCDRFIDSSLAY
FT                   QGYARGLGMDKVFEINRFATEDCMPSLTIYLDIEPEVGLARIAKDAGREVNRLDMEDIS
FT                   FHKRVREGYLQVVERFSDRIVLVNADQPMEKLIEEVIQVIEDKLL"
FT   gene            36639..37622
FT                   /gene="holB"
FT                   /locus_tag="BA_0028"
FT                   /old_locus_tag="BA0028"
FT   CDS_pept        36639..37622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="BA_0028"
FT                   /old_locus_tag="BA0028"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by similarity to EGAD:13071; match to
FT                   protein family HMM TIGR00678"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24084"
FT                   /db_xref="GOA:A0A384L7G9"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L7G9"
FT                   /protein_id="AAP24084.1"
FT                   /translation="MTKTWEQLSAIQPIGVKMLMNSIAKERISHAYLLEGEKGTGKFAT
FT                   AIQMAKSFLCSQRNRVEPCHVCTNCKRIDSGNHPNLHIVKPDGLSIKKQQIHDLQEEFS
FT                   KTGLEANKKVYIIEHADRMTANAANALLKFLEEPSSDTTAILLTEQSHQILNTILSRCQ
FT                   VVTFRPLPTESLIRRLQDEGITVSLSTLAAQLTNSFDEALTLCNDEWFAQARALVIKLC
FT                   EALEKDKASIFFVQEKWGKHFGEKEQLQQGLDMLLLIYKDLLYVQLGEEDRLVFREQKE
FT                   MFESFSYAQKRIVSALFNILEAKNRINANVNAQLVFEQLVLRLQEG"
FT   gene            37619..38455
FT                   /locus_tag="BA_0029"
FT                   /old_locus_tag="BA0029"
FT   CDS_pept        37619..38455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0029"
FT                   /old_locus_tag="BA0029"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01BS00032; match
FT                   to protein family HMM PF04468"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24085"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0PQI1"
FT                   /protein_id="AAP24085.1"
FT                   /translation="MTVLYDVVGVRFKKAGKVYYFDPNQFDISENEFVIVETVRGIEYG
FT                   KVVITKKQVDENDVVLPLKKVIRIANENDRTIVEENKHAAKEAYQVCQQKVVEHNLDMK
FT                   LVDVEYTFDRNKIIFYFTADGRIDFRELVKDLAAIFRTRIELRQIGVRDEAKMLGGIGP
FT                   CGRMLCCSTFLGDFEPVSIKMAKDQNLSLNPAKISGLCGRLMCCLKYENDEYEAAKEQL
FT                   PDLDQRIQTPHGTGRVIGLNILERLIQVELVDKERIVEYTLDELVNKGVVSSQTTD"
FT   gene            38470..38820
FT                   /locus_tag="BA_0030"
FT                   /old_locus_tag="BA0030"
FT   CDS_pept        38470..38820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0030"
FT                   /old_locus_tag="BA0030"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:12219; match to
FT                   protein family HMM PF06156"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24086"
FT                   /db_xref="GOA:Q6I511"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6I511"
FT                   /protein_id="AAP24086.1"
FT                   /translation="MEKKDIFASVSSMEEQIGHLYKQLGELKQHLAELLEENQHIKMEN
FT                   ENLRHRFEEVQIKEKQKTQKRKEVKPKTDIGEGYDNLARLYQEGFHICNLHYGSVRKEG
FT                   DCLFCLSFLNKK"
FT   gene            38941..39681
FT                   /locus_tag="BA_0031"
FT                   /old_locus_tag="BA0031"
FT   CDS_pept        38941..39681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0031"
FT                   /old_locus_tag="BA0031"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:23049"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24087"
FT                   /db_xref="GOA:A0A347ZXL0"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZXL0"
FT                   /protein_id="AAP24087.1"
FT                   /translation="MNLYEDERLDYLLAQDMKIIQSPSVFNFSLDAVLLADFAWVPIQK
FT                   GNLLDLCTGNAVVPLLLSTRTKGNITGVEIQERLYDMGIRSVQYNKLEERIHLIHGDLK
FT                   DMPEKLGRHQYDVVTCNPPYFQTPVTSEKNMNEHLAIARHEIMCTLEDVVSASSQLVKQ
FT                   GGKVAFVHRPGRLLDIVTLMRKYKIEPKRVRFVYPKAGKEANTLLIEGIKDGNADLKIL
FT                   PPLFVYEENNEYTKEIRSILYGEE"
FT   gene            39668..39958
FT                   /locus_tag="BA_0032"
FT                   /old_locus_tag="BA0032"
FT   CDS_pept        39668..39958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0032"
FT                   /old_locus_tag="BA0032"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:108187; match to
FT                   protein family HMM PF01541"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24088"
FT                   /db_xref="GOA:Q81W06"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81W06"
FT                   /protein_id="AAP24088.1"
FT                   /translation="MEKNKHCFYVVECSDGSYYAGYTNHIEKRIGTHNSGRGAKYTRAR
FT                   LPVVLKYVEFHEDKRTAMQAEYYFKQLNRKQKEEYMQKGERYVATKKLSTK"
FT   gene            39927..40802
FT                   /locus_tag="BA_0033"
FT                   /old_locus_tag="BA0033"
FT   CDS_pept        39927..40802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0033"
FT                   /old_locus_tag="BA0033"
FT                   /product="tetrapyrrole methylase family protein"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by similarity to OMNI:NTL01BH0050; match
FT                   to protein family HMM PF00590; match to protein family HMM
FT                   TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24089"
FT                   /db_xref="GOA:A0A347ZXL2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZXL2"
FT                   /protein_id="AAP24089.1"
FT                   /translation="MWQQKSFQQNEKGVLYLVPTPIGNLEDMTFRAIRILKEADLIAAE
FT                   DTRQTKKLCNYFEIETPVMSYHEHNKEVSGKKILEKLDEGKTVALVSDAGMPCISDPGY
FT                   DIVVEAVAEQYHVIPLPGANAALTALIASGLQTKQFYFYGFLQRNKKERKMELEKLRYV
FT                   QTTMMFYEAPHRLDDTLISMQEVLGNREIVLCRELTKKFEEFIRGTVEEAIEWTKQNEV
FT                   RGEFCILVAGSTEEPAPEEQWWESISVYNHIEHYINEKGMNSKEAIKTVAKDRDLSKRD
FT                   VYQIYHVDKK"
FT   gene            complement(40823..41107)
FT                   /gene="abrB"
FT                   /locus_tag="BA_0034"
FT                   /old_locus_tag="BA0034"
FT   CDS_pept        complement(40823..41107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abrB"
FT                   /locus_tag="BA_0034"
FT                   /old_locus_tag="BA0034"
FT                   /product="transition state transcriptional regulatory
FT                   protein AbrB"
FT                   /note="identified by similarity to EGAD:14837; match to
FT                   protein family HMM PF04014; match to protein family HMM
FT                   TIGR01439"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24090"
FT                   /db_xref="GOA:A0A3P1TLC2"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR040678"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TLC2"
FT                   /protein_id="AAP24090.1"
FT                   /translation="MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIIL
FT                   KKYKPNMTCQVTGEVSDGNLFLAEGKIILSKEGAEQILNELQDYIETAK"
FT   gene            41598..43580
FT                   /gene="metS"
FT                   /locus_tag="BA_0036"
FT                   /old_locus_tag="BA0036"
FT   CDS_pept        41598..43580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metS"
FT                   /locus_tag="BA_0036"
FT                   /old_locus_tag="BA0036"
FT                   /product="methionine--tRNA ligase"
FT                   /EC_number="6.1.1.10"
FT                   /note="identified by similarity to SP:P37465; match to
FT                   protein family HMM PF00133; match to protein family HMM
FT                   PF01588; match to protein family HMM PF09334; match to
FT                   protein family HMM TIGR00398; match to protein family HMM
FT                   TIGR00399"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24091"
FT                   /db_xref="GOA:Q81W03"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81W03"
FT                   /protein_id="AAP24091.1"
FT                   /translation="MTEENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKCMQGYN
FT                   VHYLTGTDEHGQKIQKKAEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHK
FT                   DVVEKIFKQLVDQGDIYLDEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHD
FT                   VELVREESYFFRMGKYVDRLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSF
FT                   DWGVRVPGNPKHVIYVWVDALSNYITALGYGTENEEMYKKFWPADVHLVGKEIVRFHTI
FT                   YWPIILMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPVILIDRYGLDALRYYLLRE
FT                   VPFGSDGVFTPEGFVERINFDLANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETL
FT                   VTFAKDTLKKVEEAMENMEFSVALSSIWQLVSRTNKYIDETQPWVLAKDEDDREKLASV
FT                   MAHLAEVLRQTGIMLMPFLTVAPSKMFAQLGLTDEAHTSWGSLSTIGCIPAGTKVEKGQ
FT                   PIFPRLEMDVEVAYIKEQMKASAPKVEEKKEEEPKAEEITIDDFFKVELRVAEVLSAEP
FT                   VKKADKLLKIQLDLGTEKRQVVSGIAKFYSPEDLKGKKVICVTNLKPVKLRGELSQGMI
FT                   LAGEENGVLSLASIDQNIPNGTKIK"
FT   gene            43746..44513
FT                   /locus_tag="BA_0037"
FT                   /old_locus_tag="BA0037"
FT   CDS_pept        43746..44513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0037"
FT                   /old_locus_tag="BA0037"
FT                   /product="deoxyribonuclease, TatD family"
FT                   /note="identified by match to protein family HMM PF01026;
FT                   match to protein family HMM TIGR00010"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24092"
FT                   /db_xref="GOA:A0A347ZXL5"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZXL5"
FT                   /protein_id="AAP24092.1"
FT                   /translation="MLFDTHSHLNAEQFEEDLQEVIARMKEAGVTYTVVVGFDEATIKK
FT                   AIELAEAYDFIYAAVGWHPVDAIDMTEEHLAWLEELASHPKVVALGEMGLDYHWDKSPK
FT                   EIQKEVFRKQITLAKKVKLPIIIHNRDATQDIVDILEEENAAEVGGIMHCFSGSVEVAE
FT                   RCVDMNFLISLGGPVTFKNAKKPKEVATEIPLEKLLIETDCPYLTPHPFRGKRNEPSYV
FT                   KLVAEEIANLKGISYEEVAEITTKNAKALFGVE"
FT   gene            44728..45285
FT                   /gene="rnmV"
FT                   /locus_tag="BA_0038"
FT                   /old_locus_tag="BA0038"
FT   CDS_pept        44728..45285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnmV"
FT                   /locus_tag="BA_0038"
FT                   /old_locus_tag="BA0038"
FT                   /product="ribonuclease M5"
FT                   /EC_number="3.1.26.8"
FT                   /note="identified by match to protein family HMM PF01751;
FT                   match to protein family HMM TIGR00334"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24093"
FT                   /db_xref="GOA:Q81W01"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81W01"
FT                   /protein_id="AAP24093.1"
FT                   /translation="MKIKEIIVVEGKDDTVAIKRAVDADTIETNGSAIGDHVIEQVKLA
FT                   LQKRGVIIFTDPDYPGERIRKIISDKVPGCKHAFLPKEEALAKRKKGVGIEHASNESIR
FT                   RALENIHEEMEAYTSEISWSDLVDAGLVGGEMAKSRRERMGKLLKIGYTNAKQLHKRLQ
FT                   MFQVSKESFAEAYKQVIQEERK"
FT   gene            45282..46160
FT                   /gene="ksgA"
FT                   /locus_tag="BA_0039"
FT                   /old_locus_tag="BA0039"
FT   CDS_pept        45282..46160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="BA_0039"
FT                   /old_locus_tag="BA0039"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by similarity to EGAD:18456; match to
FT                   protein family HMM PF00398; match to protein family HMM
FT                   TIGR00755"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24094"
FT                   /db_xref="GOA:Q81W00"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81W00"
FT                   /protein_id="AAP24094.1"
FT                   /translation="MKDIATPNRTKDIVEKYGFSFKKSLGQNFLIDTNVLNRIVDHAEI
FT                   GSESGAIEIGPGIGALTEQLAKRAKKVVAFEIDQRLLPILDETLAPYGNVTVINKDVLK
FT                   ADVHEVFSEQFEEGQDVMVVANLPYYITTPILFKLLEEKLPVRGFVVMMQKEVGDRLAA
FT                   KPGTKEYGSLSIAIQYYTEVETVMTVPRTVFVPQPNVDSAIIRLLKRPKPVVEVTDETF
FT                   FFEVVRASFAQRRKTLMNNLSNNLNGFPKDKELLDRILTEVGIDPKRRGETLSIEEFAT
FT                   LSNALVLHKLS"
FT   gene            46271..47134
FT                   /locus_tag="BA_0040"
FT                   /old_locus_tag="BA0040"
FT   CDS_pept        46271..47134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0040"
FT                   /old_locus_tag="BA0040"
FT                   /product="yabG protein"
FT                   /note="identified by similarity to EGAD:24564; match to
FT                   protein family HMM PF05582; match to protein family HMM
FT                   TIGR02855"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24095"
FT                   /db_xref="GOA:A0A347ZXL8"
FT                   /db_xref="InterPro:IPR008764"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZXL8"
FT                   /protein_id="AAP24095.1"
FT                   /translation="MALHVGELVERYSHNRDILFRIIEIKGEIAILFGEEIRLVADAPL
FT                   EDLISIDQREHKKRAKREKETMERTYRLFQQDYVLMKQRHEHTSTGGYTSEVNYFQMPG
FT                   RVLHIDGDPLYLRKCLDLYNKIGVPVQGIHCKETEMHEKVVDLIDHFRPDILVITGHDA
FT                   YTKSKGVKGDLAAYRHSRHFVQAVREVRKKYPSLDQLVIFAGACQSHFEALIRAGANFA
FT                   SSPSRINIHALDPVYVVGKISFTSFMERVNVWDVVRNTITGEKGLGGIETRGILRTGLP
FT                   FQHYEE"
FT   gene            47373..47633
FT                   /locus_tag="BA_0041"
FT                   /old_locus_tag="BA0041"
FT   CDS_pept        47373..47633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0041"
FT                   /old_locus_tag="BA0041"
FT                   /product="veg protein"
FT                   /note="identified by similarity to EGAD:13222; match to
FT                   protein family HMM PF06257"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24096"
FT                   /db_xref="GOA:A0A3P1TLA6"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TLA6"
FT                   /protein_id="AAP24096.1"
FT                   /translation="MSKRLDEIKSELDHHLGQRLMLKANSGRRKTVEQSGVLAETYRSV
FT                   FVVQLDQQEDALQRVSYSYADVLTETVELTFYGEPHNEVIL"
FT   gene            47725..47904
FT                   /gene="sspF"
FT                   /locus_tag="BA_0042"
FT                   /old_locus_tag="BA0042"
FT   CDS_pept        47725..47904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspF"
FT                   /locus_tag="BA_0042"
FT                   /old_locus_tag="BA0042"
FT                   /product="small, acid-soluble spore protein"
FT                   /note="identified by similarity to EGAD:12298"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24097"
FT                   /db_xref="GOA:A0A3Q0PQS1"
FT                   /db_xref="InterPro:IPR001448"
FT                   /db_xref="InterPro:IPR018126"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0PQS1"
FT                   /protein_id="AAP24097.1"
FT                   /translation="MSRRRGVMSNQFKEELAKELGFYDVVQKEGWGGIRAKDAGNMVKR
FT                   AIEIAEQQLMKQNQ"
FT   gene            48101..48970
FT                   /gene="ispE"
FT                   /locus_tag="BA_0043"
FT                   /old_locus_tag="BA0043"
FT   CDS_pept        48101..48970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="BA_0043"
FT                   /old_locus_tag="BA0043"
FT                   /product="4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="identified by match to protein family HMM PF00288;
FT                   match to protein family HMM PF08544; match to protein
FT                   family HMM TIGR00154"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24098"
FT                   /db_xref="GOA:Q81VZ6"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VZ6"
FT                   /protein_id="AAP24098.1"
FT                   /translation="MKLLVKAPAKINLSLDVLGKRQDGYHEVKMIMTTIDLADRLELME
FT                   LAEDRIEILSHNRYVPDDQRNLAYQAAKLLKEKFNVKKGVSITIEKTIPVAAGLAGGSS
FT                   DAAATLRGLNKLWNLGLTIDQLAELGAEIGSDVSFCVYGGTAIATGRGEQIEHIKTPPS
FT                   CWVILAKPHIGVFTADVYGNLKLNRVTHPNVDKMVDVINAGDYKGICDTVGNVLEDVTF
FT                   AMHPEVARIKAQMKRFGADAVLMSGSGPTVFGLVHHDSRMHRIYNGLKGFCEQVYAVRL
FT                   LGERETLE"
FT   gene            49025..49873
FT                   /gene="purR"
FT                   /locus_tag="BA_0044"
FT                   /old_locus_tag="BA0044"
FT   CDS_pept        49025..49873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purR"
FT                   /locus_tag="BA_0044"
FT                   /old_locus_tag="BA0044"
FT                   /product="pur operon repressor"
FT                   /note="identified by similarity to SP:P37551; match to
FT                   protein family HMM PF00156; match to protein family HMM
FT                   PF09182; match to protein family HMM TIGR01743"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24099"
FT                   /db_xref="GOA:A0A0J1HL67"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1HL67"
FT                   /protein_id="AAP24099.1"
FT                   /translation="MKIRRSTRLVDMTYYLLQNPRQLVSLTFFAERYQSAKSSISEDLV
FT                   IIKQTFEQQGVGTLQTIPGAAGGVKYIPYISEEEADLIIGELCSLFENPDRILPGGYLY
FT                   MTDLLSNPRHINGAGRLFASVFARQPIDAVMTVATKGIPLAYAVANYLDVPVVIARKDN
FT                   KVTEGPTVSINYVSGSSKRIQTMTLAKRSLPEGSNVLIIDDFMKAGGTIQGMMSMLEEF
FT                   KANVVGIGVLVESTDIEERLINNFVSLIRLSEVDVKEKAIQVEKGNYSLAPFDEGIVEA
FT                   E"
FT   gene            49860..49979
FT                   /locus_tag="BA_0045"
FT                   /old_locus_tag="BA0045"
FT   CDS_pept        49860..49979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0045"
FT                   /old_locus_tag="BA0045"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24100"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1T3UU75"
FT                   /protein_id="AAP24100.1"
FT                   /translation="MRLSKKIKQIALSFFILFINYKIDGQTAFRALFLKSKNK"
FT   gene            49996..50370
FT                   /locus_tag="BA_0046"
FT                   /old_locus_tag="BA0046"
FT   CDS_pept        49996..50370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0046"
FT                   /old_locus_tag="BA0046"
FT                   /product="putative endoribonuclease L-PSP"
FT                   /note="identified by match to protein family HMM PF01042;
FT                   match to protein family HMM TIGR00004"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24101"
FT                   /db_xref="GOA:A0A347ZXM3"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZXM3"
FT                   /protein_id="AAP24101.1"
FT                   /translation="MKVVQTNNAPQAIGPYSQGIIVNNMFYSSGQIPLTASGELVAGDV
FT                   TVQTEQVFQNLQAVLEEAGASFDTVVKTTVFLKDMDDFNAVNEVYGSYFSAHKPARSCV
FT                   QVAKLPKDVSVEIEVIALVK"
FT   gene            50523..50816
FT                   /gene="spoVG"
FT                   /locus_tag="BA_0047"
FT                   /old_locus_tag="BA0047"
FT   CDS_pept        50523..50816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVG"
FT                   /locus_tag="BA_0047"
FT                   /old_locus_tag="BA0047"
FT                   /product="stage V sporulation protein G"
FT                   /note="identified by match to protein family HMM PF04026"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24102"
FT                   /db_xref="GOA:Q81VZ2"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VZ2"
FT                   /protein_id="AAP24102.1"
FT                   /translation="MEVTDVRLRRVNTEGRMRAIASITLDHEFVVHDIRVIDGNNGLFV
FT                   AMPSKRTPDGEFRDIAHPINSGTRSKIQDAVLTEYHRLGELEEVEFEEAGAS"
FT   gene            51139..52518
FT                   /gene="glmU"
FT                   /locus_tag="BA_0048"
FT                   /old_locus_tag="BA0048"
FT   CDS_pept        51139..52518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="BA_0048"
FT                   /old_locus_tag="BA0048"
FT                   /product="UDP-N-acetylglucosamine
FT                   diphosphorylase/glucosamine-1-phosphate
FT                   N-acetyltransferase"
FT                   /EC_number="2.7.7.23"
FT                   /EC_number="2.3.1.157"
FT                   /note="identified by match to protein family HMM PF00132;
FT                   match to protein family HMM PF00483; match to protein
FT                   family HMM TIGR01173"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24103"
FT                   /db_xref="GOA:Q81VZ1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VZ1"
FT                   /protein_id="AAP24103.1"
FT                   /translation="MSNRFAVILAAGKGTRMKSKLYKVLHPVCGKPMVQHVVDQVSQLG
FT                   LQKLVTVVGHGAEMVQEQLGNVSEFALQAEQLGTAHAVDQAAGVLANEEGTTLVICGDT
FT                   PLITAETMEALLQQHKEAGAMATVLTAYIEEPAGYGRIVRNENGHVEKIVEHKDANEKE
FT                   LAIKEINTGTYCFDNKALFASLSKVSNDNVQGEYYLPDVIEILKNEGHIVSAYQTEHFD
FT                   ETLGVNDRVALSQAEIIMKNRINRKNMVNGVTIIDPSNTYISADAIIGSDTVLHPGTII
FT                   EGNTVIGSDCEIGPHTVIRDSEIGDRTTIRQSTVHDSKLGTEVSVGPFAHIRPDSVIGD
FT                   EVRVGNFVEIKKTVFGNRSKASHLSYIGDAQVGEDVNLGCGSITVNYDGKNKFKTVIGN
FT                   GVFIGCNSNLVAPVTVEDGAYVAAGSTITENVPSKALSVARARQVNKEDYVDQLLNKKK
FT                   S"
FT   gene            52537..53490
FT                   /gene="prsA"
FT                   /locus_tag="BA_0049"
FT                   /old_locus_tag="BA0049"
FT   CDS_pept        52537..53490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prsA"
FT                   /locus_tag="BA_0049"
FT                   /old_locus_tag="BA0049"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="identified by similarity to SP:P14193; match to
FT                   protein family HMM PF00156; match to protein family HMM
FT                   TIGR01251"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24104"
FT                   /db_xref="GOA:Q81VZ0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VZ0"
FT                   /protein_id="AAP24104.1"
FT                   /translation="MSTQYLNSNLKVFSLNSNKELAEQIAKHIGVGLGKCSVDRFSDGE
FT                   VQINIEESIRGCDVFIIQSTSFPVNEHIMELLIMIDALKRASAKTINIVIPYYGYARQD
FT                   RKARSREPITSKLVANLLETAGATRVITLDLHAPQIQGFFDIPIDHLMGVPILSDYFET
FT                   KGLKDIVIVSPDHGGVTRARKMADRLKAPIAIIDKRRPRPNVSEVMNIIGNIEGKTAIL
FT                   IDDIIDTAGTITLAANALVENGASEVYACCTHPVLSGPAIERIQNSNIKELVVTNSIVL
FT                   PEEKKIDKVHELSVAPLIGEAIIRVYEEESVSVLFN"
FT   gene            53563..54123
FT                   /gene="spoVC"
FT                   /locus_tag="BA_0050"
FT                   /old_locus_tag="BA0050"
FT   CDS_pept        53563..54123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVC"
FT                   /locus_tag="BA_0050"
FT                   /old_locus_tag="BA0050"
FT                   /product="aminoacyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="identified by match to protein family HMM PF01195;
FT                   match to protein family HMM TIGR00447"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24105"
FT                   /db_xref="GOA:Q81VY9"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VY9"
FT                   /protein_id="AAP24105.1"
FT                   /translation="MKLIVGLGNPGREYELTRHNIGFMAIDELAKRWNISLNEQKFKGL
FT                   FGAGFVNGEKVILLKPLTYMNLSGESIRPLMDYYKIDVEDFVVLYDDLDIPVGKLRLRM
FT                   KGSAGGHNGVKSTISHLGTQEFQRIRMGIDRPKNGMKVVDYVLGRFTSEEIPDVNHSIE
FT                   KAADACEEWLNKPFLQIMNTFNS"
FT   gene            54194..54418
FT                   /locus_tag="BA_0051"
FT                   /old_locus_tag="BA0051"
FT   CDS_pept        54194..54418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0051"
FT                   /old_locus_tag="BA0051"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:13260"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24106"
FT                   /db_xref="GOA:A0A2A8YD47"
FT                   /db_xref="InterPro:IPR020115"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A8YD47"
FT                   /protein_id="AAP24106.1"
FT                   /translation="MEGYYYCRHCGSNVGSVTAEKVYSDVLFQLTEQEVVEMIHFHENG
FT                   NIYIKTICELCQETLASYPEYYEYEKFLQ"
FT   gene            54524..58054
FT                   /gene="mfd"
FT                   /locus_tag="BA_0052"
FT                   /old_locus_tag="BA0052"
FT   CDS_pept        54524..58054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="BA_0052"
FT                   /old_locus_tag="BA0052"
FT                   /product="transcription-repair coupling factor"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF02559; match to protein family HMM PF03461;
FT                   match to protein family HMM PF04851; match to protein
FT                   family HMM TIGR00580"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24107"
FT                   /db_xref="GOA:A0A3P1TLD1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TLD1"
FT                   /protein_id="AAP24107.1"
FT                   /translation="MIGLLEQFYKNEEIQSVINGLEDGLKEQLVSGMATSSRSFLMAAL
FT                   YKKTKKSQLIVTHNLYQAQKVHEDLVALLGEKDVWLYPVNELIASELGVASPELKAQRI
FT                   EVLNRLAAGEHGIIVAPVAGLRRFLPMKELWKQRQIEISLGQEIDLDTFLHTLHHIGYE
FT                   RKSMVEAPGEFSLRGGILDIYPLTEELPFRIEFFDTEVDSIRLFDVDEQRSQDKKESVR
FT                   FGPATEFLFSQEELKSGIKHLEEGLTKTMQKLSDDKLKTTVLETVSHEIEMLKNGQSIE
FT                   QMFKYLSIFYNEPASLIDYLPEDGVVILDEISRIQETASHLESEEAEWYISLLGEGTII
FT                   QDLSFSHSFEEFLHHKKRSFVYLTLFLRHIAHTHPQNIVNVTCKTMQDFHGQMQLLKTE
FT                   IDRWNEGHFTTVVLGTDDERVKKLQHILSDYDIDADIVEGTDILLPGRLQIAVGDLHAG
FT                   FEMPMQKLVVITEKELFHKKVKKSQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFL
FT                   GIETLEINGVHKDYLNIKYQGNDKLYVPIEQIDQVQKYVGSEGKDPKVYKLGGNDWKKV
FT                   KTKVEKSVQDIADDLIKLYAEREASKGYAYTPDTAEQQEFESSFPYQETEDQLRSIEEI
FT                   KKDMERGRPMDRLLCGDVGYGKTEVAIRAAFKAIMDEKQVAILVPTTILAQQHYETIRE
FT                   RFQDYPINIGLLSRFRTRKQQNETIKGLKDGTVDIVIGTHRILSKDVTYKDLGLLIIDE
FT                   EQRFGVTHKEKIKQLKANVDVLTLTATPIPRTLHMSMLGVRDLSVIETPPENRFPVQTY
FT                   VVEYNPALMREAIERELARGGQVYFLYNRVEDIERKADEISMLVPDARVTYAHGKMNES
FT                   ELESVMLSFLEGQHDVLVSTTIIETGVDIPNVNTLIVFDADRMGLSQLYQLRGRVGRSN
FT                   RVAYAYFAYKRDKVLSEVAEKRLQAIKEFTELGSGFKIAMRDLSIRGAGNLLGAEQHGF
FT                   IDSVGFDLYSQMLKDAIEQRRGTDGVENTVNVEIDLEVDAYLPDAYISDSKQKIMMYKQ
FT                   FRGVSAIEDIEELQEEMIDRFGDYPQEVGYLLQIANIKVLAMKEQIELIKQNKFEVTIL
FT                   FSEQASQNIDGGKLFMLGNSFGRMIGLGMEGSQLKIVMKTNGLETSKWLTIAENLLKGL
FT                   PDVKKEVINA"
FT   gene            58190..58726
FT                   /gene="spoVT"
FT                   /locus_tag="BA_0053"
FT                   /old_locus_tag="BA0053"
FT   CDS_pept        58190..58726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVT"
FT                   /locus_tag="BA_0053"
FT                   /old_locus_tag="BA0053"
FT                   /product="stage V sporulation protein T"
FT                   /note="identified by match to protein family HMM PF04014;
FT                   match to protein family HMM TIGR01439; match to protein
FT                   family HMM TIGR02851"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24108"
FT                   /db_xref="GOA:A0A2B6BY47"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR014213"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2B6BY47"
FT                   /protein_id="AAP24108.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRDGEVI
FT                   LKKYSPISELGDFAKEYAEALYDSLGHNVLVCDRDSIIAVSGVSKKEYLNKSVGDLIEK
FT                   TMEERKSVIMTDESDVSIIDGVTEKVHSYTVGPIVANGDPIGAVIIFSKEAIISEIEHK
FT                   AVNTAASFLAKQMEQ"
FT   gene            58957..60558
FT                   /locus_tag="BA_0054"
FT                   /old_locus_tag="BA0054"
FT   CDS_pept        58957..60558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0054"
FT                   /old_locus_tag="BA0054"
FT                   /product="polysaccharide synthase family protein"
FT                   /note="identified by similarity to SP:Q00758; match to
FT                   protein family HMM PF01554; match to protein family HMM
FT                   PF01943; match to protein family HMM PF03023"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24109"
FT                   /db_xref="GOA:A0A2B6BXE5"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2B6BXE5"
FT                   /protein_id="AAP24109.1"
FT                   /translation="MESKKYQAFWRGAIILTIASFVTKVLSAFYRIPYQNIAGDIGFYI
FT                   YQQIYPFYGFCLILATYGFPIIISKMVAERLERGKKQEAEEIICVSFWFLLGIGFIGFF
FT                   TLFFGAEVIATAMGDIHLDKLLRVISFSFILMPFLSVARGYFQGFNNMVPTAVSQVIEQ
FT                   TIRVSIIVFLSLFLIAHEFDLYTVGAGAMLGSIAGGLIGIIVLILYMRHDFRSIFFKSV
FT                   KRIKGKKKIIKILFWQGLAICVSNLVLIFIQMADSVSFYSLLIGAGEPAESAKVLKGVY
FT                   DRSIPLMQLGTVVTTSFSLSLIPIITAAKERGDLTFIREKVRLAMKITFVIGFAAAIGL
FT                   TCIIQPTNIMLFENSDGSDVLSILSLSILFSSLSITTASILQGLGQTLKPAIFVVFGGC
FT                   LKLVLNYILMPYFGAKGAAIATLVALIVISVLNSMLLMRAVSESLIDKRNMLGIVISGF
FT                   SMGFVLIMFMRVLQMSGLVMDTSHRGVATFEALLGVAIGGLAYMFLILKLRVFTKAEIG
FT                   TVMKKEKKEGSLKKSG"
FT   gene            60571..62031
FT                   /locus_tag="BA_0055"
FT                   /old_locus_tag="BA0055"
FT   CDS_pept        60571..62031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0055"
FT                   /old_locus_tag="BA0055"
FT                   /product="tetrapyrrole methylase family protein/MazG family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM PF03819; match to protein
FT                   family HMM TIGR00444"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24110"
FT                   /db_xref="GOA:A0A347ZXN2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR024180"
FT                   /db_xref="InterPro:IPR035013"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZXN2"
FT                   /protein_id="AAP24110.1"
FT                   /translation="MSGIITILGLGAGELDQLTMGVYRKIKEADHMFVRTKEHPVIEEL
FT                   EKEGIQYTAFDNVYEAHDTFEIVYETIANTLIEKAEGTEIIYAVPGHPLVAERTVQLLL
FT                   EKGEVANIEVRIEGGQSFLDPMFASLKIDPIEGFQLIDATSFERGQLELRQHLIFCQVY
FT                   DAFVASDVKLTLMEMLPDDYEVYIVTAAGTSFEQVKKVPLYMLDHETELNNLTSVYVPP
FT                   VQERASLYQQFDVLREIIADLRGPNGCPWDKKQTHQSLKKYLIEEAYEVLEAIDEEDDD
FT                   HLVEELGDILLQVMLHAQIGEDEGWFSIDDIIRTLSEKMVRRHPHVFGNTDVDNADEVI
FT                   ANWEEIKKQEKGFVKESVLDGVPKSLPQLLRAYEIQKKAGKVGFDWVDVQPMIEKALEE
FT                   WQEFQQEVTNMDEAKMLSEFGDLLFAFVNIARHYKIDPEEALHSTNEKFVGRFLYMEAK
FT                   VAEMNKEMQDLSLEQLDVLWEEAKQTER"
FT   gene            62046..62321
FT                   /locus_tag="BA_0056"
FT                   /old_locus_tag="BA0056"
FT   CDS_pept        62046..62321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0056"
FT                   /old_locus_tag="BA0056"
FT                   /product="S4 domain protein"
FT                   /note="identified by similarity to OMNI:SA0550; match to
FT                   protein family HMM PF01479"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24111"
FT                   /db_xref="GOA:A0A1J9VMQ7"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9VMQ7"
FT                   /protein_id="AAP24111.1"
FT                   /translation="MRLDKFLKVSRLIKRRTLAKEVADQGRISINGQVAKASSDVKVAD
FT                   ELTIRFGQKIVTVKINELKETTKKEDAANMYSLVREEKVKAEEGLF"
FT   gene            62380..62688
FT                   /gene="yabP"
FT                   /locus_tag="BA_0057"
FT                   /old_locus_tag="BA0057"
FT   CDS_pept        62380..62688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabP"
FT                   /locus_tag="BA_0057"
FT                   /old_locus_tag="BA0057"
FT                   /product="sporulation protein YabP"
FT                   /note="identified by match to protein family HMM PF07873;
FT                   match to protein family HMM TIGR02892"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24112"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9X194"
FT                   /protein_id="AAP24112.1"
FT                   /translation="MNNGYSPMSSNQQNVSVEHDIIMRGRRVIDITGVKQVESFDSEEF
FT                   LLETVMGFLTIRGQNLQMKNLDVEKGVVSIKGKVHEMLYIDENQGEKTKGFFSKLFK"
FT   gene            62685..63338
FT                   /gene="yabQ"
FT                   /locus_tag="BA_0058"
FT                   /old_locus_tag="BA0058"
FT   CDS_pept        62685..63338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabQ"
FT                   /locus_tag="BA_0058"
FT                   /old_locus_tag="BA0058"
FT                   /product="spore cortex biosynthesis protein YabQ"
FT                   /note="identified by match to protein family HMM PF09578;
FT                   match to protein family HMM TIGR02893"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24113"
FT                   /db_xref="GOA:A0A2A7D1P5"
FT                   /db_xref="InterPro:IPR014242"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A7D1P5"
FT                   /protein_id="AAP24113.1"
FT                   /translation="MSLTIQLYTMLSMIGMGAWIGASLDTYQRFLKRQERKRWLVFIHD
FT                   ILFWIVQALFVFYVLLLVNEAELRIYVFLALLCGFAAYQSLLKAIYMRLLNFLIYIFVQ
FT                   TTHFFVQIIKLLMIKPVIIIAQLFIAFILFLFRILLSIGHVLWKMVIWILLFIWKVFFW
FT                   PVRFIASLIWKLLPNRVKLFIMKHVGFLQYIAKLKGHIFQLWERIKKKLGGPRK"
FT   gene            63335..63694
FT                   /gene="divIC1"
FT                   /locus_tag="BA_0059"
FT                   /old_locus_tag="BA0059"
FT   CDS_pept        63335..63694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="divIC1"
FT                   /locus_tag="BA_0059"
FT                   /old_locus_tag="BA0059"
FT                   /product="cell division protein DivIC"
FT                   /note="identified by match to protein family HMM PF04977"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24114"
FT                   /db_xref="GOA:A0A2B8IG05"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2B8IG05"
FT                   /protein_id="AAP24114.1"
FT                   /translation="MRELRQRTIEKQSPNPVKEHIIQTDENRKRLYRRLAVFLVFAFTI
FT                   IASISVTFYQQNSSIKAKEAKVKDMKKELDSLTNKEKSLKDEVQKLNDEEYVLKIARRD
FT                   YFFSGKGEIIFPVSK"
FT   gene            63782..64264
FT                   /locus_tag="BA_0060"
FT                   /old_locus_tag="BA0060"
FT   CDS_pept        63782..64264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0060"
FT                   /old_locus_tag="BA0060"
FT                   /product="S1 RNA binding domain protein"
FT                   /note="identified by similarity to EGAD:20846; match to
FT                   protein family HMM PF00575"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24115"
FT                   /db_xref="GOA:A0A1J9W2Q1"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9W2Q1"
FT                   /protein_id="AAP24115.1"
FT                   /translation="MSIEVGSKLQGKVTGITNFGAFVELPEGLTGLVHISEVADNYVKD
FT                   INDHLKVGDQVEVKVINVEKDGKIGLSIKKAKEREKTEGDRPRGEYQRGGDQQRSGRPQ
FT                   RNRSFNRDNRGGGNDRAPKETFEQKMARFLKDSEDRLTSLKRNTESKRGGRGARRG"
FT   gene            64425..64498
FT                   /locus_tag="BA_5750"
FT   tRNA            64425..64498
FT                   /locus_tag="BA_5750"
FT                   /product="tRNA-Met"
FT   gene            64512..64583
FT                   /locus_tag="BA_5751"
FT   tRNA            64512..64583
FT                   /locus_tag="BA_5751"
FT                   /product="tRNA-Glu"
FT   gene            64936..67314
FT                   /gene="spoIIE"
FT                   /locus_tag="BA_0061"
FT                   /old_locus_tag="BA0061"
FT   CDS_pept        64936..67314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIE"
FT                   /locus_tag="BA_0061"
FT                   /old_locus_tag="BA0061"
FT                   /product="stage II sporulation protein E"
FT                   /EC_number="3.1.3.16"
FT                   /note="identified by similarity to SP:P37475; match to
FT                   protein family HMM PF07228; match to protein family HMM
FT                   TIGR02865"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24116"
FT                   /db_xref="GOA:A0A2P0H8S2"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014221"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H8S2"
FT                   /protein_id="AAP24116.1"
FT                   /translation="MKFEQVFFRWGFIIVVIGFLLGRAYILTNILPFALPFFAAVYVMK
FT                   RDKMPLAFLALMGGALSVSIDNLFFTFASIFTFFIYNIFFSRFTRKTVGLVPFQVFISA
FT                   LTAHLVVVYFAQQTVTMYDLLVSTIEAGLSFVLTMIFLQSVPLLVERKGKQQALETEEI
FT                   VCLIILLASVLTGTTDWFVYDASIQHIFTRYLVLVFAFIAGAATGSTVGVVTGLILSLA
FT                   NVSSLSQLSLLAFSGLLGGLLKEGKRIGVSLGLLIGTSLITLYVDKQTNIVTTLIESGV
FT                   AIAFFLLTPKLVMDRIAKFMPGTQEHSQDQQQYLRRMRDVTANKINQFANVFAALSNSF
FT                   SVYGYVEEEDKETEADLFLSTITAKTCQTCFKKDQCWVVNFDKTYDYMKQIMSETEEGT
FT                   LQHNRKLVREWDKHCVRGKKVTDLVAGELDHFYEGQKLRKQMKENRRIVAEQLLGVSKV
FT                   MEDFAKEIQRERENHQVQEEQILQAFRDFGVEIEHVDIYCLDRGSIDIEMLIPVASNEH
FT                   GECEKLVAPMLSDILKENIVVKHEEKSSYPNGHSLISFGSAKTYSLDTGLATAAKGGGF
FT                   VSGDSYAMMDLSVGKYALAISDGMGNGQRAHMESKETVKLLQKILQSGIDEEIAIKSIN
FT                   SILSLRTTEEMFTTLDLAMVDLRDASAKFLKIGSTPSFVKRANNILKIEASNLPMGIIE
FT                   DVEVDVVGEQLKTGDILIMMSDGIFEGAQHVENHELWMKRKIKELQTEDPQEIADIIME
FT                   EVIRSGDGYINDDMTIVVAKVKKNMPKWATIPIVGMQAQ"
FT   gene            67548..68978
FT                   /gene="tilS"
FT                   /locus_tag="BA_0062"
FT                   /old_locus_tag="BA0062"
FT   CDS_pept        67548..68978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tilS"
FT                   /locus_tag="BA_0062"
FT                   /old_locus_tag="BA0062"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /EC_number="6.-.-.-"
FT                   /note="identified by similarity to GP:467456; match to
FT                   protein family HMM PF01171; match to protein family HMM
FT                   PF06508; match to protein family HMM TIGR02432; match to
FT                   protein family HMM TIGR02433"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24117"
FT                   /db_xref="GOA:Q81VX7"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VX7"
FT                   /protein_id="AAP24117.1"
FT                   /translation="MKDTFVEKVDDFVRQHDVLKERSTIVVGVSGGPDSLALLYYLLEK
FT                   RAAKQFEIVVAHVDHMFRGDESHEDLQFVQDLCKGLGVICETIRINVSQYQKQYGMNAQ
FT                   VAARECRYAFLERIMKKYDARYVALGHHGDDQVETILMRLVRGSTPKGYAGIAVKRPFH
FT                   NGYLIRPLLGVTKEEIVNYCNELKIIPRIDPSNKKEVYTRNRLRKYVLPHLKEENPQVH
FT                   EKFQKFSMQMQEDEAYLQELAFEKMNKVITKKSDKQISLSIPTFESMSMPLQRRGIQLI
FT                   LNYLYEYKIPSSLSSIHIDKVIEFFKRTQPSGSLDFPGDLKIVRAYEECSFGFKQEIVS
FT                   PFLQDLSVPGTITLSNGDKLVTEVSEDIPSDMNETVFVAKYNDISYPIRIRSRENGDRM
FT                   SIQGMNGTKKIKAIFIEAKVPREKREEWPVVCDASGNIIWLPLLKRSAFAISKETAKKD
FT                   KYMIIHYKSKESSGRIMK"
FT   gene            68975..69517
FT                   /gene="hpt1"
FT                   /locus_tag="BA_0063"
FT                   /old_locus_tag="BA0063"
FT   CDS_pept        68975..69517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt1"
FT                   /locus_tag="BA_0063"
FT                   /old_locus_tag="BA0063"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01203"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24118"
FT                   /db_xref="GOA:A0A1S0QLD4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="PDB:3H83"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1S0QLD4"
FT                   /protein_id="AAP24118.1"
FT                   /translation="MMNQDIEKVLISEEQIQEKVLELGAIIAEDYKNTVPLAIGVLKGA
FT                   MPFMADLLKRTDTYLEMDFMAVSSYGHSTVSTGEVKILKDLDTSVEGRDILIVEDIIDS
FT                   GLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQ
FT                   YRNLPYVGVLKPSVYSN"
FT   gene            69603..71504
FT                   /gene="ftsH"
FT                   /locus_tag="BA_0064"
FT                   /old_locus_tag="BA0064"
FT   CDS_pept        69603..71504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="BA_0064"
FT                   /old_locus_tag="BA0064"
FT                   /product="cell division protein FtsH"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF01434; match to protein
FT                   family HMM PF06480; match to protein family HMM PF07728;
FT                   match to protein family HMM TIGR01241"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24119"
FT                   /db_xref="GOA:A0A2P0H8S1"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H8S1"
FT                   /protein_id="AAP24119.1"
FT                   /translation="MNRIFRNTIFYLLIFLVVIGIVSYFNGSTQKTTSVSYDKFITKLE
FT                   KGEVRNVQLQPKNGVFEVKGQFNNSSQGEQFVTYAPNTEELQKKINDKAQGAEVKYQPA
FT                   EETSAWVTFFTSIIPFVIIFILFFFLLNQAQGGGSRVMNFGKSKAKLYNDEKKKVRFRD
FT                   VAGADEEKQELVEVVEFLKDPRKFAEVGARIPKGVLLVGPPGTGKTLLARAVAGEAGVP
FT                   FFSISGSDFVEMFVGVGASRVRDLFENAKKNAPCIIFIDEIDAVGRQRGAGLGGGHDER
FT                   EQTLNQLLVEMDGFGANEGIIIIAATNRPDILDPALLRPGRFDRQITVDRPDVNGREAV
FT                   LKVHARNKPLDENINLRAIATRTPGFSGADLENLLNEAALVAARQDKKKIDMSDIDEAT
FT                   DRVIAGPAKKSRVISEKERNIVAFHEAGHTVIGVVLDEADVVHKVTIVPRGQAGGYAVM
FT                   LPKEDRYFMTKPELLDKITGLLGGRVAEEIVFGEVSTGAHNDFQRATGIARRMVTEFGM
FT                   SDKLGPMQFGSSQGGQVFLGRDFHSEQNYSDAIAHEIDMEMQTIMKECYARAKQILTDN
FT                   RDKLDLIAKTLLEVETLDAEQINHLCDYGRLPERPTSSADVKVNINMKKDDEESEDK"
FT   gene            71729..72517
FT                   /locus_tag="BA_0065"
FT                   /old_locus_tag="BA0065"
FT   CDS_pept        71729..72517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0065"
FT                   /old_locus_tag="BA0065"
FT                   /product="putative transcriptional activator, Baf family"
FT                   /note="identified by similarity to GP:11066275; match to
FT                   protein family HMM PF03309; match to protein family HMM
FT                   TIGR00671"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24120"
FT                   /db_xref="GOA:Q81VX4"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="PDB:2H3G"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VX4"
FT                   /protein_id="AAP24120.1"
FT                   /translation="MIFVLDVGNTNAVLGVFEEGELRQHWRMETDRHKTEDEYGMLVKQ
FT                   LLEHEGLSFEDVKGIIVSSVVPPIMFALERMCEKYFKIKPLVVGPGIKTGLNIKYENPR
FT                   EVGADRIVNAVAGIHLYGSPLIIVDFGTATTYCYINEEKHYMGGVITPGIMISAEALYS
FT                   RAAKLPRIEITKPSSVVGKNTVSAMQSGILYGYVGQVEGIVKRMKEEAKQEPKVIATGG
FT                   LAKLISEESNVIDVVDPFLTLKGLYMLYERNANLQHEKGE"
FT   gene            72524..73399
FT                   /gene="hslO"
FT                   /locus_tag="BA_0066"
FT                   /old_locus_tag="BA0066"
FT   CDS_pept        72524..73399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="BA_0066"
FT                   /old_locus_tag="BA0066"
FT                   /product="chaperonin, 33 kDa"
FT                   /note="identified by match to protein family HMM PF01430"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24121"
FT                   /db_xref="GOA:Q81VX3"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VX3"
FT                   /protein_id="AAP24121.1"
FT                   /translation="MKDYLVKALAFDGEVRAYSVRTTNTVSEAQRRHDTWRTASAALGR
FT                   SLTAGTMMGAMLKGDQKLTIKVEGNGPIGPILVDAHANGDVRGYVTNPHVDFEGTEQGK
FT                   LRVYQAVGTEGFVTVIKDIGMREPFIGQSPIVSGELGEDFTYYFAVSEQTPSSVGVGVL
FT                   VNGDDSILAAGGFILQIMPGAQEETISFIEERLQKIPPVSTLIEQGLSPEELLYAVLGE
FT                   DKVKVLETMDVQFNCTCSRERIESVLISLGKTELEQVREEEEETEVHCHFCNERYKFSK
FT                   EDITNLIENL"
FT   gene            73504..74427
FT                   /gene="cysK1"
FT                   /locus_tag="BA_0067"
FT                   /old_locus_tag="BA0067"
FT   CDS_pept        73504..74427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK1"
FT                   /locus_tag="BA_0067"
FT                   /old_locus_tag="BA0067"
FT                   /product="cysteine synthase A"
FT                   /EC_number="2.5.1.47"
FT                   /note="identified by similarity to SP:P37887; match to
FT                   protein family HMM PF00291; match to protein family HMM
FT                   TIGR01136; match to protein family HMM TIGR01139"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24122"
FT                   /db_xref="GOA:A0A347ZXP4"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZXP4"
FT                   /protein_id="AAP24122.1"
FT                   /translation="MRVAQSVSELIGKTPIVKLNRIVESDSADIYLKLEFMNPGSSVKD
FT                   RIALAMIEDAEKKGLLKEGDTIIEPTSGNTGIGLAMVAAAKGYKAILVMPETMSVERRN
FT                   LLRAYGAELVLTPGPEGMGGAIRQATELAKEHGYFIPQQFKNQSNPEIHRLTTGPEIVE
FT                   QMGDQLDAFIAGIGTGGTITGAGEVLKEAYKDIKIYAVEPADSPVLSGGKPGPHKIQGI
FT                   GAGFVPETLDVEVYDEIIQVKTEQAFEYARRVAKEEGILVGISSGAVIYAATEVAKKLG
FT                   KGKKVLVIIPSNGERYLSTPLYQFES"
FT   gene            74648..76045
FT                   /gene="pabB"
FT                   /locus_tag="BA_0068"
FT                   /old_locus_tag="BA0068"
FT   CDS_pept        74648..76045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabB"
FT                   /locus_tag="BA_0068"
FT                   /old_locus_tag="BA0068"
FT                   /product="para-aminobenzoate synthase, component I"
FT                   /EC_number="2.6.1.85"
FT                   /note="aminodeoxychorismate synthase; identified by match
FT                   to protein family HMM PF00425; match to protein family HMM
FT                   PF04715"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24123"
FT                   /db_xref="GOA:A0A2P0H8Q4"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H8Q4"
FT                   /protein_id="AAP24123.1"
FT                   /translation="MQRRKSLALSIPYQLDFFKQYKFLSKDKPQHILLESGRGGRYNIV
FT                   GLNPVAVIRGKGEALHISESGKETIKQGNPLDLMQEYMERWKTDYNPEYPPFQGGAIGY
FT                   FSYDCIRYIEKLPSLAEDDINIPDIFFLLFDDVFVYDQKEKVLWIITHYVDKHEEAKER
FT                   LNEWKILWATEAPEVTIPFACPEKKNEAVAFTEESFMKAVECIQEYIGAGDVFQVNLST
FT                   RQERTLQTHPLEIYTSLREINPSPYMGYLELGDFQIVSGSPELLIKKQGTEVSTRPIAG
FT                   TRSRGANEQEDEELARELIENEKERAEHVMLVDLERNDLGRVCKYGTVEVDEFMVIEKY
FT                   SHVMHIVSNVRGEVEEDKDAFDLVKAVFPGGTITGAPKIRTMEIIEELEPVRRGIYTGS
FT                   IGWIGYSGDTELNIVIRTLLAKDGKAHVQAGAGIVIDSNPENEYKESLKKAIALWRAKE
FT                   RSEETVR"
FT   gene            76051..76638
FT                   /gene="pabA"
FT                   /locus_tag="BA_0069"
FT                   /old_locus_tag="BA0069"
FT   CDS_pept        76051..76638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /locus_tag="BA_0069"
FT                   /old_locus_tag="BA0069"
FT                   /product="para-aminobenzoate synthase, glutamine
FT                   amidotransferase component"
FT                   /EC_number="4.1.3.27"
FT                   /note="identified by similarity to SP:P28819; match to
FT                   protein family HMM PF00117; match to protein family HMM
FT                   TIGR00566"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24124"
FT                   /db_xref="GOA:A0A3P1TMQ4"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TMQ4"
FT                   /protein_id="AAP24124.1"
FT                   /translation="MILMIDNYDSFTFNLVQFLGELGQELVVKRNDEVTISDIENMKPD
FT                   FLMISPGPCSPNEAGISMDVIRYFAGKIPIFGVCLGHQSIAQVFGGEVVRAERLMHGKT
FT                   SPMHHDGKTIFSDIPNPFTATRYHSLIVKKETLPDCLEVTSWTEEGEIMALRHTTLPIE
FT                   GVQFHPESIMTSHGKELLQNFIRKYSPSVTSC"
FT   gene            76632..77504
FT                   /gene="pabC"
FT                   /locus_tag="BA_0070"
FT                   /old_locus_tag="BA0070"
FT   CDS_pept        76632..77504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabC"
FT                   /locus_tag="BA_0070"
FT                   /old_locus_tag="BA0070"
FT                   /product="4-amino-4-deoxychorismate lyase PabC"
FT                   /note="identified by similarity to OMNI:NTL01BS00076; match
FT                   to protein family HMM PF01063"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24125"
FT                   /db_xref="GOA:A0A347ZXP7"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZXP7"
FT                   /protein_id="AAP24125.1"
FT                   /translation="MLIYVNGQYVKSSEARISPYDHGYLYGLGVFETFRIYNGHPFLLD
FT                   DHYDRLIDALDTLQIKWTMTKDEVLLILKNLLIKNKLENAYVRFNVSAGIDEIGLQTEM
FT                   YEEPSVIVFIKPLAAPGEVAEKEGVVLKQVRNTPEGAARLKSHHYLNNILGKREIGNVV
FT                   NKEGIFLTETGYVAEGIVSNLFFVKGDILYTPSLETGILNGITRAFIIKVAEELGIKVK
FT                   EGFFTKDELLSADEVFVTNSIQEIVPLNRIEERDFPGKVGMVTKRFINLYEMQREKLWS
FT                   RNELRRGDV"
FT   gene            77497..78339
FT                   /gene="folP"
FT                   /locus_tag="BA_0071"
FT                   /old_locus_tag="BA0071"
FT   CDS_pept        77497..78339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="BA_0071"
FT                   /old_locus_tag="BA0071"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="identified by match to protein family HMM PF00809;
FT                   match to protein family HMM TIGR01496"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24126"
FT                   /db_xref="GOA:A0A384LNM4"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LNM4"
FT                   /protein_id="AAP24126.1"
FT                   /translation="MCSLKWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEV
FT                   DAAVRHAKEMRDEGAHIIDIGGESTRPGFAKVSVEEEIKRVVPMIQAVSKEVKLPISID
FT                   TYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADM
FT                   IADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSR
FT                   KSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGKGVK"
FT   gene            78340..78702
FT                   /gene="folB"
FT                   /locus_tag="BA_0072"
FT                   /old_locus_tag="BA0072"
FT   CDS_pept        78340..78702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="BA_0072"
FT                   /old_locus_tag="BA0072"
FT                   /product="dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /note="identified by similarity to SP:P28823; match to
FT                   protein family HMM PF02152; match to protein family HMM
FT                   TIGR00525; match to protein family HMM TIGR00526"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24127"
FT                   /db_xref="GOA:A0A347ZXP9"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZXP9"
FT                   /protein_id="AAP24127.1"
FT                   /translation="MDKIYIHDMEFYGYHGVFPEENKLGQRFKVDLTVELDLKRAGESD
FT                   DLEHSVNYGELFELCRKVVEDRTYKLVESIAENIATDILKQYESISRCTIKVIKPDPPI
FT                   PGHYRAVAVEITRERP"
FT   gene            78699..79214
FT                   /gene="folK"
FT                   /locus_tag="BA_0073"
FT                   /old_locus_tag="BA0073"
FT   CDS_pept        78699..79214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="BA_0073"
FT                   /old_locus_tag="BA0073"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   diphosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="identified by similarity to SP:P29252; match to
FT                   protein family HMM PF01288; match to protein family HMM
FT                   TIGR01498"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24128"
FT                   /db_xref="GOA:A0A347ZXQ0"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZXQ0"
FT                   /protein_id="AAP24128.1"
FT                   /translation="MNNIAYIALGSNIGERYTYLTEAIQFLNKNPYIKVEDVSSVYETE
FT                   PVGYTDQSCFLNLVIKISTNLSPQELLKVTQKVENDLGRKREIRWGPRTIDLDILLYNQ
FT                   ENIEAENLIVPHPRMFERAFVIVPLLEINQDIKQNISRSQVEEMKRREGVTVWKQKNGE
FT                   DAFVLFEN"
FT   gene            79166..79369
FT                   /locus_tag="BA_0074"
FT                   /old_locus_tag="BA0074"
FT   CDS_pept        79166..79369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0074"
FT                   /old_locus_tag="BA0074"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24129"
FT                   /db_xref="GOA:A0A1T3UUD4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1T3UUD4"
FT                   /protein_id="AAP24129.1"
FT                   /translation="MEAEKWGRRIRAFRKLKGYTQEGFAKELGVSVSVLGEVERGNRSP
FT                   SQDFVVEVAKALKVSIDELMPK"
FT   gene            79372..80391
FT                   /locus_tag="BA_0075"
FT                   /old_locus_tag="BA0075"
FT   CDS_pept        79372..80391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0075"
FT                   /old_locus_tag="BA0075"
FT                   /product="putative TIM-barrel protein, NifR3 family"
FT                   /note="identified by match to protein family HMM PF01180;
FT                   match to protein family HMM PF01207; match to protein
FT                   family HMM TIGR00737"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24130"
FT                   /db_xref="GOA:A0A0F7R9M2"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R9M2"
FT                   /protein_id="AAP24130.2"
FT                   /translation="MKEGVNRVLKIANIEMKNPVVLAPMAGVCNSAFRLTVKEFGAGLV
FT                   CAEMVSDKAILLNNKRTLDMLYIDEREKPLSLQIFGGEKETLVDAAKYVDQYTTADIID
FT                   INMGCPVPKIVKCDAGAKWLLDPNKIYEMVAAVVDAVEKPVTVKMRIGWDEDHIFAIEN
FT                   AKAVERAGGQVVAVHGRTRVQMYEGKADWDIIKQVKQAVNIPVIGNGDVATPQDAKRML
FT                   DEIGVDGVMIGRAALGDPWMIYRTVKYLETGELMPEPTVREKIDVCMLHLDRLIDLKNE
FT                   SVAVREMRKHAAWYLKGIRGNANVRNGINACNTREDLANVLGVFVEEVEAKQQTIHVG"
FT   gene            80551..82050
FT                   /gene="lysS"
FT                   /locus_tag="BA_0076"
FT                   /old_locus_tag="BA0076"
FT   CDS_pept        80551..82050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="BA_0076"
FT                   /old_locus_tag="BA0076"
FT                   /product="lysine--tRNA ligase"
FT                   /EC_number="6.1.1.6"
FT                   /note="identified by similarity to SP:P37477; match to
FT                   protein family HMM PF00152; match to protein family HMM
FT                   PF01336; match to protein family HMM TIGR00499"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24131"
FT                   /db_xref="GOA:Q81VW3"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VW3"
FT                   /protein_id="AAP24131.1"
FT                   /translation="MDNMNHEELNDQLLVRREKLHNLREQGIDPFGKRFERTNATNDLL
FT                   SLYGEFSKEELEEKEISVSIAGRIMTKRGKGKAGFAHIQDLHGQVQIYVRKDAVGDEEY
FT                   ELFKTADLGDLVGIEGKVFKTNVGELSVKATGFTLLTKSLRPLPDKYHGLKDVEQRYRQ
FT                   RYLDLITSMESRETFVTRSKIIREMRRYLDDNGYLEVETPMMHAIAGGASARPFITHHN
FT                   ALDMELYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADY
FT                   KDIMKLTENMVAHIAKQVLGTTTIQYGDYEINLEPEWTRLHMVDAIKEHSGADFWNPMS
FT                   VEEARELAKEHNVEIKDTMEVGHIINEFFEQKVEDKLIQPTFIYGHPVEISPLAKKNDE
FT                   DPRFTDRFELFIVAREHANAFTELNDPIDQKERFEAQLKEREQGNDEAHMMDDDYIEAL
FT                   EYGMPPTGGLGIGIDRLVMLLTNAPSIRDVLLFPAMRHKQD"
FT   gene            82451..83957
FT                   /gene="rrsC"
FT                   /locus_tag="BA_5752"
FT   rRNA            82451..83957
FT                   /gene="rrsC"
FT                   /locus_tag="BA_5752"
FT                   /product="16S ribosomal RNA"
FT   gene            84136..87043
FT                   /gene="rrlC"
FT                   /locus_tag="BA_5753"
FT   rRNA            84136..87043
FT                   /gene="rrlC"
FT                   /locus_tag="BA_5753"
FT                   /product="23S ribosomal RNA"
FT   gene            87093..87208
FT                   /gene="rrfC"
FT                   /locus_tag="BA_5754"
FT   rRNA            87093..87208
FT                   /gene="rrfC"
FT                   /locus_tag="BA_5754"
FT                   /product="5S ribosomal RNA"
FT   gene            87415..87876
FT                   /gene="ctsR"
FT                   /locus_tag="BA_0077"
FT                   /old_locus_tag="BA0077"
FT   CDS_pept        87415..87876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctsR"
FT                   /locus_tag="BA_0077"
FT                   /old_locus_tag="BA0077"
FT                   /product="transcriptional regulator CtsR"
FT                   /note="identified by similarity to SP:P37568; match to
FT                   protein family HMM PF05848"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24132"
FT                   /db_xref="GOA:A0A2A8KMB8"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A8KMB8"
FT                   /protein_id="AAP24132.1"
FT                   /translation="MRNISDIIEQYLKQVIDLSNNNVIEIKRNEIADRFECVPSQINYV
FT                   INTRFTLERGFVVESKRGGGGYIRIIKVKLHDDIDIIDQMLHMIDHSVAQGNAESMIIR
FT                   LIEEGIITNREAKLMLSVLDRSVLSMDVPSRDELRARILCAMLRTLKYK"
FT   gene            88050..88598
FT                   /locus_tag="BA_0078"
FT                   /old_locus_tag="BA0078"
FT   CDS_pept        88050..88598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0078"
FT                   /old_locus_tag="BA0078"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:12309; match to
FT                   protein family HMM PF02151"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24133"
FT                   /db_xref="GOA:A0A3P1TQ14"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TQ14"
FT                   /protein_id="AAP24133.1"
FT                   /translation="MTCQNCNIRPATLHYTKVINEKKAEVHLCEQCAEQSGYTSFFQSS
FT                   QSNFSFHDLFAGLLHGESTMFEEGKNGFSNTSILRCPDCKMTYEQFTKVGRFGCASCYD
FT                   TFKEHLKPLLKRLHGGHTDHCGKIPERIEGNIHLKKELDELKLILKQYVQKEEFEKAAE
FT                   VRDKIRNLENQLSEYREGE"
FT   gene            88603..89667
FT                   /locus_tag="BA_0079"
FT                   /old_locus_tag="BA0079"
FT   CDS_pept        88603..89667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0079"
FT                   /old_locus_tag="BA0079"
FT                   /product="phosphotransferase domain protein"
FT                   /note="identified by similarity to EGAD:21117; match to
FT                   protein family HMM PF00217"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24134"
FT                   /db_xref="GOA:Q81VW0"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VW0"
FT                   /protein_id="AAP24134.1"
FT                   /translation="MSLDKIMNEAISPWMKGDGPDSDIVLSSRIRLARNFKKYQFSTMQ
FT                   NEEETKQIQELFKKEFINKTVEPFGEFELLKMNELTPLQRRVLVEKHLISPNLAGTEYG
FT                   ACLLSESEHISVMLNEEDHIRIQCLFSGLQLSEALQSANQIDNWIEKEVEYAFDESLGY
FT                   ITSCPTNVGTGLRASVMIHLPGLVLTKRISRIIQVIQKLGLVVRGIYGEGSEALGNIFQ
FT                   VSNQMTLGKSEEDIIADLKSVIQQIIQQEKMARELIVQNSSIELEDKVYRSYGILANSR
FT                   LIQSAEAANCLSDLRLGIDLGYIQGISRNILTELMVLTQPGILQQYAGGPLGPEERDYR
FT                   RATLIRERLRIEKN"
FT   gene            89690..92125
FT                   /locus_tag="BA_0080"
FT                   /old_locus_tag="BA0080"
FT   CDS_pept        89690..92125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0080"
FT                   /old_locus_tag="BA0080"
FT                   /product="negative regulator of genetic competence
FT                   ClpC/MecB"
FT                   /note="identified by similarity to SP:P37571; match to
FT                   protein family HMM PF00004; match to protein family HMM
FT                   PF02151; match to protein family HMM PF02861; match to
FT                   protein family HMM PF07724; match to protein family HMM
FT                   PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24135"
FT                   /db_xref="GOA:A0A1T3UXA3"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1T3UXA3"
FT                   /protein_id="AAP24135.1"
FT                   /translation="MMFGRFTERAQKVLALSQEEAIRIGHNNIGTEHILLGLVREGEGI
FT                   AAKALIALGLSPEKVQKEVEALIGRGTEASQTVHYTPRAKKVIELSMDEARKLGHSYVG
FT                   TEHILLGLIREGEGVAARVLNNLGVSLNKARQQVLQLLGSNEASSGHQGGSSTNANTPT
FT                   LDSLARDLTVVARENRLDPVIGRGKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGL
FT                   AQQIVNNEVPETLRDKRVMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNIILFIDE
FT                   LHTLIGAGGAEGAIDASNILKPSLARGELQCIGATTLDEYRKYIEKDAALERRFQPIHV
FT                   DEPSLDESTQILKGLRDRYEAHHRVSITDDAIDAAVKLSDRYITDRFLPDKAIDLIDEA
FT                   ASKVRLRSYTTPPNLKELEVKLEEIRKEKDAAVQSQEFEKAASLRDMEQRLREKLEDTK
FT                   RQWKEQQGKENSEVTVEDIANVVSTWTRIPVSKLAQTETDKLLNLESILHDRVIGQDEA
FT                   VVAVAKAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARALAESMFGDEDAMIRIDMS
FT                   EYMEKHSTSRLVGSPPGYVGYEEGGQLTEKVRRKPYSVVLLDEVEKAHPDVFNILLQVL
FT                   EDGRLTDSKGRTVDFRNTIVIMTSNVGAEALKRNKHLGFNVQDESRDYSDMKGKVMDEL
FT                   KKAFRPEFLNRIDEIIVFHMLEKKHIQEIVTLMVNQLVNRLKEQEIELHLTEGAISAIA
FT                   DKGFDREYGARPLRRAIQKHVEDRLSEELLKGAIEKGQKVIFDVEGESFVIHSAEKVK"
FT   gene            92222..93598
FT                   /gene="radA"
FT                   /locus_tag="BA_0081"
FT                   /old_locus_tag="BA0081"
FT   CDS_pept        92222..93598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="BA_0081"
FT                   /old_locus_tag="BA0081"
FT                   /product="DNA repair protein RadA"
FT                   /note="identified by similarity to EGAD:13219; match to
FT                   protein family HMM TIGR00416"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24136"
FT                   /db_xref="GOA:A0A347ZXQ8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZXQ8"
FT                   /protein_id="AAP24136.1"
FT                   /translation="MAKKKTKFTCQECGYQSPKYMGKCPGCGQWNTLVEEMEPVVSSRR
FT                   LNYANAIQTEVTKPRRLTEVETKSEARIETKFQEFNRVLGGGIVDGSLVLIGGDPGIGK
FT                   STLLLQISSQLADSSYDVLYISGEESAKQIKLRADRLHVNGSNLFVVSETDLQRIATHI
FT                   EEMNPAFVVIDSIQTIHLPEVTSAPGSVAQVRECTAELMKLAKTKGIPIFIVGHVTKEG
FT                   AIAGPRMLEHMVDAVLYFEGDRHHTYRILRAVKNRFGSTNEMGIFEMKELGLAEVLNPS
FT                   EIFLEERPVGVAGSTVVASMEGTRPVLVEIQALISPTSFGNPRRMATGIDHNRVSLIMA
FT                   VLEKRTGLLLQNQDAYLKVAGGLKLDEPAIDLAVALSIASSFRDKSTAPTDAVIGEVGL
FT                   TGEIRRVSRIEQRVQEAAKLGFQRAIIPRKNLGGWTIPDGIEVVGVSNLGEALRLTLGG
FT                   "
FT   gene            93602..94675
FT                   /locus_tag="BA_0082"
FT                   /old_locus_tag="BA0082"
FT   CDS_pept        93602..94675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0082"
FT                   /old_locus_tag="BA0082"
FT                   /product="putative DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF00633;
FT                   match to protein family HMM PF02457"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24137"
FT                   /db_xref="GOA:Q81VV7"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VV7"
FT                   /protein_id="AAP24137.1"
FT                   /translation="MEENKQRVKSMINILQLVAPGTPLREGIDNVLRAQTGGLIVLGYN
FT                   EQIKSIVDGGFHINCAFSPASLYELAKMDGALILNETGSKILIANAQLVPESSIDSIET
FT                   GMRHRTAERVAKQTGSLVVAISQRRNVITLYQGNLRYTLKDIGVILTKANQAIQTLEKY
FT                   KAVWNDGITNLGILEFEEVVTMSEVVHVLHSVEMVLRIKNEILSYIHELGTEGRLIRLQ
FT                   LTELLADLEAEAALLIKDYYQEKTQDHHQILKKLQELANTQLLEDSDLVKLLGYPGQTS
FT                   LEESVTPRGYRITSKISRVPPLIIENLINRFKTLQGVCRATINELDDVEGIGEVRAKKI
FT                   REGLKRIQEHLYMSRHN"
FT   gene            94836..95945
FT                   /locus_tag="BA_0083"
FT                   /old_locus_tag="BA0083"
FT   CDS_pept        94836..95945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0083"
FT                   /old_locus_tag="BA0083"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01850;
FT                   match to protein family HMM PF01938"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24138"
FT                   /db_xref="GOA:A0A347ZXR0"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZXR0"
FT                   /protein_id="AAP24138.1"
FT                   /translation="MLKRIVQLFFLVIGGALGIYLIPKVINVLDIGAVPLLEGSYVRAI
FT                   IGAIILFLTTFWLVDYIVQLIKHIEEALVKAPVADVLFGTLGLISGLIVAYLILIPIRE
FT                   FTIPVISTVLQVFFTLLLGYLGFQVGFKKRNELLGLFTLPQRGKKKNNNSENEEPENEV
FT                   EESLAHWKILDTSVIIDGRIADICQTKFLEGTIVIPQFVLEELQHIADSSDALKRNRGR
FT                   RGLDILNRIQKEMPIPVEIYEGDFDDIQEVDSKLVKLAKITGGTVVTNDFNLNKVSELQ
FT                   GVTVLNINDLANAIKPVVLPGEELSVYVVKDGKEQNQGVAYLDDGTMIVVEDGREYVGS
FT                   QLDVLVTSVLQTSAGRMIFAKRKLLEKAL"
FT   gene            95962..96642
FT                   /gene="ispD"
FT                   /locus_tag="BA_0084"
FT                   /old_locus_tag="BA0084"
FT   CDS_pept        95962..96642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="BA_0084"
FT                   /old_locus_tag="BA0084"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.60"
FT                   /note="identified by match to protein family HMM PF01128;
FT                   match to protein family HMM TIGR00453"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24139"
FT                   /db_xref="GOA:Q81VV5"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VV5"
FT                   /protein_id="AAP24139.1"
FT                   /translation="MYTLIIPAAGQGKRMGAGKNKLFLLINEVPIIVHTLRAFEKDKAC
FT                   KNIIMAINEEERPYFEELMQKYPVEKPVQFIQGGAERQDSVYNAIQHTTDVEYVLVHDG
FT                   ARPFVTNKVIQDVLTAAEKYGASICAVPVKDTVKKVEQGVVVETVERSQLKAVQTPQGF
FT                   SVSLLLEAHRSAKQSCFLGTDDASLVERIGKQVGVVEGSYYNIKVTTPEDLLIAESFLH
FT                   VQKK"
FT   gene            96757..97233
FT                   /gene="ispF"
FT                   /locus_tag="BA_0085"
FT                   /old_locus_tag="BA0085"
FT   CDS_pept        96757..97233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispF"
FT                   /locus_tag="BA_0085"
FT                   /old_locus_tag="BA0085"
FT                   /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="identified by similarity to SP:P36663; match to
FT                   protein family HMM PF02542; match to protein family HMM
FT                   TIGR00151"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24140"
FT                   /db_xref="GOA:Q81VV4"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VV4"
FT                   /protein_id="AAP24140.1"
FT                   /translation="MFRIGQGFDVHEFAEGRPLIIGGITIPHEKGLIGHSDADVLLHTI
FT                   ADACLGAIAAGDIGKHFPDTDPAFKDADSAVLLQKVWEFVREQGYELGNLDCTIIAQKP
FT                   KMAPHIESMRKRISELLETSIDNINVKATTTEKLGFTGREEGIASQAVVLLQKK"
FT   gene            97323..98780
FT                   /gene="gltX"
FT                   /locus_tag="BA_0086"
FT                   /old_locus_tag="BA0086"
FT   CDS_pept        97323..98780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="BA_0086"
FT                   /old_locus_tag="BA0086"
FT                   /product="glutamate--tRNA ligase"
FT                   /EC_number="6.1.1.17"
FT                   /note="identified by similarity to SP:P22250; match to
FT                   protein family HMM PF00749; match to protein family HMM
FT                   TIGR00464"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24141"
FT                   /db_xref="GOA:Q81VV3"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VV3"
FT                   /protein_id="AAP24141.1"
FT                   /translation="MEKQVRVRYAPSPTGHLHIGNARTALFNYLFARHQDGKFIIRIED
FT                   TDVKRNVAGGEESQLKYLKWLGMDWDEGVDVGGEFGPYRQTERLDIYKKLYEDLLERGL
FT                   AYKCYMTEEELEAEREGQIARGETPRYAGNHRDLTEAQVKEFEAEGRIPSIRFRVPADR
FT                   DYTFKDIVKDEVAFHSNDFGDFVIVKKDGIPTYNFAVAVDDHLMEITHVLRGDDHISNT
FT                   PKQMMIYEAFGWDIPQFGHMTLIVNESRKKLSKRDESIIQFIEQYKELGYLPEAIFNFI
FT                   ALLGWSPVGEEEIFSQEEFIKMFDAARLSKSPALFDSQKLKWMNNQYMKKQDLDTVVEL
FT                   SLPHLVKAGRIGETLSEQEQAWIRDVIALYHEQMSFGAEIVELSEMFFKDHVDYEEEGQ
FT                   EVLKGEQVPEVLRAFAGQVEALEAMEPAAIKAAIKAVQKETGHKGKNLFMPIRVATTGQ
FT                   THGPELPNAIALLGKEKVLNRLQKVIG"
FT   gene            99213..99878
FT                   /gene="cysE"
FT                   /locus_tag="BA_0088"
FT                   /old_locus_tag="BA0088"
FT   CDS_pept        99213..99878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="BA_0088"
FT                   /old_locus_tag="BA0088"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="identified by similarity to SP:Q06750; match to
FT                   protein family HMM PF00132; match to protein family HMM
FT                   TIGR01172"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24142"
FT                   /db_xref="GOA:A0A347ZXR4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZXR4"
FT                   /protein_id="AAP24142.1"
FT                   /translation="MFKRLREDIEVVFEQDPAARSYFEVILTYSGLHAVWAHRIAHAFY
FT                   KKNFFFIARWISQVSRFFTGIEIHPGATIGRRFFIDHGMGVVIGETCEIGDNVTIYQGV
FT                   TLGGTGKEKGKRHPTIQDNVLIATGAKVLGSITVGENSKIGAGSVVLKEVPAHSTVVGI
FT                   PGRVVIQNGVKIGQELNHSDLPDPIFDKLKVMEVELDKLKKQLEVKVERKDKNDYSHL"
FT   gene            99859..101256
FT                   /gene="cysS"
FT                   /locus_tag="BA_0089"
FT                   /old_locus_tag="BA0089"
FT   CDS_pept        99859..101256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="BA_0089"
FT                   /old_locus_tag="BA0089"
FT                   /product="cysteine--tRNA ligase"
FT                   /EC_number="6.1.1.16"
FT                   /note="identified by similarity to SP:Q06752; match to
FT                   protein family HMM PF01406; match to protein family HMM
FT                   PF09190; match to protein family HMM PF09334; match to
FT                   protein family HMM TIGR00435"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24143"
FT                   /db_xref="GOA:Q81VV1"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VV1"
FT                   /protein_id="AAP24143.1"
FT                   /translation="MTIHIYNTLTRQKEEFTPLEENKVKMYVCGPTVYNYIHIGNARPP
FT                   MVFDTVRRYLEYKGYDVQYVSNFTDVDDKLIKAANELGEDVPTIADRFVEAYFEDVTAL
FT                   GCKHATVHPRVTENMDIIIEFIQELVNKGYAYESEGDVYFRTKEFEGYGKLSHQPIADL
FT                   RHGARIEVGEKKQDPLDFALWKAAKEGEIFWESPWGQGRPGWHIECSAMARKYLGDTID
FT                   IHAGGQDLAFPHHENEIAQSEALTGKTFARYWMHNGYININNEKMSKSLGNFILVHDII
FT                   KQYDPQLIRFFMLSVHYRHPINFSEELLQSTNNGLERIKTAYGNLKHRMESSTDLTDHN
FT                   EKWLADLEKFQTAFEEAMNDDFNTANAITELYNVANHANQYLLEEHTSTVVIEAYVKQL
FT                   ETLFDILGLELAQEELLDEEIEALIQKRIEARKNRDFALSDQIRDDLKDRNIILEDTAQ
FT                   GTRWKRG"
FT   gene            101259..101666
FT                   /locus_tag="BA_0090"
FT                   /old_locus_tag="BA0090"
FT   CDS_pept        101259..101666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0090"
FT                   /old_locus_tag="BA0090"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:2632362; match to
FT                   protein family HMM PF00636"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24144"
FT                   /db_xref="GOA:A0A347ZXR6"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZXR6"
FT                   /protein_id="AAP24144.1"
FT                   /translation="MIDAKQLNSLALAYMGDAVYEQYIRYHLLQKGKVRPNQLHRLGTS
FT                   FVSAKAQAKVVYHLLETAFLTEEEEAVLRRGRNANSGTVPKNTDVQTYRHSTAFEALIG
FT                   YHHLLNNRERLDEIVYKAIAVLEEKEGGTSS"
FT   gene            101663..102406
FT                   /locus_tag="BA_0091"
FT                   /old_locus_tag="BA0091"
FT   CDS_pept        101663..102406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0091"
FT                   /old_locus_tag="BA0091"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="identified by similarity to SP:Q06753; match to
FT                   protein family HMM PF00588; match to protein family HMM
FT                   PF08032; match to protein family HMM TIGR00186"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24145"
FT                   /db_xref="GOA:A0A347ZXR7"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZXR7"
FT                   /protein_id="AAP24145.1"
FT                   /translation="MSSEYIIGRNPVIEALRSGRDINKIWIAEGAAKGQVQIVLALAKE
FT                   NKIILQHAPKKKLDQLVEGNHQGVIAQVAAYQYAELEDLFKVAEKRNEDPFFLILDEIE
FT                   DPHNLGSIMRTADATGAHGIIIPKRRAVGLTASVAKASTGAIEYIPVARVTNLSRTIDE
FT                   LKERGLWIAGTDAKGKTDYRNLDGKMPIGLVIGSEGKGMSRIIGEKCDFLITLPMVGKV
FT                   TSLNASVAASLLMYEVYRKRNEIGK"
FT   gene            102410..102922
FT                   /locus_tag="BA_0092"
FT                   /old_locus_tag="BA0092"
FT   CDS_pept        102410..102922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0092"
FT                   /old_locus_tag="BA0092"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:14028; match to
FT                   protein family HMM PF05991"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24146"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A7D110"
FT                   /protein_id="AAP24146.1"
FT                   /translation="MNDILIVDGYNIIGAWGDLKKLRDVDLQSSRDALIDKMADYQGYT
FT                   GTKVMIVFDAYTVHGIEKKMKQSRVEVIFTRKNQTADEKIEQLAIELRNINTQIYVATS
FT                   DYTEQWVIFAQGALRKSARELELEVQAMEQQVRRRTQDTKEKQPAMRKIFSKDITEKLE
FT                   KLRRGER"
FT   gene            102990..103646
FT                   /gene="sigH"
FT                   /locus_tag="BA_0093"
FT                   /old_locus_tag="BA0093"
FT   CDS_pept        102990..103646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigH"
FT                   /locus_tag="BA_0093"
FT                   /old_locus_tag="BA0093"
FT                   /product="RNA polymerase sigma-30 factor"
FT                   /note="identified by similarity to EGAD:24440; match to
FT                   protein family HMM PF04542; match to protein family HMM
FT                   PF08281; match to protein family HMM TIGR02859; match to
FT                   protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24147"
FT                   /db_xref="GOA:A0A2A8LC13"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014218"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A8LC13"
FT                   /protein_id="AAP24147.1"
FT                   /translation="MEAGFVSVGDVTFRDLEDEAIVELVRKGNTDALEYLIHKYKNFVR
FT                   AKSRSYFLVGADREDIVQEGMIGLFKAIRDYKEDKLSSFKAFAELCITRQIITAIKTAT
FT                   RQKHIPLNSYVSLDKPIYDEESDRTLLDVISEAKVTDPEEMIISQEEYTDIESKISELL
FT                   SDLERKVLSLYLDGRSYQEISEQLNRHVKSIDNALQRVKRKLERYMEMRESTTSN"
FT   gene            103778..103924
FT                   /gene="rpmG"
FT                   /locus_tag="BA_0094"
FT                   /old_locus_tag="BA0094"
FT   CDS_pept        103778..103924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="BA_0094"
FT                   /old_locus_tag="BA0094"
FT                   /product="50S ribosomal protein L33"
FT                   /note="identified by similarity to SP:Q06798; match to
FT                   protein family HMM PF00471; match to protein family HMM
FT                   TIGR01023"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24148"
FT                   /db_xref="GOA:Q81VU6"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VU6"
FT                   /protein_id="AAP24148.1"
FT                   /translation="MRKKVVLSCEECKNRNYSTMKDTSSVERLEIKKFCKTCNQHTVHK
FT                   ETK"
FT   gene            103957..104136
FT                   /locus_tag="BA_0095"
FT                   /old_locus_tag="BA0095"
FT   CDS_pept        103957..104136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0095"
FT                   /old_locus_tag="BA0095"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="identified by similarity to SP:Q06799; match to
FT                   protein family HMM PF00584; match to protein family HMM
FT                   TIGR00964"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24149"
FT                   /db_xref="GOA:A0A2A8KNC1"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A8KNC1"
FT                   /protein_id="AAP24149.1"
FT                   /translation="MRLTNFFGDVGREMKKVSWPKKDELLRSTATVIATVVFFAIFFAV
FT                   VDMGISSLIRLILG"
FT   gene            104268..104801
FT                   /gene="nusG"
FT                   /locus_tag="BA_0096"
FT                   /old_locus_tag="BA0096"
FT   CDS_pept        104268..104801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="BA_0096"
FT                   /old_locus_tag="BA0096"
FT                   /product="transcription termination/antitermination factor
FT                   NusG"
FT                   /note="identified by match to protein family HMM PF02357;
FT                   match to protein family HMM TIGR00922"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24150"
FT                   /db_xref="GOA:A0A2A8YDC9"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A8YDC9"
FT                   /protein_id="AAP24150.1"
FT                   /translation="MEKSWYVVHTYSGYENKVKANLEKRVESMGMQDKIFRVVVPEEVE
FT                   VEMKNGKEKLMKRKVFPGYVLVELIMTDDSWYVVRNTPGVTGFVGSSGSGSKPSPLLEE
FT                   EVVTIMKHMGMDNEVVDFDFELHETVRVNEGPFADYTGAIEEIDVEKKKVSVLVDMFGR
FT                   ETPVELDFHQIEKL"
FT   gene            104969..105394
FT                   /gene="rplK"
FT                   /locus_tag="BA_0097"
FT                   /old_locus_tag="BA0097"
FT   CDS_pept        104969..105394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="BA_0097"
FT                   /old_locus_tag="BA0097"
FT                   /product="50S ribosomal protein L11"
FT                   /note="identified by similarity to SP:Q06796; match to
FT                   protein family HMM PF00298; match to protein family HMM
FT                   PF03946; match to protein family HMM TIGR01632"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24151"
FT                   /db_xref="GOA:Q81VU3"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VU3"
FT                   /protein_id="AAP24151.1"
FT                   /translation="MAKKVIKMVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNAR
FT                   TADQAGLIIPVEITVFEDRSFTFITKTPPAAVLLKKVAGIESGSGEPNRNKVATVKRDK
FT                   VREIAETKMPDLNAASVEAAMRMVEGTARSMGIVIED"
FT   gene            105572..106264
FT                   /gene="rplA"
FT                   /locus_tag="BA_0098"
FT                   /old_locus_tag="BA0098"
FT   CDS_pept        105572..106264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="BA_0098"
FT                   /old_locus_tag="BA0098"
FT                   /product="50S ribosomal protein L1"
FT                   /note="identified by similarity to SP:Q06797; match to
FT                   protein family HMM PF00687; match to protein family HMM
FT                   TIGR01169"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24152"
FT                   /db_xref="GOA:Q81VU2"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VU2"
FT                   /protein_id="AAP24152.1"
FT                   /translation="MAKRGKKYVEAAKLVDRAAAYSATEAVELVKKTNTAKFDATVEAA
FT                   FRLGVDPKKADQQIRGAVVLPHGTGKVQRVLVFAKGEKAKEAEAAGADFVGDADYIGKI
FT                   QQGWFDFDVVVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTFDVTKAVNEIKAGKVEY
FT                   RVDKAGNIHVPIGKVSFEDAKLVENFRTIADTLQKVKPAAAKGTYMKNVTVASTMGPGV
FT                   RVDVSTLA"
FT   gene            106497..106997
FT                   /gene="rplJ"
FT                   /locus_tag="BA_0099"
FT                   /old_locus_tag="BA0099"
FT   CDS_pept        106497..106997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="BA_0099"
FT                   /old_locus_tag="BA0099"
FT                   /product="50S ribosomal protein L10"
FT                   /note="identified by similarity to SP:P42923; match to
FT                   protein family HMM PF00466"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24153"
FT                   /db_xref="GOA:Q81VU1"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VU1"
FT                   /protein_id="AAP24153.1"
FT                   /translation="MSKVIETKQQVVTEIADKLRASKSTIVVDYRGLTVSEATELRKQL
FT                   REAGVEFKVYKNSLTRRAAESAEMAELNEFLTGPNAIAFSNEDVVAPAKVLNDFAKDHE
FT                   ALEIKAGVIEGKLVTLDEVKAIATLPSREGLLSMLLSVLQAPIRNLALATKAVADQKEE
FT                   QGA"
FT   gene            107065..107424
FT                   /gene="rplL"
FT                   /locus_tag="BA_0100"
FT                   /old_locus_tag="BA0100"
FT   CDS_pept        107065..107424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="BA_0100"
FT                   /old_locus_tag="BA0100"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /note="identified by similarity to SP:P02394; match to
FT                   protein family HMM PF00542; match to protein family HMM
FT                   TIGR00855"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24154"
FT                   /db_xref="GOA:Q81VU0"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VU0"
FT                   /protein_id="AAP24154.1"
FT                   /translation="MTKEQIIEAVKSMTVLELNDLVKAIEEEFGVTAAAPVAVAGGAGE
FT                   AAAEKTEFDVELTSAGAQKIKVIKVVREITGLGLKEAKELVDNTPKVIKEAAAKEEAEE
FT                   IKAKLEEVGAAVEVK"
FT   gene            107499..108098
FT                   /locus_tag="BA_0101"
FT                   /old_locus_tag="BA0101"
FT   CDS_pept        107499..108098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0101"
FT                   /old_locus_tag="BA0101"
FT                   /product="ybxB protein"
FT                   /note="identified by similarity to EGAD:20573; match to
FT                   protein family HMM PF05175; match to protein family HMM
FT                   PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24155"
FT                   /db_xref="GOA:A0A347ZXS6"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZXS6"
FT                   /protein_id="AAP24155.1"
FT                   /translation="MADHYFSNDPSSKSDRKRWEFTLRGSRFTFLSDRGVFSKNEVDFG
FT                   SRLLIEAFQVPDIKGDILDVGCGYGPIGLSLAKEFQDRKVHMVDVNERALELAKENAAN
FT                   NRIGNVHIFQSSVYENVDGMYAAILSNPPIRAGKDIVHEILEKAVEHLVPGGELWIVIQ
FT                   KKQGAPSALKKLEEVFSEVEVVEKKKGYYIIKSKKR"
FT   gene            108391..111924
FT                   /gene="rpoB"
FT                   /locus_tag="BA_0102"
FT                   /old_locus_tag="BA0102"
FT   CDS_pept        108391..111924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="BA_0102"
FT                   /old_locus_tag="BA0102"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by similarity to EGAD:12597; match to
FT                   protein family HMM PF00562; match to protein family HMM
FT                   PF04560; match to protein family HMM PF04561; match to
FT                   protein family HMM PF04563; match to protein family HMM
FT                   PF04565; match to protein family HMM TIGR02013"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24156"
FT                   /db_xref="GOA:Q81VT8"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VT8"
FT                   /protein_id="AAP24156.1"
FT                   /translation="MTGQLVQYGRHRQRRSYARISEVLELPNLIEIQTSSYQWFLDEGL
FT                   REMFQDISPIEDFTGNLSLEFIDYSLGEPKYSVDECKERDVTYAAPLRVKVRLINKETG
FT                   EVKEQDVFMGDFPLMTETGTFVINGAERVIVSQLVRSPSVYYSGKVDKNGKRGFTATVI
FT                   PNRGAWLEYETDAKDVVYVRIDRTRKLPVTVLLRALGFGSDQEITELLGDNEYLSNTLE
FT                   KDNTDSTEKALLEIYERLRPGEPPTVENAKSLLVSRFFDPKRYDLANVGRYKINKKLHI
FT                   KNRLFNQRLAETLVDPETGEILAAEGTILDRRTLDRILPYLEKNIGFKTAKPMGGVVEG
FT                   DVELQSIKIYAPESEGERVINVIGNANITRDVKHITPGDILASISYFFNLLYKVGDTDD
FT                   IDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQDTNAITPQALINIRPVIAAIK
FT                   EFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLTRERAGFEVRDVHYSHYGRMCPIE
FT                   TPEGPNIGLINSLSSFAKVNEFGFIETPYRRVDPETGLVTGHVDYLTADEEDNYVVAQA
FT                   NMKLSEEGEFLDEDIVARFRGENIVTNKERIDYMDVSPKQVVSAATACIPFLENDDSNR
FT                   ALMGANMQRQAVPLMNPESPIVGTGMEYVSAKDSGAAVICKHPGIVERVEAREVWVRRY
FT                   VEVDGQTVKGDLDRYKMQKFIRSNQGTCYNQRPIVSVGNEVVKGEILADGPSMELGELA
FT                   LGRNVLVGFMTWDGYNYEDAIIMSERLVKDDVYTSIHIEEYESEARDTKLGPEEITRDI
FT                   PNVGEDALRNLDERGIIRVGAEVKDGDLLVGKVTPKGVTELTAEERLLHAIFGEKAREV
FT                   RDTSLRVPHGGGGIILDVKVFNREDGDELPPGVNQLVRAYIVQKRKISEGDKMAGRHGN
FT                   KGVISRILPEEDMPYLPDGTPIDIMLNPLGVPSRMNIGQVLELHLGMAARYLGIHIATP
FT                   VFDGAREEDVWGTIEEAGMANDAKTILYDGRTGEPFDNRVSVGVMYMIKLAHMVDDKLH
FT                   ARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVKSDDVIGRVK
FT                   TYEAIVKGENVPEPGVPESFKVLIKELQSLGMDVKMMSSDDTEIEMRDTEDDDDHQSAD
FT                   KLNVEVETTKE"
FT   gene            111962..115573
FT                   /gene="rpoC"
FT                   /locus_tag="BA_0103"
FT                   /old_locus_tag="BA0103"
FT   CDS_pept        111962..115573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="BA_0103"
FT                   /old_locus_tag="BA0103"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by similarity to SP:P37871; match to
FT                   protein family HMM PF00623; match to protein family HMM
FT                   PF04983; match to protein family HMM PF04997; match to
FT                   protein family HMM PF04998; match to protein family HMM
FT                   PF05000; match to protein family HMM TIGR02386"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24157"
FT                   /db_xref="GOA:P77819"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:P77819"
FT                   /protein_id="AAP24157.2"
FT                   /translation="MIDVNNFEYMKIGLASPDKIRSWSYGEVKKPETINYRTLKPEKDG
FT                   LFCERIFGPQKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLVLDMSPRALEEVIYFASYVVTESGDTPLDKKQLLSEKEYRAYRDRYG
FT                   STFQAAMGAEAIKKLLQDIDLDKEVDFLKEELKTAQGQRRTRAIKRLEVLEAFRNSGNE
FT                   PSWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVEKGLAHNIKSAKRKIERVQPEVWD
FT                   VLESVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVH
FT                   VPLSSEAQAEARLLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLEREGAIGEGMVFK
FT                   DANEALLAYQNGYVHLHTRVAVAASAVNNVTFTEEQKNMLLLTTVGKLIFNEILPESFP
FT                   YINEPTNSNLEKETPAKYFVEKGANIKEIIASREEVAPFSKKILGNIIAEVFKRFKITE
FT                   TSRMLDRMKNLGFKYSTKAGITVGVSDILVLGEKDEILHEAQAKVDNVIKQFRRGLITE
FT                   EERYDRVISIWSNAKDVIQGKLMKSLNKRNPIFMMSDSGARGNASNFTQLAGMRGLMAN
FT                   PSGRIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVI
FT                   VREDDCGTDRGLLIGAIKEGNEVIESLYDRLVGRFARKTVKHPETGEVLVAENQLITED
FT                   IAHIVENSGVETVNIRSAFTCNTRHGVCKKCYGRNLATGTDVEVGEAVGIIAAQSIGEP
FT                   GTQLTMRTFHTGGVAGDDITQGLPRIQEIFEARNPKGQAVISEIDGVIAAINDVKDRQE
FT                   VVVQGEVEARTYAIPYGARLKVIPGQKISHGKELTEGSIDPKELLKVTDITAVQEYLLR
FT                   EVQKVYRMQGVEIGDKHVEVMVRQMLRKVRVSDAGETDVLPGTLLDIHQFTDANAKVLL
FT                   QGKQPATARPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVII
FT                   GKLVPAGTGMNRYRKVDLVKTTQDDMNVENDEVYVEQ"
FT   gene            115687..115935
FT                   /locus_tag="BA_0104"
FT                   /old_locus_tag="BA0104"
FT   CDS_pept        115687..115935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0104"
FT                   /old_locus_tag="BA0104"
FT                   /product="ribosomal protein L7A family"
FT                   /note="identified by match to protein family HMM PF01248"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24158"
FT                   /db_xref="GOA:A0A2A8YDU3"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A8YDU3"
FT                   /protein_id="AAP24158.1"
FT                   /translation="MSYQKVSNAENVVVGHKRTLEAIKNGIVKEVVIAEDADMRLTHVI
FT                   IRTALQHNIPITKVESVRKLGKVAGIQVGASAIGIIS"
FT   gene            116050..116472
FT                   /gene="rpsL"
FT                   /locus_tag="BA_0105"
FT                   /old_locus_tag="BA0105"
FT   CDS_pept        116050..116472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="BA_0105"
FT                   /old_locus_tag="BA0105"
FT                   /product="30S ribosomal protein S12"
FT                   /note="identified by similarity to SP:P21472; match to
FT                   protein family HMM PF00164; match to protein family HMM
FT                   TIGR00981"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24159"
FT                   /db_xref="GOA:Q81VT5"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VT5"
FT                   /protein_id="AAP24159.1"
FT                   /translation="MPTINQLVRNGRTDKVWKSKSPALNKGFNSLKKKSTDISAPQKRG
FT                   VCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIVRGALDTAGVDKRMQGRSKYGTKKPKAAKK"
FT   gene            116502..116972
FT                   /gene="rpsG"
FT                   /locus_tag="BA_0106"
FT                   /old_locus_tag="BA0106"
FT   CDS_pept        116502..116972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="BA_0106"
FT                   /old_locus_tag="BA0106"
FT                   /product="30S ribosomal protein S7"
FT                   /note="identified by similarity to SP:P21469; match to
FT                   protein family HMM PF00177; match to protein family HMM
FT                   TIGR01029"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24160"
FT                   /db_xref="GOA:Q81VT4"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VT4"
FT                   /protein_id="AAP24160.1"
FT                   /translation="MPRKGPVAKRDVLPDPMYNSKLVTRLINKMMVDGKKGKSQTILYN
FT                   AFDIVSERTGKEPMEVFEQALKNIMPVLEVRARRVGGANYQVPVEVRPERRTTLGLRWL
FT                   VNYARLRGEKTMEERLANEILDAANNAGASVKKREDTHKMAEANKAFAHYRW"
FT   gene            117180..119258
FT                   /gene="fusA"
FT                   /locus_tag="BA_0107"
FT                   /old_locus_tag="BA0107"
FT   CDS_pept        117180..119258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="BA_0107"
FT                   /old_locus_tag="BA0107"
FT                   /product="translation elongation factor G"
FT                   /note="identified by similarity to SP:P80868; match to
FT                   protein family HMM PF00009; match to protein family HMM
FT                   PF00679; match to protein family HMM PF03144; match to
FT                   protein family HMM PF03764; match to protein family HMM
FT                   TIGR00231; match to protein family HMM TIGR00484"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24161"
FT                   /db_xref="GOA:Q81VT3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VT3"
FT                   /protein_id="AAP24161.1"
FT                   /translation="MAREFSLENTRNIGIMAHIDAGKTTATERILYYTGRIHKIGETHE
FT                   GASQMDWMEQEQERGITITSAATTAQWKGHRVNIIDTPGHVDFTVEVERSLRVLDGAVA
FT                   VLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKIGADFLYSVGTIHDRLQANAHPIQ
FT                   LPIGAEDEFNGIIDLVEECAYMYGNDLGTDIQRVEIPEEHKELAEEYRGKLIEAVAELD
FT                   EEMMMKYLEGEEITVEELKAGIRKATTSVEFFPVICGSAFKNKGVQILLDAVIDYLPSP
FT                   LDVPAIKGIVPDTDEEVERKSSDEEPFAALAFKIMTDPYVGKLTFFRVYSGVLNSGSYV
FT                   KNSTKGKRERVGRILQMHANSREEISTVYAGDIAAAVGLKDTTTGDTLCDEKSLVILES
FT                   MEFPEPVISVAIEPKSKADQDKMGTALSKLSEEDPTFRAHTDQETGQTIIAGMGELHLD
FT                   IIVDRMRREFKVEANVGAPQVAYRETFRAAAKVEGKFARQSGGRGQFGHVWIEFEPNEE
FT                   GKGFEFENKIVGGVVPREYIPAVGAGLEDALKNGVLAGYPVVDIKAALVDGSYHDVDSS
FT                   EMAFKIAASMALKAAVSKCNPVILEPMMKVEVVIPEEYMGDIMGDVTSRRGRVEGMEAR
FT                   GNAQVVRAMVPLSEMFGYATSLRSNTQGRGTFSMVFDHYEEVPKSVSEEIIKKNKGE"
FT   gene            119376..120563
FT                   /gene="tuf"
FT                   /locus_tag="BA_0108"
FT                   /old_locus_tag="BA0108"
FT   CDS_pept        119376..120563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="BA_0108"
FT                   /old_locus_tag="BA0108"
FT                   /product="translation elongation factor Tu"
FT                   /note="identified by similarity to SP:O50306; match to
FT                   protein family HMM PF00009; match to protein family HMM
FT                   PF03143; match to protein family HMM PF03144; match to
FT                   protein family HMM TIGR00231; match to protein family HMM
FT                   TIGR00485"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24162"
FT                   /db_xref="GOA:Q81VT2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VT2"
FT                   /protein_id="AAP24162.1"
FT                   /translation="MAKAKFERSKPHVNIGTIGHVDHGKTTLTAAITTVLAKAGGAEAR
FT                   GYDQIDAAPEERERGITISTAHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGGIL
FT                   VVSAADGPMPQTREHILLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYGF
FT                   PGDDIPVIKGSALKALQGEADWEAKIIELMAEVDAYIPTPERETDKPFLMPVEDVFSIT
FT                   GRGTVATGRVERGIVKVGDVVEIIGLAEENASTTVTGVEMFRKLLDQAQAGDNIGALLR
FT                   GVAREDIQRGQVLAKSGSVKAHAKFKAEVFVLSKEEGGRHTPFFANYRPQFYFRTTDVT
FT                   GIIQLPEGTEMVMPGDNIEMTIELIAPIAIEEGTKFSIREGGRTVGYGVVATIVE"
FT   gene            120962..121270
FT                   /gene="rpsJ"
FT                   /locus_tag="BA_0109"
FT                   /old_locus_tag="BA0109"
FT   CDS_pept        120962..121270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="BA_0109"
FT                   /old_locus_tag="BA0109"
FT                   /product="30S ribosomal protein S10"
FT                   /note="identified by similarity to SP:P21471; match to
FT                   protein family HMM PF00338; match to protein family HMM
FT                   TIGR01049"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24163"
FT                   /db_xref="GOA:Q81VT1"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VT1"
FT                   /protein_id="AAP24163.1"
FT                   /translation="MAKEKIRIRLKAYDHRILDQSADKIVETAKRSGATVSGPIPLPTE
FT                   KTVYTILRAVHKYKDSREQFEMRTHKRLIDIVSPTPQTVDSLMRLDLPSGVDIEIKL"
FT   gene            121305..121937
FT                   /gene="rplC"
FT                   /locus_tag="BA_0110"
FT                   /old_locus_tag="BA0110"
FT   CDS_pept        121305..121937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="BA_0110"
FT                   /old_locus_tag="BA0110"
FT                   /product="50S ribosomal protein L3"
FT                   /note="identified by similarity to OMNI:NTL01BS00116; match
FT                   to protein family HMM PF00297; match to protein family HMM
FT                   TIGR03625"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24164"
FT                   /db_xref="GOA:Q81VT0"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VT0"
FT                   /protein_id="AAP24164.1"
FT                   /translation="MTKGILGRKIGMTQVFAENGELIPVTVIAANPNVVLQKKTTETDG
FT                   YNAIQLGFEDKREKLTNKPEQGHTAKASTTPKRFIREIRDADVDGLEVGQEVKVDVFAT
FT                   GEIVDVTGISKGKGFQGVIKRHGQSRGPMSHGSRYHRRPGSMGPVAPNRVFKGKKLAGR
FT                   MGGDQVTIQNLEIVQVDTERNLLLVKGNVPGAKKSLVVVQGAVKVSK"
FT   gene            121963..122586
FT                   /gene="rplD"
FT                   /locus_tag="BA_0111"
FT                   /old_locus_tag="BA0111"
FT   CDS_pept        121963..122586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="BA_0111"
FT                   /old_locus_tag="BA0111"
FT                   /product="50S ribosomal protein L4"
FT                   /note="identified by similarity to SP:P42921; match to
FT                   protein family HMM PF00573"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24165"
FT                   /db_xref="GOA:Q81VS9"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VS9"
FT                   /protein_id="AAP24165.1"
FT                   /translation="MPKVTVYNQTGSQVGEIELAEAIFGIEPNEAVLFEAVMMQRASLR
FT                   QGTHKVKTRSEVRGGGRKPWRQKGTGRARQGSIRSPQWRGGGTVFGPTPRSYAYKLPKK
FT                   VRRLAIKSALATKVVENNIVVLEDLVLNAPKTKDMLAVLKGLTVEKKALIVTADANESV
FT                   ELSARNIPGVTVITADGVNVLDVLHHDKLIMTKAAVEKVEEVLA"
FT   gene            122586..122876
FT                   /gene="rplW"
FT                   /locus_tag="BA_0112"
FT                   /old_locus_tag="BA0112"
FT   CDS_pept        122586..122876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="BA_0112"
FT                   /old_locus_tag="BA0112"
FT                   /product="50S ribosomal protein L23"
FT                   /note="identified by similarity to OMNI:NTL01BS00118; match
FT                   to protein family HMM PF00276"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24166"
FT                   /db_xref="GOA:Q81VS8"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VS8"
FT                   /protein_id="AAP24166.1"
FT                   /translation="MRDPRDIIKRPVITERSMEMMAEKKYTFDVDVKSNKTEVKDALEA
FT                   IFGVKVEKVNIMNYKPKAKRVGRHAGFTSRRRKAIVKLTADSKEIEIFQGV"
FT   gene            122905..123735
FT                   /gene="rplB"
FT                   /locus_tag="BA_0113"
FT                   /old_locus_tag="BA0113"
FT   CDS_pept        122905..123735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="BA_0113"
FT                   /old_locus_tag="BA0113"
FT                   /product="50S ribosomal protein L2"
FT                   /note="identified by similarity to SP:P42919; match to
FT                   protein family HMM PF00181; match to protein family HMM
FT                   PF03947; match to protein family HMM TIGR01171"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24167"
FT                   /db_xref="GOA:Q81VS7"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VS7"
FT                   /protein_id="AAP24167.1"
FT                   /translation="MGIKKYNPTTNGRRNMTTNDFAEITTDRPEKSLLAPLSKKAGRNN
FT                   QGKITVRHQGGGHKRQYRIIDFKRNKDGIPGRVATIEYDPNRSANIALINYVDGEKRYI
FT                   LAPKNLEVGMEIMSGAEADIKIGNALPLINIPVGTVVHNIELKPGRGGQLVRSAGTSAQ
FT                   VLGKEGKYVLVRLTSGEVRLVLSACRATVGQVGNESHELIKIGKAGRSRWLGKRPTVRG
FT                   SVMNPVDHPHGGGEGRSPIGRKSPMSPWGKPTLGFKTRKKNKASDKFIVRRRKK"
FT   gene            123796..124074
FT                   /gene="rpsS"
FT                   /locus_tag="BA_0114"
FT                   /old_locus_tag="BA0114"
FT   CDS_pept        123796..124074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="BA_0114"
FT                   /old_locus_tag="BA0114"
FT                   /product="30S ribosomal protein S19"
FT                   /note="identified by similarity to SP:P21476; match to
FT                   protein family HMM PF00203; match to protein family HMM
FT                   TIGR01050"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24168"
FT                   /db_xref="GOA:Q81VS6"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VS6"
FT                   /protein_id="AAP24168.1"
FT                   /translation="MARSLKKGPFVDDHLMSKIAKLNETEQKQVVKTWSRRSTIFPQFI
FT                   GHTIAVYDGRKHVPVYVTEDMVGHKLGEFAPTRTYKGHDADDKKTRR"
FT   gene            124092..124433
FT                   /gene="rplV"
FT                   /locus_tag="BA_0115"
FT                   /old_locus_tag="BA0115"
FT   CDS_pept        124092..124433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="BA_0115"
FT                   /old_locus_tag="BA0115"
FT                   /product="50S ribosomal protein L22"
FT                   /note="identified by similarity to OMNI:NTL01BS00121; match
FT                   to protein family HMM PF00237; match to protein family HMM
FT                   TIGR01044"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24169"
FT                   /db_xref="GOA:Q81VS5"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VS5"
FT                   /protein_id="AAP24169.1"
FT                   /translation="MQAKAVARTVRIAPRKVRLVVDLIRGKQVGEAIAILNHTPKTASP
FT                   VVEKVLKSAIANAEHNYEMDINSLVVEKVFVDEGPTLKRFRPRAMGRASQINKRTSHIT
FT                   VVVSEKKEG"
FT   gene            124437..125096
FT                   /gene="rpsC"
FT                   /locus_tag="BA_0116"
FT                   /old_locus_tag="BA0116"
FT   CDS_pept        124437..125096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="BA_0116"
FT                   /old_locus_tag="BA0116"
FT                   /product="30S ribosomal protein S3"
FT                   /note="identified by match to protein family HMM PF00189;
FT                   match to protein family HMM PF00417; match to protein
FT                   family HMM PF07650; match to protein family HMM TIGR01009"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24170"
FT                   /db_xref="GOA:Q81VS4"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VS4"
FT                   /protein_id="AAP24170.1"
FT                   /translation="MGQKVNPIGLRVGVIRDWESRWFAEKDYATLLHEDIKIREYINVR
FT                   LKDSAVAKVEIERAANRVNVTIHTAKPGMVIGKGGTEVEALRKALNQLTGKRVHINILE
FT                   VKRADLNAKLVGENIARQLENRVSFRRAQKQVIQRAMRAGAKGIKTQVSGRLGGADIAR
FT                   AESYSEGTVPLHTLRADIDYAAVEADTTYGKLGVKVWIYRGEVLPTKKKASEEGGK"
FT   gene            125098..125532
FT                   /gene="rplP"
FT                   /locus_tag="BA_0117"
FT                   /old_locus_tag="BA0117"
FT   CDS_pept        125098..125532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="BA_0117"
FT                   /old_locus_tag="BA0117"
FT                   /product="50S ribosomal protein L16"
FT                   /note="identified by similarity to EGAD:5179; match to
FT                   protein family HMM PF00252; match to protein family HMM
FT                   TIGR01164"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24171"
FT                   /db_xref="GOA:Q81VS3"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VS3"
FT                   /protein_id="AAP24171.1"
FT                   /translation="MLMPKRVKYRREHRGKMRGRAKGGTEIAFGEFGLQAQAASWITNR
FT                   QIEAARRAMTRYMKRGGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKIMF
FT                   EIAGVSEEVAREALRLAAHKLPVKCKFVKREENGGESNEN"
FT   gene            125522..125722
FT                   /gene="rpmC"
FT                   /locus_tag="BA_0118"
FT                   /old_locus_tag="BA0118"
FT   CDS_pept        125522..125722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="BA_0118"
FT                   /old_locus_tag="BA0118"
FT                   /product="50S ribosomal protein L29"
FT                   /note="identified by similarity to OMNI:NTL01BS00124; match
FT                   to protein family HMM PF00831; match to protein family HMM
FT                   TIGR00012"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24172"
FT                   /db_xref="GOA:Q81VS2"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VS2"
FT                   /protein_id="AAP24172.1"
FT                   /translation="MKTNDIRELTTAEIETKVKALKEELFNLRFQLATGQLENPTRIRE
FT                   VRKAIARMKTVVREREIGINR"
FT   gene            125743..126006
FT                   /gene="rpsQ"
FT                   /locus_tag="BA_0119"
FT                   /old_locus_tag="BA0119"
FT   CDS_pept        125743..126006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="BA_0119"
FT                   /old_locus_tag="BA0119"
FT                   /product="30S ribosomal protein S17"
FT                   /note="identified by similarity to SP:P12874; match to
FT                   protein family HMM PF00366; match to protein family HMM
FT                   TIGR03635"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24173"
FT                   /db_xref="GOA:Q81VS1"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VS1"
FT                   /protein_id="AAP24173.1"
FT                   /translation="MSERNQRKVYTGRVVSDKMDKTITVLVETYKTHSLYGKRVKYSKK
FT                   YKAHDEQNQAKLGDIVKIMETRPLSATKRFRLVEIVEEAVII"
FT   gene            126050..126418
FT                   /gene="rplN"
FT                   /locus_tag="BA_0120"
FT                   /old_locus_tag="BA0120"
FT   CDS_pept        126050..126418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="BA_0120"
FT                   /old_locus_tag="BA0120"
FT                   /product="50S ribosomal protein L14"
FT                   /note="identified by similarity to EGAD:7028; match to
FT                   protein family HMM PF00238; match to protein family HMM
FT                   TIGR01067"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24174"
FT                   /db_xref="GOA:Q81VS0"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VS0"
FT                   /protein_id="AAP24174.1"
FT                   /translation="MIQQESRLKVADNSGARELLTIKVLGGSGRKYANIGDIIVATVKQ
FT                   ATPGGVVKKGDVVKAVVVRTKSGARRPDGSYIKFDENAAVIIKDDKSPRGTRIFGPVAR
FT                   ELRDSNFMKIVSLAPEVL"
FT   gene            126457..126768
FT                   /gene="rplX"
FT                   /locus_tag="BA_0121"
FT                   /old_locus_tag="BA0121"
FT   CDS_pept        126457..126768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="BA_0121"
FT                   /old_locus_tag="BA0121"
FT                   /product="50S ribosomal protein L24"
FT                   /note="identified by similarity to SP:P12876; match to
FT                   protein family HMM PF00467; match to protein family HMM
FT                   TIGR01079"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24175"
FT                   /db_xref="GOA:Q81VR9"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VR9"
FT                   /protein_id="AAP24175.1"
FT                   /translation="MHVKKGDKVQVITGKDKGKQGVILVAFPKQNRVIVEGVNIVKKHS
FT                   KPSQLNPQGGIITKEAPIHVSNVMILDPKTGEPTRVGFKVEDGKKVRIAKKSGELLDK"
FT   gene            126795..127334
FT                   /gene="rplE"
FT                   /locus_tag="BA_0122"
FT                   /old_locus_tag="BA0122"
FT   CDS_pept        126795..127334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="BA_0122"
FT                   /old_locus_tag="BA0122"
FT                   /product="50S ribosomal protein L5"
FT                   /note="identified by similarity to SP:P12877; match to
FT                   protein family HMM PF00281; match to protein family HMM
FT                   PF00673"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24176"
FT                   /db_xref="GOA:Q81VR8"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VR8"
FT                   /protein_id="AAP24176.1"
FT                   /translation="MNRLKEKFQKEITPALVSKFNYKSVMQVPKIEKIVINTGVGDAVS
FT                   NSKTLDNAVEELTQITGQKPVVTRAKKSIAGFRLREGMPIGAKVTLRGEQMYEFFDKLV
FT                   SVSLPRVRDFRGVSKKSFDGRGNYTLGVKEQLIFPEIDYDKVSKVRGMDIVIVTTAKTD
FT                   EEARELLTQFGMPFQK"
FT   gene            127368..127553
FT                   /gene="rpsN"
FT                   /locus_tag="BA_0123"
FT                   /old_locus_tag="BA0123"
FT   CDS_pept        127368..127553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="BA_0123"
FT                   /old_locus_tag="BA0123"
FT                   /product="30S ribosomal protein S14"
FT                   /note="identified by similarity to SP:P12878; match to
FT                   protein family HMM PF00253"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24177"
FT                   /db_xref="GOA:Q81VR7"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VR7"
FT                   /protein_id="AAP24177.1"
FT                   /translation="MAKKSMIAKQKRTPKFKVQEYTRCERCGRPHSVYRKFKLCRICFR
FT                   ELAYKGQIPGVKKASW"
FT   gene            127583..127981
FT                   /gene="rpsH"
FT                   /locus_tag="BA_0124"
FT                   /old_locus_tag="BA0124"
FT   CDS_pept        127583..127981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="BA_0124"
FT                   /old_locus_tag="BA0124"
FT                   /product="30S ribosomal protein S8"
FT                   /note="identified by similarity to SP:P12879; match to
FT                   protein family HMM PF00410"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24178"
FT                   /db_xref="GOA:Q81VR6"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="PDB:4PDB"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VR6"
FT                   /protein_id="AAP24178.1"
FT                   /translation="MVMTDPIADMLTRIRNANMVRHEKLEVPASKIKKEIAELLKREGF
FT                   IRDVEYIEDNKQGILRIFLKYGANNERVITGLKRISKPGLRVYAKADEVPRVLNGLGIA
FT                   LVSTSKGVMTDKDARQLQTGGEVVAYVW"
FT   gene            128014..128553
FT                   /gene="rplF"
FT                   /locus_tag="BA_0125"
FT                   /old_locus_tag="BA0125"
FT   CDS_pept        128014..128553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="BA_0125"
FT                   /old_locus_tag="BA0125"
FT                   /product="50S ribosomal protein L6"
FT                   /note="identified by similarity to SP:P46898; match to
FT                   protein family HMM PF00347; match to protein family HMM
FT                   TIGR03654"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24179"
FT                   /db_xref="GOA:Q81VR5"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VR5"
FT                   /protein_id="AAP24179.1"
FT                   /translation="MSRIGKKILEIPAGVTITVAEDNTVTVKGPKGELTRTFNADMLIK
FT                   IEENTLTVERPSEQKEHRALHGTTRALIGNMVEGVTEGFARGLELVGVGYRAQKQGDKL
FT                   VLSVGYSHPVEMTPEAGLEVEVPAPTKIVIKGIDKQRVGEFAANIRAVRAPEPYKGKGI
FT                   RYEGEVVRRKEGKTAK"
FT   gene            128585..128947
FT                   /gene="rplR"
FT                   /locus_tag="BA_0126"
FT                   /old_locus_tag="BA0126"
FT   CDS_pept        128585..128947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="BA_0126"
FT                   /old_locus_tag="BA0126"
FT                   /product="50S ribosomal protein L18"
FT                   /note="identified by similarity to SP:P46899; match to
FT                   protein family HMM PF00861; match to protein family HMM
FT                   TIGR00060"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24180"
FT                   /db_xref="GOA:Q81VR4"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VR4"
FT                   /protein_id="AAP24180.1"
FT                   /translation="MITKADKNATRKKRHARVRAKLTGTAERPRLNVFRSNQHIYAQVI
FT                   DDVNGVTLVSASTLDKDLALNGTSNIEAATKVGESVAKRAVEKGVKEVVFDRGGYLYHG
FT                   RVKALAEAAREAGLQF"
FT   gene            128969..129469
FT                   /gene="rpsE"
FT                   /locus_tag="BA_0127"
FT                   /old_locus_tag="BA0127"
FT   CDS_pept        128969..129469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="BA_0127"
FT                   /old_locus_tag="BA0127"
FT                   /product="30S ribosomal protein S5"
FT                   /note="identified by similarity to SP:P21467; match to
FT                   protein family HMM PF00333; match to protein family HMM
FT                   PF03719; match to protein family HMM TIGR01021"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24181"
FT                   /db_xref="GOA:Q81VR3"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VR3"
FT                   /protein_id="AAP24181.1"
FT                   /translation="MHRIDPSKLELEERVVTINRVAKVVKGGRRFRFAALVVVGDKNGH
FT                   VGFGTGKAQEVPDAIRKAIEDAKKNLIAVPLVGTTIPHTINGHFGAGEVFLKPAAEGTG
FT                   VIAGGPVRAVLELAGVQDILSKSLGSNTPINMIRATVNGLSELKRAEDVAKLRGKSVEE
FT                   LLG"
FT   gene            129483..129665
FT                   /gene="rpmD"
FT                   /locus_tag="BA_0128"
FT                   /old_locus_tag="BA0128"
FT   CDS_pept        129483..129665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="BA_0128"
FT                   /old_locus_tag="BA0128"
FT                   /product="50S ribosomal protein L30"
FT                   /note="identified by similarity to SP:P19947; match to
FT                   protein family HMM PF00327; match to protein family HMM
FT                   TIGR01308"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24182"
FT                   /db_xref="GOA:Q81VR2"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VR2"
FT                   /protein_id="AAP24182.1"
FT                   /translation="MAKKLEITLTRSVIGRPQDQRATVEALGLKKLNSTVVKEETPAIL
FT                   GMINKVSHLVTVKEA"
FT   gene            129699..130139
FT                   /gene="rplO"
FT                   /locus_tag="BA_0129"
FT                   /old_locus_tag="BA0129"
FT   CDS_pept        129699..130139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="BA_0129"
FT                   /old_locus_tag="BA0129"
FT                   /product="50S ribosomal protein L15"
FT                   /note="identified by similarity to EGAD:16743; match to
FT                   protein family HMM PF00256; match to protein family HMM
FT                   PF01305; match to protein family HMM TIGR01071"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24183"
FT                   /db_xref="GOA:Q81VR1"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VR1"
FT                   /protein_id="AAP24183.1"
FT                   /translation="MKLHELKPAEGSRKVRNRVGRGIGSGNGKTAGKGHKGQNARSGGG
FT                   VRLGFEGGQTPLFRRLPKRGFTNINRKEFAIVNLSTLNRFEDGTEVTPELLLETGVISK
FT                   LNDGVKILASGAVEKKLTVKAHKFSSSAKEAIEAAGGSVEVI"
FT   gene            130139..131440
FT                   /gene="secY1"
FT                   /locus_tag="BA_0130"
FT                   /old_locus_tag="BA0130"
FT   CDS_pept        130139..131440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY1"
FT                   /locus_tag="BA_0130"
FT                   /old_locus_tag="BA0130"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="identified by similarity to SP:P16336; match to
FT                   protein family HMM PF00344; match to protein family HMM
FT                   TIGR00967"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24184"
FT                   /db_xref="GOA:A0A2A8YEQ6"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A8YEQ6"
FT                   /protein_id="AAP24184.1"
FT                   /translation="MFRTISNFMRVAEIRRKILFTLAMLIVFRIGTFIPVPFTNGDVLK
FT                   AQDQLNALGILNTFGGGALKNFSIFAMGIMPYITASIIVQLLQMDVVPKFSEWAKQGEM
FT                   GRRKLTQFTRYFTIVLAFIQGFGMSIGFNGMVGGQLILNPGWSTYLYIATVLTAGTAFL
FT                   MWLGEQITAKGVGNGISILIFGGIAAAIPSVISQVYQQQFQNIGDQLFMSIVKVALILL
FT                   AVLAVIVGVIFIQQAVRKIPIQYAKRVTGGNGGYAGAQNTHLPLKVNSAGVIPVIFAVS
FT                   FLITPPTIAQFFPKHDVSQWIIANFNYSHPVGMIIYVALIVAFTYFYAFVQVNPEQMSE
FT                   NLNKQGGYVPGIRPGKNTEQYLTKILYRLTFVGSIFLAAIAILPVIFTKLGNLPPSAQI
FT                   GGTSMLIVVGVALETMKQLESQLVKRHYKGFIKQ"
FT   gene            131497..132147
FT                   /gene="adk"
FT                   /locus_tag="BA_0131"
FT                   /old_locus_tag="BA0131"
FT   CDS_pept        131497..132147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="BA_0131"
FT                   /old_locus_tag="BA0131"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="identified by similarity to SP:P27142; match to
FT                   protein family HMM PF00406; match to protein family HMM
FT                   PF05191; match to protein family HMM TIGR01351"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24185"
FT                   /db_xref="GOA:Q81VQ9"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VQ9"
FT                   /protein_id="AAP24185.1"
FT                   /translation="MNLILMGLPGAGKGTQAEQIVAKYNIPHISTGDMFRAAMKAETEM
FT                   GLQAKSFIDKGALVPDEVTIGIVRERLSQEDCVRGFLLDGFPRTVAQASALEEIMKDLG
FT                   KKIDYVLNINVDSGLLLKRLTGRRICKECGATYHLEFNAPAKADVCDKCGGELYQRSDD
FT                   NEETVANRLDVNIKQTKPLLDFYEELGYLQSINGEQDINKVFADIDVLIGGLA"
FT   gene            132147..132893
FT                   /gene="maP1"
FT                   /locus_tag="BA_0132"
FT                   /old_locus_tag="BA0132"
FT   CDS_pept        132147..132893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maP1"
FT                   /locus_tag="BA_0132"
FT                   /old_locus_tag="BA0132"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /note="identified by match to protein family HMM PF00557;
FT                   match to protein family HMM TIGR00500"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24186"
FT                   /db_xref="GOA:A0A347ZXV7"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZXV7"
FT                   /protein_id="AAP24186.1"
FT                   /translation="MIICKTPREIEIMREAGRIVALTHQELKQHITPGITTKELDQIAE
FT                   KTIQKYGATPSFKGYNGFPGSICASVNEELVHGIPGKRKLKEGDIISIDIGAKYNGYHG
FT                   DSAWTYPVGNISESVQKLLDVTEKSLYLGLEQVKPGERLSNISHAVQTHAEENGFSIVR
FT                   EYVGHGIGQDLHEDPQIPHYGPPNRGPRLKPGMVICVEPMVNQGRRYVKTLSDDWTVVT
FT                   VDGKWCAHFEHTIALTEAGYEILTTL"
FT   gene            132962..133180
FT                   /gene="infA"
FT                   /locus_tag="BA_0133"
FT                   /old_locus_tag="BA0133"
FT   CDS_pept        132962..133180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="BA_0133"
FT                   /old_locus_tag="BA0133"
FT                   /product="translation initiation factor IF-1"
FT                   /note="identified by similarity to SP:P20458; match to
FT                   protein family HMM PF00575; match to protein family HMM
FT                   PF01176; match to protein family HMM TIGR00008"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24187"
FT                   /db_xref="GOA:Q81VQ7"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VQ7"
FT                   /protein_id="AAP24187.1"
FT                   /translation="MAKDDVIEVEGTVLETLPNAMFKVELENGHVVLAHVSGKIRMNFI
FT                   RILPGDKVTVELSPYDLNRGRITYRFK"
FT   gene            133216..133329
FT                   /gene="rpmJ"
FT                   /locus_tag="BA_0134"
FT                   /old_locus_tag="BA0134"
FT   CDS_pept        133216..133329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="BA_0134"
FT                   /old_locus_tag="BA0134"
FT                   /product="50S ribosomal protein L36"
FT                   /note="identified by similarity to SP:P20278; match to
FT                   protein family HMM PF00444; match to protein family HMM
FT                   TIGR01022"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24188"
FT                   /db_xref="GOA:Q81VQ6"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VQ6"
FT                   /protein_id="AAP24188.1"
FT                   /translation="MKVRPSVKPICEKCKVIRRRGKVMVICENPKHKQKQG"
FT   gene            133351..133716
FT                   /gene="rpsM"
FT                   /locus_tag="BA_0135"
FT                   /old_locus_tag="BA0135"
FT   CDS_pept        133351..133716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="BA_0135"
FT                   /old_locus_tag="BA0135"
FT                   /product="30S ribosomal protein S13"
FT                   /note="identified by similarity to SP:P20282; match to
FT                   protein family HMM PF00416; match to protein family HMM
FT                   TIGR03631"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24189"
FT                   /db_xref="GOA:P62176"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62176"
FT                   /protein_id="AAP24189.1"
FT                   /translation="MARIAGVDIPRDKRVVISLTYVFGIGRTTAEKILAEAGISEETRV
FT                   RDLTEDELGRIRDIIDRIKVEGDLRREVSLNIKRLMEIGSYRGLRHRRGLPVRGQNSKN
FT                   NARTRKGPRRTVANKKK"
FT   gene            133741..134130
FT                   /gene="rpsK"
FT                   /locus_tag="BA_0136"
FT                   /old_locus_tag="BA0136"
FT   CDS_pept        133741..134130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="BA_0136"
FT                   /old_locus_tag="BA0136"
FT                   /product="30S ribosomal protein S11"
FT                   /note="identified by similarity to SP:P04969; match to
FT                   protein family HMM PF00411; match to protein family HMM
FT                   TIGR03632"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24190"
FT                   /db_xref="GOA:Q81VQ5"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VQ5"
FT                   /protein_id="AAP24190.1"
FT                   /translation="MARKTNTRKKRVKKNIEAGVAHIRSTFNNTIVTLTDTHGNALSWS
FT                   SAGALGFRGSRKSTPFAAQMAAETAAKAAMEHGLKTLEVTVKGPGAGREAAIRALQAAG
FT                   LEVTAIRDVTPVPHNGCRPPKRRRV"
FT   gene            134311..135255
FT                   /gene="rpoA"
FT                   /locus_tag="BA_0137"
FT                   /old_locus_tag="BA0137"
FT   CDS_pept        134311..135255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="BA_0137"
FT                   /old_locus_tag="BA0137"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by similarity to EGAD:15427; match to
FT                   protein family HMM PF01000; match to protein family HMM
FT                   PF01193; match to protein family HMM PF03118; match to
FT                   protein family HMM TIGR02027"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24191"
FT                   /db_xref="GOA:Q81VQ4"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VQ4"
FT                   /protein_id="AAP24191.1"
FT                   /translation="MIEIEKPKIETVELNEDAKYGKFVIEPLERGYGTTLGNSLRRILL
FT                   SSLPGAAVTAIQIDGVLHEFSTVEGVVEDVTTIILNLKKLALKIYSEEEKTLEIDVQGE
FT                   GIVTAADITHDSDVEILNPDLHIATLAKDAHFRVRLTAKRGRGYTPADANKSEDQPIGV
FT                   IPIDSIYTPVSRVTYQVEKTRVGQVANYDKLTLDVWTDGSIGPKEAISLGAKILTEHLN
FT                   IFVGLTDEAQNAEIMVEKEEDQKEKVLEMTIEELDLSVRSYNCLKRAGINTVQELANKT
FT                   EEDMMKVRNLGRKSLEEVKHKLEELGLGLRKDD"
FT   gene            135291..135653
FT                   /gene="rplQ"
FT                   /locus_tag="BA_0138"
FT                   /old_locus_tag="BA0138"
FT   CDS_pept        135291..135653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="BA_0138"
FT                   /old_locus_tag="BA0138"
FT                   /product="50S ribosomal protein L17"
FT                   /note="identified by similarity to SP:P20277; match to
FT                   protein family HMM PF01196; match to protein family HMM
FT                   TIGR00059"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24192"
FT                   /db_xref="GOA:Q81VQ3"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VQ3"
FT                   /protein_id="AAP24192.1"
FT                   /translation="MAYRKLGRTSAQRKAMLRDLATDLIINERIQTTETRAKELRSVVE
FT                   KMITLGKRGDLHARRQAAAFIRNEVANAETGQDALQKLFADVAPRYAERQGGYTRIAKI
FT                   GPRRGDAAPMVIIELV"
FT   gene            135757..136599
FT                   /locus_tag="BA_0139"
FT                   /old_locus_tag="BA0139"
FT   CDS_pept        135757..136599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0139"
FT                   /old_locus_tag="BA0139"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24193"
FT                   /db_xref="GOA:Q81VQ2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VQ2"
FT                   /protein_id="AAP24193.1"
FT                   /translation="MKKEKLRTENISFQYPGAATYALKDVSFSLFEGEWVSVIGQNGSG
FT                   KSTLAKLLNGLFLPEAGTITVNDTMILSEETVWDVRKQIGMVFQNPDNQFVGTTVQDDV
FT                   VFGLENIGMPREQMVERLNQALRLVRMEDFLNDEPHSLSGGQKQRVAIAGVLALQPSIL
FT                   ILDEATSMLDPQGRREVVETVRQLVNEKGITVLSITHDLEEAAQSDRVIILNKGEILEE
FT                   GTPEQIFKSSHMLQEIGLDVPFSVKIAELLKRNEILLQNTHLTMESLVNELWRLHSKK"
FT   gene            136575..137456
FT                   /locus_tag="BA_0140"
FT                   /old_locus_tag="BA0140"
FT   CDS_pept        136575..137456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0140"
FT                   /old_locus_tag="BA0140"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24194"
FT                   /db_xref="GOA:Q81VQ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VQ1"
FT                   /protein_id="AAP24194.1"
FT                   /translation="MEITFQKVEHRYQYKTPFERRALYDVDVSFPSGGYYAIIGHTGSG
FT                   KSTMIQHLNGLLQPTNGTVQIGEHFISAGKKEKKLKPLRKKVGVVFQFPEHQLFEETVE
FT                   KDICFGPTNFGVSEEAAKQKAREAIELVGLEPELLARSPFELSGGQMRRVAIAGVLAME
FT                   PEVLVLDEPTAGLDPKGQNELMEMFYKLHKEKGLTVILVTHNMEDAAKYAEQIVVMHKG
FT                   TVFLQGSAEEVFSHADELEKIGVDLPMSLKYKRAIEEKFGISIPKATLSLEDLTHEVVQ
FT                   VLRKGGHESCSS"
FT   gene            137444..138238
FT                   /locus_tag="BA_0141"
FT                   /old_locus_tag="BA0141"
FT   CDS_pept        137444..138238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0141"
FT                   /old_locus_tag="BA0141"
FT                   /product="cobalt transport protein"
FT                   /note="identified by match to protein family HMM PF02361"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24195"
FT                   /db_xref="GOA:A0A2A7D0V9"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR024919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A7D0V9"
FT                   /protein_id="AAP24195.1"
FT                   /translation="MQQLIIGRYIPGNSLIHQLDPRTKLLIVFLYVFVVFLANNAISYG
FT                   FLFLYALIALFFAKVPIRYVLSGLKPILWIFLFTFFLHIFTNKEGEVLFQLGWFSIHEK
FT                   GLEQGIYISIRFFVIILMTTLLTLTTTPIEITDGLETLLKPLKRIKVPVHEIALMMSIS
FT                   LRFIPTLMDETSKIMKAQSSRGIDFAGGPIKDRMKAIISLLVPLFISAFKRAEDLAIAM
FT                   EARGYQSGEGRTKFRQLRWKTSDTVTIISLLCLACILAWVRS"
FT   gene            138253..138996
FT                   /gene="truA1"
FT                   /locus_tag="BA_0142"
FT   CDS_pept        138253..138996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA1"
FT                   /locus_tag="BA_0142"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="identified by similarity to SP:P70973; match to
FT                   protein family HMM PF01416; match to protein family HMM
FT                   TIGR00071"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ49980"
FT                   /db_xref="GOA:A0A347ZXW7"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZXW7"
FT                   /protein_id="ACZ49980.1"
FT                   /translation="MDRIKCTVAYDGMHFCGYQIQPQHRTVQQEIEKALQKLHKGELVR
FT                   VQASGRTDSTVHAKGQVIHFDTPLSLEEWQWSNALNTMLPDDIVITQVEKKTEEFHARY
FT                   GVERKEYRYRVLVSKTADVFRRNYVYQYPYPLEVNSIRKAIPYFIGTHDFTSFCSAKTD
FT                   KKDKVRTIYEIELIEQDDELIFRFVGNGFLYNMVRIIVGTLLNVGQGKLDPDSIPEILA
FT                   KQNRQFAGKMAPGHGLYLWQVNYNN"
FT   gene            139149..139586
FT                   /gene="rplM"
FT                   /locus_tag="BA_0143"
FT                   /old_locus_tag="BA0143"
FT   CDS_pept        139149..139586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="BA_0143"
FT                   /old_locus_tag="BA0143"
FT                   /product="50S ribosomal protein L13"
FT                   /note="identified by similarity to EGAD:97842; match to
FT                   protein family HMM PF00572; match to protein family HMM
FT                   TIGR01066"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24196"
FT                   /db_xref="GOA:Q81VP9"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VP9"
FT                   /protein_id="AAP24196.1"
FT                   /translation="MRTTFMAKANEVERKWYVVDAEGQTLGRLASEVASILRGKNKPTF
FT                   TPHVDTGDHVIIINAEKIHLTGNKLNDKIYYRHTNHPGGLKQRTALEMRTNYPVQMLEL
FT                   AIKGMLPKGRLGRQVSKKLNVYAGAEHPHQAQKPEVYELRG"
FT   gene            139608..140000
FT                   /gene="rpsI"
FT                   /locus_tag="BA_0144"
FT                   /old_locus_tag="BA0144"
FT   CDS_pept        139608..140000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="BA_0144"
FT                   /old_locus_tag="BA0144"
FT                   /product="30S ribosomal protein S9"
FT                   /note="identified by similarity to SP:P21470; match to
FT                   protein family HMM PF00380"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24197"
FT                   /db_xref="GOA:Q81VP8"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VP8"
FT                   /protein_id="AAP24197.1"
FT                   /translation="MAQVQYYGTGRRKSSVARVRLVSGEGRVIINGRDFENYIPFAALR
FT                   EVVKQPLVATETLGNYDVLVNVNGGGYTGQAGAIRHGISRALLKADPEYRLTLKRAGLL
FT                   TRDARMKERKKYGLKGARRAPQFSKR"
FT   gene            140163..140591
FT                   /locus_tag="BA_0145"
FT                   /old_locus_tag="BA0145"
FT   CDS_pept        140163..140591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0145"
FT                   /old_locus_tag="BA0145"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01BH0239"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24198"
FT                   /db_xref="InterPro:IPR019667"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TQB3"
FT                   /protein_id="AAP24198.1"
FT                   /translation="MNVIVSLQEKQKEKQLKYERKMLRELSLKTLRSNIRDAFQMQELH
FT                   RQYEDYCIELGIESYLLGARYSKFGYYGESFFDVKYRALEEEQQLTETLFQFLTSMTMR
FT                   EIKLQDEELLFESCQQFIGLWWQEGYEKGERRYRLKLH"
FT   gene            140658..141371
FT                   /gene="cwlD"
FT                   /locus_tag="BA_0146"
FT                   /old_locus_tag="BA0146"
FT   CDS_pept        140658..141371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cwlD"
FT                   /locus_tag="BA_0146"
FT                   /old_locus_tag="BA0146"
FT                   /product="N-acetylmuramoyl-L-alanine amidase CwlD"
FT                   /EC_number="3.5.1.28"
FT                   /note="identified by match to protein family HMM PF01520;
FT                   match to protein family HMM TIGR02883"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24199"
FT                   /db_xref="GOA:A0A2P0H8V2"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR014234"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H8V2"
FT                   /protein_id="AAP24199.1"
FT                   /translation="MKRIRIISFALAAVILFFLVKQEFQIIKSWRAWNLPLSGKVIVLD
FT                   AGHGGPDGGAVGGKDIVEKDITLEITKKVQDYLQEQGALVILTREGDYDLAQKDTKSYS
FT                   RRKAEDLKKRVEIINKPDVDFFASIHLNALTSSGSKGAQTFYYRSSIENERAAKFIQAE
FT                   LRTSLENTNRSAKTISHVYLLKYAKTPGALIEAGFLSNVNERYMLNSEKYQQKVAAAVY
FT                   RGILRYFTEKGNPPE"
FT   gene            141516..142580
FT                   /locus_tag="BA_0147"
FT                   /old_locus_tag="BA0147"
FT   CDS_pept        141516..142580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0147"
FT                   /old_locus_tag="BA0147"
FT                   /product="mrp protein"
FT                   /note="identified by match to protein family HMM PF01883"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24200"
FT                   /db_xref="GOA:A0A3P1TQ37"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TQ37"
FT                   /protein_id="AAP24200.1"
FT                   /translation="MVMKEQVVEALEGIVDPFLHKTLKETGAIKEVTVKPEKKHVSVKI
FT                   AIVKTGTAEQMQLQSGIVKLVKELGAATVGLRFAEFTEEELAQFAPEQEEQTESLLSPN
FT                   SKTTFLAVASGKGGVGKSTVSVNLAIALARLGKKVGIIDADIYGFSVPDMMGIEKRPVV
FT                   RGDKIIPVERLGVKVISMGFFVEDNAPVIWRGPMLGKMLNHFFTEVEWGDLDYLVLDLP
FT                   PGTGDVALDLHSMLPACKEIIVTTPHPTAAFVAARAGAMALRTEHSILGVVENMAYFES
FT                   KTTGEKEYVFGRGGGDKLATELQTEVLGRIPLQQPDWNKEDFAPSVYEDTHTTGLIYRT
FT                   IAETVIDKTAFAQK"
FT   gene            complement(142637..143254)
FT                   /gene="gerD"
FT                   /locus_tag="BA_0148"
FT                   /old_locus_tag="BA0148"
FT   CDS_pept        complement(142637..143254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerD"
FT                   /locus_tag="BA_0148"
FT                   /old_locus_tag="BA0148"
FT                   /product="spore germination protein GerD"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24201"
FT                   /db_xref="InterPro:IPR041262"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A8KMF1"
FT                   /protein_id="AAP24201.1"
FT                   /translation="MKRMLLVLTSSFLFLVLVACAQEKEAKSELDYDQTKKMIVDILKT
FT                   DQGKKAIQDVLTDEKMKQALILDETVVKKTIEDAMVSDKGQQFWEKLFKDPEFSSKFAK
FT                   SMGKEQTALMKTLLKDPEYQAGVIEIMKNPEVEKMMLQTMKSKEYRQYLQQVLTETAES
FT                   PLFQAKMIDIISKGVQKAEKSGSDKKEAGGEGGSQEGKKEQQ"
FT   gene            143394..144005
FT                   /gene="kbaA"
FT                   /locus_tag="BA_0149"
FT                   /old_locus_tag="BA0149"
FT   CDS_pept        143394..144005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kbaA"
FT                   /locus_tag="BA_0149"
FT                   /old_locus_tag="BA0149"
FT                   /product="kinb signaling pathway activation protein"
FT                   /note="identified by similarity to SP:P16449"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24202"
FT                   /db_xref="GOA:A0A0J1HLZ1"
FT                   /db_xref="InterPro:IPR024164"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1HLZ1"
FT                   /protein_id="AAP24202.1"
FT                   /translation="MNSRKWVRLFFTTLFLGGISTVIIGFVLEWDKYAKFFQNFDGKEI
FT                   LAVSFWLMGVGFIFSVISQMGFFAYLTIHRFGLGMFRSSSLWNIVQLFFIAFVLFDFVY
FT                   LRSVLIANGEVSLGNNILVAGVLFMFGAIVAYIKSKETNKKAFVPALFFMVVVTILEWV
FT                   PALRINDTDWLYLMVIPLLLCNAYQLLILHRLIGKTSKSA"
FT   gene            complement(144110..144874)
FT                   /locus_tag="BA_0150"
FT                   /old_locus_tag="BA0150"
FT   CDS_pept        complement(144110..144874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0150"
FT                   /old_locus_tag="BA0150"
FT                   /product="putative polysaccharide deacetylase"
FT                   /note="identified by match to protein family HMM PF01522;
FT                   match to protein family HMM TIGR02764"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24203"
FT                   /db_xref="GOA:A0A347ZXX5"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR014132"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZXX5"
FT                   /protein_id="AAP24203.1"
FT                   /translation="MFFFFITSKRNFKHISLIVILSLFTAWLLFLKTYSHESAFSTATG
FT                   PKVIYKGDTSKKQVAFTFDISWGDKKAIPILDTLKERDIKNATFFLSAAWAERHPDVVE
FT                   RIIKDGHEIGSMGYNYTSYTSLETNEIRRDLLRAQDVFTKLGVKQIKLLRPPSGDFNKA
FT                   TLKIAESLGYTVVHWSNNSNDWKNPGVNKIVSTVSNNLKGGDIVLLHASDSALQTNKAL
FT                   PLLLQKLKSDGYEQISVSQLISNTSTKSKDVQ"
FT   gene            145045..145263
FT                   /locus_tag="BA_0151"
FT                   /old_locus_tag="BA0151"
FT   CDS_pept        145045..145263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0151"
FT                   /old_locus_tag="BA0151"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24204"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1T3UXZ4"
FT                   /protein_id="AAP24204.1"
FT                   /translation="MLGFMLTKEEKKEMEYILKRELEELLFDFEDERIHDVVKKAMEER
FT                   YKIIFCLFRRVANAEDCIRYVRKRTFY"
FT   gene            145421..145519
FT                   /locus_tag="BA_0152"
FT                   /old_locus_tag="BA0152"
FT   CDS_pept        145421..145519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0152"
FT                   /old_locus_tag="BA0152"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24205"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H9S3"
FT                   /protein_id="AAP24205.1"
FT                   /translation="MKTERNKQRETSIFILDARQTNFIGEFDPGSG"
FT   gene            145515..147021
FT                   /gene="rrsD"
FT                   /locus_tag="BA_5755"
FT   rRNA            145515..147021
FT                   /gene="rrsD"
FT                   /locus_tag="BA_5755"
FT                   /product="16S ribosomal RNA"
FT   gene            147200..150107
FT                   /gene="rrlD"
FT                   /locus_tag="BA_5756"
FT   rRNA            147200..150107
FT                   /gene="rrlD"
FT                   /locus_tag="BA_5756"
FT                   /product="23S ribosomal RNA"
FT   gene            150194..150309
FT                   /gene="rrfD"
FT                   /locus_tag="BA_5757"
FT   rRNA            150194..150309
FT                   /gene="rrfD"
FT                   /locus_tag="BA_5757"
FT                   /product="5S ribosomal RNA"
FT   gene            150319..150393
FT                   /locus_tag="BA_5758"
FT   tRNA            150319..150393
FT                   /locus_tag="BA_5758"
FT                   /product="tRNA-Asn"
FT   gene            150398..150470
FT                   /locus_tag="BA_5759"
FT   tRNA            150398..150470
FT                   /locus_tag="BA_5759"
FT                   /product="tRNA-Thr"
FT   gene            150495..150569
FT                   /locus_tag="BA_5760"
FT   tRNA            150495..150569
FT                   /locus_tag="BA_5760"
FT                   /product="tRNA-Glu"
FT   gene            150575..150650
FT                   /locus_tag="BA_5761"
FT   tRNA            150575..150650
FT                   /locus_tag="BA_5761"
FT                   /product="tRNA-Val"
FT   gene            150668..150751
FT                   /locus_tag="BA_5762"
FT   tRNA            150668..150751
FT                   /locus_tag="BA_5762"
FT                   /product="tRNA-Tyr"
FT   gene            150817..150891
FT                   /locus_tag="BA_5763"
FT   tRNA            150817..150891
FT                   /locus_tag="BA_5763"
FT                   /product="tRNA-Gln"
FT   gene            150897..150972
FT                   /locus_tag="BA_5764"
FT   tRNA            150897..150972
FT                   /locus_tag="BA_5764"
FT                   /product="tRNA-Lys"
FT   gene            150978..151049
FT                   /locus_tag="BA_5765"
FT   tRNA            150978..151049
FT                   /locus_tag="BA_5765"
FT                   /product="tRNA-Gly"
FT   gene            151060..151132
FT                   /locus_tag="BA_5766"
FT   tRNA            151060..151132
FT                   /locus_tag="BA_5766"
FT                   /product="tRNA-Ala"
FT   gene            151247..152393
FT                   /pseudo
FT                   /locus_tag="BA_0153"
FT                   /old_locus_tag="BA0153"
FT                   /note="glycerate kinase, authentic frameshift; an automated
FT                   process has identified a potential problem with this gene
FT                   model; it may contain one or more premature stops and/or
FT                   frameshifts"
FT   gene            152603..153496
FT                   /gene="rocF"
FT                   /locus_tag="BA_0154"
FT                   /old_locus_tag="BA0154"
FT   CDS_pept        152603..153496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocF"
FT                   /locus_tag="BA_0154"
FT                   /old_locus_tag="BA0154"
FT                   /product="arginase"
FT                   /EC_number="3.5.3.1"
FT                   /note="identified by similarity to EGAD:14086; match to
FT                   protein family HMM PF00491; match to protein family HMM
FT                   TIGR01229"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24206"
FT                   /db_xref="GOA:A0A347ZXX9"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZXX9"
FT                   /protein_id="AAP24206.1"
FT                   /translation="MKKEISVIGVPMDLGQMRRGVDMGPSAIRYAGVIERIEEIGYDVK
FT                   DMGDICIEREKEVDVNTSLRNLTQVATVCNELASKVDHIIEEGRFPLVLGGDHSIAIGT
FT                   LAGVAKHYKNLGVIWYDAHGDLNTEETSPSGNIHGMSLAASLGYGHPTLVDLYGAYPKV
FT                   KKENVVIIGARALDEGEKDFIRNEGIKVFTMHEIDRMGMTAVMEETIEYLSHTDGVHLS
FT                   LDLDGLDPHDAPGVGTPVIGGLSYRESHLAMEMLAEADIVTSAEFVEVNMILDERNRTA
FT                   TTAVALMGSLFGEKLK"
FT   gene            153745..154566
FT                   /locus_tag="BA_0155"
FT                   /old_locus_tag="BA0155"
FT   CDS_pept        153745..154566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0155"
FT                   /old_locus_tag="BA0155"
FT                   /product="conserved hypothetical protein TIGR00159"
FT                   /note="identified by similarity to EGAD:108364; match to
FT                   protein family HMM PF02457; match to protein family HMM
FT                   TIGR00159"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24207"
FT                   /db_xref="GOA:A0A347ZXY0"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZXY0"
FT                   /protein_id="AAP24207.1"
FT                   /translation="MPFEDTTILKYLSTALDIAVVWFIIYKLILIIRGTKAVQLLKGIT
FT                   VIIVVRMISIFLELRTLYWLTEQVLTWGFLAVIIIFQPELRRALEQLGRGSLFSRTGTH
FT                   EDDEPEMVATAIAKATEYMGKRRIGALITLSKETGMGDYVETGIPLNANVSSELLINIF
FT                   IPNTPLHDGAVIMQGSTIKAAACYLPLSESPFISKELGTRHRAAMGVSEVTDSITVVVS
FT                   EETGQISLTKNGKLHRDLKTEQLKDMLLAEFSANEKTTSSSLWNWRRKRHG"
FT   gene            154559..156049
FT                   /locus_tag="BA_0156"
FT                   /old_locus_tag="BA0156"
FT   CDS_pept        154559..156049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0156"
FT                   /old_locus_tag="BA0156"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:108365; match to
FT                   protein family HMM PF07949"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24208"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZXY1"
FT                   /protein_id="AAP24208.1"
FT                   /translation="MDKLMENHWFLKGISLLLACMLFMSATLTEKNTTSGILPFANDAK
FT                   ETLTNYAINVKYDEEKYIVSGIPAEGVKVKLEGPKAAVATAKAKKQFDIPVDLRDSEKG
FT                   TYEVSLKTNGLPDDVKGTVQPSTIKVTLHEKARKYVHVDLKLSNEDQMPAGAILEKSSL
FT                   KPDTVEVVGTKEEIESISSAKAYVDLKGVNKTVTKTPEVTLYNKEGKRLNVRTSPSKIS
FT                   VTLNVATQATANNTEKTVPIAYTKKGSLPEGLAVTNISVEPREVTIAGPKDILDNIQSI
FT                   EGVEVDLSQLTESTTFDTSVLLPKGVTSAKPNQVKVSVGVQKTKQTKTRTIDGISIQKN
FT                   GLSKDVTAQLLSPQDGKISVDISGETSIVDKIIANQITAVINLQNVSPGTKDVAIQVSG
FT                   PSNISIEPKQKSAKVTIVKKENPDKEVQGNGEQPNSNNNQDNQDNQTEKPKNPEPEPNP
FT                   DPDPEKEKEPEQNKDKETSQEPTVDNQKEPEKGANHNG"
FT   gene            156042..157388
FT                   /gene="glmM"
FT                   /locus_tag="BA_0157"
FT                   /old_locus_tag="BA0157"
FT   CDS_pept        156042..157388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmM"
FT                   /locus_tag="BA_0157"
FT                   /old_locus_tag="BA0157"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="identified by similarity to EGAD:108366; match to
FT                   protein family HMM PF00408; match to protein family HMM
FT                   PF02878; match to protein family HMM PF02879; match to
FT                   protein family HMM PF02880; match to protein family HMM
FT                   TIGR01455"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24209"
FT                   /db_xref="GOA:Q81VN7"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="PDB:3PDK"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VN7"
FT                   /protein_id="AAP24209.1"
FT                   /translation="MGKYFGTDGVRGVANKELTPELAFKIGRFGGYVLTKDTDRPKVII
FT                   GRDTRISGHMLEGALVAGLLSTGAEVMRLGVISTPGVAYLTKALDAQAGVMISASHNPV
FT                   QDNGIKFFGSDGFKLTDEQEAEIEALLDKEVDELPRPTGTNLGQVSDYFEGGQKYLQYI
FT                   KQTVEEDFSGLHIALDCAHGATSSLAPYLFADLEADISTMGTSPNGMNINDGVGSTHPE
FT                   VLAELVKEKGADIGLAFDGDGDRLIAVDEKGNIVDGDQIMFICAKYMKETGQLKHNTVV
FT                   STVMSNLGFYKALEANGITSDKTAVGDRYVMEEMKRGGYNLGGEQSGHIILLDYITTGD
FT                   GMLSALQLVNIMKMTKKPLSELAGEMTKFPQLLVNVRVTDKKLALENEKIKEIIRVVEE
FT                   EMNGDGRILVRPSGTEPLIRVMAEAPTQEVCDAYVHRIVEVVKAEVGAE"
FT   gene            157676..157861
FT                   /locus_tag="BA_0158"
FT                   /old_locus_tag="BA0158"
FT   CDS_pept        157676..157861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0158"
FT                   /old_locus_tag="BA0158"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24210"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TVZ9"
FT                   /protein_id="AAP24210.1"
FT                   /translation="MREKERIQTSCISIYGLKPNREEGESRYKLTGLAICNPFFSINKN
FT                   GIGLCRYMFAEQRKHL"
FT   gene            157874..159676
FT                   /gene="glmS"
FT                   /locus_tag="BA_0159"
FT                   /old_locus_tag="BA0159"
FT   CDS_pept        157874..159676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="BA_0159"
FT                   /old_locus_tag="BA0159"
FT                   /product="glutamine--fructose-6-phosphate transaminase
FT                   (isomerizing)"
FT                   /EC_number="2.6.1.16"
FT                   /note="identified by match to protein family HMM PF00310;
FT                   match to protein family HMM PF01380; match to protein
FT                   family HMM TIGR01135"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24211"
FT                   /db_xref="GOA:Q81VN5"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VN5"
FT                   /protein_id="AAP24211.1"
FT                   /translation="MCGIVGFIGEQDAKEILLKGLEKLEYRGYDSAGIAVQAENGVVVY
FT                   KEKGRIAKLREIVDENVAASVGIGHTRWATHGVPSKVNAHPHQSTSKRFTLVHNGVIEN
FT                   YELVKKEYLQDVTFVSETDTEVIVQLMEQQVSTGLSVEEAFRNTLSLLHGSYAIGLLDA
FT                   ENPNMIYVAKNKSPLLVGVGDNFNVVASDAMAMLQVTDQFIELMDKEIVIVMKESITIK
FT                   NLQGETIERAPFTAELDASDIEKGTYPHFMLKEIDEQPLVIRNIIQKYQDENGEIELDQ
FT                   DIRNAILDSDRIYIIACGTSYHAGLVGKQFIEKFAKMPVEVHVASEFSYNMPLLTERPF
FT                   FIYISQSGETADSRAVLVQTNEMGHKALTITNVPGSTLSREADYTLPLYAGPEIAVAST
FT                   KAYTAQLAVLSILAADIAKAKGEVLGFDLTHELGLVANAMIELCDQKEEMDALAKQFLA
FT                   TTRNCFFIGRSVDFYVGLEGALKLKEISYIQAEGFAGGELKHGTIALIENGTPVIALAT
FT                   QEHVNLGIRGNVKEVVARGANPCIISMKGLEMEGDSFVLPAVHEALAPLVAVIPLQLIS
FT                   YYAALHRECDVDKPRNLAKSVTVE"
FT   gene            160040..160849
FT                   /locus_tag="BA_0160"
FT                   /old_locus_tag="BA0160"
FT   CDS_pept        160040..160849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0160"
FT                   /old_locus_tag="BA0160"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01BS02683; match
FT                   to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24212"
FT                   /db_xref="GOA:A0A384L9W6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L9W6"
FT                   /protein_id="AAP24212.1"
FT                   /translation="MSIVKNGTLQVIGASIYYEVRGSGPILLLIHGGGGDADKFHNIAD
FT                   HLAKWYTVVTYDRRGHSRSNLVNKNEDYHVHTHSEDAHRLLANLTKEPAYVFGSSSGAV
FT                   IGLDLCIRHPEQVQLLIPHEPVLLQLLSENELKQAINFLEDLKGNHQNEVMKLLSNIDD
FT                   SNSEPSKDMLTERLLGNSTYFTEYEIPGILSYTLNIDALKSLLKPASIQVRPAGGSISR
FT                   ETFPYHCAFNLAEHLGTEFAEFPGHHVGYNTVHHKEFAERLHDVIEN"
FT   gene            161256..161987
FT                   /gene="gntR"
FT                   /locus_tag="BA_0161"
FT                   /old_locus_tag="BA0161"
FT   CDS_pept        161256..161987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntR"
FT                   /locus_tag="BA_0161"
FT                   /old_locus_tag="BA0161"
FT                   /product="gluconate operon transcriptional repressor"
FT                   /note="identified by similarity to OMNI:NTL01BS03999; match
FT                   to protein family HMM PF00392; match to protein family HMM
FT                   PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24213"
FT                   /db_xref="GOA:A0A384KEY6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KEY6"
FT                   /protein_id="AAP24213.1"
FT                   /translation="MTKSMEFLYPEKWLSKASTGDRVASELRMRIIAGVIESGTILSEN
FT                   KIAADFSVSRSPVREALKLLVSENIIRLERMGAVVIGLTEKEIEEIYDVRLLIETFIFE
FT                   RLGKMDTNDLVRELNKIMEMMKIAIKYHDSDEFSYQDLLFHETIIRTIEHSYILMIWNN
FT                   LKPVMESLILLSMRTRFKEKYEDFERIIKNHELYIKAIESKDRALMIEALHQNFDDVQG
FT                   KVEDLWMSQQMLSKGVEQGHE"
FT   gene            161980..163515
FT                   /pseudo
FT                   /locus_tag="BA_0162"
FT                   /old_locus_tag="BA0162"
FT                   /note="gluconate kinase, authentic point mutation; an
FT                   automated process has identified a potential problem with
FT                   this gene model; it may contain one or more premature stops
FT                   and/or frameshifts"
FT   gene            163635..164981
FT                   /gene="gntP1"
FT                   /locus_tag="BA_0163"
FT                   /old_locus_tag="BA0163"
FT   CDS_pept        163635..164981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntP1"
FT                   /locus_tag="BA_0163"
FT                   /old_locus_tag="BA0163"
FT                   /product="gluconate permease"
FT                   /note="identified by similarity to EGAD:19179; match to
FT                   protein family HMM PF02447; match to protein family HMM
FT                   PF03600; match to protein family HMM TIGR00791"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24214"
FT                   /db_xref="GOA:A0A3P1TYM4"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TYM4"
FT                   /protein_id="AAP24214.1"
FT                   /translation="MPLVIVAIGILALLLLIMRFKLNTFISLIIVSVGVALALGMPPEK
FT                   IFKTIEAGLGGTLGHLALVFGLGAMLGKLLSDSGGAQRIAMTLVKKFGEKNIQWAVVTA
FT                   SFIIGIALFFEVGLVLLIPIVFAISRELKVSILYLGISMAAALSVTHGFLPPHPGPTAI
FT                   AGELHANIGEVLLYGFMIAVPTVVLAGPVFTKLAKKLVPEAFTKTGNIQSLGEQKVFKL
FT                   EETPGFGISVFTALLPVLLMAVATIITLLQKTMGFKDNSLLATIEFIGNADTAMLISLL
FT                   VAIYTMGLARNIPIKSVMESCTTAISNIGMMLLIIGGGGAFKQVLIDGGVGNYVAELFK
FT                   GTSLSPILLAWIIAAILRISLGSATVAALTTVGLVIPMLGQSDVNLALVVLATGAGSLI
FT                   ASHVNDAGFWMFKEYFGLSMKETFATWTLLETIVSVAGLGFTLLLSLFV"
FT   gene            165246..166655
FT                   /gene="yqjI"
FT                   /locus_tag="BA_0164"
FT                   /old_locus_tag="BA0164"
FT   CDS_pept        165246..166655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqjI"
FT                   /locus_tag="BA_0164"
FT                   /old_locus_tag="BA0164"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /EC_number="1.1.1.44"
FT                   /note="identified by similarity to SP:P80859; match to
FT                   protein family HMM PF00393; match to protein family HMM
FT                   PF03446; match to protein family HMM TIGR00873"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24215"
FT                   /db_xref="GOA:A0A2P0H8Y7"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H8Y7"
FT                   /protein_id="AAP24215.1"
FT                   /translation="MENLQIGVVGVGVMGKSLALNFESKGYSVALYDISKEKVDETIEE
FT                   NRGKNLVGTHIVEEFVNSLESPRKILLMVNAGEITDKAIDSLVPHLDKGDILIDGGNTY
FT                   FVDTIRRNKRLAEEGINFIGAGVSGGEEGALKGPSIMPGGQKDAYEKVKDMLENISAKV
FT                   NNEPCCSYIGPNGAGHYVKMVHNGIEYGDMQLICEAYFFLKQTLDLTAEEFHEIFAEWN
FT                   KGELNSYLIEITADIFKKKDEETGKPLVDVILDTAGQKGTGKWTSQSALDLGISLPIIT
FT                   ESVFARCISALKEERVNASKVLSGPKDKTAIGVEKAELIEAVRQALYMSKICSYAQGFT
FT                   QLKAASEEYNWNLDFGSISMLWRGGCIIRAAFLQNIKEAYETNTDLPNLLLDPYFKEIV
FT                   ESYQGGLRQIISMAVQQGIPIPAFSAAISYYDSYRTAKLPANLLQAQRDYFGAHTYKRV
FT                   DKEGTFHTKWI"
FT   gene            166998..168962
FT                   /locus_tag="BA_0165"
FT                   /old_locus_tag="BA0165"
FT   CDS_pept        166998..168962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0165"
FT                   /old_locus_tag="BA0165"
FT                   /product="putative prolyl oligopeptidase family protein"
FT                   /note="identified by match to protein family HMM PF00326;
FT                   match to protein family HMM PF07676"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24216"
FT                   /db_xref="GOA:A0A347ZXZ0"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZXZ0"
FT                   /protein_id="AAP24216.1"
FT                   /translation="MKVSEKTYLSIEEIISLPTVSSTNISDDGKNVAFVKRTANWEDNT
FT                   YRNHVWIYEKDKGKSYPLTTGDIDSIHPLWSPDSKSIAYLSSGGDGDMKNQIFVKSLDD
FT                   YSKVKITDEKEGISNFKWDPTGKGFYYITQSKECEEIKKRKELYGDFQHVGKEHQNNCL
FT                   CYIEMEKVIQNDKEEREINGVYQLTGGKDFYIHGFDISDNGKKVVCMATPSLNDHMNGD
FT                   LYILDVEARELQQMNVDKLLGGSACFSPEGNKICYSASIREKEYYRNHIQESTLEIYDM
FT                   NTGEVIQPLTNFDSMVMPLQWTAKGILIRWQDKTNYFIGLLAEDGTVETLREKVDGFIM
FT                   DASITRDGNHITYNKAITNETFEIYLDDKKITNENSLFEGKLKSNREIISWRSSDGLEI
FT                   EGVLSTPVEFDANKKYPLLVVIHGGPAWASFPIFSNCFNEKYPIEQFVEKGFIVLEPNY
FT                   RGSSGYGNEFLKANYRKQGLADYDDVISGVDELVEKGMVDKDRVGVMGWSNGGYISAFC
FT                   STFSSRFKAISVGGGITNWSTHYVNTDIPYFIRMYLGNTPWNDPDIYKRTSPMTYIKSA
FT                   CTPTLIQHGEKDARIPITNAYELHQGLKDMEVDTELIIFKGMAYSSDQPGVHVAIMKQN
FT                   LMWFSHYILGESMEDFSTI"
FT   gene            169081..169647
FT                   /locus_tag="BA_0166"
FT                   /old_locus_tag="BA0166"
FT   CDS_pept        169081..169647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0166"
FT                   /old_locus_tag="BA0166"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:22775861"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24217"
FT                   /db_xref="InterPro:IPR025352"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H8V3"
FT                   /protein_id="AAP24217.1"
FT                   /translation="MTENKNELSVEQREELLKVLQARFEKNMNRHEGLEWAKVETKLAT
FT                   NNEKLWTLNEMEVTGGEPDVVGYDEEKDEYTFYDCSKESPKGRRSLCYDLEALESRKKH
FT                   KPENNAIDVAAAMGIELLTEQQYRELQKLGDFDMKSSSWVQTPSDIRELGGALFCDYRF
FT                   GHVFVYHNGADSYYAARGFRGSLRV"
FT   gene            complement(169719..170225)
FT                   /locus_tag="BA_0167"
FT                   /old_locus_tag="BA0167"
FT   CDS_pept        complement(169719..170225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0167"
FT                   /old_locus_tag="BA0167"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01BH2256; match
FT                   to protein family HMM PF04173; match to protein family HMM
FT                   PF07681"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24218"
FT                   /db_xref="GOA:A0A0J1HN18"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1HN18"
FT                   /protein_id="AAP24218.1"
FT                   /translation="MVINFLRTDKRAAFILLFLRLYIGYTWLAAGIGKVFGQSFDASGF
FT                   LKGAIAQASGDHPAVQSWWADFLQHFVLPNADLFSFLVQWGEILVGLGLILGGLTKTAA
FT                   FFGIIMNLAFLLSGTVSVNPNLLILTMFILVAGQNAGRIGLDGYVFPKLFRKNSHGTYK
FT                   LSKTA"
FT   gene            complement(170466..171380)
FT                   /locus_tag="BA_0168"
FT                   /old_locus_tag="BA0168"
FT   CDS_pept        complement(170466..171380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0168"
FT                   /old_locus_tag="BA0168"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:EF3019"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24219"
FT                   /db_xref="GOA:A0A2B6BZ77"
FT                   /db_xref="InterPro:IPR025672"
FT                   /db_xref="InterPro:IPR029101"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2B6BZ77"
FT                   /protein_id="AAP24219.1"
FT                   /translation="MDTSLKNALKKAQRKQLLKIIITSILVVIILIPIIYKVGNYFAAK
FT                   GSMRLHEQLFLYNSIAEPNVQIDSQVTSSSSMFGGNITSNRSKNINGYVVKWNTLTSPY
FT                   NWFRSNIDYNEVIPGTHWGRSNTESYNYDKQTKNKVATFYNPAIKEYYDGVKNELSAVS
FT                   KMENYVAEVAISFDQPYTLKEIQTKIPDNLNIVWLYMVSPIRDESGGPAGMPVYGFEPG
FT                   TPLEESYKGFFDSLKQYNDGYDKDIQKFLKSNENKPFDQVKILGVMLTGKTENFKALEN
FT                   QNFIRGASVGVTAQIVPYIKPEK"
FT   gene            complement(171380..171871)
FT                   /locus_tag="BA_0169"
FT                   /old_locus_tag="BA0169"
FT   CDS_pept        complement(171380..171871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0169"
FT                   /old_locus_tag="BA0169"
FT                   /product="RNA polymerase sigma-70 factor, ECF family"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545; match to protein
FT                   family HMM PF08281; match to protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24220"
FT                   /db_xref="GOA:A0A2B6BYQ1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2B6BYQ1"
FT                   /protein_id="AAP24220.1"
FT                   /translation="MGKENILTSYLINLGEEVFKLLLAKGAIKEDAEDIIQNTFYKVYT
FT                   LLDDLTENNIRPWFFRVALNEYIDLKRKKEQQNIYLTEEIYSKLQYTDRELDAVLNKDE
FT                   IFYLLKDIKLEYKEAFFLKYYYDFTYEEIALILDIRVNSVKQKLHRARKTIHSTVGGKP
FT                   "
FT   gene            complement(172012..172974)
FT                   /locus_tag="BA_0170"
FT                   /old_locus_tag="BA0170"
FT   CDS_pept        complement(172012..172974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0170"
FT                   /old_locus_tag="BA0170"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24221"
FT                   /db_xref="InterPro:IPR031888"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R9B1"
FT                   /protein_id="AAP24221.1"
FT                   /translation="MNSYTLVELNGFHTDFNIPFNRQTEGGVILVNYSVKNSSAKDIYY
FT                   MPALDISFTGAQKVYSNYKDLIPKEDQLPTKLAPTNDYLVKAGETISGYIAYPFGKDDL
FT                   AKISSLSTVSVTVPTAQANKGKFDAPIGSPGSFSLSLNKQGAEKVATDKAFYQDKATAN
FT                   NMGDKKMLKEKSSINNSQELGAVNVTLDGYQFTQFTPNSVEAPRFANFKNGIVLLTVKF
FT                   KLDNKDTQDVSLSPISSTLRVNDGTQYTINEGMLLNYDYNASVKTGTSGELLQVFILDQ
FT                   EQYEKIWKEKSFEIELGPMRNKEAKDISQGKKAKFTLPK"
FT   gene            complement(172971..173312)
FT                   /locus_tag="BA_0171"
FT                   /old_locus_tag="BA0171"
FT   CDS_pept        complement(172971..173312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0171"
FT                   /old_locus_tag="BA0171"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24222"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R342"
FT                   /protein_id="AAP24222.1"
FT                   /translation="MSKKLLSLFSAVIVAAFVITGCGQSDTTNKEQKENAAKENKTEKT
FT                   DTTKENKPEEKNPKTRKLKIKRRKIPLLAPAIILNLFPTWKKKQAEKQKFFLKIRNHKS
FT                   INLKMFQYR"
FT   gene            173755..174528
FT                   /pseudo
FT                   /locus_tag="BA_0172"
FT                   /old_locus_tag="BA0172"
FT                   /note="oxidoreductase, short-chain dehydrogenase/reductase
FT                   family, authentic point mutation; an automated process has
FT                   identified a potential problem with this gene model; it may
FT                   contain one or more premature stops and/or frameshifts"
FT   gene            complement(174566..175234)
FT                   /locus_tag="BA_0173"
FT                   /old_locus_tag="BA0173"
FT   CDS_pept        complement(174566..175234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0173"
FT                   /old_locus_tag="BA0173"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by similarity to OMNI:NTL01EC00198; match
FT                   to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24223"
FT                   /db_xref="GOA:A0A2B6BLE3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2B6BLE3"
FT                   /protein_id="AAP24223.1"
FT                   /translation="MENKSFLDEWGKVIWEATIQTFQMTSISLFISILIALPLGVTLVL
FT                   TRPGGQHENKIIYSILNTIINIIRSLPFIILLFFILPFTKFLMGTSIGVQGVIVPLVVF
FT                   TAPYIARLMETALLEVDRGVIEAYQAMGVSTIQIIWHVMVKEARPSLVLGLTIATIGLI
FT                   GATAMAGLVGAGGLGDLAYRFGHLRYEPEVMYATVFILIILVQGLQSLGNGIARRLKKD
FT                   "
FT   gene            complement(175209..176249)
FT                   /locus_tag="BA_0174"
FT                   /old_locus_tag="BA0174"
FT   CDS_pept        complement(175209..176249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0174"
FT                   /old_locus_tag="BA0174"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to OMNI:NTL01EC00199; match
FT                   to protein family HMM PF00005; match to protein family HMM
FT                   PF09383"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24224"
FT                   /db_xref="GOA:Q81VM2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VM2"
FT                   /protein_id="AAP24224.1"
FT                   /translation="MIELKNVSKVFTTKKGNVEALKSTSLQVKKGEVFGIIGYSGAGKS
FT                   TLIRCVNLLEKPTTGNIIVNEQDLTTLSTKELAKARQKIGMIFQGFNLLKTVTVYENIA
FT                   LPLRLAGVPKLEIEKRVEKYLRIVDLFNRKDAYPSELSGGQKQRVAIARALSHEPEVLL
FT                   SDEATSALDPETTDSILDLLLKINEEIGITILLITHEMNVIQRICDRVAVMEHGAVVES
FT                   GTVKDIFTNPQHVTTKKFVNSAFAAKIPAEVQKELQRTGEIVTLSFIGNSSGEPALAVA
FT                   TKRFQVYPNILSGNITQLKHEAYGKLVIHMQGEQNEINHALSFLQEQGIIVEGGRTDYG
FT                   KQVLFG"
FT   gene            complement(176262..177074)
FT                   /locus_tag="BA_0175"
FT                   /old_locus_tag="BA0175"
FT   CDS_pept        complement(176262..177074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0175"
FT                   /old_locus_tag="BA0175"
FT                   /product="putative ABC transporter, substrate-binding
FT                   protein"
FT                   /note="identified by similarity to GP:17984003; match to
FT                   protein family HMM PF03180"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24225"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TYN4"
FT                   /protein_id="AAP24225.1"
FT                   /translation="MKKVLLSIVSGAVLLLGACSAGSDKEVKALDEKKITVGVTGGPHE
FT                   QIFEKVKEVAAKDGLEIDVKVFNDYVAPNVSLDEKSLDVNSYQTKSYLDVFKAERNMKL
FT                   TEVFSTVTFPMGVYSKSLKDVKDLKDGDAIAVPNDPTNELRALKLFEKAGVLKVDPKAT
FT                   EKATAKDVIENPKNLKIVELEASQLPTQLSEVKAAAINTNFALGAKLSPAKDSIFREGK
FT                   DSPYVNWVVVRTENKDDAVVNKLKKAYQSKEVKEFIEKKFDGSVLPSW"
FT   gene            complement(177354..178262)
FT                   /locus_tag="BA_0176"
FT                   /old_locus_tag="BA0176"
FT   CDS_pept        complement(177354..178262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0176"
FT                   /old_locus_tag="BA0176"
FT                   /product="oxidoreductase, zinc-binding dehydrogenase
FT                   family"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM PF08240"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24226"
FT                   /db_xref="GOA:A0A347ZY02"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZY02"
FT                   /protein_id="AAP24226.1"
FT                   /translation="MKAIICTQYGPPNVLQLQNIEKPIPKKNEVLVKIHATSVSTGDCR
FT                   IRGFNSPLLFWIPMRLILGLRKPRNPILGVELAGEIEDIGTDVTQFKKGDQIFALTELN
FT                   LGGYAEYTCVHESGLITLKPTNVTYEEAAVIPFGGTSALHFLRKSRIKKGQQVLIYGAS
FT                   GSVGTAAIQLAKYFGATVTAVCSNSNFELVQSLGADKVIDYTKEDFTKRRERYDIIFDA
FT                   VGKHKKSLCKQVLAPNGKYVSVNGMMAKVSKEDMILLKKLTETEHLKPVIDRTYRLEEI
FT                   AEAHMYVEIGHKKGNVSITLK"
FT   gene            178408..179172
FT                   /locus_tag="BA_0177"
FT                   /old_locus_tag="BA0177"
FT   CDS_pept        178408..179172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0177"
FT                   /old_locus_tag="BA0177"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24227"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KB32"
FT                   /protein_id="AAP24227.1"
FT                   /translation="MKKIIFVSSLVLAISLGVGCSNEKTAKTDEPKKESVQKEKELTAK
FT                   DVFKKTNEAFKNEEHVTMTYGVGVKAEGTEMDIVKAKMQLEPKTKNSRSEMNISGTDVV
FT                   VYTVDGKVAGEVKKPNTGEVITVPEEQLNAGGMKATQDIIDKLEVPEVVLDKMKLEKSG
FT                   DKYKLKFTLKGQETESMLTSMDETQKKMLQAQNAKIEEVDAEYIITKDFKYESAKIDMI
FT                   MSSNGKDKAHIITNAKYTSYEKFDPIQLPAAK"
FT   gene            179305..180720
FT                   /locus_tag="BA_0178"
FT                   /old_locus_tag="BA0178"
FT   CDS_pept        179305..180720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0178"
FT                   /old_locus_tag="BA0178"
FT                   /product="oxidoreductase, FAD-binding protein"
FT                   /note="identified by match to protein family HMM PF01565"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24228"
FT                   /db_xref="GOA:A0A384L992"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L992"
FT                   /protein_id="AAP24228.1"
FT                   /translation="MVTVAYTVLLATSVHTYKKQLDHPIMSDVGKLLPTKIKRVESATD
FT                   EHSLIKLVQDANVSGEKISIAGMQHSQGGQTYYPHGTMLDMKGYNKILEFDPEKKRITV
FT                   QSGVTWNDIQKKVNPYGLAVQVMQSQNIFTVGGSLSVNVHGRDIRHEALIDTVESFRLL
FT                   MADGIVRNVSREENADLFPYVIGGYGLFGVILDVTLKLTNDELYETHTKMLDYKEYTSY
FT                   FKEKVKKDANVRMHLARISVAPNSFLREMYVTDYTLAQNQNMREEYSELKEETIIAAPK
FT                   FLLGLSRYSDWGKNTFWDIQRSYFERTDGKYETRNNVMRSDSTFMEYENPNRTEVLQEY
FT                   FVPIDSFTEYIDDLRNVLNEEEFNLLNITIRYVEKNENAVLSYAKDDMFALVLLINQGR
FT                   SENEIKKTEGVIQKMIDVTLKHNGSYYLPYYSYPTKEQLKRAYPRIEEFLGKKKEADPK
FT                   ERFVNLFYREYTK"
FT   gene            180717..181250
FT                   /locus_tag="BA_0179"
FT                   /old_locus_tag="BA0179"
FT   CDS_pept        180717..181250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0179"
FT                   /old_locus_tag="BA0179"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01BS01119"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24229"
FT                   /db_xref="GOA:A0A3P1TWC5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TWC5"
FT                   /protein_id="AAP24229.1"
FT                   /translation="MTYRRFVASQSIIMMAGSMVFPFYILLLRNVGNSFSQFGWAYGLF
FT                   ALTSALVYPLVGKLSDRVGDQKLLIIYAWTMAILMLCFPIATEVWHVYILQILMGVLGA
FT                   VQRNTEKTSLARKVVQENAGYEIGKYHVWTSIGGAVAIIATGYLVDFFTIGTIFYIASI
FT                   LYVVSGVVLSSKKI"
FT   gene            181329..183050
FT                   /locus_tag="BA_0180"
FT                   /old_locus_tag="BA0180"
FT   CDS_pept        181329..183050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0180"
FT                   /old_locus_tag="BA0180"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to OMNI:EF3018"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24230"
FT                   /db_xref="GOA:A0A2P0H8Z0"
FT                   /db_xref="InterPro:IPR025043"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H8Z0"
FT                   /protein_id="AAP24230.1"
FT                   /translation="MKFLILAILTLFLIPWTRRSGSKLRAVDKKGDEKVVKGKKSSILV
FT                   IPVLFWIGIAIYEYFWLIDDRADSILTHYSVAVAILIGLVLFSQDQIGKLEGTLKGLLM
FT                   FVLLASYGYFGYLHDIVISQTKYDSVVKIEKDISEPFTENDQPFTVPPKTAENKMKKVF
FT                   GDIPKVAYFELGELTPQMVNGEALYVAPIEVSGFFKARKAETIPGYVTMSGTNPDAEAK
FT                   LHLGYKMKYVPSMFFGNNLERVVRQAEPNLIFKGKPKLEVDDKGKPYYTMTYGEFISGR
FT                   SGFEIEGVVVVDAQTGEVKRYDKGKAPKFIDGVLNHETASTLNTYFGKYIHGFWNTKFS
FT                   QTDMKIPTEWGTKEGVTPIFGKDGTLYYFTDFTSPKEGVDSALGYSLIDARTGKLYYYN
FT                   GKEVKGIMDGSAASEVVDNSFKREKWHGTMPVIYNVYGKPSWIVPVIDDGGLVRAHTVI
FT                   YASNAKIFATGSTQKEALENYKNALSGSGDSFRPTSSSKEAQKEGVVQRVYKEKTGENT
FT                   IVYVLLENEQKVFMIPAKKFPYAMFTEVGDPIQITYLDTGEAMSSVSKFTNSNLNK"
FT   gene            183178..184428
FT                   /locus_tag="BA_0181"
FT                   /old_locus_tag="BA0181"
FT   CDS_pept        183178..184428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0181"
FT                   /old_locus_tag="BA0181"
FT                   /product="drug resistance transporter, Bcr/CflA family"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00710"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24231"
FT                   /db_xref="GOA:A0A3P1TX04"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TX04"
FT                   /protein_id="AAP24231.1"
FT                   /translation="MNEVNQEIYKPVKTNRLWMILVLGTLTAIGPLSIDMYLPSLPKLT
FT                   DDLQTGASLAQLTLTACLLGLSVGQLFVGSISDIYGRRKPLIIALIIYVASSLLCAVAP
FT                   SIWTLVLLRFLQGASGSAGIVISRAMVRDMYSGSEMTKFFSLLMLVNGAAPILAPIIGG
FT                   QLLQFTTWRGVFIVLGAISVFMLISATFVLRETLPPEERETGGLSGTLATYGKLLKDRL
FT                   FMGYALSQGLVTAAMFAYISGSPFVLQNIYGASPQQFSLFFAINGIGIIIASQVTGRLA
FT                   GKVNEKTLFVSGIVIAAVGGLSLLLTILLGIGLIGVLCSLFLVVSSVGVVSTTGFSLAM
FT                   RNQKQAAGTASALLGLLQFISGALVAPLVGIGGSNTALPMGIVIALCEIGAVLCYLFMA
FT                   RRSEKQFELQARQNLEV"
FT   gene            184679..185179
FT                   /locus_tag="BA_0183"
FT                   /old_locus_tag="BA0183"
FT   CDS_pept        184679..185179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0183"
FT                   /old_locus_tag="BA0183"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24232"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZY08"
FT                   /protein_id="AAP24232.1"
FT                   /translation="MKKALGIAVMGSMILLAGCNGSKDTKEPKEKVEQSTEQTEEMKEY
FT                   RAVHEKYDLKMNKEINNALQLFEVAKEKGGKEITTATYKEDVQKVTTSMLEDIDHIRKE
FT                   IRVPKSKEQEHEVYVGFLNESEQAMKKLQKLAKEDSSLIRDIEINFATASTYYKRFQAE
FT                   TKK"
FT   gene            complement(185196..185411)
FT                   /locus_tag="BA_0184"
FT                   /old_locus_tag="BA0184"
FT   CDS_pept        complement(185196..185411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0184"
FT                   /old_locus_tag="BA0184"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24233"
FT                   /db_xref="GOA:A0A0J1HN29"
FT                   /db_xref="InterPro:IPR025028"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1HN29"
FT                   /protein_id="AAP24233.1"
FT                   /translation="MDPLLLATIGLPLTIVILVIIGFYKLFIKKKSITSFYTPFDNITG
FT                   QTISEFHEEQKVLVSEDEDGDGKKKK"
FT   gene            185820..186743
FT                   /locus_tag="BA_0185"
FT                   /old_locus_tag="BA0185"
FT   CDS_pept        185820..186743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0185"
FT                   /old_locus_tag="BA0185"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /note="identified by similarity to EGAD:8134; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24234"
FT                   /db_xref="GOA:A0A3Q0PQB1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0PQB1"
FT                   /protein_id="AAP24234.1"
FT                   /translation="MEVYVIKKLSVMVFTLWVITTVTFLIMHIIPGDPFSSDAKIFPEE
FT                   VIQNMRAKYHLDEPLWNQYVAYLDGVVHFDFGESVQSTGQGVSEIITTGFGPSAIIGLQ
FT                   ALIISLLVGIAAGTFAALYHGKVIDYSVSLLAILGISIPSFILAPLFIQVFAIQFELLP
FT                   VASWGTFEHTVLPSFALALGPIAVITRFVRSNMIEVLQSDYIKLARAKGIPIKKIIIRH
FT                   ALRNAIVPVLTFVGPLMAGLLTGTFVIEKIFSIPGLGKYFVDSIFNRDYPVIMGTTIFY
FT                   SALLILCIFITDIIHRIVDPRIRSIT"
FT   gene            186760..187764
FT                   /locus_tag="BA_0186"
FT                   /old_locus_tag="BA0186"
FT   CDS_pept        186760..187764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0186"
FT                   /old_locus_tag="BA0186"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /note="identified by similarity to EGAD:19603; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24235"
FT                   /db_xref="GOA:A0A347ZY11"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZY11"
FT                   /protein_id="AAP24235.1"
FT                   /translation="MGAYEINNQLLTNEEKKELTINKDQQKISRKKEVFRKFVSNPIAV
FT                   LGSVTLLLIIVFSLIGESLTPFTASEQVKKATNLPPSSEHWFGTDDLGRDIWARTWAGG
FT                   KISLTVGLVAAALDIGLGVLIGGFSGYVRGRNCLGTLIDEWIIRGIEVLYGIPYLLIVI
FT                   LLLIVMKPGLFTIIIALALTGWIGMARLIRAQVLSLKQREFVIAAERLGTSHMKIIYGH
FT                   LIPNLTGIIIVNLSFTIPAAIFSESFLSFIGLGVQSPAASWGTMTNDALGTLLSGEWWQ
FT                   LFFPAIMIALIMFAFNAIGDGLQDAIDPKIIKRNRKEKKHGASLIFRKRNISR"
FT   gene            187721..188731
FT                   /locus_tag="BA_0187"
FT                   /old_locus_tag="BA0187"
FT   CDS_pept        187721..188731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0187"
FT                   /old_locus_tag="BA0187"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by similarity to EGAD:30672; match to
FT                   protein family HMM PF00005; match to protein family HMM
FT                   PF08352; match to protein family HMM TIGR01727"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24236"
FT                   /db_xref="GOA:A0A3P1TYP6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TYP6"
FT                   /protein_id="AAP24236.1"
FT                   /translation="MAQVLSLENVTLAVEKENSKQAIVKHVSFFINEGEIVALVGESGS
FT                   GKSVTAQSIIGLNQESIQFDDGNISFESKDLTNLQESEWNQIRGKDISFIFQDPLSSLN
FT                   PTMKVGRQITEVILQHEKKSKKEAKEIAINLLNDLGIHEAEKRFEQYPHQLSGGMRQRI
FT                   CLAIAFACHPKLVIADEPTTALDVTIQKQIMGLLKERKEKQNTSILLITHDLALVREVA
FT                   DRVVVMYGGRIVEKGTIQEVIGSPKHPYTKSLLQAIPNMDDAEKVLRAIEGTTPSIETL
FT                   NSFGCPFVNRCPVAIQECIHRFPERTTYSAEHSSHCWQHVLEHDRAKSKEKVNVS"
FT   gene            188728..189501
FT                   /locus_tag="BA_0188"
FT                   /old_locus_tag="BA0188"
FT   CDS_pept        188728..189501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0188"
FT                   /old_locus_tag="BA0188"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by similarity to SP:P24137; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24237"
FT                   /db_xref="GOA:A0A3P1TVZ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TVZ3"
FT                   /protein_id="AAP24237.1"
FT                   /translation="MTTDLITVKQVTKTYGSKNKEIAALKDISLAIPKGTTLGIIGESG
FT                   SGKTTLGKLIAGIESPTSGEIDYNGQVVHKLKAAHKRDFLQKVQFIFQDSTAALNPRWK
FT                   VRDSVTEGYISFGLGDKGLKDKVAGDALERVGLDRRYINRYPHEFSGGQRQRIAIARAL
FT                   LCEPEVLILDEPISALDVSLQIQIVHLLQKIQREQGYTYLFIAHDLPMVHYLCEKVAVL
FT                   YKGELVEFGNTDEVFRNPQHSYTKTLLASTPKISG"
FT   gene            189515..191125
FT                   /locus_tag="BA_0189"
FT                   /old_locus_tag="BA0189"
FT   CDS_pept        189515..191125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0189"
FT                   /old_locus_tag="BA0189"
FT                   /product="oligopeptide ABC transporter,
FT                   oligopeptide-binding protein"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24238"
FT                   /db_xref="GOA:A0A2P0H8Y2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H8Y2"
FT                   /protein_id="AAP24238.1"
FT                   /translation="MKKFLLFVIMTVLAITSVACGKKETQKASAGKGEGDRLVTNISSD
FT                   PYTLDAAISTDSTSGYVIGHLFSSLYTQDSDGKYQNELAEKEEVNADGTEYTIHLKKDI
FT                   KWSDGSPITANDFEFAWKRLLNPKTGSMNATEMYFIKGAEAYNTGKGEEGQVGIQVVDP
FT                   QTLKITLEHPVSSIKQKLASSLFIPLSKKSIDDNNKLKTNPKELITNGPFTLKEWKHNQ
FT                   AITVQKNKEYYDKKVTLKEIEFRIIPDSKTAYQLYKSKELDLLSGLPQEMIEKEKGNKE
FT                   YKRVAGFSSYIYSFNVEKEPFTNAKVRKAFSLAVDRKFIVEKLYKNNAQEAYAFVPEGA
FT                   KTQGGRDFRKEKGDYVKFDPEEAKKLLEEGMKEQGWSTLPAVTLKFTTDTQHKKVAEAM
FT                   QEMFKKNLGVDIKLENKEWKSYIDTYKQSDFQLAYMGWGGSLLDPITKLDLYAGDGLNN
FT                   YAKWHNKEFDALVKEAEVEQNEDKRFDLLHKAEDIMFTDSPLIPIIFPSDSYLQKESVS
FT                   GLQYYVGSKPDLRYVKIKK"
FT   gene            complement(191142..191609)
FT                   /locus_tag="BA_0190"
FT                   /old_locus_tag="BA0190"
FT   CDS_pept        complement(191142..191609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0190"
FT                   /old_locus_tag="BA0190"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24239"
FT                   /db_xref="InterPro:IPR025623"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KLG8"
FT                   /protein_id="AAP24239.1"
FT                   /translation="MRTLLSVLLALMLVPALTGCKAPAKEDTTSNKKTTEEAKNETPAD
FT                   LKLNFNEFSLDADYQDTKKDYEADYKNVAADKKMEAKIEDHKADVNLTGDEAITKLSPL
FT                   LQELKFDKGTPDQEVIDQVLNVFKLDKDYQKFELEVVFSDGTKKEYKREIK"
FT   gene            191781..192680
FT                   /locus_tag="BA_0191"
FT                   /old_locus_tag="BA0191"
FT   CDS_pept        191781..192680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0191"
FT                   /old_locus_tag="BA0191"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by similarity to GP:3599654; match to
FT                   protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24240"
FT                   /db_xref="GOA:A0A347ZY16"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZY16"
FT                   /protein_id="AAP24240.1"
FT                   /translation="MHEEYKEMIKKAIEYIENHLHEELTTERVASHSAVSMYHFHRIFQ
FT                   RYIGMSVTDYIRKRRLTHAAQVLVSTERAVIDIAMQYGFSSQEAFTRAFKRMFQLPPKK
FT                   YRKYFQSFYIEREGVSMQKGIPKGWILSGSHPAEYEMGLDYEVVHQGKVSAYIKAKENV
FT                   THGGFSTLMQMFRADKYVGKRLRFTAFVKSENVRDWAGLWMRVDGKETEPFAMDNMQNR
FT                   PIKNTNNWQSYSVVLDIKEGALGIAFGVLLSGEGCVWLDSIRFDEVDEKIPTTDLAENF
FT                   YETLLEEPVNLQFEEVEK"
FT   gene            192699..192890
FT                   /locus_tag="BA_0192"
FT                   /old_locus_tag="BA0192"
FT   CDS_pept        192699..192890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0192"
FT                   /old_locus_tag="BA0192"
FT                   /product="putative lipoprotein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24241"
FT                   /db_xref="GOA:A0A2B6BYS4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2B6BYS4"
FT                   /protein_id="AAP24241.1"
FT                   /translation="MLKYVKLISISLVISSCIMGINYLVSYIWSGHTPSLTWKTYLMFL
FT                   FIFMMSFSSMQKEGEEDY"
FT   gene            192939..193235
FT                   /locus_tag="BA_0193"
FT                   /old_locus_tag="BA0193"
FT   CDS_pept        192939..193235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0193"
FT                   /old_locus_tag="BA0193"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to SP:P32399"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24242"
FT                   /db_xref="GOA:A0A0F7R439"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R439"
FT                   /protein_id="AAP24242.1"
FT                   /translation="MFGNAGMIFNIISLSLQLVSSGVIVPHEMLSKTYQTIGELFPATY
FT                   AANGYYTIIFGGVSLERNIISLLVIVLVTQSVAVMTLAIKGIVKGRSSVVKEA"
FT   gene            complement(193280..194920)
FT                   /locus_tag="BA_0194"
FT                   /old_locus_tag="BA0194"
FT   CDS_pept        complement(193280..194920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0194"
FT                   /old_locus_tag="BA0194"
FT                   /product="putative oligopeptide ABC transporter,
FT                   oligopeptide-binding protein"
FT                   /note="identified by similarity to GP:10717143; match to
FT                   protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24243"
FT                   /db_xref="GOA:A0A3P1TVU6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TVU6"
FT                   /protein_id="AAP24243.1"
FT                   /translation="MKKKVVPVVASVLGASLLLTACGGNKDNASGAKANDKAPDKQAIN
FT                   LSFASEIPTMDVAKATDGESMNVMRNVFEGLYAMGEDNKPIPGVAESVDVSADKTKYTF
FT                   HLRDSKWSNGTPVTAKDFVFAWQRAVNPDTAAEYAFLFFDIKNAKQINQKQLPVDQLGI
FT                   KAVDDKTLEVQLDRPVPYFLSLTTFSTFLPINEEYLKSQGDKYGLETNHLIYNGAFTLD
FT                   NWKHEQSFQLKKNPNYWDAKTVKLEEINFNVVKDKSTEVNLYDSGQIDRVALTAEFVDK
FT                   YKGDPNFKERAEVGIQFLRLNQKNETLKNQHARLAINGAMNKKAYVETILNNGAVPAEG
FT                   MIPAKFAKSPDGNDFRKENGNLVKDDVKTAKENWKKAKQELGTDKVTIELLTSDNALAK
FT                   KTGEYLKGELEKNLDGLTVNLKPQPRKQQLKLLLSGDYEIGIDGWGPDFADPITFLDLF
FT                   TTDSAYNFDKYSNKEYDELIHKVKTDLAGDEKARFEAMKQAEKILLQDGAVAPLYQQGR
FT                   SYLQRSFIKGLVTTDFGGEFNYKWTEVAK"
FT   gene            complement(195308..196948)
FT                   /locus_tag="BA_0195"
FT                   /old_locus_tag="BA0195"
FT   CDS_pept        complement(195308..196948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0195"
FT                   /old_locus_tag="BA0195"
FT                   /product="putative oligopeptide ABC transporter,
FT                   oligopeptide-binding protein"
FT                   /note="identified by similarity to GP:10717143; match to
FT                   protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24244"
FT                   /db_xref="GOA:A0A2P0H8Y5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H8Y5"
FT                   /protein_id="AAP24244.1"
FT                   /translation="MKKKFVPGIASVVGVSILLTGCGSYKNEASGANAKDEAPSKQVLN
FT                   LSSPTEIRTMDTARATDTDSGQVMRNVFEGLYNLGEGNKPIPGVAKSHEVSGDKTKYTF
FT                   HLRDSKWSNGTPVTAKDFVFAWQRAVDPATASEYAFLFFDIKNATKINNKELPADQLGV
FT                   KAVDDHTFEVELERPVPYFISLTAFPTFLPINEEFFKAQGDKYALEDNTILYNGAFTLS
FT                   DWKHEQSFKFKKNPTYWDKDTVKLEEINFNVVKEKSTEVNLFESKQLDRIKLTSDFVDK
FT                   YKKDANFKERPNVGVQFLRMNQQNKVLQNVSARQAIDQTIDRKSFVNTLLNDGSTPTFG
FT                   LVPKNFAKGPDGKDFRTINGDLTKVDTKSAQELWKKAKQELGSEKITLELLTSDADLDK
FT                   KTGEFLKGQLEKNLDGLTVNVKPQPRKQQVSLLLKGDYEIGIDGWSPDFADPITFLELF
FT                   TTNNPYNLDHYSNKEFDKTIEKVKTTLAGDEKARWEALLASEKILFKDSVIAPLYQKGE
FT                   SYLERSYVKGIVQVDFAGQLNFKWAQIEK"
FT   gene            complement(197340..198173)
FT                   /locus_tag="BA_0196"
FT                   /old_locus_tag="BA0196"
FT   CDS_pept        complement(197340..198173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0196"
FT                   /old_locus_tag="BA0196"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24245"
FT                   /db_xref="GOA:A0A347ZY21"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZY21"
FT                   /protein_id="AAP24245.1"
FT                   /translation="MSLTSLKDYTTLHNGVKMPWFGLGVFKVEDGSQVIDSVKAAIKNG
FT                   YRSIDTAAIYQNEEGVGQAIRESGVSREELFITSKVWNSDQGYETTLQAFETTLEKLGL
FT                   EYLDLYLVHWPVKGKYTESWKALEKLYKDGRVRAIGVSNFHIHHLQDVFEIAEIKPMVN
FT                   QVEYHPRLAQEELHAFCKEHNIQLEAWSPLMQGQLLDNPTLQDIAKKYNKSTAQIILRW
FT                   DLQNEVVTIPKSIKEHRIIENANIFDFELSSDDMKAIQALNEDHRVGPDPDNFNF"
FT   gene            complement(198241..198978)
FT                   /locus_tag="BA_0197"
FT                   /old_locus_tag="BA0197"
FT   CDS_pept        complement(198241..198978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0197"
FT                   /old_locus_tag="BA0197"
FT                   /product="putative pyrroline-5-carboxylate reductase"
FT                   /note="identified by similarity to SP:P14383; match to
FT                   protein family HMM PF01210; match to protein family HMM
FT                   PF03807"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24246"
FT                   /db_xref="GOA:Q81VK0"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VK0"
FT                   /protein_id="AAP24246.1"
FT                   /translation="MLTKHRILFIGAGRMAEAIFSGLLKTSKEYIEEIIVSNRSNVEKL
FT                   DQLRARYNVSTTTDWKQHVTSVDTIVLAMPPSAHEELLAELSPLLSNQLVVTVAAGISP
FT                   SYLEERLPGGTPVAWIMPNTAAEIGKSISLYTMGQFVNETHQETLQLLLRGIGTSQLCT
FT                   EEEVHQLTAVTGSAPAFLYYFAESLIEATKSYGVDEATAKHLVIQMISGSASMLEQTQD
FT                   PANLREQVTTPGGSTAEGLKALY"
FT   gene            199078..199173
FT                   /locus_tag="BA_0198"
FT                   /old_locus_tag="BA0198"
FT   CDS_pept        199078..199173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0198"
FT                   /old_locus_tag="BA0198"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24247"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0PR92"
FT                   /protein_id="AAP24247.1"
FT                   /translation="MKSRKLMVKGRVIPYTGDREFITHLGRDDYD"
FT   gene            199166..199816
FT                   /locus_tag="BA_0199"
FT                   /old_locus_tag="BA0199"
FT   CDS_pept        199166..199816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0199"
FT                   /old_locus_tag="BA0199"
FT                   /product="nucleoside transporter, PnuC family"
FT                   /note="identified by similarity to SP:P24520; similarity to
FT                   OMNI:NTL01EC00727; match to protein family HMM PF04973;
FT                   match to protein family HMM TIGR01528"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24248"
FT                   /db_xref="GOA:A0A3P1TYQ7"
FT                   /db_xref="InterPro:IPR006419"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TYQ7"
FT                   /protein_id="AAP24248.1"
FT                   /translation="MIRSPLFLLITSIICVLVGLYIQSSYIEIFASVMGIINVWLLARE
FT                   KVSNFLFGMITVAVFLYIFITQGLYAMAVLAAFQFIFNVYGWYHWIARSGEEEVKATVR
FT                   LDLKGWIFYIIFILVAWIGWGYYQVHYLESTSPYLDALNAVLGLVAQFMLSRKILENWH
FT                   LWILYNVVSISIYISTGLYVMLILAVINLFICVAGLLEWKNNYKGQKHTNNYI"
FT   gene            complement(199884..200735)
FT                   /locus_tag="BA_0200"
FT                   /old_locus_tag="BA0200"
FT   CDS_pept        complement(199884..200735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0200"
FT                   /old_locus_tag="BA0200"
FT                   /product="putative transporter"
FT                   /note="identified by similarity to OMNI:NTL01LL2308; match
FT                   to protein family HMM PF06800"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24249"
FT                   /db_xref="GOA:Q81VJ7"
FT                   /db_xref="InterPro:IPR010651"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VJ7"
FT                   /protein_id="AAP24249.1"
FT                   /translation="MGILLALLPAIAWGNILLVSVKMGGGAYSQTVGMTIGALFFATIM
FT                   YVFTQPALTMTILIVGFISGLFWALGQVNQLKTVEKLGVSTTVTISTGMQLVATSIFGV
FT                   IAFREWTTTTTIILGTIAILLIVVGVVFTSLDDKENAQPPGQLKKGLLTLIVSTFGYLV
FT                   YVIIIRWYNIDGWSAILPQAVGMFVGAVVLTSKHKPFNKYAIRNALSGLLWGTGNLFLL
FT                   LSLPRVGVATSFPLSQTGIVISTFGAIVFLGEKKTKRQLIFIALGSVLIIGGAVLLGMT
FT                   KA"
FT   gene            complement(201022..201711)
FT                   /gene="modB"
FT                   /locus_tag="BA_0202"
FT                   /old_locus_tag="BA0202"
FT   CDS_pept        complement(201022..201711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modB"
FT                   /locus_tag="BA_0202"
FT                   /old_locus_tag="BA0202"
FT                   /product="molybdenum ABC transporter, permease protein"
FT                   /note="identified by similarity to OMNI:NTL01EC00740; match
FT                   to protein family HMM PF00528; match to protein family HMM
FT                   TIGR02141"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24250"
FT                   /db_xref="GOA:A0A0F7R985"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R985"
FT                   /protein_id="AAP24250.2"
FT                   /translation="MSFDIILSPIFLSLRVAACATIIVTILGTIIGRALARSSWRYKVI
FT                   LETIFLLPMVLPPTVIGFFLIIIFGNNSPIGMWIESIFQQSIMFTSTAAIIASTVVAFP
FT                   LMYQSAKTGFSIANVQIEESARDLGASEYQVFLHVTLPLAFPALLSGMILSFVRALGEF
FT                   GATLMFAGNIPGKTQTIPTAIYMAIDASNMQLAWTLVVITISMSLLFLLCIQLINKRIT
FT                   NSSGSFF"
FT   gene            complement(201717..202522)
FT                   /pseudo
FT                   /gene="modA"
FT                   /locus_tag="BA_0204"
FT                   /old_locus_tag="BA0204"
FT                   /note="molybdenum ABC transporter, molybdenum-binding
FT                   protein, authentic frameshift; an automated process has
FT                   identified a potential problem with this gene model; it may
FT                   contain one or more premature stops and/or frameshifts"
FT   gene            202684..203604
FT                   /locus_tag="BA_0205"
FT                   /old_locus_tag="BA0205"
FT   CDS_pept        202684..203604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0205"
FT                   /old_locus_tag="BA0205"
FT                   /product="putative molybdopterin biosynthesis protein"
FT                   /note="identified by similarity to GP:2832791; similarity
FT                   to GP:15025004; match to protein family HMM PF05930; match
FT                   to protein family HMM TIGR01764"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24252"
FT                   /db_xref="GOA:A0A1Q4MBC3"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Q4MBC3"
FT                   /protein_id="AAP24252.1"
FT                   /translation="MDHHSYTTEEVAKRLKVSKLTVYDLIKKGELPSYRVGRQMRIDAA
FT                   DLEQYIKQMKTGKVQVTPVKNDSNSISNTCIISGQELTLDMLAKRIENRLPSSNILRAY
FT                   QGSLTSLVKMYQGEGSIVSLHLFDGETGTYNVPYVKRILVGQPCTMINLLSRNVGFYVQ
FT                   KGNPKNIKTWADLSQSSIRFVNREKGSGIRVLVDEQLRIQNLNKERISGYEWEESNHLG
FT                   VATQVANEKADVGVGSEKFSQIVNVDFIPIMKEQYDLVILKNKENEELIEVVKDILQSE
FT                   EFHNELKAIGGYDMTKTGQIIYEIK"
FT   gene            complement(203820..203921)
FT                   /locus_tag="BA_0206"
FT                   /old_locus_tag="BA0206"
FT   CDS_pept        complement(203820..203921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0206"
FT                   /old_locus_tag="BA0206"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24253"
FT                   /db_xref="GOA:A0A3P1TWE2"
FT                   /db_xref="InterPro:IPR025034"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TWE2"
FT                   /protein_id="AAP24253.1"
FT                   /translation="MNNITFNKSDFIGLASGATLLTAFIYSLAQGLV"
FT   gene            complement(203934..204035)
FT                   /locus_tag="BA_0207"
FT                   /old_locus_tag="BA0207"
FT   CDS_pept        complement(203934..204035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0207"
FT                   /old_locus_tag="BA0207"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24254"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LMA4"
FT                   /protein_id="AAP24254.1"
FT                   /translation="MMNKMKSNKFLNTMGMVLSALVDAKAVATTLNK"
FT   gene            complement(204177..205043)
FT                   /locus_tag="BA_0208"
FT                   /old_locus_tag="BA0208"
FT   CDS_pept        complement(204177..205043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0208"
FT                   /old_locus_tag="BA0208"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by similarity to SP:P94501; match to
FT                   protein family HMM PF00126; match to protein family HMM
FT                   PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24255"
FT                   /db_xref="GOA:Q81VJ1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VJ1"
FT                   /protein_id="AAP24255.1"
FT                   /translation="MELRDLQIFQSVADQGSVSSAAKELNYVQSNVTARIKQLENELKT
FT                   PLFYRHKRGMTLTAEGRKMLVYVNKILQDVDELKQVFLDSETPSGILKIGTVETVSTLP
FT                   TILSSYYKSYPNVDLSLQAGLTEELIREVLDHQLDGAFISGPIKHPLIEQYDVSTEKLM
FT                   LVTQNKTFHIEEFTTTPLLVFNQGCGYRSKLERWLKDEGLLPKRIMEFNILETLLNSVA
FT                   LGLGITLVPQSAVHHLSKAGKVHCHAIPEKYGSISTVFIRRKDSYMTNSMRSFLKTIEE
FT                   HHHINML"
FT   gene            205171..206139
FT                   /locus_tag="BA_0210"
FT                   /old_locus_tag="BA0210"
FT   CDS_pept        205171..206139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0210"
FT                   /old_locus_tag="BA0210"
FT                   /product="transporter, EamA family"
FT                   /note="identified by similarity to SP:O07086; match to
FT                   protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24256"
FT                   /db_xref="GOA:A0A2P0H929"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H929"
FT                   /protein_id="AAP24256.1"
FT                   /translation="MRRGQMIIGALACLIASMSWGAMFPVADHALEYIDPFYFSLIRYG
FT                   AVAIMLIILLLMKEGKQAFRLEGRGKLLVFFGTMAFTVYNVLIFLGQMLMGKSGVMVAS
FT                   IMEALMPMISICILWGYKHVKPKKYMITSMLIAFIGAVFVITKGDMSFFLTLKDNMFSL
FT                   ACIFVGVVGWVIYTMGGQTCSDWSTLRYSTLTCVFGTTVTGIITIIITAFGYVSVPNMG
FT                   TISIVKYDLLFMMTLPGIVALLAWNYGVKILSSINGILFINFVPITTLVIMMMQGYQIT
FT                   MFDIVGTLLVIAALIRNNVCQRKEENINKRILEKEQLRQAV"
FT   gene            206161..206301
FT                   /locus_tag="BA_0211"
FT                   /old_locus_tag="BA0211"
FT   CDS_pept        206161..206301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0211"
FT                   /old_locus_tag="BA0211"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24257"
FT                   /db_xref="InterPro:IPR025417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2B6BZA7"
FT                   /protein_id="AAP24257.1"
FT                   /translation="MLESLLFFFAVGVACELAAINRNGRKKIKQQAEMIELLKELKERN
FT                   I"
FT   gene            complement(206362..206457)
FT                   /locus_tag="BA_0212"
FT                   /old_locus_tag="BA0212"
FT   CDS_pept        complement(206362..206457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0212"
FT                   /old_locus_tag="BA0212"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24258"
FT                   /db_xref="GOA:A0A3P1TX29"
FT                   /db_xref="InterPro:IPR025034"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TX29"
FT                   /protein_id="AAP24258.1"
FT                   /translation="MQNITFNKLDLLGLASGSILLTAFIYTATLV"
FT   gene            206669..207274
FT                   /locus_tag="BA_0213"
FT                   /old_locus_tag="BA0213"
FT   CDS_pept        206669..207274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0213"
FT                   /old_locus_tag="BA0213"
FT                   /product="putative 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase"
FT                   /note="identified by match to protein family HMM PF01553;
FT                   match to protein family HMM TIGR00530"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24259"
FT                   /db_xref="GOA:A0A347ZY35"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZY35"
FT                   /protein_id="AAP24259.1"
FT                   /translation="MYKPITFSLKYIFKTAGKVEVQGREKLPEGGPYVVACTHTSFMDV
FT                   LMLATGMYPTEIHYMAKKELFEGKFKNWFFKNVNAFPVDRANPGPSTLKIPSRLLKEGK
FT                   VVGIFPSGTRSTEDVSLKAGAVTIAMRSNVPLIPAAYIGPSSVKELIKGKRAQLIFGDP
FT                   IQIDAEEQIDRKTAMKMMTDQLNEKFEGLKEALQSNQK"
FT   gene            207749..208726
FT                   /locus_tag="BA_0216"
FT                   /old_locus_tag="BA0216"
FT   CDS_pept        207749..208726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0216"
FT                   /old_locus_tag="BA0216"
FT                   /product="sugar-binding transcriptional regulator, LacI
FT                   family"
FT                   /note="identified by similarity to GP:16415415; match to
FT                   protein family HMM PF00356; match to protein family HMM
FT                   PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24260"
FT                   /db_xref="GOA:A0A347ZY37"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZY37"
FT                   /protein_id="AAP24260.1"
FT                   /translation="MANIKDIAKMAGVSVTTVSRVLNDHPYVSEEKRKAVIEIVEKLNY
FT                   SQNANAVHLSKGKTNIVGVILPYINHPSFDAMVGGMMEGALTHNYRVLLCQTNYNKKEE
FT                   MKSLHMLKTKQLDGLIICSRANDWEIIEPYASYGTIIACEDNDISNISSVYTNHSAAFQ
FT                   LGMNHLIEKGYKKIGYCTGRKLGPSSQKRFDVYKQQLQSIDEEVNEEWIFTECFTLEDG
FT                   VRVAHKLKGMQNLPEALIVAGDEVAIGVMTEVGKLGIQVPEDLAIIGLDNQPISQVLQL
FT                   TTIDQNLKEIGKTAFEMFYRHISDKSSKQEKVEIPYELVERSTV"
FT   gene            208875..209204
FT                   /locus_tag="BA_0217"
FT                   /old_locus_tag="BA0217"
FT   CDS_pept        208875..209204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0217"
FT                   /old_locus_tag="BA0217"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24261"
FT                   /db_xref="GOA:A0A3P1TW11"
FT                   /db_xref="InterPro:IPR039519"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TW11"
FT                   /protein_id="AAP24261.1"
FT                   /translation="MNELLLSVKKYLENDENIVAFVIGIFEKDNFTLCYQHGIFVATTR
FT                   RLLFYGKFPYYPSTFKEYSYLHIDSIDFCPYFEFTCNHETVRAKCIQKGNVEQFVRTVR
FT                   TNMNN"
FT   gene            209323..210159
FT                   /locus_tag="BA_0218"
FT                   /old_locus_tag="BA0218"
FT   CDS_pept        209323..210159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0218"
FT                   /old_locus_tag="BA0218"
FT                   /product="yitT family protein"
FT                   /note="identified by similarity to EGAD:108622; match to
FT                   protein family HMM PF02588"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24262"
FT                   /db_xref="GOA:A0A1J9VWD3"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9VWD3"
FT                   /protein_id="AAP24262.1"
FT                   /translation="MVNQRIKEITLITIGSLLFAIGINYFAIPNRLSEGGIIGLTVVTY
FT                   YLFDWSPGIVNFAINAILLAIGYKFFDKKTMVYTILGIVETSLFLYVTEHIEYHVNSDT
FT                   LLAALFAGLFVGIGLGCMFKAGGTSGGSAILAQLANQYLGWSVGKGVLIIDIVVIAGSV
FT                   FIIGQEKAMYTLVAVFIGAKVIDFIVEGMDTKTAVTIISNQPDLIREAITKNMTRGVTV
FT                   LEGRGGYTGKNKEVLYVVINKQELVKLKQVISRVDEDAFVVIHDVRDVLGGGFKAS"
FT   gene            210297..210653
FT                   /locus_tag="BA_0219"
FT                   /old_locus_tag="BA0219"
FT   CDS_pept        210297..210653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0219"
FT                   /old_locus_tag="BA0219"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:45945; match to
FT                   protein family HMM PF06486; match to protein family HMM
FT                   TIGR01655"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24263"
FT                   /db_xref="InterPro:IPR006542"
FT                   /db_xref="InterPro:IPR036166"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TXM2"
FT                   /protein_id="AAP24263.1"
FT                   /translation="MKKKMITTIIAMLVIVVMLLPTKLGPVIDKYNPFYKTKEYYTVVN
FT                   TIGQHVGDEWYEYEFIAFDERGKEQKIKKTVKHMLKRDEMLKVYAKGRYGELIEEIEAV
FT                   NIPINAKSKLLSMR"
FT   gene            211225..211338
FT                   /locus_tag="BA_0221"
FT                   /old_locus_tag="BA0221"
FT   CDS_pept        211225..211338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0221"
FT                   /old_locus_tag="BA0221"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24264"
FT                   /db_xref="GOA:A0A384LNM8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LNM8"
FT                   /protein_id="AAP24264.1"
FT                   /translation="MRKEEVVKFPIKDFCSYFTVAVVCIGLFDIITNLIVK"
FT   gene            211397..212161
FT                   /locus_tag="BA_0222"
FT                   /old_locus_tag="BA0222"
FT   CDS_pept        211397..212161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0222"
FT                   /old_locus_tag="BA0222"
FT                   /product="putative deoxyribonuclease, TatD family"
FT                   /note="identified by similarity to EGAD:28653; match to
FT                   protein family HMM PF01026"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24265"
FT                   /db_xref="GOA:A0A347ZY42"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZY42"
FT                   /protein_id="AAP24265.1"
FT                   /translation="MKWIDSHIHVDQYKDEEKSRLLKDVENSKEIQGLIAVSMNYQSSK
FT                   EILSLAKRYSFVHPAVGFHPEQPIHKEECEKIYKLIEDHVEDIVAIGEVGLPYYLRKED
FT                   EHIAINSYISVLQRFVELASKYDLPIVLHAVYEDADVVCDLLEKHKVSRAHFHWFKGSE
FT                   TTMERMMRNGYYISITPDVLHKEKIRKIVSYYPLEYMMVETDGPWGFQEGVMTHPGMIR
FT                   EVLKEISVIKNVAVDKVAETIYENTIQFYLKG"
FT   gene            complement(212264..213913)
FT                   /locus_tag="BA_0223"
FT                   /old_locus_tag="BA0223"
FT   CDS_pept        complement(212264..213913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0223"
FT                   /old_locus_tag="BA0223"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:1881239"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24266"
FT                   /db_xref="GOA:A0A3P1TX36"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR018763"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TX36"
FT                   /protein_id="AAP24266.1"
FT                   /translation="MKKWLLLLFSLLLLIPVPISAQKNENPKVLILYSSSDDQITSDTQ
FT                   ILNTQVGHFTNNITIKSIKQLAEITDKSSYTHVIYIGEKQEELPTETKEFLENFSGPLL
FT                   VLGQNIEKLSKRFSFITLKNEDINSDTIEYPTRKLKNTLEDERSIKILDTNGTILANAL
FT                   KGKNTYPLIVQQNNSYYVATPNLFDWMSHYIGEVLFSYFGQKPTNNKVEAYLRLEDVHP
FT                   AADINQLKEIAELLKEKKMPYMITVIPVYTDPETGKTLHLKDKPELVDLLRSMQDDGAT
FT                   IIMHGYTHQFYDSETGEGFEFWDVKTDQPIRQPKHEKPKTKDDFPNIEAYNTYVKKGEE
FT                   FEEKYTTDHIEKGIQELVDAKLYPVAFEAPHYTMSQKGYEILSRYFSTYVGQLQLSDTT
FT                   WKSMHSPAYRSTPSFLNGMKLMPETVGFIEEDKPHAIAKMKANAVSVAKLSDGVIGAFY
FT                   HPYLGVKPLKEVLKDLESIPNIEWIDLQKETNEVKMKDIHITTNKDGIHVEKPTSASDV
FT                   MDYIKQYGFFLILGFLVIVFLLLLRRAKKLES"
FT   gene            214164..214697
FT                   /locus_tag="BA_0224"
FT                   /old_locus_tag="BA0224"
FT   CDS_pept        214164..214697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0224"
FT                   /old_locus_tag="BA0224"
FT                   /product="invasion protein IagB domain protein"
FT                   /note="identified by similarity to EGAD:156443; match to
FT                   protein family HMM PF01464"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24267"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZY44"
FT                   /protein_id="AAP24267.1"
FT                   /translation="MKKFFVGFLVVLGVYLYFQGKSEGMGKLVNETSYVDSEEAKQMKQ
FT                   IIIEEAKKVNLPEWIPLTIAEHESRLNPRSVGDNGTSFGLFQLHRGGGLAPDHLTDDEL
FT                   KDPRTNAQIAMPHLMKGYKRGVQKGLTDFALLKYIANTSGWPGNLGPEWTDNNMKYNVG
FT                   LEDVYYRNKGIIKE"
FT   gene            complement(214713..215495)
FT                   /locus_tag="BA_0225"
FT                   /old_locus_tag="BA0225"
FT   CDS_pept        complement(214713..215495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0225"
FT                   /old_locus_tag="BA0225"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LL0849"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24268"
FT                   /db_xref="GOA:A0A3P1TX39"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR012361"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TX39"
FT                   /protein_id="AAP24268.1"
FT                   /translation="MDTQQLYFLNDIGKQKPESIRNRSAACPFCDRENLTDILATEGPI
FT                   IWLKNKFPTLKDTFQTVLIETDNCEDHIATYTEEHMRSLIRFSVKHWLDLQKNEEFKSV
FT                   ILYKNHGPFSGGSLHHAHMQIIGMKYVNYLDNVEQDNFQGVIVQKNKNIELNISDRPII
FT                   GFTEFNIIVKDIECIDEMANYIQQTVRYILTDFHKGCSSYNLFFYHVSGKIICKVVPRF
FT                   VVSPLYVGYKIPQVSTKLEDVKIQLAEYFTKRHDDPQK"
FT   gene            215703..215795
FT                   /locus_tag="BA_0226"
FT                   /old_locus_tag="BA0226"
FT   CDS_pept        215703..215795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0226"
FT                   /old_locus_tag="BA0226"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift; identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24269"
FT                   /db_xref="GOA:A0A3Q0PQX7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0PQX7"
FT                   /protein_id="AAP24269.1"
FT                   /translation="MYKAIAVLAMTIMAFFIFVYPFFIVGLILG"
FT   gene            216438..218318
FT                   /locus_tag="BA_0228"
FT                   /old_locus_tag="BA0228"
FT   CDS_pept        216438..218318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0228"
FT                   /old_locus_tag="BA0228"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24270"
FT                   /db_xref="GOA:A0A3P1TW60"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TW60"
FT                   /protein_id="AAP24270.1"
FT                   /translation="MTICSVNNVTKSFGGNIIFENISLEIKNGERVGLVGRNGSGKTTI
FT                   FQLLTGMESLDAGAIHMKKGTRIGHVAQIPKFDESMTVYEVLSSAFKIEKELEREMRTL
FT                   EKDMAEEQESSVLQKLMERYGIIQEKFAFLGGYEIEANIMKVANGLQVTELFPRSFLEL
FT                   SGGEQTKVSLAYMLLQKPDLLLLDEPTNHLDLFAVEWLEQFLKEYNGTVMVISHDRYFL
FT                   DEVVTKIFDLEDGEIHVYHTNYSRFVEEKEERLLQEFQAYQEQQKKIKKMKEAIKRLRE
FT                   WANQANPPNEGLHKRARSMERALERMQKLKKPILERKQIGLQFEGQDRSGKDVVVIKEV
FT                   SKGFADHPLFNEVNLHVRFQERAAIVGRNGTGKTTLLKLLLEEIEPDAGEIRIGSSVKI
FT                   GYLSQHAYGNMKSDVLEAFREYVAVTEGEARHILAKFLFYGPAVFKKVTQLSGGEKMRL
FT                   RLAQLMYQDINFLILDEPTNHLDIESREVLEEALEQYNGTILAVSHDRYFLNKLFEKTY
FT                   WIDEHKLFEFAGNYAWARQKWEERLETQVIKQQRQGRKSIETAPVKKKEARNIEEIETE
FT                   LMHVEEDIYTLECTMEHVVDIKRLEQLYEEKTKKELLRAELYNELENIVE"
FT   gene            complement(218560..218805)
FT                   /locus_tag="BA_0229"
FT                   /old_locus_tag="BA0229"
FT   CDS_pept        complement(218560..218805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0229"
FT                   /old_locus_tag="BA0229"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24271"
FT                   /db_xref="GOA:A0A3Q0PPT0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0PPT0"
FT                   /protein_id="AAP24271.1"
FT                   /translation="MKHRILITNYQKGGENMDNLFQYVLHYVLLTIMIVGALLLFPFFP
FT                   KFVLFLAFFIMLGVAIIISTREDTTQKENRVQRVKL"
FT   gene            218858..218977
FT                   /locus_tag="BA_0230"
FT                   /old_locus_tag="BA0230"
FT   CDS_pept        218858..218977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0230"
FT                   /old_locus_tag="BA0230"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24272"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2B6BZ42"
FT                   /protein_id="AAP24272.1"
FT                   /translation="MIDMFNSKVVSAHHARIQGLQEDNYNGILLSLPKLKIEQ"
FT   gene            219275..220942
FT                   /locus_tag="BA_0231"
FT                   /old_locus_tag="BA0231"
FT   CDS_pept        219275..220942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0231"
FT                   /old_locus_tag="BA0231"
FT                   /product="putative oligopeptide ABC transporter,
FT                   oligopeptide-binding protein"
FT                   /note="identified by similarity to EGAD:30669; match to
FT                   protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24273"
FT                   /db_xref="GOA:A0A2P0H919"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H919"
FT                   /protein_id="AAP24273.1"
FT                   /translation="MLSACGGQEDTASTEPVKKQDLKDAKIESIPATDKKKSPEKANQR
FT                   KDTFITAISKPGGVFLPYFQENGWDGNVTSVIFASLVTTDKQSKPIPDLAEKWDISADQ
FT                   LTYTFHLRKNLKFSDGSPLTADDVAFTLTLLHDKAYEGGLDIAQYAVKGGKEYKEGKTT
FT                   SIEGIQVVDPQTIKITTEKVNSQALTNLGGPVLSKAYYGKDYKQNTSLDYLKALYGQPI
FT                   AAGPYKFEKYVPGQEVRFVSNEHYYAGKPKIKNFIYKITSGDTGFQLFQTGELDYSGFR
FT                   ANPENIDQLKGLEFANINLESSSDIAYIYVNNKKSYLKDKKVRQALTYGLDRKKYVDTA
FT                   LQGYGSVANVPIAPVSWAYTEEGINKYPHDVEKAKKLLDEAGWKVGSDGVREKDGQKLK
FT                   LTYYASNTGKTNDIFIPIAKESYKEIGVELNPELMDFNTMLSKVGKGDYDLAAVSTPGI
FT                   SDPSEVVSEYLSTNPKSDTGYNNPKVDELIVKGIGTTDIEKRKAIYKELYKELSDDPPV
FT                   ILLNYRKLLYAHNARIKGIDPEKYDSISSNLPVLSIEQ"
FT   gene            221051..222007
FT                   /locus_tag="BA_0232"
FT                   /old_locus_tag="BA0232"
FT   CDS_pept        221051..222007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0232"
FT                   /old_locus_tag="BA0232"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /note="identified by similarity to EGAD:30670; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24274"
FT                   /db_xref="GOA:A0A3P1TXM3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TXM3"
FT                   /protein_id="AAP24274.1"
FT                   /translation="MKTYIIRRFLQMIPTLFGTSIIIFFLFALLPGDYIDSNPKLTPER
FT                   AQELRELYGLNKPIIERYFHWLVNALHGDFGFSLQYQEPVTSLLNKFIWNTFIVAVAAL
FT                   FFTWIIALIIGVISATKQHSWFDRLVTIGVFAAMSFPSFFIGLFLIKLLAVDLKLLPIG
FT                   GMIDIGSNSTGIAYILEVLRHMILPVFILTLLGVGSLTRYFRTGMLDVIRQDYIRTARA
FT                   KGLKERTVIYKHALKNAILPAITLLAFELPGLFSGAIIIEQIFNWPGIGSIQLEALNFR
FT                   DYTVLMAFTMFLSCLTIMANFLADIVYAFVDPRIRLK"
FT   gene            222020..222943
FT                   /locus_tag="BA_0233"
FT                   /old_locus_tag="BA0233"
FT   CDS_pept        222020..222943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0233"
FT                   /old_locus_tag="BA0233"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24275"
FT                   /db_xref="GOA:A0A347ZY52"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZY52"
FT                   /protein_id="AAP24275.1"
FT                   /translation="METITPIIEKKKERKKRNESSPWRQAYKKIKKNKMALCGLYVLIF
FT                   MFLFSFIGPIFSPYADGKVQVTQINKPPSLSHWLGTDQLGRDILTRLMQAGRISLTIGL
FT                   ASMLLSVILGALLGAIAGFYRGVVDHLIMRVADVLMSIPGLPLLIIMGAILSEWKLPSE
FT                   YRLYVVMIILSLVGWPGLARLVRGQILTLREQAFMQAADVLGLKDSRKIIHHLIPNVFP
FT                   LLIVVATLGVAGSILSESALSYLGLGVVPPTPPWGNMISAANSLIDFQKRPWLWIPPGF
FT                   AIFITVVSINLLGDALRDALDPKMRR"
FT   gene            222954..223934
FT                   /locus_tag="BA_0234"
FT                   /old_locus_tag="BA0234"
FT   CDS_pept        222954..223934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0234"
FT                   /old_locus_tag="BA0234"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by similarity to EGAD:30672; match to
FT                   protein family HMM PF00005; match to protein family HMM
FT                   PF08352; match to protein family HMM TIGR01727"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24276"
FT                   /db_xref="GOA:A0A347ZY53"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZY53"
FT                   /protein_id="AAP24276.1"
FT                   /translation="MSKAVVELKDLQTHFQTEEGTVKAVNHVSFSVREGETVCVVGESG
FT                   CGKSVTALSIMGLIAESGSVVGGDILYEGKSLLGMKEKELRSLRGNDIAMIFQEPMTSL
FT                   NPVFTVGEQIVETLREHELLSKNEAYKKAIELIRKVGIARADEIVHSYPHELSGGMLQR
FT                   IMIAVALSCNPKLLIADEPTTALDVTIQAQILDLLRQIKREFKTSILLITHDLGVVAEM
FT                   ADYVVVMYGGKVIEEAPVLEIFQNPKHPYTKGLLKSKPVMGKRIDKLYSIPGQVPNLVG
FT                   LDEFCYFSGRCEHCMEICKEEAPNLNVHDENHKVACWLYEERAGQ"
FT   gene            223931..224941
FT                   /locus_tag="BA_0235"
FT                   /old_locus_tag="BA0235"
FT   CDS_pept        223931..224941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0235"
FT                   /old_locus_tag="BA0235"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by similarity to EGAD:30673; match to
FT                   protein family HMM PF00005; match to protein family HMM
FT                   PF08352; match to protein family HMM TIGR01727"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24277"
FT                   /db_xref="GOA:A0A0F7R7S5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R7S5"
FT                   /protein_id="AAP24277.1"
FT                   /translation="MSEPLLEVKNLKTYFPIKGGIFSRTVGHVKAVDGVSFTIKKGEVF
FT                   GLVGESGSGKTTIGKTILRLVQKTEGEVKFKGHDVHSLSKEELRKHRPNMQLVFQDPFS
FT                   SLNPRMRIGEALGEPMLAHGLATKENVREKVTEVLELCGLAPYHIDRYPHEFSGGQRQR
FT                   IVIARAMVLNPEFIVADEPVAALDVSIQAQIINLFSELQEKKGLSYLFISHDLSVVEHL
FT                   CTKIGIMYLGTIVETAPRDELFTNPLHPYTKALLSAVPIPDPTVKRERIILEGDIPSPA
FT                   NPPSGCCFHTRCPFATDICKQTGNSVMLVKSTLLLVIMYKREGLFQKLKESFFIY"
FT   gene            complement(224931..225891)
FT                   /pseudo
FT                   /locus_tag="BA_0236"
FT                   /old_locus_tag="BA0236"
FT                   /note="hydrolase, haloacid dehalogenase-like family,
FT                   authentic frameshift; an automated process has identified a
FT                   potential problem with this gene model; it may contain one
FT                   or more premature stops and/or frameshifts"
FT   gene            226255..226362
FT                   /locus_tag="BA_0238"
FT                   /old_locus_tag="BA0238"
FT   CDS_pept        226255..226362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0238"
FT                   /old_locus_tag="BA0238"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24278"
FT                   /db_xref="GOA:A0A2C3G720"
FT                   /db_xref="InterPro:IPR025034"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2C3G720"
FT                   /protein_id="AAP24278.1"
FT                   /translation="MKEQVLQVTKGDFVGSASGAVVLTALIVFLSSVLV"
FT   gene            226405..226515
FT                   /locus_tag="BA_0239"
FT                   /old_locus_tag="BA0239"
FT   CDS_pept        226405..226515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0239"
FT                   /old_locus_tag="BA0239"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24279"
FT                   /db_xref="GOA:A0A2A8YIA7"
FT                   /db_xref="InterPro:IPR025034"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A8YIA7"
FT                   /protein_id="AAP24279.1"
FT                   /translation="MNSEQVLQVTKTDLLGSLGGAVVLTSFILFLANVLV"
FT   gene            226826..227944
FT                   /gene="hppD"
FT                   /locus_tag="BA_0240"
FT                   /old_locus_tag="BA0240"
FT   CDS_pept        226826..227944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hppD"
FT                   /locus_tag="BA_0240"
FT                   /old_locus_tag="BA0240"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /EC_number="1.13.11.27"
FT                   /note="identified by match to protein family HMM PF00903;
FT                   match to protein family HMM TIGR01263"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24280"
FT                   /db_xref="GOA:A0A2P0H911"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR005956"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041735"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H911"
FT                   /protein_id="AAP24280.1"
FT                   /translation="MKQKSMDTLAAQMEDFFPVRDVDHLEFYVGNAKQSSYYLARAFGF
FT                   KIVAYSGLETGNREKVSYVLVQKNMRFVVSGALSSDNRIAEFVKTHGDGVKDVALLVDD
FT                   VDKAYSEAVKRGAVAIAPPVELTDENGTLKKAVIGTYGDTIHTLVERKNYKGTFMPGFQ
FT                   KAEFDIPFEESGLIAVDHVVGNVEKMEEWVSYYENVMGFKQMIHFDDDDISTEYSALMS
FT                   KVMTNGSRIKFPINEPADGKRKSQIQEYLEFYNGAGVQHLALLTNDIVKTVEALRANGV
FT                   EFLDTPDTYYDELTARVGKIDEEIDKLKELKILVDRDDEGYLLQIFTKPIVDRPTLFIE
FT                   IIQRKGSRGFGEGNFKALFESIEREQERRGNL"
FT   gene            228011..228967
FT                   /locus_tag="BA_0241"
FT                   /old_locus_tag="BA0241"
FT   CDS_pept        228011..228967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0241"
FT                   /old_locus_tag="BA0241"
FT                   /product="FAH family protein"
FT                   /note="identified by match to protein family HMM PF01557"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24281"
FT                   /db_xref="GOA:A0A347ZY63"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZY63"
FT                   /protein_id="AAP24281.1"
FT                   /translation="MKFVTFRLPSKEMRAGWLEGDKVIDMNLASDGKLPSSMFAFLEKA
FT                   DEYVEVLRNIKNPEKGIYSLEEVQLAAAIPNPSSIRDFYAFEQHVKTARGRRGLDVVPE
FT                   WYDIPVFYFTNHRAVIGPNDVVIGPKKSEKIDYELEIACVIGKEGRNISREQAEEYIFG
FT                   YCIMNDWSARDLQATEMKVGLGPAKGKDFATSLGAHLVTKEELDVYRNGDRYELEMTAH
FT                   VNGKLLSKGNFQDIYYTFAEMIERASEDVTLYPGDVIGSGTVGTGCILELGTEEWLQDG
FT                   DVVELTITGLGTLRNTVKKEKEAGDEHVLSSHGGATS"
FT   gene            228933..230105
FT                   /locus_tag="BA_0242"
FT                   /old_locus_tag="BA0242"
FT   CDS_pept        228933..230105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0242"
FT                   /old_locus_tag="BA0242"
FT                   /product="putative homogentisate 1,2-dioxygenase"
FT                   /note="identified by match to protein family HMM PF04209"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24282"
FT                   /db_xref="GOA:A0A347ZY64"
FT                   /db_xref="InterPro:IPR005708"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZY64"
FT                   /protein_id="AAP24282.1"
FT                   /translation="MFYRHMGELPHKRHVQFRKKDGSLYREQVMGTKGFSGTQSILYHH
FT                   YMPTEVGHAALSHSCQLQYEEDVVLSHRHFRTKENKKSGDAVSGRNFILGNEDLLIGVV
FT                   TPTEKMNYFYRNGDGDEMLFVHYGTGKIETMFGTIHYRKGDYVTIPIGTIYRVIPDEGE
FT                   TKFLVVEANSQITTPRRYRNEYGQLLEHSPFCERDIRGPEKLETYDEKGEFVVMTKSRG
FT                   YMHKHVLGHHPLDVVGWDGYLYPWVFNVEDFEPITGRIHQPPPVHQTFEGHNFVICSFV
FT                   PRLYDYHPESIPAPYYHSNVNSDEVLYYVEGNFMSRKGVEEGSITLHPSGIPHGPHPGK
FT                   TEASIGKKETLELAVMIDTFRPLRIVKQAHETEDEKYMYSWIEEGSYTVK"
FT   gene            230118..230228
FT                   /locus_tag="BA_0243"
FT                   /old_locus_tag="BA0243"
FT   CDS_pept        230118..230228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0243"
FT                   /old_locus_tag="BA0243"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24283"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0PR19"
FT                   /protein_id="AAP24283.1"
FT                   /translation="MLNNGACLFYGIDMYNNTKKSYRKIYRKDDQDNAYS"
FT   gene            230339..231610
FT                   /locus_tag="BA_0244"
FT                   /old_locus_tag="BA0244"
FT   CDS_pept        230339..231610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0244"
FT                   /old_locus_tag="BA0244"
FT                   /product="MFS transporter"
FT                   /note="identified by similarity to GP:16414326; match to
FT                   protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24284"
FT                   /db_xref="GOA:A0A1T3UUC7"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1T3UUC7"
FT                   /protein_id="AAP24284.1"
FT                   /translation="MKNTWRELREMDRNVWIRFIGETLNGIAMMMLMPFFALYLKDKVD
FT                   SLLQVGVIMALSPIAASFGSIIGGRIADIYGRKPIMIFSMTSNALLMLGFLFIEGFIPY
FT                   AILSVFLGLSNSLFHPAASAMVADVTAPEKRTEAYGLLRMGHNIGAAIGPIMGASVVML
FT                   SKNLVFIIASSTMLFYALLVFVLIQETMPKSANKEEDNEKESGVVWKIVLRDKALMIYL
FT                   LAGIIISMGFSQTEGMLPLHFDNEMKDIFGTNNPYPYLMALNGLLVVLFQFQISKWATD
FT                   KPVGKTMLYGACLFGIGLFFIGWLPKWFGGLDTNATIILIMLLFVYAIYTLGEMIMSPV
FT                   QMTFVANLAPEHLRGTYMGAASLQWITGNAFGPLLGGFLLDRLLGHFLFTILAIGCVVA
FT                   GVVYISLDRLVEQRQKGTLTKQSS"
FT   gene            231993..233079
FT                   /pseudo
FT                   /locus_tag="BA_0245"
FT                   /old_locus_tag="BA0245"
FT                   /note="D-alanine--D-alanine ligase, authentic frameshift;
FT                   an automated process has identified a potential problem
FT                   with this gene model; it may contain one or more premature
FT                   stops and/or frameshifts"
FT   gene            233140..234516
FT                   /gene="murF"
FT                   /locus_tag="BA_0246"
FT                   /old_locus_tag="BA0246"
FT   CDS_pept        233140..234516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="BA_0246"
FT                   /old_locus_tag="BA0246"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /EC_number="6.3.2.10"
FT                   /note="identified by similarity to EGAD:108108; match to
FT                   protein family HMM PF01225; match to protein family HMM
FT                   PF02875; match to protein family HMM PF08245; match to
FT                   protein family HMM TIGR01143"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24285"
FT                   /db_xref="GOA:A0A2P0H914"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H914"
FT                   /protein_id="AAP24285.1"
FT                   /translation="MINRTLKQVEQMINGTGLAEQYEGITIQGVSIDTRKIEKGNLYVP
FT                   IQGERFDGHAFVDKAVENGAVATLWVKDVANPPENLPVIFVEDTLSALQMLAKNYRDQL
FT                   DVKVIGVTGSNGKTSTKDIVTSLLATKFKVQKTEGNFNNHIGLPLTILNLEENTEVAVL
FT                   EMGMSSRGEIEFLSKLARPNAAIITNIGEAHLMDLGSREAIAEAKLEIVTGLQEGGVFV
FT                   YNGDEPLLTNRVPEMNLIAETVTFGDARANDYYPTTVTLQATGTHFKMNREENISFYLP
FT                   VLGKHNVYNTLASMAIAKYFGVTWEEMKEGLVTLQMTGMRMEIVKTDSGLTIINDAYNA
FT                   SPTAMEAAFHLMNGLDGFSKKIVVLGDMLELGDQEVQFHYEVGKLIDPAKISYVFTYGK
FT                   LGAQIAEGAKINFPNERVKAYDNKEELVKELQAVVDTKDVVLVKASRGMKLEEVITMLK
FT                   "
FT   gene            234821..236407
FT                   /locus_tag="BA_0247"
FT                   /old_locus_tag="BA0247"
FT   CDS_pept        234821..236407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0247"
FT                   /old_locus_tag="BA0247"
FT                   /product="ATP-dependent RNA helicase, DEAD/DEAH box family"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24286"
FT                   /db_xref="GOA:Q81VG0"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030880"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VG0"
FT                   /protein_id="AAP24286.1"
FT                   /translation="MTTFRELGLSDSLLQSVESMGFEEATPIQAETIPHALQGKDIIGQ
FT                   AQTGTGKTAAFGLPLLDKVDTHKESVQGIVIAPTRELAIQVGEELYKIGKHKRVRILPI
FT                   YGGQDINRQIRALKKHPHIIVGTPGRILDHINRKTLRLQNVETVVLDEADEMLNMGFIE
FT                   DIEAILTDVPETHQTLLFSATMPDPIRRIAERFMTEPQHIKVKAKEVTMPNIQQFYLEV
FT                   QEKKKFDVLTRLLDIQSPELAIVFGRTKRRVDELSEALNLRGYAAEGIHGDLTQAKRMS
FT                   VLRKFKEGSIEVLVATDVAARGLDISGVTHVYNFDIPQDPESYVHRIGRTGRAGKKGIA
FT                   MLFVTPRESGQLKNIERTTKRKMDRMDAPTLDEALEGQQRLIAEKLQSTIENENLAYYK
FT                   RIAEEMLEENDSVTVVAAALKMMTKEPDTTPIALTSEPPVVSRGGGSKKRGGNGGGYRD
FT                   GNRNRSRDGRGGDGRNRDRNRDGRNRDGNRDRNREGSRDGNRGRRGEGQGRPGSSNGRG
FT                   ERKHHSRKPQA"
FT   gene            236504..237466
FT                   /gene="uvdE"
FT                   /locus_tag="BA_0248"
FT                   /old_locus_tag="BA0248"
FT   CDS_pept        236504..237466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvdE"
FT                   /locus_tag="BA_0248"
FT                   /old_locus_tag="BA0248"
FT                   /product="UV damage endonuclease UvdE"
FT                   /note="identified by match to protein family HMM PF03851;
FT                   match to protein family HMM TIGR00629"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24287"
FT                   /db_xref="GOA:A0A384LJL3"
FT                   /db_xref="InterPro:IPR004601"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LJL3"
FT                   /protein_id="AAP24287.1"
FT                   /translation="MLVRLGHVAMSVHLKNASPSQTMTYAQFQKIDDREAAIRKLERIA
FT                   NSNLENCLRLLKHNKGHDISFFRLSSKLIPLANHEELLEWNYIRPLKENLKVLGDYAIR
FT                   MNMRIDFHPDHFVVLNSPEENIFKQSVKTLQMHRKLLKGMGIEHKQRCVMHVGGGYKDK
FT                   ELALERFIENWSNVPRGIQEMIMLENDDTTFTLEDTLYLGEKLDIPVVFDLHHHMMNHD
FT                   REDWHEDWARVVHTWESSLLPVKMHISSPREGKDPRAHADFIDVDTFLSFLKKIKGSVP
FT                   QIDCMIEAKMKDESLFQLMRDLSEQTDVEIIDGASFYIK"
FT   gene            complement(237459..238031)
FT                   /locus_tag="BA_0249"
FT                   /old_locus_tag="BA0249"
FT   CDS_pept        complement(237459..238031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0249"
FT                   /old_locus_tag="BA0249"
FT                   /product="rhomboid family protein"
FT                   /note="identified by match to protein family HMM PF01694"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24288"
FT                   /db_xref="GOA:A0A347ZY71"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZY71"
FT                   /protein_id="AAP24288.1"
FT                   /translation="MLIPSARISLQPIAISLLLIQFIMIMLGDFFLFPMAAYHEYIANG
FT                   EWWRLITSLFVHVDLQHFLSNSICLFVLGSSIEKQLGRFSFIIIFFLSGILGNIFSYLI
FT                   MPHEYIHAGASGGIFGLLGAQLFLLYSRYRSSNPKDIAIFSIMICILLLFTFFNPSANP
FT                   ISHLTGLVIGGICTPLLIKKLDGAELI"
FT   gene            238124..238483
FT                   /gene="acpS"
FT                   /locus_tag="BA_0250"
FT                   /old_locus_tag="BA0250"
FT   CDS_pept        238124..238483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="BA_0250"
FT                   /old_locus_tag="BA0250"
FT                   /product="holo-[acyl-carrier-protein] synthase"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   premature stop; identified by match to protein family HMM
FT                   PF01648; match to protein family HMM TIGR00516; match to
FT                   protein family HMM TIGR00556"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24289"
FT                   /db_xref="GOA:Q81JG3"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="PDB:3HYK"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81JG3"
FT                   /protein_id="AAP24289.1"
FT                   /translation="MIVGIGIDIIELNRIEKMLDGKLKFMERILTENERNVAKGLKGSR
FT                   LTEFVAGRFAAKEAYSKAVGTGIGKEVSFLDIEVRNDDRGKPILITSTEHIVHLSISHS
FT                   KEFAVAQVVLESSSS"
FT   gene            238577..239590
FT                   /locus_tag="BA_0251"
FT                   /old_locus_tag="BA0251"
FT   CDS_pept        238577..239590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0251"
FT                   /old_locus_tag="BA0251"
FT                   /product="putative lipoprotein"
FT                   /note="identified by similarity to EGAD:108121"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24290"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L7M6"
FT                   /protein_id="AAP24290.1"
FT                   /translation="MKRRLFLVLVGLLTVFVLAGCMEKKQDDVVRDLEAKVKGLKSYQA
FT                   EAKLSIKTGNEPQEYKVEIWHKEPSFYRVNLQNAKKDQSQIILRNEEGVFVLTPALNKS
FT                   FRFQSDWPQNSSQAYLYESLVRDILQDKKNLTFEKTDKHYIFKTKTNYQHQNMLPRQEI
FT                   TLKKSDLTPVSVKLMDNDQNVLVKVDFSKVKFDAKFDKGAFDTKQNMSRAQVDVQTTAK
FT                   EDKPFAILYPRDTPQGMTLKDEKELKTDSGKRAILTYTGSKKSFTLIQEKAKVAEASSA
FT                   ISVSGELVDLGFTIGALTKDSLTWSHNGVEYMLVSKGLEPKELLMVARSVTEKQVK"
FT   gene            239709..240878
FT                   /gene="dal1"
FT                   /locus_tag="BA_0252"
FT                   /old_locus_tag="BA0252"
FT   CDS_pept        239709..240878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dal1"
FT                   /locus_tag="BA_0252"
FT                   /old_locus_tag="BA0252"
FT                   /product="alanine racemase, spore-specific"
FT                   /EC_number="5.1.1.1"
FT                   /note="identified by similarity to SP:P10724; similarity to
FT                   GB:AAP24291.1; match to protein family HMM PF00842; match
FT                   to protein family HMM PF01168; match to protein family HMM
FT                   TIGR00492"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24291"
FT                   /db_xref="GOA:A0A2P0H940"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H940"
FT                   /protein_id="AAP24291.1"
FT                   /translation="MEEAPFYRDTWVEVDLDAIYNNVTHIKEFIPSDVEIFAVVKGNAY
FT                   GHDYVPVAKIALEAGATRLAVAFLDEALVLRRAGITAPILVLGPSPPRDINVAAENDVA
FT                   LTVFQKEWVDEAIKLWDGSSTMKYHINFDSGMGRIGIRERKELKGFLKSLEGAPFLELE
FT                   GVYTHFATADEVETSYFDKQYNTFLEQLSWLKEFGVDPKFVHTANSAATLRFQGITFNA
FT                   VRIGIAMYGLSPSVEIRPFLPFKLEPALSLHTKVAHIKQVIKGDGISYNVTYRTKTEEW
FT                   IATVAIGYADGWLRRLQGFEVLVNGKRVPIVGRVTMDQFMIHLPCEVPLGTKVTLIGRQ
FT                   GDEYISATEVAEYSGTINYEIITTISFRVPRIFIRNGKVVEVINYLNDI"
FT   gene            241188..241475
FT                   /gene="pemI"
FT                   /locus_tag="BA_0253"
FT                   /old_locus_tag="BA0253"
FT   CDS_pept        241188..241475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pemI"
FT                   /locus_tag="BA_0253"
FT                   /old_locus_tag="BA0253"
FT                   /product="addiction module antitoxin component PemI"
FT                   /note="identified by similarity to OMNI:NTL01BH0522"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24292"
FT                   /db_xref="GOA:A0A1T3UU94"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1T3UU94"
FT                   /protein_id="AAP24292.1"
FT                   /translation="MSESSVTTEIVVRLPKQMVTELDGIGKQENKNRHELICQATQLLL
FT                   RQHKTKKRYQHESMRRGYIEMGKINLGIASEAFLAEYEAAHTVERLVSGG"
FT   gene            241480..241830
FT                   /gene="pemK"
FT                   /locus_tag="BA_0254"
FT                   /old_locus_tag="BA0254"
FT   CDS_pept        241480..241830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pemK"
FT                   /locus_tag="BA_0254"
FT                   /old_locus_tag="BA0254"
FT                   /product="addiction module toxin component PemK"
FT                   /note="identified by match to protein family HMM PF02452"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24293"
FT                   /db_xref="GOA:A0A347ZY76"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZY76"
FT                   /protein_id="AAP24293.1"
FT                   /translation="MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVA
FT                   AITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQIRTIDKQRLTDKITHLDEVMMIRVD
FT                   EALQISLGLIDF"
FT   gene            241898..244066
FT                   /locus_tag="BA_0255"
FT                   /old_locus_tag="BA0255"
FT   CDS_pept        241898..244066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0255"
FT                   /old_locus_tag="BA0255"
FT                   /product="S1 RNA binding domain protein"
FT                   /note="identified by similarity to OMNI:NTL01BH0532; match
FT                   to protein family HMM PF00575; match to protein family HMM
FT                   PF09371"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24294"
FT                   /db_xref="GOA:A0A2P0H901"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H901"
FT                   /protein_id="AAP24294.1"
FT                   /translation="MEMVDNRQALMKMLVKELGFTEKQVRHVIQLTEEGNTVPFIARYR
FT                   KEWTGSLDEVQIRTILERWQYIMQLEDRKEEVLRLIDEKGKLTGELRQQILKATKLQEV
FT                   EDLYRPYKEKRRTKATIAKEKGLEPLAEWLLLYTKEDPNQKAMEFINAEKEVQSAEEAL
FT                   QGAQDIIAEIVSDEAAYRSWIRNVTFRKGVMSSVVKDEEKDEKNIYEMYYDYEEPLQKV
FT                   VPHRVLAMNRGEKEDILRVSVVPPVDEIVTFLYKKVIRDNDSKSAQYVKLAIEDGYKRL
FT                   IQSSIEREIRKELTETAEEQAIHIFSENLRNLLLQPPMKGKVVLAVDPAYRTGCKLAIV
FT                   DDTGKVLYIDVIYPHPPVRKYEDAKAKVLSIIDKYQVEMIAIGNGTASRESEEFIVDVL
FT                   QNVKREVFYIIVNEAGASVYSASDLAREEFPDLQVEERSAVSIGRRLQDPLAELVKIDP
FT                   KSVGVGQYQHDVSQKRLNESLTFVVETAVNQVGVNVNTASVALLQYVSGLSKTVAKNIV
FT                   AKREEEGKFTKRTDLKKIPRLGAKTYEQCIGFLRILEGANPLDRTGIHPEQYKNVELLL
FT                   KSLGLSKDDVGQPQLQKSLEEVEISKLSEETGIGEPTLVDIIDALISPERDMRDELPKP
FT                   LLKKGILKLEDLKRGMELEGTARNVVDFGAFVDVGVKQDGLVHISKLSKQYVKHPLDVV
FT                   SVGQIVKVWVDDIDTKKGRVALSMLPIE"
FT   gene            complement(244124..244240)
FT                   /locus_tag="BA_0256"
FT                   /old_locus_tag="BA0256"
FT   CDS_pept        complement(244124..244240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0256"
FT                   /old_locus_tag="BA0256"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24295"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TWI0"
FT                   /protein_id="AAP24295.1"
FT                   /translation="MPTWLKKQMQRAYFEKNRYQIKLLNECWFYYSKIHQSS"
FT   gene            244436..244894
FT                   /locus_tag="BA_0257"
FT                   /old_locus_tag="BA0257"
FT   CDS_pept        244436..244894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0257"
FT                   /old_locus_tag="BA0257"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:108492; match to
FT                   protein family HMM PF03926"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24296"
FT                   /db_xref="GOA:Q81VF1"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023524"
FT                   /db_xref="InterPro:IPR035240"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VF1"
FT                   /protein_id="AAP24296.1"
FT                   /translation="MDEQEIQRLVEEVSLQYFGMPFLHKAMFNSRLRTTGGRYLLNTHN
FT                   IELNYRYYEMYGKEELVGIVKHELCHYHLHITGRGYKHRDKDFRELLKAVDAPRFCKRM
FT                   VNAEKEKRVYVYECMECLLQYVRRRQINTKRYVCGKCKGKLNLIKKTS"
FT   gene            245009..245083
FT                   /locus_tag="BA_5767"
FT   tRNA            245009..245083
FT                   /locus_tag="BA_5767"
FT                   /product="tRNA-Asn"
FT   gene            245087..245177
FT                   /locus_tag="BA_5768"
FT   tRNA            245087..245177
FT                   /locus_tag="BA_5768"
FT                   /product="tRNA-Ser"
FT   gene            245186..245260
FT                   /locus_tag="BA_5769"
FT   tRNA            245186..245260
FT                   /locus_tag="BA_5769"
FT                   /product="tRNA-Glu"
FT   gene            245265..245340
FT                   /locus_tag="BA_5770"
FT   tRNA            245265..245340
FT                   /locus_tag="BA_5770"
FT                   /product="tRNA-Val"
FT   gene            245387..245462
FT                   /locus_tag="BA_5771"
FT   tRNA            245387..245462
FT                   /locus_tag="BA_5771"
FT                   /product="tRNA-Asp"
FT   gene            245551..245625
FT                   /locus_tag="BA_5772"
FT   tRNA            245551..245625
FT                   /locus_tag="BA_5772"
FT                   /product="tRNA-Gln"
FT   gene            245631..245703
FT                   /locus_tag="BA_5773"
FT   tRNA            245631..245703
FT                   /locus_tag="BA_5773"
FT                   /product="tRNA-Lys"
FT   gene            245721..245806
FT                   /locus_tag="BA_5774"
FT   tRNA            245721..245806
FT                   /locus_tag="BA_5774"
FT                   /product="tRNA-Leu"
FT   gene            245902..245978
FT                   /locus_tag="BA_5775"
FT   tRNA            245902..245978
FT                   /locus_tag="BA_5775"
FT                   /product="tRNA-Arg"
FT   gene            245983..246059
FT                   /locus_tag="BA_5776"
FT   tRNA            245983..246059
FT                   /locus_tag="BA_5776"
FT                   /product="tRNA-Pro"
FT   gene            246061..246131
FT                   /locus_tag="BA_5777"
FT   tRNA            246061..246131
FT                   /locus_tag="BA_5777"
FT                   /product="tRNA-Gly"
FT   gene            246235..247741
FT                   /gene="rrsE"
FT                   /locus_tag="BA_5778"
FT   rRNA            246235..247741
FT                   /gene="rrsE"
FT                   /locus_tag="BA_5778"
FT                   /product="16S ribosomal RNA"
FT   gene            247920..250827
FT                   /gene="rrlE"
FT                   /locus_tag="BA_5779"
FT   rRNA            247920..250827
FT                   /gene="rrlE"
FT                   /locus_tag="BA_5779"
FT                   /product="23S ribosomal RNA"
FT   gene            250877..250992
FT                   /gene="rrfE"
FT                   /locus_tag="BA_5780"
FT   rRNA            250877..250992
FT                   /gene="rrfE"
FT                   /locus_tag="BA_5780"
FT                   /product="5S ribosomal RNA"
FT   gene            251005..251081
FT                   /locus_tag="BA_5781"
FT   tRNA            251005..251081
FT                   /locus_tag="BA_5781"
FT                   /product="tRNA-Met"
FT   gene            251085..251160
FT                   /locus_tag="BA_5782"
FT   tRNA            251085..251160
FT                   /locus_tag="BA_5782"
FT                   /product="tRNA-Asp"
FT   gene            251335..251808
FT                   /locus_tag="BA_0258"
FT                   /old_locus_tag="BA0258"
FT   CDS_pept        251335..251808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0258"
FT                   /old_locus_tag="BA0258"
FT                   /product="ATPase, YjeE family"
FT                   /note="identified by similarity to OMNI:NTL01BH0546; match
FT                   to protein family HMM PF02367; match to protein family HMM
FT                   TIGR00150"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24297"
FT                   /db_xref="GOA:A0A347ZY79"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZY79"
FT                   /protein_id="AAP24297.1"
FT                   /translation="MSKYEITTKSSEETQKLSEKLGELVRAQDVIILEGDLGAGKTTFT
FT                   KGLAKGLGVKRVVNSPTFNIIKEYKGRLPLYHMDVYRLAESEEDLGFDEYFYGEGITVV
FT                   EWAHLIEAYLPNEKLQISLFHAGDDTRNIVLEPIGNRYIRLCEELLQDESTSN"
FT   gene            251789..252481
FT                   /locus_tag="BA_0259"
FT                   /old_locus_tag="BA0259"
FT   CDS_pept        251789..252481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0259"
FT                   /old_locus_tag="BA0259"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00814"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24298"
FT                   /db_xref="GOA:A0A3P1TJB0"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TJB0"
FT                   /protein_id="AAP24298.1"
FT                   /translation="MKVLAIDTSNYVMGVSLIEEGNVIGEIITNLTKNHSVRLMPAVEQ
FT                   LLKECGVKPKELTKIVVAAGPGSYTGVRIGVTAAKTLAWSLQIPIVGVSSLEVVAANGA
FT                   NFNGLISPLFDGRRGQIYTGLYTYEGEDLTSIEEDRIILIVDWLQMLKDKGKPVLFIGN
FT                   DVKLHKETIIEHLGDQAVFAPVTKNNPRPSELAFLGLQKEEQDVHSFVPSYLRLAEAET
FT                   KWLESQNK"
FT   gene            252501..252938
FT                   /gene="rimI"
FT                   /locus_tag="BA_0260"
FT                   /old_locus_tag="BA0260"
FT   CDS_pept        252501..252938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimI"
FT                   /locus_tag="BA_0260"
FT                   /old_locus_tag="BA0260"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /note="identified by similarity to SP:P09453; match to
FT                   protein family HMM PF00583; match to protein family HMM
FT                   TIGR01575"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24299"
FT                   /db_xref="GOA:A0A3Q0PR74"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0PR74"
FT                   /protein_id="AAP24299.1"
FT                   /translation="MIFRKMELDDIAQIVAIEEASFSTPWTADAFHRELTMNEHAHYVV
FT                   LEKDGRVIGYCGLWIIIDESHITNIAILPEYRGLKLGDALLKEVISEAKTLGVKTMTLE
FT                   VRVSNEVAKQLYRKYGFQNGGIRKRYYADNQEDGLVMWVNI"
FT   gene            252938..253954
FT                   /locus_tag="BA_0261"
FT                   /old_locus_tag="BA0261"
FT   CDS_pept        252938..253954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0261"
FT                   /old_locus_tag="BA0261"
FT                   /product="putative O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="identified by match to protein family HMM PF00814;
FT                   match to protein family HMM TIGR00329"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24300"
FT                   /db_xref="GOA:Q6I4E9"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6I4E9"
FT                   /protein_id="AAP24300.1"
FT                   /translation="MEKNTIILGIETSCDETAVAVVKNGTEIIANVVASQIESHKRFGG
FT                   VVPEIASRHHVEEITVVLEEALKEANITFDDIDAIAVTEGPGLVGALLIGVNAAKAVAF
FT                   AHDIPLVGVHHIAGHIYANRLVKEVQFPLLSLVVSGGHTELVYMKEHGSFEVIGETRDD
FT                   AAGEAYDKVARTLSMPYPGGPHIDRLAHEGKPTIDLPRAWLEPDSYDFSFSGLKSAVIN
FT                   TVHNAKQRGIEIAPEDLAASFQESVIDVLVTKASRAADAYNVKQVLLAGGVAANKGLRA
FT                   RLETEFAQKENVELIIPPLSLCTDNAAMIAAAGTIAYEQGKRATLALNANPGLDIEA"
FT   gene            complement(254436..256358)
FT                   /locus_tag="BA_0262"
FT                   /old_locus_tag="BA0262"
FT   CDS_pept        complement(254436..256358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0262"
FT                   /old_locus_tag="BA0262"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24301"
FT                   /db_xref="GOA:A0A2P0H950"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H950"
FT                   /protein_id="AAP24301.1"
FT                   /translation="MILLQVNALSKLYGAETILANIKLEVQTKDRIALVGRNGAGKSTL
FT                   LKIIAGELSHDGGEIIKPKDVSMGYLAQNTGLETSLTIWDEMLTVFTHLQQMETKLRRL
FT                   EQEMGKEENFSNEATYERLLADYDQLQLDYKDQGGYQYEADIRSILSGLGFPVETHQTT
FT                   ISTLSGGQKTRLALGKLLLTKPDLLILDEPTNHLDIETLTWLEQYLQGYPGAILIVSHD
FT                   RYFLDKLVTQVYEISNKESRRFVGNYSKYLDLKSALYEQEMKRYEKQQDEIAKLEDFVQ
FT                   KNIARASTTKRAQSRRKQLDRMELLTRPLGDSKSASFHFDIEKQSGNDVLQVKDATIGY
FT                   DKDPIIEHVTMRLTRGDSVALVGPNGIGKSTLLKSIVNKLPLLHGDVSFGSNVSVGYYD
FT                   QEQANLTSSKRVLNELWDEYPLQPEKEIRTILGNFLFTGDDVLKPVSSLSGGQKARLAL
FT                   AKLMMQKSNLLILDEPTNHLDLNSKEILENALIDYPGTLLFVSHDRYFINRVTTTVIEL
FT                   STEGAQEYLGDYDYYVEKKNEMIERAELEQEDETPVQKTVAQEKLNYLEEKERKKLERQ
FT                   RTRKIEELEQNIVQFEEEIATLEDQLCLPEIYADYEKASEITTKKQTLQEQLDACMAEW
FT                   EELHV"
FT   gene            256546..257175
FT                   /locus_tag="BA_0263"
FT                   /old_locus_tag="BA0263"
FT   CDS_pept        256546..257175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0263"
FT                   /old_locus_tag="BA0263"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:109959; match to
FT                   protein family HMM PF02629; match to protein family HMM
FT                   PF06971"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24302"
FT                   /db_xref="GOA:Q81VE5"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VE5"
FT                   /protein_id="AAP24302.1"
FT                   /translation="MEQQKIPQATAKRLPLYYRFIQNLSLSGKQRVSSAELSEAVKVDS
FT                   ATIRRDFSYFGALGKKGYGYNVNYLLSFFRETLDQDDITRVALIGVGNLGTAFLHYNFT
FT                   KNNNTKIEMAFDVSEEKVGTEIGGIPVYHLDELEERLSSDIQVAILTVPATVAQSVADR
FT                   LAETNVHGILNFTPARLNVSDNIRIHHIDLAVELQTLVYFLKNYPQ"
FT   gene            complement(257205..257396)
FT                   /locus_tag="BA_0264"
FT                   /old_locus_tag="BA0264"
FT   CDS_pept        complement(257205..257396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0264"
FT                   /old_locus_tag="BA0264"
FT                   /product="putative lipoprotein"
FT                   /note="identified by similarity to EGAD:107497"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24303"
FT                   /db_xref="GOA:A0A3P1TJ24"
FT                   /db_xref="InterPro:IPR025426"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TJ24"
FT                   /protein_id="AAP24303.1"
FT                   /translation="MRNSPLFMAALYFLLGCIFTHLAIRNVTDTIWNMWTILFAVMATI
FT                   DFNLALRLILVKFTKKKQ"
FT   gene            complement(257393..258100)
FT                   /locus_tag="BA_0265"
FT                   /old_locus_tag="BA0265"
FT   CDS_pept        complement(257393..258100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0265"
FT                   /old_locus_tag="BA0265"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24304"
FT                   /db_xref="GOA:A0A2P0H912"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H912"
FT                   /protein_id="AAP24304.1"
FT                   /translation="MQLSSIAGLPLLLKTGLYDNRGFTREEKFQLITGHWAIISFFIAL
FT                   CIVLWLLRTDIRDRHLDTKRSTVPATIGWIFIGFFLAFFSQSIAGMIEMYVLGIKPGSE
FT                   NTARLMDIARTTPWFLIVISIIGPILEEIVFRKILFGTLYKKFNFFIAAIISSLVFAAI
FT                   HFDFTHLLVYTAMGLVFAFLYVKTKRIIVPIAAHVAMNTLVAIAQVLVSNEQIQEMIKE
FT                   AEKMQGFIGGFLV"
FT   gene            258543..258827
FT                   /gene="groES"
FT                   /locus_tag="BA_0266"
FT                   /old_locus_tag="BA0266"
FT   CDS_pept        258543..258827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="BA_0266"
FT                   /old_locus_tag="BA0266"
FT                   /product="chaperonin, 10 kDa"
FT                   /note="identified by similarity to SP:P28599; match to
FT                   protein family HMM PF00166"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24305"
FT                   /db_xref="GOA:Q81VE2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VE2"
FT                   /protein_id="AAP24305.1"
FT                   /translation="MLKPLGDRVVIELVQAEEKTASGIVLPDTAKEKPQEGKVIAVGTG
FT                   RVLENGERVALEVAAGDLIIFSKYAGTEVKYEGTDYLILRESDILAVIG"
FT   gene            258866..260500
FT                   /gene="groEL"
FT                   /locus_tag="BA_0267"
FT                   /old_locus_tag="BA0267"
FT   CDS_pept        258866..260500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="BA_0267"
FT                   /old_locus_tag="BA0267"
FT                   /product="chaperonin, 60 kDa"
FT                   /note="identified by similarity to SP:P28598; match to
FT                   protein family HMM PF00118; match to protein family HMM
FT                   TIGR02348"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24306"
FT                   /db_xref="GOA:Q81VE1"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VE1"
FT                   /protein_id="AAP24306.1"
FT                   /translation="MAKDIKFSEEARRSMLRGVDTLANAVKVTLGPKGRNVVLEKKFGS
FT                   PLITNDGVTIAKEIELEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLK
FT                   NVTAGANPMGLRKGIEKAVVAAVEELKTISKPIEGKSSIAQVAAISAADEEVGQLIAEA
FT                   MERVGNDGVITLEESKGFTTELDVVEGMQFDRGYASPYMITDSDKMEAVLDNPYILITD
FT                   KKISNIQEILPVLEQVVQQGKPLLIIAEDVEGEALATLVVNKLRGTFNVVAVKAPGFGD
FT                   RRKAMLEDIAILTGGEVITEELGRDLKSATVESLGRAGKVVVTKENTTVVEGVGSTEQI
FT                   EARIGQIRAQLEETTSEFDREKLQERLAKLVGGVAVIKVGAATETELKERKLRIEDALN
FT                   STRAAVEEGIVAGGGTSLMNVYTKVASIVAEGDEATGINIVLRALEEPVRQIAINAGLE
FT                   GSVVVERLKGEKVGVGFNAATGEWVNMLETGIVDPAKVTRSALQNAASVAAMFLTTEAV
FT                   VADKPEPNAPAMPDMGGMGMGGMGGMM"
FT   gene            260908..262446
FT                   /gene="guaA"
FT                   /locus_tag="BA_0268"
FT                   /old_locus_tag="BA0268"
FT   CDS_pept        260908..262446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="BA_0268"
FT                   /old_locus_tag="BA0268"
FT                   /product="GMP synthase"
FT                   /EC_number="6.3.5.2"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF00958; match to protein
FT                   family HMM TIGR00884; match to protein family HMM
FT                   TIGR00888"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24307"
FT                   /db_xref="GOA:Q81VE0"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VE0"
FT                   /protein_id="AAP24307.1"
FT                   /translation="MKKQHDTIIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIK
FT                   AMNPKGIIFSGGPNSVYGEGALHCDEKIFDLGLPIFGICYGMQLMTQQFGGTVERANHR
FT                   EYGKAVLKVENESKLYANLPEEQVVWMSHGDLVTGLPEGFVVDATSESCPIAGMSNEAK
FT                   NLYGVQFHPEVRHSEHGNDLIKNFVFGVCGCSEGWNMENFIEVELEKIRETVGDKKVLC
FT                   ALSGGVDSSVVAVLIHKAIGDQLTCIFVDHGLLRKGEAEGVMKTFSEGFHMNVIKVDAK
FT                   ERFMNKLKGVEDPEQKRKIIGNEFIYVFDDEASKLEGMDFLAQGTLYTDIVESGTATAQ
FT                   TIKSHHNVGGLPEDMQFKLIEPLNTLFKDEVRVLGSELGIPDEIVWRQPFPGPGLGIRV
FT                   LGEITEEKLEIVRESDAILREEIIKAGLDREIWQYFTALPGMRSVGVMGDERTYDYTVG
FT                   IRAVTSIDGMTADWARIPWDVLEKISVRIVNEVKHVNRIVYDVTSKPPATIEWE"
FT   gene            262831..264156
FT                   /locus_tag="BA_0270"
FT                   /old_locus_tag="BA0270"
FT   CDS_pept        262831..264156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0270"
FT                   /old_locus_tag="BA0270"
FT                   /product="xanthine/uracil permease family protein"
FT                   /note="identified by similarity to OMNI:SA2242; match to
FT                   protein family HMM PF00860"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24308"
FT                   /db_xref="GOA:A0A1T3UHI5"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1T3UHI5"
FT                   /protein_id="AAP24308.1"
FT                   /translation="MKRYFQFDELGTNYKTEFIAGLTTFLSMAYVLFVNPATLSLGNVK
FT                   GLPAGTGMDPGAVFVATALAAAIGSLIMGIFAKYPIALAPGMGINAFFAYTAVLTMGIP
FT                   WQTAIAGTLMSGIIFIILTASGIREKIINAIPSELKFAVAAGIGLFIAFLGFQNAGIIV
FT                   KNDAVLVGLGDLTKGTTLLAIFGVVTTIIFMIKKVNGAVFYGMILTAILGVATGLIDTP
FT                   KAVVGAIPSLEPTFGAALTHFGDIFTVQMGIVIITFFFIDFFDTAGTLVAVANQAGLMK
FT                   NNKLPRAGKALFADAIATVIGAILGTSTTTSYIESSAGVAAGGRSGFTAVVTAGFFLLA
FT                   LFFSPLLSVVTPAVTAPALIIVGILMVSSLGEIDWKKFEIAVPAFFTIISMPLTYSIAT
FT                   GIAIGFIFYPITMVVSGRRKEIHPIMYVMGVLFVLYFIYVRK"
FT   gene            264301..265002
FT                   /locus_tag="BA_0271"
FT                   /old_locus_tag="BA0271"
FT   CDS_pept        264301..265002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0271"
FT                   /old_locus_tag="BA0271"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by similarity to GP:15023431; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24309"
FT                   /db_xref="GOA:A0A1T3UH94"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1T3UH94"
FT                   /protein_id="AAP24309.1"
FT                   /translation="MAHETILVVDDEKEIRNLITIYLKNEGYKVLQAGDGEEGLRLLEE
FT                   NEVHLVVLDIMMPKVDGIHMCMKIREEKEMPIIMLSAKTQDMDKILGLTTGADDYVTKP
FT                   FNPLELIARIKSQLRRYMKMNGFAIQNEDELEIGEMKINISTHKVIVEGEEVKLTPREF
FT                   SILELLARNPGMVFSAEQIYEKVWNERSFQSDNTVMVHIRKVREKIEENPRKPRYIKTV
FT                   WGVGYKIEKDI"
FT   gene            264986..266491
FT                   /locus_tag="BA_0272"
FT                   /old_locus_tag="BA0272"
FT   CDS_pept        264986..266491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0272"
FT                   /old_locus_tag="BA0272"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="identified by similarity to GP:15023432; match to
FT                   protein family HMM PF00512; match to protein family HMM
FT                   PF00672; match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24310"
FT                   /db_xref="GOA:A0A3Q0PQJ1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0PQJ1"
FT                   /protein_id="AAP24310.1"
FT                   /translation="MKKIFNPFTYIRKARQLIEKLVKGVRKSIRIQLITTFAACALLGV
FT                   FFAKGAAPFFENANRQATIDYRAGMEQINHEAQRAANSSVHENKLEAISNMIEMENQNL
FT                   ERGSRALKILVTDESGKVLYKTKQAQEEQIDLHNTIRNAASFAINYSNGRDVFENTRKE
FT                   FIAFSPITIEDKNLYMFVSGIPDGVVMYDTQEGPFPFLIGVLVFIFSFFYITKRKMKQI
FT                   EAMAEGVKEIEKGNLAYRIEKKGEDEIASLTENINNMAEELMNNIEKERKLEKQKNELI
FT                   TNVSHDLRTPLTSIMGYLRLLRDSKYENKEQHDEYTRIAFAKSEQLKNLIEDLFEYTKL
FT                   TNEQVVLEKQEVCVNELLEQLIEELVPQAEEHGLTFVKKFPEERAYAAIDSEKMVRVFD
FT                   NLLMNAIKYSKDDGEIKVSLQRQRWEIQIVIANHSEEFTREELASLFERFYKKDQSRSR
FT                   VTEGSGLGLAIAKSIVELQGGSIRAEYKDGIIQFIVSLPIIER"
FT   gene            266814..268320
FT                   /gene="rrsF"
FT                   /locus_tag="BA_5783"
FT   rRNA            266814..268320
FT                   /gene="rrsF"
FT                   /locus_tag="BA_5783"
FT                   /product="16S ribosomal RNA"
FT   gene            268499..271406
FT                   /gene="rrlF"
FT                   /locus_tag="BA_5784"
FT   rRNA            268499..271406
FT                   /gene="rrlF"
FT                   /locus_tag="BA_5784"
FT                   /product="23S ribosomal RNA"
FT   gene            271456..271571
FT                   /gene="rrfF"
FT                   /locus_tag="BA_5785"
FT   rRNA            271456..271571
FT                   /gene="rrfF"
FT                   /locus_tag="BA_5785"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(271709..272662)
FT                   /locus_tag="BA_0273"
FT                   /old_locus_tag="BA0273"
FT   CDS_pept        complement(271709..272662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0273"
FT                   /old_locus_tag="BA0273"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to OMNI:CC0633"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24311"
FT                   /db_xref="InterPro:IPR032719"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LJT0"
FT                   /protein_id="AAP24311.1"
FT                   /translation="MKIIAFYLPQFHQIKENDRWWGKGFTEWTNTKSARPLFSKHYQPR
FT                   EPYQDFYYDLTDPSVRKWQAEIAKAHGIYGFCYYHYWFKGKRLLETPFNEVLKTGEPDF
FT                   PFCLSWANEPWTKTWDGLDSHILMPQNYGELSDWKEHFDYLLQAFQDERYIRIDDKPLF
FT                   IIYRPGHIPDCEQMLNYWNILAQENGLKGIYFVETLNSFPLPNIHGFDASIQFEPFYTI
FT                   AHDSSSDINKTIYESGKQINAWDYDKVWMYILKRSPSEKKTFPGAFVDWDNTARRKDLN
FT                   SSIFLGSTPEKFTIYLSKQIYRTYSLYNSEFLFMNA"
FT   gene            complement(272895..273767)
FT                   /locus_tag="BA_0274"
FT                   /old_locus_tag="BA0274"
FT   CDS_pept        complement(272895..273767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0274"
FT                   /old_locus_tag="BA0274"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to OMNI:NTL02MT01494; match
FT                   to protein family HMM PF08241; match to protein family HMM
FT                   PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24312"
FT                   /db_xref="GOA:A0A0F7RNU8"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RNU8"
FT                   /protein_id="AAP24312.1"
FT                   /translation="MNNFKLGNDFDNLVSPLSDVELLNLFIQSCSQTKINGTPVPMFPP
FT                   EEIQQQFVGASYEHALYEAYLFYSHVKTYAQNLGVPLNKERKILDFGCGWGRIIRFFFK
FT                   DIRDENLLGIDVDPAMINICNETLGRGIYKTANPQPPVEFISDNSLDIIFAYSVFSHLS
FT                   EETAEHWIKEFSRILRPGGIFIATTQARYFLDYCQQFKEHPEFIQTGWHKTLSQAFPDI
FT                   NRAISDYESGNFVHSPTGAGNVRNSRFYGETVIPRTYIKNHYEKYLKLRDFFDDVNRLP
FT                   QALFVLQKD"
FT   gene            complement(273794..274516)
FT                   /locus_tag="BA_0275"
FT                   /old_locus_tag="BA0275"
FT   CDS_pept        complement(273794..274516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0275"
FT                   /old_locus_tag="BA0275"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to EGAD:170757; match to
FT                   protein family HMM PF08241"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24313"
FT                   /db_xref="GOA:A0A347ZY95"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZY95"
FT                   /protein_id="AAP24313.1"
FT                   /translation="MEGNLKHNNGYCVICEKEATFIEHNDWLRDHYLCSTCHSIPRQRA
FT                   LVHVLNTLFPKWDSYHIHESSPGGITTQLLIKNCKNYTYSQYFKNYPLGQYFQGIRCEN
FT                   LENMTFQNESFDLFITQDVFEHVMEPEKAFKEIERVLKPGGAHVFTVPWYPTLPKTLQR
FT                   ARNNKDGIEYMEEPIYHGNPIDEKGALVTFDWGQDMIEYIYTHANMYTIVYLQKDRSLG
FT                   LDAEFLHVFISKKHEHNF"
FT   gene            complement(274820..275614)
FT                   /locus_tag="BA_0276"
FT                   /old_locus_tag="BA0276"
FT   CDS_pept        complement(274820..275614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0276"
FT                   /old_locus_tag="BA0276"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24314"
FT                   /db_xref="GOA:A0A2P0H922"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H922"
FT                   /protein_id="AAP24314.1"
FT                   /translation="MKNINQKFLEYIILHKDRIPHFHKDFPLILFWSHRSGCTALANWF
FT                   FFQIGLFPEAKKYNDFIHYYEFWVYKNNPNYIQAVHSGLLEAKKHVCKLVRNPYTRAVS
FT                   SFLLLADNPYASPQWDSIRKCFYNDKHSKQGISFKQFLYYVQTLGSNSQVIDMHFSQQY
FT                   VQGEEAFIQSYIPLEDFNKQIPKTENEYGLIKSDLTKLTSSGHHRAHKMVYTGSYAELS
FT                   ITDEAFPRFPTYASFYDKETMDLVTEIYAKDFEMYPYTKGIF"
FT   gene            275877..276819
FT                   /pseudo
FT                   /locus_tag="BA_0277"
FT                   /old_locus_tag="BA0277"
FT                   /note="UDP-glucose 4-epimerase, authentic frameshift; an
FT                   automated process has identified a potential problem with
FT                   this gene model; it may contain one or more premature stops
FT                   and/or frameshifts"
FT   gene            complement(276860..277633)
FT                   /locus_tag="BA_0278"
FT                   /old_locus_tag="BA0278"
FT   CDS_pept        complement(276860..277633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0278"
FT                   /old_locus_tag="BA0278"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to EGAD:47667; match to
FT                   protein family HMM PF08241; match to protein family HMM
FT                   PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24315"
FT                   /db_xref="GOA:A0A2B6BL90"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2B6BL90"
FT                   /protein_id="AAP24315.1"
FT                   /translation="MKEFIETNKDLISQIAQNYNVNASIHPEDHIFQFLVTNPVFPSKK
FT                   EAIDYYFKDGRKSAETLLDLMTSFYPPVDTPIKLLEFASGYGCVTRHLLNLQTNLRITA
FT                   CDIHEEAITFLERTLHTSSILSHPEPEQIKLSSTYDIVFGLSFFSHMPDTTWFRWLQTL
FT                   YNAVSPGGLFIFTTHGYQSKKYFGFPDLNKQGYWFLPSSEQLDLDVHQYGQTIVSPSYV
FT                   CDKIKLLPYNPIIKKYTEGFWWEHQDLWVIQKEIK"
FT   gene            complement(277701..278135)
FT                   /locus_tag="BA_0279"
FT                   /old_locus_tag="BA0279"
FT   CDS_pept        complement(277701..278135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0279"
FT                   /old_locus_tag="BA0279"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24316"
FT                   /db_xref="GOA:Q81VD1"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VD1"
FT                   /protein_id="AAP24316.1"
FT                   /translation="MANHYLDYTNDIDKEKWQSSYVRKGIDEIQDTLLIKNTIPNVSSV
FT                   VFKNIDIKTTAKQLEKFKIASDWFFYVSILKEGNIYFNPKPLNYHRRHKNSVTRAEDSY
FT                   SHYSEVVQMQNFIKETFTIDDISKKKMYAYRKYLKAYLKV"
FT   gene            complement(278301..279632)
FT                   /locus_tag="BA_0280"
FT                   /old_locus_tag="BA0280"
FT   CDS_pept        complement(278301..279632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0280"
FT                   /old_locus_tag="BA0280"
FT                   /product="glycosyltransferase, group 1 family"
FT                   /note="identified by similarity to GP:5702002; match to
FT                   protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24317"
FT                   /db_xref="GOA:A0A0F7RI84"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RI84"
FT                   /protein_id="AAP24317.1"
FT                   /translation="MHVNKKIIYVSHDAHFHGAQLLSLHTIKALKENFHYSVAIISIRT
FT                   GILIHDFQKYGPVYCLEEDYPTENKVESLIKKLLSQDYTIAICSTVISGDIVALLAKHN
FT                   IKVISLIHELPHLIQQYSAEGKARKIAESAHKIVFPSQYVYEKFHTITQLDHQKCHILP
FT                   QGLFNHNPYKNNIAKARNELRKKHNLPLDSKIILGVGFADHRKGIDLFSLIAYSVRKIH
FT                   KNIHFIWVGKTDVHFLNTLSQRYTAHFTLVEPTPDIGLYNAGADLYLLTSREDPFPNVV
FT                   LEALDTKVPVIGFKNAGGFGDVVTEQTGALVDYLNLPMMLEKIYEFIGDEDLRLQKGTF
FT                   GQELIEKNFNFLHYIYQLLNLLEHNYKKISVIVPNYNYEKYLSERVKSILNQTYPLYEL
FT                   IFLDDASTDNSVSIFEKLLSNENKHHLKIQQIINDKNSGSVFKQ"
FT   gene            280018..280116
FT                   /locus_tag="BA_0281"
FT                   /old_locus_tag="BA0281"
FT   CDS_pept        280018..280116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0281"
FT                   /old_locus_tag="BA0281"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   premature stop; identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H9S3"
FT                   /protein_id="AAP24318.1"
FT                   /translation="MKTERNKQRETSIFILDARQTNFIGEFDPGSG"
FT   gene            280112..281618
FT                   /gene="rrsG"
FT                   /locus_tag="BA_5786"
FT   rRNA            280112..281618
FT                   /gene="rrsG"
FT                   /locus_tag="BA_5786"
FT                   /product="16S ribosomal RNA"
FT   gene            281797..284704
FT                   /gene="rrlG"
FT                   /locus_tag="BA_5787"
FT   rRNA            281797..284704
FT                   /gene="rrlG"
FT                   /locus_tag="BA_5787"
FT                   /product="23S ribosomal RNA"
FT   gene            284755..284870
FT                   /gene="rrfG"
FT                   /locus_tag="BA_5788"
FT   rRNA            284755..284870
FT                   /gene="rrfG"
FT                   /locus_tag="BA_5788"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(285321..286118)
FT                   /gene="uppP"
FT                   /locus_tag="BA_0283"
FT                   /old_locus_tag="BA0283"
FT   CDS_pept        complement(285321..286118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppP"
FT                   /locus_tag="BA_0283"
FT                   /old_locus_tag="BA0283"
FT                   /product="undecaprenyl-diphosphatase UppP"
FT                   /EC_number="3.6.1.27"
FT                   /note="identified by match to protein family HMM PF02673;
FT                   match to protein family HMM TIGR00753"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24319"
FT                   /db_xref="GOA:Q81VC9"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VC9"
FT                   /protein_id="AAP24319.1"
FT                   /translation="MSDIITAFILGIVEGLAEFLPISSTGHLILVGHLLGFEGERAKTF
FT                   EIVIQLGAILAIAILYHKRLVSLCNLKPLLRKEKKFNAFHVFLGVFPAVVAGLLLHDVI
FT                   KTYLFQPYTVVIGLVAGAILMIFAEVKKQEATSYSLDDLTYRQALTIGLFQCLAVYPGF
FT                   SRAGSTISGGLLAKVNYKTASEFSFLIALPVMVGATGLDLLKSWTYLSVDDIPMFAVGF
FT                   ITSFIVAMLAVVTFLKLLEKIGLKPFAYYRILLAILFTVFVLL"
FT   gene            complement(286136..286882)
FT                   /locus_tag="BA_0284"
FT                   /old_locus_tag="BA0284"
FT   CDS_pept        complement(286136..286882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0284"
FT                   /old_locus_tag="BA0284"
FT                   /product="putative bacitracin ABC transporter, permease
FT                   protein"
FT                   /note="identified by similarity to SP:P42333"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24320"
FT                   /db_xref="GOA:A0A3Q0PQZ6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0PQZ6"
FT                   /protein_id="AAP24320.1"
FT                   /translation="MEQLVNLFYTELLKLKRSNMFLISIIGAGVAPFLVVVASYIHIKT
FT                   KQPTPTIWFHQLFTEVNLYTTLVIGFPLYGVVVAYLFTREYAEDTLKNLLTIPVSRISF
FT                   IISKFIILFLWIMMLTLVAWSLTLILGLLGNFPGFNTTLLLGSFLKFLICGGLLFLLSS
FT                   PIVLLTLVMKSYVPPIILTVIITMTNLMLVNSKHKDLFPWTATLDIANNELQPTYPPEY
FT                   SYIIIVTTAIFGFIATLFYFKRVDIH"
FT   gene            complement(286866..287795)
FT                   /locus_tag="BA_0285"
FT                   /old_locus_tag="BA0285"
FT   CDS_pept        complement(286866..287795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0285"
FT                   /old_locus_tag="BA0285"
FT                   /product="putative bacitracin ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by similarity to SP:P42332; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24321"
FT                   /db_xref="GOA:A0A3Q0PQ75"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0PQ75"
FT                   /protein_id="AAP24321.1"
FT                   /translation="MSPINTIIKTTNLTKVYGKQKSVDNLNINVQQGEIYGFIGRNGAG
FT                   KTTTIRMLLGLIKPTSGTIEIFGEDLFQNQKDILSRIGSIVEVPGFYENLTAKENLLIN
FT                   AKIIGVYKKNAIEDTLEIVGLQHETKKLVGKYSLGMKQRLGIARALLHYPELLILDEPT
FT                   NGLDPIGIKEMRKLIHSLAQERNITILISSHILAEVEQLVDRIGIIHEGRLLEEVSLDK
FT                   LRKANRKYIEFQVNNENKAAMLLENQFQIFDYEVHDEGNIRIYSHFGQQGYINRTFVLN
FT                   DIEVLKMMISEDRLEDYFTKLVGGGTIG"
FT   gene            complement(287864..288808)
FT                   /locus_tag="BA_0286"
FT                   /old_locus_tag="BA0286"
FT   CDS_pept        complement(287864..288808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0286"
FT                   /old_locus_tag="BA0286"
FT                   /product="putative sensor histidine kinase"
FT                   /note="identified by similarity to GP:10173433; match to
FT                   protein family HMM PF00512; match to protein family HMM
FT                   PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24322"
FT                   /db_xref="GOA:A0A2P0H958"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H958"
FT                   /protein_id="AAP24322.1"
FT                   /translation="MDPKVKISLFITLILITMYLFFSRIQFIQNHKSIDTKLSRALKGN
FT                   LQTRLFTSNDQSLHNIVFSINELITELEKVRIKAKRSEESRKQLLSSISHDIRTPLTSI
FT                   IGYIDALKDGVAASEIEKQEYLKILYMKSNNLKHLVDEIFNMAKLDANEFPLKEEKLDF
FT                   SEVTREVLIDFLPEISKHNIKLQVLMPESTCPIIADHLSLMRIIGNLMKNAIYYGKDGK
FT                   TIGVELLETDAAYELLIWDKGPGIPKHDLQNVFERMYRSEQSRNSSFGGSGLGLSISKA
FT                   LVEKNGGHIWVESIPWERTTFGFSIPKHNTFKK"
FT   gene            complement(288867..289580)
FT                   /locus_tag="BA_0287"
FT                   /old_locus_tag="BA0287"
FT   CDS_pept        complement(288867..289580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0287"
FT                   /old_locus_tag="BA0287"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by similarity to OMNI:NTL01BS02308; match
FT                   to protein family HMM PF00072; match to protein family HMM
FT                   PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24323"
FT                   /db_xref="GOA:A0A3Q0PR56"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0PR56"
FT                   /protein_id="AAP24323.1"
FT                   /translation="MKDIRILIADDDKEIRNLLKIYLERELYMVDTAIDGEVALQLFNQ
FT                   NNYSIVILDLMMPKVDGIEVCRKLRDKTNVPILMLTAKDHEVDKILGLSIGADDYITKP
FT                   FSIHEVVARVKALIRRFLVLGSNINVQEKTTLAFKGLTINLNTYTVHTNKEEISLTGKE
FT                   LELLKFFTSNPGQVFTKTQLFRNVWDDNYIEDDNTVMVHIRKLRKKIEIDPSNPKFIQT
FT                   VWGIGYKFVGEKLED"
FT   gene            290085..291591
FT                   /gene="rrsH"
FT                   /locus_tag="BA_5789"
FT   rRNA            290085..291591
FT                   /gene="rrsH"
FT                   /locus_tag="BA_5789"
FT                   /product="16S ribosomal RNA"
FT   gene            291770..294677
FT                   /gene="rrlH"
FT                   /locus_tag="BA_5790"
FT   rRNA            291770..294677
FT                   /gene="rrlH"
FT                   /locus_tag="BA_5790"
FT                   /product="23S ribosomal RNA"
FT   gene            294728..294843
FT                   /gene="rrfH"
FT                   /locus_tag="BA_5791"
FT   rRNA            294728..294843
FT                   /gene="rrfH"
FT                   /locus_tag="BA_5791"
FT                   /product="5S ribosomal RNA"
FT   gene            295542..296027
FT                   /gene="purE"
FT                   /locus_tag="BA_0288"
FT                   /old_locus_tag="BA0288"
FT   CDS_pept        295542..296027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="BA_0288"
FT                   /old_locus_tag="BA0288"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by match to protein family HMM PF00731;
FT                   match to protein family HMM TIGR01162"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24324"
FT                   /db_xref="GOA:A0A2P0H933"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H933"
FT                   /protein_id="AAP24324.1"
FT                   /translation="MKSLVGVIMGSTSDWETMKYACDILDELNIPYEKKVVSAHRTPDY
FT                   MFEYAETARERGLKVIIAGAGGAAHLPGMVAAKTNLPVIGVPVQSKALNGLDSLLSIVQ
FT                   MPGGVPVATVAIGKAGSTNAGLLAAQILGSFHDDIHDALELRREAIEKDVREGSELV"
FT   gene            296024..297175
FT                   /gene="purK"
FT                   /locus_tag="BA_0289"
FT                   /old_locus_tag="BA0289"
FT   CDS_pept        296024..297175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="BA_0289"
FT                   /old_locus_tag="BA0289"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by match to protein family HMM PF02222;
FT                   match to protein family HMM PF02655; match to protein
FT                   family HMM TIGR01161"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24325"
FT                   /db_xref="GOA:A0A347ZYA2"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYA2"
FT                   /protein_id="AAP24325.1"
FT                   /translation="MTRIILPGKTIGIIGGGQLGRMMALAAKEMGYKIAVLDPTKNSPC
FT                   AQVADIEIVASYDDLKAIQHLAEISDVVTYEFENIDYRCLQWLEKHAYLPQGSQLLSKT
FT                   QNRFTEKNAIEKAGLPVATYRLVQNQEQLTEAIAELSYPSVLKTTTGGYDGKGQVVLRS
FT                   EADVDEARKLANAAECILEKWVPFEKEVSVIVIRSVSGETKVFPVAENIHVNNILHESI
FT                   VPARITEELSQKAIAYAKVLADELELVGTLAVEMFATADGEIYINELAPRPHNSGHYTQ
FT                   DACETSQFGQHIRAICNLPLGETNLLKPVVMVNILGEHIEGVLRQVNRLTGCYLHLYGK
FT                   EEAKAQRKMGHVNILNDNIEVALEKAKSLHIWDHQEQLLEGKR"
FT   gene            297172..298479
FT                   /gene="purB"
FT                   /locus_tag="BA_0290"
FT                   /old_locus_tag="BA0290"
FT   CDS_pept        297172..298479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="BA_0290"
FT                   /old_locus_tag="BA0290"
FT                   /product="adenylosuccinate lyase"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift; identified by match to protein family HMM
FT                   PF00206; match to protein family HMM TIGR00928"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24326"
FT                   /db_xref="GOA:A0A3P1TZY8"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TZY8"
FT                   /protein_id="AAP24326.1"
FT                   /translation="MISRYTRPEMGAIWTEENKFKAWLEVEILACEAWAELGDIPKEDV
FT                   KKIREHASFDIDRIYEIEKETRHDVVAFTRAVSETPALGEERKWVHYGLTSTDVVDTAL
FT                   SYILKQANEIILKDLENFVSILANKAKEHKYTIMMGRTHGVHAEPTTFGLKLGLWYEEM
FT                   KRNVERFKQAANTVRVGKLSGAVGTYANIDPFVEKYVCENLGLEAAPISTQTLQRDRHA
FT                   HYMSTLALIATSIEKMAVEIRGLQKSETREVEEAFAKGQKGSSAMPHKRNPIGSENMTG
FT                   LARVIRGYMMTAYENVPLWHERDISHSSAERVILPDATIALNYMLNRFGNIVKNLTVYP
FT                   ENMKRNMTRTYGLIYSQRVMLTLIDKGMVREEAYDIVQPKAMEAWETQVQFKELVEADE
FT                   RITSKLTQEEINECFNYEHHMQHVDTIFERLGLNEA"
FT   gene            298568..299287
FT                   /gene="purC"
FT                   /locus_tag="BA_0291"
FT                   /old_locus_tag="BA0291"
FT   CDS_pept        298568..299287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="BA_0291"
FT                   /old_locus_tag="BA0291"
FT                   /product="phosphoribosylaminoimidazolesuccinocarboxamide
FT                   synthase"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift; identified by match to protein family HMM
FT                   PF01259; match to protein family HMM TIGR00081"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24327"
FT                   /db_xref="GOA:Q81ZH5"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZH5"
FT                   /protein_id="AAP24327.1"
FT                   /translation="MQKLELLYEGKAKRIYRTESADMVWVEYKDSATAFNGEKKETITG
FT                   KGRLNNEITTLLFRKLQEVGIKTHFVEKLSETEQLVKKVSIIPLEVVTRNVIAGSLSKR
FT                   LGMEEGTVLAEPIVEFYFKDDDLGDPLVTEDHIRVLNVASPEQVSVLRDMALQINQVLI
FT                   DHFASCRVRLVDFKLEFGVTDEGAIILADEISPDTCRLWDETSNEKFDKDVFRRDLGNL
FT                   TDAYEEILKRLGGISHV"
FT   gene            299280..299534
FT                   /gene="purS"
FT                   /locus_tag="BA_0292"
FT                   /old_locus_tag="BA0292"
FT   CDS_pept        299280..299534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purS"
FT                   /locus_tag="BA_0292"
FT                   /old_locus_tag="BA0292"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS
FT                   protein"
FT                   /note="identified by similarity to EGAD:10915; match to
FT                   protein family HMM PF02700; match to protein family HMM
FT                   TIGR00302"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24328"
FT                   /db_xref="GOA:A0A2B8IW76"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2B8IW76"
FT                   /protein_id="AAP24328.1"
FT                   /translation="MYKVKVYVTLRESVLDPQGTAVKGALHSLSFTEVQDVRIGKYMEL
FT                   TIDKSVSDLDAKVKEMCEKLLANVVMEDFRYEVEEVVAQ"
FT   gene            299531..300214
FT                   /gene="purQ"
FT                   /locus_tag="BA_0293"
FT                   /old_locus_tag="BA0293"
FT   CDS_pept        299531..300214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purQ"
FT                   /locus_tag="BA_0293"
FT                   /old_locus_tag="BA0293"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /EC_number="6.3.5.3"
FT                   /note="identified by similarity to SP:P12041; match to
FT                   protein family HMM PF00117; match to protein family HMM
FT                   PF07685; match to protein family HMM TIGR01737"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24329"
FT                   /db_xref="GOA:Q81ZH3"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZH3"
FT                   /protein_id="AAP24329.1"
FT                   /translation="MKFAVIVFPGSNCDVDMFHAIKDELGEEVDYVWHDTENLDEYDAI
FT                   LLPGGFSYGDYLRCGAISRFANAMKAVQKAAEQGKPILGVCNGFQILVESGLLPGALMR
FT                   NENLKFMCRTVQLRVENNETMFTSQYEKDEVINIPIAHGEGNYYCDEETLKQLEENNQI
FT                   AFRYVENPNGSVSDIAGIVNEKGNVLGMMPHPERAVDELLGGAEGLKVFQSILKQWRET
FT                   YVVNA"
FT   gene            300198..302417
FT                   /gene="purL"
FT                   /locus_tag="BA_0294"
FT                   /old_locus_tag="BA0294"
FT   CDS_pept        300198..302417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purL"
FT                   /locus_tag="BA_0294"
FT                   /old_locus_tag="BA0294"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /EC_number="6.3.5.3"
FT                   /note="identified by similarity to SP:P12042; match to
FT                   protein family HMM PF00586; match to protein family HMM
FT                   PF02769; match to protein family HMM TIGR01736"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24330"
FT                   /db_xref="GOA:Q81ZH2"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZH2"
FT                   /protein_id="AAP24330.1"
FT                   /translation="MSLMLEPNPTQIKEERIYAEMGLTDEEFAMVEKILGRLPNYTETG
FT                   LFSVMWSEHCSYKNSKPVLRKFPTTGERVLQGPGEGAGIVDIGDNQAVVFKMESHNHPS
FT                   AIEPYQGAATGVGGIIRDVFSMGARPVALLNSLRFGELQSPRVKYLFEEVVAGIAGYGN
FT                   CIGIPTVGGEVQFDPCYEGNPLVNAMCVGLINHEDIKKGQAHGAGNTVMYVGASTGRDG
FT                   IHGATFASEELSESSEAKRPAVQVGDPFMEKLLIEACLELIQSDALVGIQDMGAAGLTS
FT                   SSAEMASKAGMGIEMYLDDVPQRETGMTPYEMMLSESQERMLIVVKKGREQEIVDLFEK
FT                   YGLAAVTMGKVTEDKMLRLFHKGEMVAEVPADALAEEAPIYHKPSKEAAYFAEFQQMKM
FT                   ETPKVENYKETLFALLQQPTIASKEWVYDQYDYQVRTSTVVTPGSDAAVVRVRGTEKGL
FT                   AMTTDCNSRYIYLDPEVGGKIAVAEAARNIVCSGGEPLAITDCLNFGNPEKPEIFWQIE
FT                   KSVDGMSEACRTLQTPVIGGNVSMYNERSGEAVYPTPTVGMVGLVHDLKHVTTQEFKQA
FT                   GDLVYVIGETKAEFGGSELQKMLHGKIFGQSPSIDLDVELKRQKQVLAAIQAGLVQSAH
FT                   DVAEGGLAVAISESAIGANGLGATVKLDGEATAALFAESQSRFVITVKRENKEAFEKAV
FT                   EAIQVGEVTNTNEVTIHNEENEVLLTANVDEMRKAWKGAIPCLLK"
FT   gene            302402..303817
FT                   /gene="purF"
FT                   /locus_tag="BA_0295"
FT                   /old_locus_tag="BA0295"
FT   CDS_pept        302402..303817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="BA_0295"
FT                   /old_locus_tag="BA0295"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM PF00310; match to protein
FT                   family HMM TIGR01134"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24331"
FT                   /db_xref="GOA:A0A347ZYA8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYA8"
FT                   /protein_id="AAP24331.1"
FT                   /translation="MLAEIKGLNEECGVFGIWGHENAAQVSYYGLHSLQHRGQEGAGIV
FT                   VNNGEKIVGHKGLGLISEVFSRGELEGLNGKSAIGHVRYATAGGSEVANVQPLLFRFSD
FT                   HSMALAHNGNLINAKMLRRELEAEGSIFQTSSDTEVLLHLIKRSTKDSLIESVKEALNK
FT                   VKGAFAYLLLTGNEMIVALDPNGFRPLSIGKMGDAYVVASETCAFDVVGATYIRDVEPG
FT                   ELLIINDEGIHVDRFTNEVDHAICSMEYIYFARPDSNIAGINVHAARKNMGKRLAAEAP
FT                   IEADVVTGVPDSSISAAIGYAEATGIPYELGLIKNRYVGRTFIQPSQELREQGVKMKLS
FT                   AVRGVVEGKRVVMIDDSIVRGTTSKRIVRMLREAGATEVHVRIASPPLKYPCFYGIDIQ
FT                   TRKELIAANHTVEEIREMIGADSLTFLSEDGLVDAIGRPYEGKYGGLCMAYFNGDYPTA
FT                   LYDYEQELLESMK"
FT   gene            303924..304964
FT                   /gene="purM"
FT                   /locus_tag="BA_0296"
FT                   /old_locus_tag="BA0296"
FT   CDS_pept        303924..304964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="BA_0296"
FT                   /old_locus_tag="BA0296"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="identified by match to protein family HMM PF00586;
FT                   match to protein family HMM PF02769; match to protein
FT                   family HMM TIGR00878"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24332"
FT                   /db_xref="GOA:Q81ZH0"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="PDB:2BTU"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZH0"
FT                   /protein_id="AAP24332.1"
FT                   /translation="MANAYKQAGVDIEAGYEAVSRMKKHVQTTMRKEVLGGLGGFGGMF
FT                   DLSKFALEEPVLVSGTDGVGTKLMLAFMADKHDTIGIDAVAMCVNDIVVQGAEPLFFLD
FT                   YIACGKAEPSKIENIVKGISEGCRQAGCALIGGETAEMPGMYSTEEYDLAGFTVGIVDK
FT                   KKIVTGEKIEAGHVLIGLASSGIHSNGYSLVRKVLLEDGELSLDRIYGRLELPLGEELL
FT                   KPTKIYVKPILELLKNHEVYGMAHITGGGFIENIPRMLPEGIGAEIELGSWKIQPIFSL
FT                   LQEVGKLEEKEMFNIFNMGIGMVVAVKEEDAKDIVRLLEEQGETARIIGRTVQGAGVTF
FT                   NGGKAL"
FT   gene            304961..305548
FT                   /gene="purN"
FT                   /locus_tag="BA_0297"
FT                   /old_locus_tag="BA0297"
FT   CDS_pept        304961..305548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="BA_0297"
FT                   /old_locus_tag="BA0297"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /note="identified by match to protein family HMM PF00551;
FT                   match to protein family HMM TIGR00639"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24333"
FT                   /db_xref="GOA:A0A347ZYB0"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYB0"
FT                   /protein_id="AAP24333.1"
FT                   /translation="MSRLAVFASGSGSNFQSLVNAVEEKRLDAEISLLVCDKPEARAVG
FT                   RANYHHIPCFAFSAKAYESKEAFEKEILNKLEEYEIDYVILAGYMRLIGPTLLEAYGGR
FT                   IINIHPSLLPSFPGKDAVGQALEAGVKVTGVTIHYVDAGMDTGPIIAQEAVVVSEGDTR
FT                   ESLQKKIQQVEHKLYVNTVNQIVQSTKEPTVN"
FT   gene            305573..307108
FT                   /gene="purH"
FT                   /locus_tag="BA_0298"
FT                   /old_locus_tag="BA0298"
FT   CDS_pept        305573..307108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="BA_0298"
FT                   /old_locus_tag="BA0298"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /note="identified by match to protein family HMM PF01808;
FT                   match to protein family HMM PF02142; match to protein
FT                   family HMM TIGR00355"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24334"
FT                   /db_xref="GOA:Q81ZG8"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZG8"
FT                   /protein_id="AAP24334.1"
FT                   /translation="MKKRALVSVSDKTGVVEFVKGLLEQGIEVISTGGTKKLLEENGLQ
FT                   VIGISEVTGFPEIMDGRVKTLHPNIHGGLLAVRDNETHVAQMNELGMEPIDFVVVNLYP
FT                   FKETIAKPDVTFADAIENIDIGGPTMIRSAAKNHKFVSVIVDPVDYDVVLAELKENGEV
FT                   AEETKRKLAAKVFRHTAAYDALISNYLTEQMGEESPETLTVTFEKKQDLRYGENPHQKA
FT                   TFYKAPFAATSSVAYAEQLHGKELSYNNINDADAALSIVKEFTEPAVVAVKHMNPCGVG
FT                   VGTDIHEAYTRAYEADPVSIFGGIIAANREIDKATAEKLHEIFLEIIIAPSFSKEALEV
FT                   LQSKKNLRLLTVNIEKATSASKKLTSVQGGLLVQEEDTLSLDESTISIPTKREPSEQEW
FT                   KDLKLAWKVVKHVKSNAIVLAKDDMTIGVGAGQMNRVGSAKIAITQAGEKAQGSALASD
FT                   AFFPMPDTVEEAAKAGITAIIQPGGSIRDEDSIKVADTYGIAMVFTGVRHFKH"
FT   gene            307230..308501
FT                   /gene="purD"
FT                   /locus_tag="BA_0299"
FT                   /old_locus_tag="BA0299"
FT   CDS_pept        307230..308501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="BA_0299"
FT                   /old_locus_tag="BA0299"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="identified by match to protein family HMM PF01071;
FT                   match to protein family HMM PF02222; match to protein
FT                   family HMM PF02655; match to protein family HMM PF02843;
FT                   match to protein family HMM PF02844; match to protein
FT                   family HMM PF08442; match to protein family HMM TIGR00877"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24335"
FT                   /db_xref="GOA:A0A2P0H960"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H960"
FT                   /protein_id="AAP24335.1"
FT                   /translation="MNVLVIGRGGREHALAWKFAQSEKVEKVYVAPGNEGMRDVATPID
FT                   IDENDFDALVLFAKENHVELTFVGPEIPLMNGIVDRFKEEGLRVFGPNKAAAVIEGSKA
FT                   FTKELMKKYNIPTAAYETFTDYEEAVQYIEKVGAPIVIKADGLAAGKGVTVAMTLEEAL
FT                   QAAKEMLQDVKFGEASKKVVIEEFLDGQEFSLMAFVNGTTVHPMVIAQDHKRAFDGDKG
FT                   PNTGGMGAYSPVPQISESAVQEAIETVLYPTAKAMIQENRSFTGILYAGLILTNDGPKV
FT                   IEFNARFGDPETEVVLPRLENDLVDVCNAVLDESELTLQWSDEAVIGVVLAAKGYPEAY
FT                   KKGDIIKGLDALQDVIVFHAGTAMKRGDFVTNGGRVLFVACKANSLQEAKDKVYKEIGK
FT                   IESDVLFYRSDIGYRAIGHEMTRS"
FT   gene            complement(308537..308701)
FT                   /locus_tag="BA_0300"
FT                   /old_locus_tag="BA0300"
FT   CDS_pept        complement(308537..308701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0300"
FT                   /old_locus_tag="BA0300"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to OMNI:SP2133"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24336"
FT                   /db_xref="GOA:A0A2B0WNA2"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2B0WNA2"
FT                   /protein_id="AAP24336.1"
FT                   /translation="MAKKKSFPLRIDPELHAVIEKWANDEFRSVNAHIEYLLREMAKQK
FT                   GKLKKDKDA"
FT   gene            complement(308718..309563)
FT                   /locus_tag="BA_0301"
FT                   /old_locus_tag="BA0301"
FT   CDS_pept        complement(308718..309563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0301"
FT                   /old_locus_tag="BA0301"
FT                   /product="SPFH domain/band 7 family protein"
FT                   /note="identified by similarity to OMNI:EF1789; match to
FT                   protein family HMM PF01145"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24337"
FT                   /db_xref="GOA:A0A2B6CAT5"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2B6CAT5"
FT                   /protein_id="AAP24337.1"
FT                   /translation="MKEKQVFYVNGFLGIIGILILAAIGVFFLIQEIFIGAALTIILAA
FT                   VLATGIGIVQPNQAKVITFFGNYLGTIRQNGLFLTIPFAFRQTVSLRVENFNSKKLKVN
FT                   DVDGNPIEIAAVIVYKVVDSAKAMFGVEHYDRFVEIQSETAIRHVATKYPYDNFQDETC
FT                   ITLRGNTEEISEELKRELEARLEIAGVEVLETRLTHLAYATEIAHAMLQRQQAKAVLAA
FT                   RKEIVEGAVKMAKDSIHMLDEEGVLELDDERKANMVNNLLVAIVSDKGAQPVINTGSLY
FT                   "
FT   gene            complement(309773..310150)
FT                   /locus_tag="BA_0302"
FT                   /old_locus_tag="BA0302"
FT   CDS_pept        complement(309773..310150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0302"
FT                   /old_locus_tag="BA0302"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01BH0637"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24338"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2B3YAQ9"
FT                   /protein_id="AAP24338.1"
FT                   /translation="MKQNIGTINALIRITLGLVLFGCSATKLVRKPWCTWSNILLWIGA
FT                   MKVAEGIVRFCPVVEMWKFGKYMNMGAFKMPSMNFAEKGHTKEEVNQTSNHDKPQSNGS
FT                   YDASDKEIESAIEDIILAKPL"
FT   gene            310422..311174
FT                   /locus_tag="BA_0304"
FT                   /old_locus_tag="BA0304"
FT   CDS_pept        310422..311174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0304"
FT                   /old_locus_tag="BA0304"
FT                   /product="pcrB family protein"
FT                   /note="identified by match to protein family HMM PF01884;
FT                   match to protein family HMM TIGR01768"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24339"
FT                   /db_xref="GOA:Q81ZG3"
FT                   /db_xref="InterPro:IPR008205"
FT                   /db_xref="InterPro:IPR038597"
FT                   /db_xref="InterPro:IPR039074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZG3"
FT                   /protein_id="AAP24339.1"
FT                   /translation="MKINCYFEQKYIQLEKRKGVFMYDISGWKHVFKLDPNKELSDEHL
FT                   EMICESGTDAVIVGGSDGVTIDNVLHMLVSIRRYAVPCVLEVSDVEAITPGFDFYYIPS
FT                   VLNSRKVEWVTGVHHEALKEFGDIMDWDEIFMEGYCVLNPEAKVAQLTDAKCDVTEDDV
FT                   IAYARLADKLLRLPIFYLEYSGTYGDVELVKNVKAELKQAKLYYGGGISNAEQAKEMAQ
FT                   HADTVVVGNIIYDDIKAALKTVKAVKGE"
FT   gene            311187..313430
FT                   /gene="pcrA"
FT                   /locus_tag="BA_0305"
FT                   /old_locus_tag="BA0305"
FT   CDS_pept        311187..313430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcrA"
FT                   /locus_tag="BA_0305"
FT                   /old_locus_tag="BA0305"
FT                   /product="ATP-dependent DNA helicase PcrA"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00580;
FT                   match to protein family HMM TIGR01073"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24340"
FT                   /db_xref="GOA:A0A3P1U0G2"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005751"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1U0G2"
FT                   /protein_id="AAP24340.1"
FT                   /translation="MSMTDRLLNGLNPQQQKAVQTTNGPLLLMAGAGSGKTRVLTHRIA
FT                   YLLGEKGVAPWNVLAITFTNKAAREMRERIDTLVGPEAEDIWISTFHSMCVRILRRDID
FT                   HIGINRNFTILDSGDQLTVVKKIMKERNIDPKKFEPRSILAGISNAKNELLSADKYAKK
FT                   ITIADPYEKLTSDVYTEYQKRLLKNNSLDFDDLIMTTIQLFERVPEVLEFYQRKFQYIH
FT                   VDEYQDTNKAQYLLVKHLAARFKNLCVVGDSDQSIYRWRGADISNILSFEKDYENAQVI
FT                   LLEQNYRSSQNILNAANAVIERNTNRKPKKLWTDNEVGSKISYYRAATEKDEAYFVAKK
FT                   IRDDIQMGKRKYTDFAVLYRTNAQSRMVEEIFLKSNIPYKIVGGTKFYDRKEIKDILAY
FT                   LRLIGNPDDEISFARIINVPKRGIGATSIDKIINYGVQNGISLTAVFDEIEHVGVSAKV
FT                   TKAVKEFAGLLHNWVNMQEYLSVTELVEEVIEKTGYRDMLKNERTLEAEGRLENLDEFL
FT                   SVTQTFESQSEDKSLVAFLTDLALVADIDRVDEDPTAGEEVILMTMHSAKGLEFPVVFI
FT                   VGLEEGIFPHTRSLMEEDEMQEERRLAYVGITRAEEELYLSNAQMRTLFGRTSMNAASR
FT                   FITEIPTELVESLNETAPKRETSFGAKGRVASSSKTTTTTRSRSAFARPAAKTTGGEQI
FT                   GWAVGDKASHQKWGVGTVISVKGEGDAKELDIAFPSPIGVKRLLAKFAPVTKQ"
FT   gene            313446..315455
FT                   /gene="ligA"
FT                   /locus_tag="BA_0306"
FT                   /old_locus_tag="BA0306"
FT   CDS_pept        313446..315455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligA"
FT                   /locus_tag="BA_0306"
FT                   /old_locus_tag="BA0306"
FT                   /product="DNA ligase (NAD(+))"
FT                   /EC_number="6.5.1.2"
FT                   /note="identified by similarity to SP:O87703; match to
FT                   protein family HMM PF00533; match to protein family HMM
FT                   PF00633; match to protein family HMM PF01653; match to
FT                   protein family HMM PF03119; match to protein family HMM
FT                   PF03120; match to protein family HMM TIGR00575"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24341"
FT                   /db_xref="GOA:Q81ZG1"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZG1"
FT                   /protein_id="AAP24341.1"
FT                   /translation="MSKEIAKKRIEELRDLLNTFNYQYHVLDNPSVSDAEYDRNMQELI
FT                   KLEAENPEFMSEDSPSIRVGGTVLDIFEKVTHKSPMLSLGNAFNEGDLRDFDRRVRQGI
FT                   DDANVRYICELKIDGLAVSLHYEKGRFIQGATRGDGVTGEDITQNLKTIKAIPLRLNEE
FT                   VTLEARGEAYMPKRSFVKLNEEKEQNGEDVFANPRNAAAGSIRQLDPKIAAKRNLSMFV
FT                   YGLANVEEKTIPSHSESLDYLGELGFKTNPNRRTCETIEEVIAYVEEWQEKRPHLDYEI
FT                   DGIVIKVDDVALQESLGTTAKSPRWAIAYKFPAEEVVTRLTGIELSVGRTGVVTPTAEL
FT                   EPVRVAGTIVRRASLHNEDLIREKDIRIGDYVVVKKAGDIIPEVVNVIFDKRTGGEEEY
FT                   HMPTHCPACESELVRLEEEVALRCINPTCPAQIREGLIHFVSRNAMNIDGLGERVITQL
FT                   FDADYIRTFADLYSLTKEQLLQLERFGEKSATNLVQAIENSKENSLERLLFGLGIRHVG
FT                   AKAARTFAEHFETMDALVKATEEELKAINEIGEKMAQSVVAYFDNEDVLELLQQFKEYG
FT                   VNMTYKGIKIADLQNVESYFAGKTVVLTGKLEVMGRSEAKKKIEALGGKVTGSVSKSTD
FT                   LVVAGEAAGSKLAQAEKHNVEVWNEERFLQELNK"
FT   gene            315472..316665
FT                   /locus_tag="BA_0307"
FT                   /old_locus_tag="BA0307"
FT   CDS_pept        315472..316665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0307"
FT                   /old_locus_tag="BA0307"
FT                   /product="putative lipoprotein"
FT                   /note="identified by similarity to EGAD:107634; match to
FT                   protein family HMM PF07537"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24342"
FT                   /db_xref="InterPro:IPR011426"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1U1M9"
FT                   /protein_id="AAP24342.1"
FT                   /translation="MKKIALAVLSLGLLVSGCSAGADKDEKVVEKSGKAKEQVIVPNYS
FT                   ISDEYYKTTIPFEGGNARGLVVQGVSNRLDIDEFETGLMRIAKESFSTKDNVLKGGKSL
FT                   TTQYIQMLVKRKRTDAEQKELEDTLKKDAVKFPNIGLNPALGAGSESLEAKNKKNPIYI
FT                   SNILEHDYYVNKDKKDERSGIVVGLAMNSVHYYEEEHGYPREVTISNEKMLAEGKKMVP
FT                   EILKVMHQQDPETKNLPITFAIYRQAPKSSLVPGNFVSYGNVEKGSETVEDWKQINEKY
FT                   YLFPSEQAKTDNKREDLARVSNFKAKLSDYFQGDYTAVIGTGMYRDDELREIKLDIPVQ
FT                   FNGKAEIIGFTQYVAGLVMEYFPNYMKVQVTIKSVERPEAIIIREAKQDEPYVKILD"
FT   gene            316761..317531
FT                   /locus_tag="BA_0308"
FT                   /old_locus_tag="BA0308"
FT   CDS_pept        316761..317531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0308"
FT                   /old_locus_tag="BA0308"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF01925"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24343"
FT                   /db_xref="GOA:A0A3P1TZ01"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TZ01"
FT                   /protein_id="AAP24343.1"
FT                   /translation="MDELSFQVIILLIAFGFLAAFIDSVVGGGGLISLPALMFVGLPPA
FT                   SAIATNKLAATMGTFTSAIYFIRSGKVDFKIVGKLIPLTVIGAVAGALVVKFIPPDILR
FT                   PLVLVMLVFIAIYIIAKKDWGSVSTYKKMTKRKTLIFFFVILMIGFYDGFFGPGTGSFL
FT                   IFAFLLIGLDFIQAAASGKLLNFVSNIVSLITFLFLDVIHFEYGIIMGLSMIFGAYFGS
FT                   KFAVQKGVGYVRALFLLVTILLISKNVLEYTHIL"
FT   gene            317685..319232
FT                   /locus_tag="BA_0309"
FT                   /old_locus_tag="BA0309"
FT   CDS_pept        317685..319232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0309"
FT                   /old_locus_tag="BA0309"
FT                   /product="putative delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00171;
FT                   match to protein family HMM TIGR01237"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24344"
FT                   /db_xref="GOA:Q81ZF8"
FT                   /db_xref="InterPro:IPR005932"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZF8"
FT                   /protein_id="AAP24344.1"
FT                   /translation="MVVAYKHEPFTDFSVEANKLAFEEGLKKVESYLGQDYPLIIGGEK
FT                   ITTEDKIVSVNPANKEELVGRVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRA
FT                   AAIVRRRKHEFSAILVKEAGKPWNEADADTAEAIDFMEYYGRQMLKLKDGIPVESRPIE
FT                   YNRFSYIPLGVGVIISPWNFPFAIMAGMTTAALVSGNTVLLKPASTTPVVAAKFMEVLE
FT                   EAGLPAGVVNFVPGNGSEVGDYLVDHPRTRFISFTGSRDVGIRIYERAAKVNPGQIWLK
FT                   RVIAEMGGKDTIVVDKEADLELAAKSIVASAFGFSGQKCSACSRAVIHEDVYDHVLNRA
FT                   VELTKELTVANPAVLGTNMGPVNDQAAFDKVMSYVAIGKEEGRILAGGEGDDSKGWFIQ
FT                   PTIVADVAEDARLMKEEIFGPVVAFCKAKDFDHALAIANNTEYGLTGAVISNNRDHIEK
FT                   AREDFHVGNLYFNRGCTGAIVGYQPFGGFNMSGTDSKAGGPDYLALHMQAKTTSETL"
FT   gene            319418..319567
FT                   /locus_tag="BA_0310"
FT                   /old_locus_tag="BA0310"
FT   CDS_pept        319418..319567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0310"
FT                   /old_locus_tag="BA0310"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:SP0203"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24345"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L9Q6"
FT                   /protein_id="AAP24345.1"
FT                   /translation="MGKYQLDYKGQVAVAKFHEKQTPVKFDKKQQIEKLRAEYLKKKQK
FT                   QTDK"
FT   gene            complement(319799..320362)
FT                   /locus_tag="BA_0311"
FT                   /old_locus_tag="BA0311"
FT   CDS_pept        complement(319799..320362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0311"
FT                   /old_locus_tag="BA0311"
FT                   /product="isochorismatase family protein"
FT                   /note="identified by match to protein family HMM PF00857"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24346"
FT                   /db_xref="GOA:A0A347ZYC3"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYC3"
FT                   /protein_id="AAP24346.1"
FT                   /translation="MKTALLLVDIQNDYFPHGKMELRNPAEASAYASQLLQLFRKKNEP
FT                   IFHIQHISIKEDATFFLPNTEGVHIHESVRPLREESVILKHYPNSFRETDLLKQLQRLA
FT                   IEHVVICGMMTHMCIDATVRAAFDFGLQCTVIHDACATKDLSFKNATIPAVYIHNTILA
FT                   SLNGVYANVMSTEEFLATKKHSLQ"
FT   gene            320835..321854
FT                   /locus_tag="BA_0312"
FT                   /old_locus_tag="BA0312"
FT   CDS_pept        320835..321854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0312"
FT                   /old_locus_tag="BA0312"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF09383"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24347"
FT                   /db_xref="GOA:Q81ZF5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZF5"
FT                   /protein_id="AAP24347.1"
FT                   /translation="MISFNNVSKVYESGGQSVHAVEDVTLSVEKGEIFGIIGFSGAGKS
FT                   TLLRLVNMLERPTAGTISIDDKDITSLSTKELRKLRQRIGMIFQSFNLFNSRTVFGNIA
FT                   YPLKLAKVPKNEIKERVNELLKFVGLEDKANNYPEQLSGGQKQRVGIARALATSPDILI
FT                   CDEATSALDPETTTEILNLLKKVNREYNLTILLITHEMHVVKEICHRVAVMEKGKVIEE
FT                   GKLFDVFTQPKTTTTQNFVRSVINDHLPESVLAKIQNGGQIYRLTFTGEETGQPVLSYI
FT                   AKNYNVDVNVLYGNIIELQNVLFGNLLVELQGEQREIQKALQHLRLQVQLKEVEAHAS"
FT   gene            321844..322509
FT                   /locus_tag="BA_0313"
FT                   /old_locus_tag="BA0313"
FT   CDS_pept        321844..322509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0313"
FT                   /old_locus_tag="BA0313"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24348"
FT                   /db_xref="GOA:A0A2A8L478"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A8L478"
FT                   /protein_id="AAP24348.1"
FT                   /translation="MRVDWSIFWPRILDATGDTLLMVIVTLIFATILGIPLGLLLYVTR
FT                   KGNFLENKWVFSILNIIINTIRPIPFIIFLVALSPLTRSVIGTTIGTAAAIFPMTLVAS
FT                   IGIARMVETNLVSVPKGVIEAAQAMGASPIRIVFEILVPEALAPLILGVTFMTVGLIEF
FT                   SAVAGLVGGGGLGDLAMTYGYQRFDTSVMFVTVVLLIILVQLAQNLGNYFAKVFLRRS"
FT   gene            322531..323385
FT                   /locus_tag="BA_0314"
FT                   /old_locus_tag="BA0314"
FT   CDS_pept        322531..323385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0314"
FT                   /old_locus_tag="BA0314"
FT                   /product="putative ABC transporter, substrate-binding
FT                   protein"
FT                   /note="identified by similarity to OMNI:NTL02SP0147; match
FT                   to protein family HMM PF03180"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24349"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A8KRY0"
FT                   /protein_id="AAP24349.1"
FT                   /translation="MKKILAFALSAIVGVSALSGCSSGDTGAGAKEKVVRVGVTGTDGD
FT                   AWEILKRKAEKEGIKIKLVEFSDYTTPNKALADGDIELNSFQHIAFLEQFKKEHKLDIT
FT                   AVGTTQIAPMGLYSEKHKKANEIPDGSEIAIPNDPTNQARALKLLDAAGLLKLKKDFGL
FT                   FGDPSGIAENPKKLKITPVIAQQTPRVLKDVAASVINNGVAGQAGLDPAKDPIFLEDPK
FT                   NENAKPYINIFAARTKDKDDPTLKKVIELYHSKEVTDAIKKETNDGSISVDLSLDELEK
FT                   IVK"
FT   gene            complement(323552..324022)
FT                   /locus_tag="BA_0315"
FT                   /old_locus_tag="BA0315"
FT   CDS_pept        complement(323552..324022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0315"
FT                   /old_locus_tag="BA0315"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24350"
FT                   /db_xref="GOA:A0A384L0E5"
FT                   /db_xref="InterPro:IPR025671"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L0E5"
FT                   /protein_id="AAP24350.1"
FT                   /translation="MLKRISTIIFWIIPLLFFIHNLEESFQMPQYLANQFSITFISSQH
FT                   FFIAISVLTLFVLVIIFLYQLNFLSSIYWIIFIQGAIFFNSVQHIILFFIYRSYNPGVI
FT                   STVFIVIFSIFFFSSQKHLIHKKQFVITLVFSLFSYPIIIWITLLLASYFHS"
FT   gene            complement(324081..324272)
FT                   /locus_tag="BA_0316"
FT                   /old_locus_tag="BA0316"
FT   CDS_pept        complement(324081..324272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0316"
FT                   /old_locus_tag="BA0316"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24351"
FT                   /db_xref="InterPro:IPR025076"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TYZ7"
FT                   /protein_id="AAP24351.1"
FT                   /translation="MHEELLRKIIRTKIKVGMHILEELPAPIQQSAKQMLNILQEELSS
FT                   YPNEQGHHKNNLKNIIIE"
FT   gene            complement(324265..325442)
FT                   /pseudo
FT                   /locus_tag="BA_0317"
FT                   /old_locus_tag="BA0317"
FT                   /note="anion-transporting ATPase family protein, authentic
FT                   frameshift; an automated process has identified a potential
FT                   problem with this gene model; it may contain one or more
FT                   premature stops and/or frameshifts"
FT   gene            complement(325522..326004)
FT                   /locus_tag="BA_0318"
FT                   /old_locus_tag="BA0318"
FT   CDS_pept        complement(325522..326004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0318"
FT                   /old_locus_tag="BA0318"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by similarity to GP:10175694; match to
FT                   protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24352"
FT                   /db_xref="GOA:A0A3P1U1L6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1U1L6"
FT                   /protein_id="AAP24352.1"
FT                   /translation="MLQYEHFLDLLLDNAKKLFYPEEWVSLDLTLSKTEVFCLLWMERN
FT                   TDITMTKIADLLDIPMSTTTGVVNRLVKKGYIERYRDENDRRIVLIRLTENGVTLVQEV
FT                   KQNAAHYFNLVTEALSEEEKAFLLQIFQKIMNHIATSQQKTEEKVSTPKMKNIPIE"
FT   gene            326236..326352
FT                   /locus_tag="BA_0319"
FT                   /old_locus_tag="BA0319"
FT   CDS_pept        326236..326352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0319"
FT                   /old_locus_tag="BA0319"
FT                   /product="conserved hypothetical protein, degenerate"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain
FT                   one or more premature stops and/or frameshifts; identified
FT                   by similarity to EGAD:108669"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ49982"
FT                   /db_xref="GOA:A0A0F7RNT0"
FT                   /db_xref="InterPro:IPR008024"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RNT0"
FT                   /protein_id="ACZ49982.1"
FT                   /translation="MRRRNTQAFTFLAWTSFVCALSGMLIGIYTLDETLSVK"
FT   gene            326615..326905
FT                   /gene="gatC"
FT                   /locus_tag="BA_0320"
FT                   /old_locus_tag="BA0320"
FT   CDS_pept        326615..326905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="BA_0320"
FT                   /old_locus_tag="BA0320"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by similarity to SP:O06492; match to
FT                   protein family HMM PF02686; match to protein family HMM
FT                   TIGR00135"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24353"
FT                   /db_xref="GOA:Q81ZE9"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZE9"
FT                   /protein_id="AAP24353.1"
FT                   /translation="MSRISVENVKHVAHLARLAITDQEAEKFQKQLDAIVTFAEQLNEL
FT                   DTTDVKPTTHVLTMKNVMREDVPEKGLPVEEVLKNAPDHKDNQIRVPAVLE"
FT   gene            326921..328378
FT                   /gene="gatA"
FT                   /locus_tag="BA_0321"
FT                   /old_locus_tag="BA0321"
FT   CDS_pept        326921..328378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="BA_0321"
FT                   /old_locus_tag="BA0321"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF01425;
FT                   match to protein family HMM TIGR00132"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24354"
FT                   /db_xref="GOA:Q81ZE8"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZE8"
FT                   /protein_id="AAP24354.1"
FT                   /translation="MSLFDHSVSELHKKLNNKEISVTDLVEESYKRIADVEDNVKAFLT
FT                   LDEENARAKAKELDAKIGAEDNGLLFGMPIGVKDNIVTNGLRTTCASKILANFDPIYDA
FT                   TVVQKLKAADTITIGKLNMDEFAMGSSNENSGFYATKNPWNLDYVPGGSSGGSAAAVAA
FT                   GEVLFSLGSDTGGSIRQPAAYCGVVGLKPTYGRVSRYGLVAFASSLDQIGPITRTVEDN
FT                   AYLLQAISGLDRMDATSANVEVGNYLAGLTGDVKGLRIAVPKEYLGEGVGEEARESVLA
FT                   ALKVLEGMGATWEEVSLPHSKYALATYYLLSSSEASANLSRFDGVRYGVRSDNVNNLMD
FT                   LYKNTRSEGFGDEVKRRIMLGTFALSSGYYDAYYKKAQQVRTLIKNDFENVFANYDVII
FT                   GPTTPTPAFKVGEKVDDPMTMYANDILTIPVNLAGVPAISVPCGFGANNMPLGLQIIGK
FT                   HFDEATIYRVAHAFEQATDHHTKKASL"
FT   gene            328393..329820
FT                   /gene="gatB"
FT                   /locus_tag="BA_0322"
FT                   /old_locus_tag="BA0322"
FT   CDS_pept        328393..329820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="BA_0322"
FT                   /old_locus_tag="BA0322"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by similarity to SP:O30509; match to
FT                   protein family HMM PF01162; match to protein family HMM
FT                   PF02637; match to protein family HMM PF02934; match to
FT                   protein family HMM TIGR00133"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24355"
FT                   /db_xref="GOA:Q81ZE7"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZE7"
FT                   /protein_id="AAP24355.1"
FT                   /translation="MNLETIIGLEVHVELKTNSKIFSASPTEFGAEPNTQTSVIDLGYP
FT                   GVLPTLNKEAVNFAMKAAMALNCEIATETKFDRKNYFYPDNPKAYQISQFDKPIGENGW
FT                   IEIEVDGKKKRIGITRLHLEEDAGKSTHTADGSLVDYNRQGMPLIEIVSEPDMRTPEEA
FT                   YAYLEKLKSIIQYTGVSDCKMEEGSLRCDANISLRPVGQEKFGTKAELKNLNSFTYVQK
FT                   GLEHEQVRQEKELLSGGIIQQETRRYDEATKKTILMRVKEGSDDYRYFPEPDLVELYID
FT                   DAWKEEVRASIPELPDARKARYVAEIGLPAYDAHVLTLTKEMSDFFEAAIADGADAKLT
FT                   SNWLMGEVLAYLNKQQKELKDVALTPAGLSKMVQLIEKGTISSKIAKKVFNELIEKGGD
FT                   PEEIVKAKGLVQISDEGTLRKVVTEILDNNEQSIEDFKNGKDRAIGFLVGQIMKATKGQ
FT                   ANPPLVNKILLEEINKR"
FT   gene            330291..331196
FT                   /locus_tag="BA_0323"
FT                   /old_locus_tag="BA0323"
FT   CDS_pept        330291..331196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0323"
FT                   /old_locus_tag="BA0323"
FT                   /product="conserved hypothetical protein TIGR00147"
FT                   /note="identified by similarity to EGAD:107654; match to
FT                   protein family HMM PF00781; match to protein family HMM
FT                   TIGR00147"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24356"
FT                   /db_xref="GOA:A0A347ZYD6"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYD6"
FT                   /protein_id="AAP24356.1"
FT                   /translation="MMKRARIIYNPTSGRELFKKSLPEVLQKLEQAGYEASCHATTGPG
FT                   DATVAARQAADRKFDVVIAAGGDGTLNEVVNGLVGHEHRPKFGIIPVGTTNDFARAIGV
FT                   PRSIEEAADIICEGKTVPLDLGRANDTYFINIAGGGRITELTYEVPSKLKTVLGQLAYY
FT                   LKGIEMLPSLHPTYVEIEYDGKLLQEEITMFLITNTRSVGGFEKVAPYASINDGLFDLL
FT                   VLKKGSIADLIKAATQAQRGEHINNPKVLYTQANRIKVHSPDKLMINLDGEYGGDAPME
FT                   FENIYHCLELFVPEHQEDAL"
FT   gene            331336..332079
FT                   /locus_tag="BA_0324"
FT                   /old_locus_tag="BA0324"
FT   CDS_pept        331336..332079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0324"
FT                   /old_locus_tag="BA0324"
FT                   /product="haloacid dehalogenase/epoxide hydrolase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01549"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24357"
FT                   /db_xref="GOA:A0A384KWA7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KWA7"
FT                   /protein_id="AAP24357.1"
FT                   /translation="MEKVKAILFDKDGTLMDFHSIWIKVAEELVAECINLYELPKSMQP
FT                   TLLKEIGVEGVFVNPRSAIAAGTSLDVAKGLCKYITSSKEEEMHEWVSEKLFSLMYEHR
FT                   SYMKMTADLPRILQSLKDRGFILGVVTADDFAPTELFLKQYQLESFFDYVVASDTFPAQ
FT                   KPDKRIVESFCDKFHLDACEVAVVGDTPTDLHLAKNGDCYAIGVLSGTGDRQTLEPLAD
FT                   LVVQSVEDFISHSGEFIWERGKSNV"
FT   gene            332234..333598
FT                   /gene="gabT"
FT                   /locus_tag="BA_0325"
FT                   /old_locus_tag="BA0325"
FT   CDS_pept        332234..333598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabT"
FT                   /locus_tag="BA_0325"
FT                   /old_locus_tag="BA0325"
FT                   /product="4-aminobutyrate transaminase"
FT                   /EC_number="2.6.1.19"
FT                   /note="identified by match to protein family HMM PF00202;
FT                   match to protein family HMM TIGR00700"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24358"
FT                   /db_xref="GOA:A0A384L3Q0"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L3Q0"
FT                   /protein_id="AAP24358.1"
FT                   /translation="MNTKKFAKVNEQIPGPKAASLLERRQNIVPKGVSNGIPTFVQSAN
FT                   GALVTDVDGNQYIDFAGAIGTINVGHCHPAVKEALHKQVDQYIHTGFNVMMYEPYIELA
FT                   EKLAALAPGSFDKQVLFLNSGAEAVENAVKIARKYTKRPGIIAFSKGFHGRTLMTMTMT
FT                   SKVKPYKFGFGPFAPEVYKAPFPYEYRCPEGLTEEQYDDFMIEEFKNFFISEVAPETIA
FT                   AVVMEPVQGEGGFIVPSKKFAQEVRNICSEHGILFVADEIQTGFSRTGKYFAIDHYDVV
FT                   PDLITVSKSLGAGVPISGVIGRKEIMNESAPGELGGTYAGSPLGCAAALAVLDVIEKEN
FT                   LNDRAIELGKVVMNRFEEMKNKYNCIGDVRGLGAMCAFELVQDRKTKTPDKTLTANLCT
FT                   EANKRGLLLLSAGTYGNVIRVLMPLVITDEQLEEGLTIIEESLQICYEKANTARV"
FT   gene            333711..335078
FT                   /locus_tag="BA_0326"
FT                   /old_locus_tag="BA0326"
FT   CDS_pept        333711..335078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0326"
FT                   /old_locus_tag="BA0326"
FT                   /product="sensory box sigma-54 dependent DNA-binding
FT                   response regulator"
FT                   /note="identified by similarity to GP:10173607; match to
FT                   protein family HMM PF00158; match to protein family HMM
FT                   PF07728; match to protein family HMM PF08448; match to
FT                   protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24359"
FT                   /db_xref="GOA:A0A3P1TZ96"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030828"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TZ96"
FT                   /protein_id="AAP24359.1"
FT                   /translation="MVAEKERVLMDLQDVFEYAFDEIFVTDDKGIVVRVNSTCERHYQI
FT                   AAKELVGKHVKELQKDGIFYPSATLEVIEKKRPIELVQTTKSGEYLHVRTRPVFDDEGN
FT                   LRRVISYSRDLTELYQLRQKVEEMDNQLKTYKKELRETYEHEGLIFKSIAMQKIIETIK
FT                   KVSVVDSTVLVLGETGVGKSRLVRHLHEMSNRKNESFYEINCAALPTNLIESELFGYSG
FT                   GSFTGANREGKKGLLESAHKGTLFLDEIGEMPLEIQAKLLQVLQEKTFRPIGGRELKKV
FT                   DVRIVAATNRDLSMMVKQGTFRKDLYYRLNVIPILIPPLRERTEDILPLIYHYLQHFNE
FT                   KYGRNVKLAPSTLQMFVGYPWEGNNREIENVIERIVITADDIVTIEDLPIAMQESTVEQ
FT                   SGQSLYKMLEEVERNIILKAYKTYGSSYKVAEFLKISQSAATRKIKKLIEEEENIG"
FT   gene            335071..336522
FT                   /gene="gabD"
FT                   /locus_tag="BA_0327"
FT                   /old_locus_tag="BA0327"
FT   CDS_pept        335071..336522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="BA_0327"
FT                   /old_locus_tag="BA0327"
FT                   /product="succinate-semialdehyde dehydrogenase (NADP+)"
FT                   /EC_number="1.2.1.16"
FT                   /note="identified by match to protein family HMM PF00171;
FT                   match to protein family HMM TIGR01780"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24360"
FT                   /db_xref="GOA:A0A2P0H978"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H978"
FT                   /protein_id="AAP24360.1"
FT                   /translation="MDKKATFVNVEKKAMYINGEWITLQEQIEVNNPATKEIFATVPKG
FT                   GVTEAKQAVDAAHEAFKSWSKLTAADRAAKLKKWFTLIDENKEEIAAIMTKEQGKPFAE
FT                   ALGEVNYANSFVEWYAEEGKRVYGEMIPASHPNKRILVMKQPVGVMAAITPWNFPAAMI
FT                   TRKVAPALAAGCTAVVKPASQTPLTALKLAELAHEADIPKGVINIVTGSAKAIADTWME
FT                   DGRVRKVSFTGSTEIGKELMASAAQTMKKVSLELGGHAPFIVMNDADLDKAVEAVIGSK
FT                   FRNAGQTCICTNRVFVQEEVYEAFVEKFEKAVGQLKVGDGFGDGTTVGPLIDENAVSKV
FT                   QEHIEDAIQKGGTVLYGGQKVAELDGHFMQPTVIGLANDTMLCMNEETFGPVAPVAKFK
FT                   TVEEVIERANHTPYGLAAYIFTKDISQAFQISEALEYGIIGLNDGLPSVAQAPFGGFKE
FT                   SGIGREGGHFGIEEYLEIKYISLGL"
FT   gene            336570..336893
FT                   /locus_tag="BA_0328"
FT                   /old_locus_tag="BA0328"
FT   CDS_pept        336570..336893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0328"
FT                   /old_locus_tag="BA0328"
FT                   /product="multidrug resistance protein, Smr family"
FT                   /note="identified by similarity to GP:12024949; match to
FT                   protein family HMM PF00893"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24361"
FT                   /db_xref="GOA:A0A2B6BYE5"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2B6BYE5"
FT                   /protein_id="AAP24361.1"
FT                   /translation="MVYWLLLLVTIIFEVAGTIAMKLSNGLTKLVPSVLIFVFYGICFS
FT                   VFAIVVKKIHLSIAYAIWSGVGTLLITIISVYFFKEHISLFQACCILFIVLGVIGLKVS
FT                   SAS"
FT   gene            complement(336933..338162)
FT                   /gene="ampS"
FT                   /locus_tag="BA_0329"
FT                   /old_locus_tag="BA0329"
FT   CDS_pept        complement(336933..338162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampS"
FT                   /locus_tag="BA_0329"
FT                   /old_locus_tag="BA0329"
FT                   /product="aminopeptidase AmpS"
FT                   /EC_number="3.4.11.-"
FT                   /note="identified by similarity to SP:P39762; match to
FT                   protein family HMM PF02073"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24362"
FT                   /db_xref="GOA:A0A2P0H993"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H993"
FT                   /protein_id="AAP24362.1"
FT                   /translation="MSFEQTLEKYAALAVNVGVNIQPGQTLSISAPLEAVQFVRLVTEK
FT                   AYKSGAKHVYVDWNDETLTRLKFDLAPEEAFAEFPSWKANAREELAKEGAAFMSIYAEN
FT                   PDLLKGVDSTRIATAHKVAGEAMKVYRDYVQADKVSWCVISVPTKEWAAKVFPDAAPEE
FT                   QEAKLWDAIFKATRADLENPVEAWKEHDKTLHTKVDYLNEKHYKALHYTGPGTDLTIEL
FT                   PEKHVWAGAGSLNEKNVPFMANIPTEEVFTMPLKTGVNGQVSSTKPLAFAGNIIDNFTL
FT                   TFENGRIVDYKAEVGEEALKHLVETDKGSHFLGEVALVPHDSPISNTNILFYNTLFDEN
FT                   ASCHLAIGSAYAFNLVGGKTMSKEELAENGANTSITHNDFMIGSAKLDIDGITADGRHE
FT                   PIFRKGNWAF"
FT   gene            complement(338279..339361)
FT                   /locus_tag="BA_0330"
FT                   /old_locus_tag="BA0330"
FT   CDS_pept        complement(338279..339361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0330"
FT                   /old_locus_tag="BA0330"
FT                   /product="polysaccharide deacetylase-like protein"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24363"
FT                   /db_xref="GOA:A0A3P1U1L2"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1U1L2"
FT                   /protein_id="AAP24363.1"
FT                   /translation="MRKYAAIALCTSAILAGCNTSNVSQEPNKERKVQETKKQAETVQE
FT                   QGKISYNPITHESTNTTIHMTDIKDTLTEVQYKIWRTADGKETAKSLSSKEKEKQFSLP
FT                   FDTKEFEGKRGEFQIEAIGIKEDGKTIPLTKSAITFEQKVPVLMYHAIDDYHGQGIKDL
FT                   FVSPANFEAQMKYLKDNGYTLLTFERWGDINKVNKPIFVTFDDGMKNNMNAFHVLQKLK
FT                   DDTFKPVATEYMIVNNVDAEGSLSTSDIKEMVDSGIFSMQSHTATHADLPKITNYEEEL
FT                   KESKEKLEKITGKPVIAVAYPFGHVDDKVVAETKKYYQFATTTKPGKFITKGEPDELLK
FT                   MKRVRIHHTTTVEQFASSIK"
FT   gene            complement(339513..340616)
FT                   /locus_tag="BA_0331"
FT                   /old_locus_tag="BA0331"
FT   CDS_pept        complement(339513..340616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0331"
FT                   /old_locus_tag="BA0331"
FT                   /product="polysaccharide deacetylase-like protein"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24364"
FT                   /db_xref="GOA:A0A2P0H955"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H955"
FT                   /protein_id="AAP24364.1"
FT                   /translation="MKKYTYIALLSSAILVGCNTSSASDKQIQETTAKQAVEQKKAKAV
FT                   ELPLTQGVITWDPYEYNAQNTTLYTKDLRDSFKEVRYNIWRTADGPESKQTFTSQEKDR
FT                   DFALPLHLKTFHLKRGEFQIETVGIKEDNTETNLVTSKITFQQHVPVLMYHAIEKFPGP
FT                   SDGDYGLYVPPEQFEKHMQYLKDNGYTMLTFERWNDINRVNKPIFITMDDGRKNNMNAL
FT                   HILQKLKDDTFQPAATEFLTANEIDKPNRLSTDDIKQMMDSGIFSIQSHTANHTMMAHS
FT                   NNYDEELRGSKEKIEALTGKKVIALAYPVGSYNDPAVEETKKYYEFAVTTDHGNHITKG
FT                   MPNEQYLIKRHFVGPNTSMEKFISLIK"
FT   gene            complement(340856..342052)
FT                   /locus_tag="BA_0332"
FT                   /old_locus_tag="BA0332"
FT   CDS_pept        complement(340856..342052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0332"
FT                   /old_locus_tag="BA0332"
FT                   /product="nucleoside transporter, NupC family"
FT                   /note="identified by similarity to EGAD:6216; match to
FT                   protein family HMM PF01773; match to protein family HMM
FT                   PF07662; match to protein family HMM PF07670"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24365"
FT                   /db_xref="GOA:A0A0J1HRI1"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1HRI1"
FT                   /protein_id="AAP24365.1"
FT                   /translation="MQYVMSIIGILVVLGLCFALSNNKSKINFRAIAIMIGFQILIGWF
FT                   MFGTKIGQQIIIFISKVFNKLIKLGTTGVDFLFNGIQRDFVFFLNVLLIIVFFSALLSI
FT                   FSYLGVLPFIVRVVGGAISKVTGLPRVESFHAVNSVFFGSSEALIVIKNDLQHFNKNRM
FT                   FIICCSAMSSVSASVTASYVMMLDAKYVLAALPLNLFSSLIVCSLLTPVDTKKEDEVVQ
FT                   KFDRTVFGDSFIGAMINGALDGLKVAGIVAALMIAFIGVMEVVNYVISAASGAMGHAVT
FT                   LQQIFGYVLAPFAFLMGIPAQDIIPAGGIMGTKIVLNEFVAILDLKGVAATLSPRTVGI
FT                   VTVFLISFASISQIGAIVGTIRALSEKQGSIVSKFGWKMLFASTLASILSATIAGLFI"
FT   gene            342478..343854
FT                   /locus_tag="BA_0333"
FT                   /old_locus_tag="BA0333"
FT   CDS_pept        342478..343854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0333"
FT                   /old_locus_tag="BA0333"
FT                   /product="RNA methyltransferase, TrmA family"
FT                   /note="identified by match to protein family HMM PF01938;
FT                   match to protein family HMM PF02475; match to protein
FT                   family HMM PF05958; match to protein family HMM TIGR00479"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24366"
FT                   /db_xref="GOA:Q81ZD6"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZD6"
FT                   /protein_id="AAP24366.1"
FT                   /translation="MSTKMTPPVEKNEFIDVVFEDLTHDGAGVAKVKGYPIFVKNGLPG
FT                   EEAQIKIVKVKKNFAFGRLMKLHTESPYRKDAECPVYNQCGGCQLQHLTYEGQLQAKEK
FT                   QVRDVMQRIGGLGDVPVHPVLGMKNPWVYRNKAQVPIGEREGGLVAGFYRQGTHDIINM
FT                   ESCLIQAEENDTLIQEVKRICEKHGISAYNEERNKGTLRHVMARYGQVTGEIMLVFITR
FT                   TAELPNKKAIIEEIAAKFPEVKSIVQNVNPKRTNVIFGDKTTVLYGSEYIYDFIGDIKF
FT                   AISARSFYQVNPEQTKVLYDKTLEYAKLDGNETVIDAYCGIGSISLFLAQKAKKVYGVE
FT                   IVPEAIEDAKRNAALNNMTNAEFGVGEAEVVIPKWYKEGVIADTMVVDPPRKGCDEALL
FT                   NTIIDMKPKRVVYVSCNPATLARDLKVLEEGGYKTQEVQLVDMFPHTTHVECVAWLKLV
FT                   "
FT   gene            343951..344940
FT                   /locus_tag="BA_0334"
FT                   /old_locus_tag="BA0334"
FT   CDS_pept        343951..344940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0334"
FT                   /old_locus_tag="BA0334"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:108206; match to
FT                   protein family HMM PF01207"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24367"
FT                   /db_xref="GOA:A0A347ZYE7"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYE7"
FT                   /protein_id="AAP24367.1"
FT                   /translation="MIDNFWRDLPRPFFVLAPMEDVTDVVFRHVVSEAGRPDVFFTEFT
FT                   NSDSYCHPEGMKSVRGRLIFTEDEQPMVAHIWGDNPEYFRQMSIGMAELGFKGIDINMG
FT                   CPVPNVASRGKGSGLILRPDVAAELIQAAKAGGLPVSVKTRLGFKELSEWEDWLTHIFK
FT                   QDIANLSIHLRTREEMSQVDAHWELIPEIKKLRDRIAPNTLLTINGDIPDRKTGLELAE
FT                   KYGIDGVMIGRGIFKNPFAFEKEPREHSSKEHLDLLRLQLDLQDQYAEVLPRSITGLHR
FT                   FFKIYVKGFPGAAELRNQLMSTKSTDEVRALLNKFEESVNVVEGSETV"
FT   gene            345216..345770
FT                   /locus_tag="BA_0335"
FT                   /old_locus_tag="BA0335"
FT   CDS_pept        345216..345770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0335"
FT                   /old_locus_tag="BA0335"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24368"
FT                   /db_xref="GOA:A0A2P0H984"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H984"
FT                   /protein_id="AAP24368.1"
FT                   /translation="MKKKKKLSVMKFLIYMLIAIVVINWIYKTPEEKKADLEEKVASYE
FT                   EFESHCITYEDWNVDKGGNKNLNTLYNDPQECLEKELFIWRNDGTELTRGVAKLVFHNT
FT                   DYYFTEEELKDDIQTEAENKYKLLEEIQRECKSTLLGGFSYDYYTDGYDYIIEDTSGEK
FT                   SKMNEKIFNSLFEITKTYKNN"
FT   gene            346049..346561
FT                   /locus_tag="BA_0336"
FT                   /old_locus_tag="BA0336"
FT   CDS_pept        346049..346561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0336"
FT                   /old_locus_tag="BA0336"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:15979249; match to
FT                   protein family HMM PF07308"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24369"
FT                   /db_xref="InterPro:IPR009921"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H982"
FT                   /protein_id="AAP24369.1"
FT                   /translation="MSNNDILKRVRYALDIRDIDMVEIFKLGGIEVTKEDVVDMLTKIK
FT                   RAPQYEPENPDVEEDEYVKTCDMMMLEAFFNGFITLKRGKQDPKPGQPAPVQSKESANN
FT                   LLLKKMKIALSLTSEDVLDILDSVGVKVTKGELGALLRKKGHKNYKECGDRYARNFIKG
FT                   LAVKYRG"
FT   gene            346656..347363
FT                   /locus_tag="BA_0337"
FT                   /old_locus_tag="BA0337"
FT   CDS_pept        346656..347363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0337"
FT                   /old_locus_tag="BA0337"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01HS00093; match
FT                   to protein family HMM PF01863"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24370"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H987"
FT                   /protein_id="AAP24370.1"
FT                   /translation="MIHTYLGETINFHITYKKKKSVRLFVDSYGNVEVQAPKGTPVEYL
FT                   IQLLEEKWDWIQTTRKEMAERARGPQEKDYDQGEGFLYLGNTYPIQISQDASIEQDNAI
FT                   FEGDKLHIYVKELKDEKIQQALKRFYYKQCKSLVGKSIKAHQSNFKTKPRSIRITDSSR
FT                   TWGTCDSNLQLTFNWKLAMAPQRVIDYVVVHEMCHMVHLNHDRSFWRLVGKIMPDYKEM
FT                   ENWLALSSWKMTV"
FT   gene            complement(347563..348258)
FT                   /locus_tag="BA_0338"
FT                   /old_locus_tag="BA0338"
FT   CDS_pept        complement(347563..348258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0338"
FT                   /old_locus_tag="BA0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:22776251"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24371"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYF1"
FT                   /protein_id="AAP24371.1"
FT                   /translation="MTVLYEGRLKQNNERFHVTLLSLEYIEQILLLQNVVVEALEDKSR
FT                   LQPLSQEEFQYILEGNGMMIGAFIENELIAFRALLVPPIDDEHLGLDIGLPESELHRVI
FT                   YQEISNVHPNCRGNGMQKILATVIMDELQKEDSKYDYVCCTVAPFNIPSLKDKFAQGMK
FT                   IAALKEKYGGSMRYVFVKELREDNERDWTDIKSIPMNNAGGQQALLSEGYRGYKMEKVD
FT                   EDFVVKFGR"
FT   gene            complement(348273..349382)
FT                   /locus_tag="BA_0339"
FT                   /old_locus_tag="BA0339"
FT   CDS_pept        complement(348273..349382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0339"
FT                   /old_locus_tag="BA0339"
FT                   /product="mandelate racemase/muconate lactonizing enzyme
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF01188;
FT                   match to protein family HMM PF02746"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24372"
FT                   /db_xref="GOA:A0A347ZYF2"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034603"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYF2"
FT                   /protein_id="AAP24372.1"
FT                   /translation="MKITAIHLYAIRLPLRDPFVISYGSYSDMPSIIVKMETDEGIIGY
FT                   GEGVADDHVTGESWESTFHILKHTLAPALIGQNPMNIEKIHDMMDNTIYGVPTAKAAID
FT                   IACFDIMGKKLNQPVYQLIGGRYHEEFPITHVLSIADPEEMAEEAASMIQKGYQSFKMK
FT                   VGTNVKEDVKRIEAVRERVGNDIAIRVDVNQGWKNSANTLMALRSLGHLNIDWIEQPVI
FT                   ADDIDAMAHIRSKTDLPLMIDEGLKGSREMRQIINLDAADKVNIKLMKCGGIYPAVKLA
FT                   HQAEMAGIECQVGSMVESSVASSAGFHVAFSKKIITSVELTGPLKFTKDIGNLHYDVPF
FT                   IRLNEKPGLGIEINEDTLRELTVFQDIVR"
FT   gene            349475..350746
FT                   /locus_tag="BA_0340"
FT                   /old_locus_tag="BA0340"
FT   CDS_pept        349475..350746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0340"
FT                   /old_locus_tag="BA0340"
FT                   /product="transcriptional regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24373"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H996"
FT                   /protein_id="AAP24373.1"
FT                   /translation="MMIKIAVVGSKEFMETLLPIAHKLEEIEIDPYVYLHPAESSELLK
FT                   RLKPCDFIFFSGALPYYMAKEIREQLRIPSTYLQQDETTVASSILSVMYHQGIQPHKIS
FT                   IDLVDRSFIINVFHDIGIKESPQVFDYENMLWSKDEINRVIDFHVAKYQSGKAHLALTS
FT                   IHAVYDELQKIGIPSERMIDLKQSIIHGLKDAKIKAELARSHSATVGACIISSLELRDG
FT                   LLEQLDVISKELRGSFKTIDEMTFILYTTRGDIESIIKTNIINNLFASIEGMIAIGFGY
FT                   GKTVKEAEQNAKIAQGFAKNNPIDHCFYILTSDKELFGPFPKEQRVQSLKNDNPELMKI
FT                   AKETKLSPANLSKIIQFSQSHPSLKFTAADLSEYLQVTRRSTERLLKKLVDYGYVHICG
FT                   EEMPYQQGRPRAIYELNLPLSLSF"
FT   gene            complement(350735..352156)
FT                   /gene="nhaC1"
FT                   /locus_tag="BA_0341"
FT                   /old_locus_tag="BA0341"
FT   CDS_pept        complement(350735..352156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaC1"
FT                   /locus_tag="BA_0341"
FT                   /old_locus_tag="BA0341"
FT                   /product="Na+/H+ antiporter NhaC"
FT                   /note="identified by similarity to PIR:A41594; match to
FT                   protein family HMM PF03553; match to protein family HMM
FT                   PF03600; match to protein family HMM TIGR00931"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24374"
FT                   /db_xref="GOA:A0A3P1U1K1"
FT                   /db_xref="InterPro:IPR004770"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1U1K1"
FT                   /protein_id="AAP24374.1"
FT                   /translation="MKKEIPFGVAMIPIIITVAVMMVTIVVLKQSPHVPLIIGTTVASI
FT                   VAWRYGYKWNDIEEAMYKGIHLALPAIVIIILVGLTIGAWIGGGIVATMIYYGLNLLTP
FT                   SLFLVSITIICSIVALAIGSSWSTMGTIGVAGMGIGLSMGIPAPMVAGAIISGSYFGDK
FT                   MSPLSDTTNLAAGLTNTDLFTHIRHMLFTTIPGLIITLIVYAFLGRSFGANNIDAKSIE
FT                   QTLQVLQQNFVISPFLLIIPVVVMVLVAKKVPAIPAILVGIILGFLSQVFIQGGSVSAS
FT                   VGALQAGFVIDTGNKLVDELFNRGGLDSMMNTVSMTIVAMTFGGVLEHTGILRSIVNQI
FT                   LKLAKSAKGLIASTIASCFATNLTCSEQYISIVVPSRMYANAYTEKGLHSKNLSRALED
FT                   GGTLTSVFVPWNTCGVFILATLGVGAFEYAPYAILNFIVPIISIIYGITGLTITKLSDI
FT                   EKAELLKKQNAQLEA"
FT   gene            352436..353551
FT                   /gene="amhX"
FT                   /locus_tag="BA_0342"
FT                   /old_locus_tag="BA0342"
FT   CDS_pept        352436..353551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amhX"
FT                   /locus_tag="BA_0342"
FT                   /old_locus_tag="BA0342"
FT                   /product="amidohydrolase amhX"
FT                   /EC_number="3.5.1.-"
FT                   /note="identified by similarity to SP:P54983; match to
FT                   protein family HMM PF01546; match to protein family HMM
FT                   PF07687; match to protein family HMM TIGR01891"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24375"
FT                   /db_xref="GOA:A0A3P1TYX5"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="InterPro:IPR037484"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TYX5"
FT                   /protein_id="AAP24375.1"
FT                   /translation="MKTLELQERLTEIFQHLHENPEVSWKEYETTAYITNFLKEEGISY
FT                   KTFDDCPGVIAEIGNGNPVVAIRADMDALWQEVNGEFKANHSCGHDAHMTIVMGLILQL
FT                   KNMRWKSGTVRFIFQPAEEKGNGALKMVEKGAVDDADFLFGVHLRPIEELSLKQAASSI
FT                   RHGAAGFLEGTIHGEDAHGARPHQGINAIDVISMINIGLKNIWLRPQSSYSVKMTRCQA
FT                   GGDNLNIIPGNGHFSLDVRAENNTLLEELKKRIEHVIESAASMGSKTSYEWIDLAPGAE
FT                   VSEEAERFMRKGILEVYGEDKCTGPLYTTGSDDFHYYTVKRPYLKAVMLGLGADLQPGL
FT                   HHPYMKFDHSCIMDGVEILKQTVLKVLEDRG"
FT   gene            353703..354311
FT                   /locus_tag="BA_0343"
FT                   /old_locus_tag="BA0343"
FT   CDS_pept        353703..354311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0343"
FT                   /old_locus_tag="BA0343"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GP:15622504"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24376"
FT                   /db_xref="GOA:A0A2B6CC34"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2B6CC34"
FT                   /protein_id="AAP24376.1"
FT                   /translation="MNEQYYDAVLNIKTVGEQKGFNKSMHYHRYEPTPYSGLDELLNQY
FT                   EIKRSDRVVDFGCGKGRLNFYMHHKCGASAVGIEMNEEFYKEALDNLDRYARKVRDSKD
FT                   KIRFECCLAQEYEINPCDNRFYFFNPFSVQVFMNVVNNILLSVEETGREVDIILYYPSE
FT                   DYIFFLENQTTFELKREVRLPGAYEKNGNERFLVYTLGL"
FT   gene            complement(354356..355882)
FT                   /gene="ahpF"
FT                   /locus_tag="BA_0344"
FT                   /old_locus_tag="BA0344"
FT   CDS_pept        complement(354356..355882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpF"
FT                   /locus_tag="BA_0344"
FT                   /old_locus_tag="BA0344"
FT                   /product="alkyl hydroperoxide reductase, F subunit"
FT                   /EC_number="1.8.1.-"
FT                   /note="identified by similarity to EGAD:30995; match to
FT                   protein family HMM PF00070; match to protein family HMM
FT                   PF01134; match to protein family HMM PF07992; match to
FT                   protein family HMM TIGR03140"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24377"
FT                   /db_xref="GOA:A0A347ZYF7"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYF7"
FT                   /protein_id="AAP24377.1"
FT                   /translation="MILDADIKTQLSQYLQLMENDILLKVSAGNDDVSKDMLALVDELA
FT                   TMSSKITVEKVELERTPSFSVNRPGEDTGVVFAGIPLGHEFTSLVLALLQVSGRAPKVE
FT                   QKLIDQIKNIQGEYHFESYISLSCHNCPDVVQALNVMSVLNSGITHTMIDGAAFKEEVE
FT                   SKDIMAVPTVFLNGESFGSGRMTLEEILAKMGNGPDASELSDKDPYDVLVVGGGPAGAS
FT                   AAIYAARKGIRTGIVAERFGGQVMDTMGIENFISVKRTEGPKLVASLEEHVKEYDIDVM
FT                   NLQRAKRLEKKELIEVELENGAILKSKSVIVSTGARWRNVGVPGEAEFKNKGVAYCPHC
FT                   DGPLFTGKDVAVIGGGNSGIEAAIDLAGIVKHVTVLEFMPELKADAVLQERLNSLPNVT
FT                   VLKNVQTKEITGTDKVNGISYIDRETEEVHHVELQGVFVQIGLVPNTDWLGETVERVRG
FT                   EIVTDKHGATNVPGVFAAGDCTNNPYKQIIISMGSGANAALGAFDYLIRN"
FT   gene            complement(355897..356460)
FT                   /gene="ahpC"
FT                   /locus_tag="BA_0345"
FT                   /old_locus_tag="BA0345"
FT   CDS_pept        complement(355897..356460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="BA_0345"
FT                   /old_locus_tag="BA0345"
FT                   /product="peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /note="identified by similarity to EGAD:37649; match to
FT                   protein family HMM PF00578; match to protein family HMM
FT                   PF08534; match to protein family HMM TIGR03137"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24378"
FT                   /db_xref="GOA:A0A3P1TYV2"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TYV2"
FT                   /protein_id="AAP24378.1"
FT                   /translation="MLLIGTEVKPFKANAYHNGEFIQVTDESLKGKWSVVCFYPADFTF
FT                   VCPTELEDLQNQYATLKELGVEVYSVSTDTHFTHKAWHDSSETIGKIEYIMIGDPTRTI
FT                   TTNFNVLMEEEGLAARGTFIIDPDGVIQSMEINADGIGRDASILVNKIKAAQYVRNNPG
FT                   EVCPAKWQEGSATLKPSLDLVGKI"
FT   gene            357051..358280
FT                   /locus_tag="BA_0346"
FT                   /old_locus_tag="BA0346"
FT   CDS_pept        357051..358280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0346"
FT                   /old_locus_tag="BA0346"
FT                   /product="putative 5-methylthioribose kinase"
FT                   /note="identified by similarity to OMNI:NTL01BS01357; match
FT                   to protein family HMM TIGR01767"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24379"
FT                   /db_xref="GOA:A0A347ZYF9"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR009212"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYF9"
FT                   /protein_id="AAP24379.1"
FT                   /translation="MSKFTKYFLMEANDVIVYVKEKLCKFEHAKGLQCKEIGDGNLNYV
FT                   FRVWDEQKNISVIVKQAGDTARISDEFKLSTNRIRIESDVLQLEEELAPGLVPKVYLFD
FT                   SVMNCCVMEDLSDHTILRTALINHEIFPRLADDLTTFLVNTLLLTSDVVMNHKEKKELV
FT                   KNYINPELCEITEDLVYAEPFTNHNKRNELFPLNEGWIREHIYSDKELRIEVAKLKFSF
FT                   MTNAQALIHGDLHTGSVFVKNDSTKVIDPEFAFYGPMGYDIGNVMANLMFAWVNADATM
FT                   SAGAKKDTYMDWLQSTMVEVIDLFKKKFLDAWNIHVTEIMAKEEGFNEIYLQSVLEDTA
FT                   AVTGLELIRRIVGLAKVKDITCIENEEARARAERICLQVAKKFILRANQYKTGTSFVET
FT                   LKEQSMHYAK"
FT   gene            358293..359336
FT                   /gene="mtnA"
FT                   /locus_tag="BA_0347"
FT                   /old_locus_tag="BA0347"
FT   CDS_pept        358293..359336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtnA"
FT                   /locus_tag="BA_0347"
FT                   /old_locus_tag="BA0347"
FT                   /product="S-methyl-5-thioribose-1-phosphate isomerase"
FT                   /EC_number="5.3.1.23"
FT                   /note="identified by match to protein family HMM PF01008;
FT                   match to protein family HMM TIGR00512; match to protein
FT                   family HMM TIGR00524"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24380"
FT                   /db_xref="GOA:Q81ZC2"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZC2"
FT                   /protein_id="AAP24380.1"
FT                   /translation="MEEQLIPIQWKDDALVLLDQTLLPNEVVYESFNTAEGVWDAIQVM
FT                   KVRGAPAIGVSAAYGVYLGVKEFVESTEAEFIDEVKRVCAYLATSRPTAVNLFWALERM
FT                   ESVATDHTHLSITQLKDRLLEEAKEIHREDEEINRQIGEHALTLFHDGMGVLTHCNAGA
FT                   LATTKYGTATAPMYLAKEKGWDLKIYSDETRPRLQGSTLTALELQRAGIDVTVITDNMA
FT                   AMVMSQGKIDAVIVGCDRVAANGDVANKIGTLGVSILAKYYNIPFYVAAPTPTIDLKTP
FT                   TGKEIPIEERDASEVINRFGQYSAPKESKVYNPAFDVTPHENVTAIITEKGIVKAPFTE
FT                   NLKKLFQ"
FT   gene            359391..360032
FT                   /locus_tag="BA_0348"
FT                   /old_locus_tag="BA0348"
FT   CDS_pept        359391..360032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0348"
FT                   /old_locus_tag="BA0348"
FT                   /product="aldolase, class II"
FT                   /note="identified by match to protein family HMM PF00596"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24381"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H9B7"
FT                   /protein_id="AAP24381.1"
FT                   /translation="MLLQKEREEIVAYGKKMISSGLTKGTGGNISIFNREQGLVAISPS
FT                   GLDCYETKPEDVVILNLDGEVVEGERKPSSELDMHLIYYRNREDINALVHTHSPYAKTI
FT                   ASLGWELPAVSYLIAFAGPNVRCAPYETFGTKQLAEAAFEGMIDRRAVLLANHGLIAGA
FT                   NHIKMAFTVAEEIEFCAQIYYQTKSIGEPKLLPEDEMENLAKKFEGYGQQ"
FT   gene            complement(360073..361080)
FT                   /locus_tag="BA_0349"
FT                   /old_locus_tag="BA0349"
FT   CDS_pept        complement(360073..361080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0349"
FT                   /old_locus_tag="BA0349"
FT                   /product="iron compound ABC transporter, permease protein"
FT                   /note="identified by similarity to EGAD:37682; match to
FT                   protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24382"
FT                   /db_xref="GOA:A0A3P1U0B8"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1U0B8"
FT                   /protein_id="AAP24382.1"
FT                   /translation="MIPSILRKQRLIILALLILTITTIVIGMGLGSASLSYDRLLPILM
FT                   GQGTFKEEFVLYSLRLPRIIITLLAGMALALSGAILQGITRNDLAEPGILGINSGAGVA
FT                   VAIFFLYFPIDVGSFLYLLPVVGFIGAFLTAVLIYVFSYSKSSGLQPVRLTLTGIGFAF
FT                   ALSGMMIVLISSADRMKVDFISKWIAGNIWGDDWIFIFAMLPWLIVLIPFVFYKANRLN
FT                   ILALNEPVAIGVGIEIEKERRYLLVAAVALAAAAVSVTGGISFIGLMAPHIAKSLVGPR
FT                   HQIFMPIALLIGGWLLLLADTIGRNIVEPNGIPAGIVVALIGAPYFMYLLLKKA"
FT   gene            complement(361077..362093)
FT                   /locus_tag="BA_0350"
FT                   /old_locus_tag="BA0350"
FT   CDS_pept        complement(361077..362093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0350"
FT                   /old_locus_tag="BA0350"
FT                   /product="iron compound ABC transporter, permease protein"
FT                   /note="identified by similarity to EGAD:37681; match to
FT                   protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24383"
FT                   /db_xref="GOA:A0A3Q0PRE9"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0PRE9"
FT                   /protein_id="AAP24383.1"
FT                   /translation="MTKEHDNTRSIAFTYKLILSIIAFFLIFMVAMVLGAADTSIKDVW
FT                   LALTSSAKGDKISIIREIRLPREVAAIFVGAGLAVSGAIMQGLTRNPLAEPGLLGLSGG
FT                   ANAALALTLAFNPSISYLYLTLACFIGAAVGAIMVFGIGMVKKGGLSPLRIVLAGAAVS
FT                   AFLLAISEGVGIYFKISQDVSLWTAGGVIGTTWSQLKVIIPVISISIFIAILLAKKLTV
FT                   LSFSEEVAIGLGQKIIVIKTILFIIIILLAGASVALVGNMAFIGLMVPHMVRPIVGPDY
FT                   RFVIPMSAIAGASFMLLADTIGRTINAPYETPVAAIVAIVGLPFFLFIVRKGGKTFS"
FT   gene            complement(362166..363083)
FT                   /locus_tag="BA_0351"
FT                   /old_locus_tag="BA0351"
FT   CDS_pept        complement(362166..363083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0351"
FT                   /old_locus_tag="BA0351"
FT                   /product="iron compound ABC transporter, iron
FT                   compound-binding protein"
FT                   /note="identified by similarity to GP:15023677; match to
FT                   protein family HMM PF01497"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24384"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1U1J1"
FT                   /protein_id="AAP24384.1"
FT                   /translation="MKKLFISLTVLFVLVMSACSNGSTDKKNDAKGSKSETITYQSENG
FT                   KVEVPANPKRVVVLSSFAGNVMSLGVNLVGVDSWSKQNPRFDSKLKDVAEVSDENVEKI
FT                   AELNPDLIIGLSNIKNVDKLKKIAPTVTYTYGKVDYLTQHLEIGKLLNKEKEAKTWVDD
FT                   FKKRAQDAGKEIKAKIGEDATVSVVENFNKQLYVYGENWGRGTEILYQEMKLKMPEKVK
FT                   EKALKEGYYALSTEVLPEFAGDYLIVSKNKDTDNSFQETESYKNIPAVKNNRVYEANMM
FT                   EFYFNDPLTLDFQLDFFKKSFLGK"
FT   gene            363416..364465
FT                   /locus_tag="BA_0352"
FT                   /old_locus_tag="BA0352"
FT   CDS_pept        363416..364465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0352"
FT                   /old_locus_tag="BA0352"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF01134; match to protein
FT                   family HMM PF03486; match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24385"
FT                   /db_xref="GOA:Q81ZB7"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZB7"
FT                   /protein_id="AAP24385.1"
FT                   /translation="MNREELFDVTVIGGGPAGLYSAFYSGLREMKTKIIEFQPQLGGKI
FT                   HVYPEKMIWDIGGLLPVTGEKLIEQLVQQGLTFQPEVVLNTKIESIIRNKDGIFTLKTS
FT                   TGEEHFSKTVIVATGSGILNPQKLSIEGAERFEVSNLNYTVKSLKRFKNKTVIISGGGN
FT                   SAIDWANELEPIAKKVYLTYRKEELSGHEAQVKQLMNSSAECFFNTSITTLIAGDNHEA
FT                   IEYVELTNHETGEVSQLAIDEVIINHGYERDITLLENSELDVAIIDNYYIAGNANSESS
FT                   VDGLYAAGDILKHEGKLHLIAGAFQDAGNAVNKAKQFIQPDASEYGMVSSHNEVFKKRN
FT                   RELIKQMMK"
FT   gene            complement(364662..365030)
FT                   /locus_tag="BA_0353"
FT                   /old_locus_tag="BA0353"
FT   CDS_pept        complement(364662..365030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0353"
FT                   /old_locus_tag="BA0353"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24386"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYG6"
FT                   /protein_id="AAP24386.1"
FT                   /translation="MATRHIITMLEKTLQVETENTISHLTTSLSDRILSQSAAIQENNC
FT                   YHTIGEWYKNHFLFQQDDFLWAKYVFYDAYCEEIKKQGHLTKRVRQILESLARMHGKQY
FT                   IASILNMPFPKKRAKGTA"
FT   gene            365212..365451
FT                   /locus_tag="BA_0354"
FT                   /old_locus_tag="BA0354"
FT   CDS_pept        365212..365451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0354"
FT                   /old_locus_tag="BA0354"
FT                   /product="DNA binding domain, excisionase family"
FT                   /note="identified by match to protein family HMM TIGR01764"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24387"
FT                   /db_xref="GOA:A0A384KDS2"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KDS2"
FT                   /protein_id="AAP24387.1"
FT                   /translation="MNALYITVEEAAEYLNLPKSYIEELIQQKKIRALFDGEQYLLNKE
FT                   QFNTHLEQMEKYKQLVEEILNEPIPEDMDVKDED"
FT   gene            365687..366678
FT                   /pseudo
FT                   /locus_tag="BA_0355"
FT                   /old_locus_tag="BA0355"
FT                   /note="putative spore coat protein B, degenerate; an
FT                   automated process has identified a potential problem with
FT                   this gene model; it may contain one or more premature stops
FT                   and/or frameshifts"
FT   gene            366741..366848
FT                   /locus_tag="BA_0356"
FT                   /old_locus_tag="BA0356"
FT   CDS_pept        366741..366848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0356"
FT                   /old_locus_tag="BA0356"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0PQZ7"
FT                   /protein_id="AAP24388.1"
FT                   /translation="MKRNYLLLKQNFALIIFLKMEDWKEEIHRKEDIDE"
FT   gene            366841..367509
FT                   /locus_tag="BA_0357"
FT                   /old_locus_tag="BA0357"
FT   CDS_pept        366841..367509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0357"
FT                   /old_locus_tag="BA0357"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:107744"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24389"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2B6BYS3"
FT                   /protein_id="AAP24389.1"
FT                   /translation="MNELNKSIGENIYVKLIGEKRFKGVLIDVGNDIVVLYNGQDYVYI
FT                   SLYHVQYYKILRTYDEEISKPDVDSVIKRESPSISLRKVLSTSKGIFTEIYVAGNAPIH
FT                   GYVTSIMNDYIVFYSPVYKTVYISLKHLKWLIPYKENQVPYALNKNELPVNPLNITLAR
FT                   TFEEQLIKMSGKIMVFDLGEESNKIGKMAKIDEGHIEILKARDAKMYVNIQHVKSVHCP
FT                   "
FT   gene            367746..369011
FT                   /locus_tag="BA_0358"
FT                   /old_locus_tag="BA0358"
FT   CDS_pept        367746..369011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0358"
FT                   /old_locus_tag="BA0358"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1U0H1"
FT                   /protein_id="AAP24390.1"
FT                   /translation="MEQFPNSLSITLLGSAGGAAKAVLAILNQAIVNEKDPIYEVIKSV
FT                   TFHLVDIKQKDRTYYDELFPNLKDQLFLSEIDLQDVVTFKKHLKESSTSVVIDVSGADT
FT                   IRVLSCCNELGICYINSALENEAVDQDDSLIGFQLTERYTRFEKEKEKFTNTKAIIGSG
FT                   MNPGVVQWMVVELMKERPNEKPRACYIVEHDTSFLNDTALIKPHTLYASWAVERFLDEA
FT                   IWSYPMYMSHHRPLYFYEDVYASEYKVKLGEKEFYGCLMPHEEVLILGKNFNMEVGFLY
FT                   RINEYTTNIIRQNLNKVEDLWNWNRKVFNPAEEEIAGEDLVGVLLVYENSEAYMYNVMN
FT                   SSQVFHKYKTNATYFQVGCGIYAGLCSLLFDEFKQGAYYVEELLLNTESKYGEYLNLYM
FT                   KDFVVGENDFTDGLLHDRVRWI"
FT   gene            369284..369665
FT                   /pseudo
FT                   /locus_tag="BA_0359"
FT                   /old_locus_tag="BA0359"
FT                   /note="sensor histidine kinase domain protein, degenerate;
FT                   an automated process has identified a potential problem
FT                   with this gene model; it may contain one or more premature
FT                   stops and/or frameshifts"
FT   gene            369889..370269
FT                   /locus_tag="BA_0360"
FT                   /old_locus_tag="BA0360"
FT   CDS_pept        369889..370269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0360"
FT                   /old_locus_tag="BA0360"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24391"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1U1I2"
FT                   /protein_id="AAP24391.1"
FT                   /translation="MELTLNSTVCLHTIQFRKEQKNYIVKDTITGEKYEMPPLWIDALA
FT                   MMRDGFLLGEIEEKLKEEYPAEEINMLAFTRQLLELELVEMVDGEEIACTKKKEKDYLA
FT                   WVRPRVEQFFLSLNKKYRSKGQ"
FT   gene            complement(370298..370930)
FT                   /locus_tag="BA_0361"
FT                   /old_locus_tag="BA0361"
FT   CDS_pept        complement(370298..370930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0361"
FT                   /old_locus_tag="BA0361"
FT                   /product="putative cyclase"
FT                   /note="identified by similarity to EGAD:106397; match to
FT                   protein family HMM PF04199"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24392"
FT                   /db_xref="GOA:A0A347ZYH5"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYH5"
FT                   /protein_id="AAP24392.1"
FT                   /translation="MKVIDLSQTFENNMSQFPGTPKINLEAITSVEETGYQVTDFHSVV
FT                   HVGTHCDAPAHFISGATTIDQLPLDQFVGEAVLIDVTHVQERKLRKEVLHNADIKEGDI
FT                   VIFHSNLSTKWNTEAYEQEAFYLSEELAEELVQLKVKSVGLDFISPDEVTTETSPIHHI
FT                   LLGNNIYLIENLTNLDAIKTKRFFFSAAPLKIKDSDGAFARAFAVIF"
FT   gene            371279..372388
FT                   /locus_tag="BA_0362"
FT                   /old_locus_tag="BA0362"
FT   CDS_pept        371279..372388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0362"
FT                   /old_locus_tag="BA0362"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL03CP1550"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24393"
FT                   /db_xref="GOA:A0A347ZYH6"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYH6"
FT                   /protein_id="AAP24393.1"
FT                   /translation="MTGNVLNYFAGGNTARGFHNLYEENLKGLNRLFILKGGPGTGKSS
FT                   LIKAIGRDWVEKGYDIEFLHCSSDNKSVDGVIIPKLKVGIVDGTSPHVIEPKMPGVVEE
FT                   YINLGGAWDSDKLREQKVEIERFVSEASKAFQAAYARFNEALIIHDEWEKIYIDNIDFN
FT                   KANELTDQLIQKLFADKGGKQSLVKHRFLGAATPKGAVDFVPNLTEGLLHRYFIKGRPG
FT                   SGKSTMLKKLAKAAEEKGFEVEVYHCGFDPNSLDMVIVRELGFAIFDSTAPHEYFPSRE
FT                   GDEIIDMYALIVTPGTDEKYAEEIRHVSIQYKTKMNEAMSFLAKAKSVRDKLERIYIAA
FT                   MDFSKVDAYKEEIQKEFERIAISVTEKNK"
FT   gene            372511..373293
FT                   /locus_tag="BA_0363"
FT                   /old_locus_tag="BA0363"
FT   CDS_pept        372511..373293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0363"
FT                   /old_locus_tag="BA0363"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:108881"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24394"
FT                   /db_xref="InterPro:IPR018775"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYH7"
FT                   /protein_id="AAP24394.1"
FT                   /translation="MREKIKLELERIEKEKDVKILFAVESGSRAWGFPSKDSDYDVRFV
FT                   YMHPVEWYLSIHDKRDVIEYPISDDLDISGWDIKKALQLFAKSNPALLEWIRSPIFYSK
FT                   NSNFPEQLQQMSEKNFDPKATIYHYLHMASKNYREFLQGENVKLKKYFYVLRPILACKW
FT                   LEEKTTLPPVEFDRLITELLLERSVLDEIEQLLIKKKAGTELDVGLKIEVLNQFLEEQI
FT                   HYYQQYVKGIEKGSGIDIESLNTLFRDMLFEVYKKEHE"
FT   gene            complement(373308..374609)
FT                   /locus_tag="BA_0364"
FT                   /old_locus_tag="BA0364"
FT   CDS_pept        complement(373308..374609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0364"
FT                   /old_locus_tag="BA0364"
FT                   /product="putative benzoate transport protein"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24395"
FT                   /db_xref="GOA:A0A347ZYH8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYH8"
FT                   /protein_id="AAP24395.1"
FT                   /translation="MQPSAPPHLESTKTIFSNSITKLVVFICWLAILADGYDLGIYGAV
FT                   LPKLLEDNSWALSPAHAGTIASYALFGMFIGAILVGTITDLIGRKWTLICCLALFSITM
FT                   GLAALAPSPELFGLWRFIGGIGLGGVIPTASALTVEYSPKKRQSFIYALMFTGYPLGIV
FT                   LGAILSMFMLEDFGWRIMFGIGMIPLLLIPFIIRYLPESIQFLLSRNRQEEVDKILNRF
FT                   QIEFYAKDETHQAPSNIRKKNGFLTLFSKEYIKATLLFWITYIMGMFLIYGLNTWLPQM
FT                   MRQAGYPLGSSLSFLLMLNITAAIGALFAGAIADRIGAKIVISISYLMAAICIGLLTIK
FT                   PSVSIIYLLIGLAGIGSVGITQILNAYVTQYFPSHIRATSLGWGLGLGRVGAIAGPILV
FT                   GIIMTMQYDLAWNFYLFSFAGLLAAISVFFIPTK"
FT   gene            complement(374753..376279)
FT                   /locus_tag="BA_0365"
FT                   /old_locus_tag="BA0365"
FT   CDS_pept        complement(374753..376279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0365"
FT                   /old_locus_tag="BA0365"
FT                   /product="putative Rieske 2Fe-2S iron-sulfur protein"
FT                   /note="identified by match to protein family HMM PF00355;
FT                   match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24396"
FT                   /db_xref="GOA:A0A347ZYH9"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="InterPro:IPR038010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYH9"
FT                   /protein_id="AAP24396.1"
FT                   /translation="MTSDTFPQFPSSYWIESTQIPTFPPLSENIKTKVAIIGAGITGIT
FT                   TAYLLAKEGIDVVLIDSGLILNGTTGHTTAKITAQHDLIYDELINHFGMEKAGLYYEAN
FT                   NHALQFINKTVQTYKIDCNFLNEDSYLYTTTDNGLRTLSKEYEAYQKLNIPCDFVQSLS
FT                   IPIPVQSALVMKNQAQFHPLLYLKTLLEKFVEMGGKVYEQTTAIDVEKGDYPQVITKGG
FT                   HRITCEYVVSCSHFPFYDATSFFFTRMYAERSYALAIKAKTDYPGGMYLSIDDPKRSLR
FT                   YTTNNGEKLILIGGESHKTGQGINTMLHYEALYSFAEATFGVDEVPYRWSAQDLITLDK
FT                   VPYIGHINESNPNIFVATGYRKWGMTTGTAAAHLLKDSILKVHSPYKELYTPSRFHANP
FT                   DIKTFLSQNIDVAKHLIEGKIETALRKPEDLEVGEGSVVHVNGKRAGAYKDKEGKLHIV
FT                   DTTCTHLGCEVEWNNGDCTWDCPCHGSRFSIEGDVIEGPADQPLKRVDNE"
FT   gene            376862..377947
FT                   /locus_tag="BA_0366"
FT                   /old_locus_tag="BA0366"
FT   CDS_pept        376862..377947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0366"
FT                   /old_locus_tag="BA0366"
FT                   /product="stearoyl-CoA 9-desaturase"
FT                   /note="identified by match to protein family HMM PF00487"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24397"
FT                   /db_xref="GOA:A0A347ZYI0"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYI0"
FT                   /protein_id="AAP24397.1"
FT                   /translation="MKELHTFGWYAARVSPHLPKKAFKPVPTRLFGGLAYLLVALAGLI
FT                   SIGVFELNVWANLGIAIVLGLCFASLGFLGHEILHGTVVRKAWLRDFLGAIAFMPLSTG
FT                   PKLWRKWHNATHHVHTQHEENDPDAWPTLEKLKKSKFLSWVYRMPLHVRSFFSFLSLTI
FT                   QFTLHSTRMFFHFIKEFKSSNQKSVWLQLLLPWTVWISLLFIMGPGKWLFAYVIPLLIA
FT                   NFIVMAYIATNHRLNPIVPVNDPLANCLSVTVPRWVDVLHFNFSYHTEHHLFPAMSSKY
FT                   YPLVKEKIKEMWPERYHEMPMTKALAALWNTPRVYYQGSELVDPHREHFYGSLGNGLDP
FT                   HNISYREEHIEEEESIKKVNQ"
FT   gene            complement(378000..379581)
FT                   /pseudo
FT                   /locus_tag="BA_0367"
FT                   /old_locus_tag="BA0367"
FT                   /note="putative amino acid ABC transporter, amino
FT                   acid-binding protein, authentic frameshift; an automated
FT                   process has identified a potential problem with this gene
FT                   model; it may contain one or more premature stops and/or
FT                   frameshifts"
FT   gene            complement(379703..380425)
FT                   /locus_tag="BA_0368"
FT                   /old_locus_tag="BA0368"
FT   CDS_pept        complement(379703..380425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0368"
FT                   /old_locus_tag="BA0368"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to SP:P27675; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24398"
FT                   /db_xref="GOA:A0A347ZYI3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYI3"
FT                   /protein_id="AAP24398.1"
FT                   /translation="MIQVRNLVKSFGSLDVLKGIDLEVNEKEVVVLIGASGSGKSTLLR
FT                   CLNFLEMYDEGEIHLQGERIDPKHSNLNKVRENVGMVFQHFNLFPHMTSLENIIEAPIH
FT                   VKKLETANAKEIGNQLLQKVGLQDKADVTPHLLSGGQKQRIAIARALAMNPKIMLFDEP
FT                   TSALDPELVGEVLQVMKELAEEGMTMVIVTHEMNFARDVADRVIFMDDGKIVEDAPPAQ
FT                   FFSTPSHERAKQFLRNVL"
FT   gene            complement(380595..382319)
FT                   /locus_tag="BA_0369"
FT                   /old_locus_tag="BA0369"
FT   CDS_pept        complement(380595..382319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0369"
FT                   /old_locus_tag="BA0369"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by similarity to GP:16410112; match to
FT                   protein family HMM PF00015; match to protein family HMM
FT                   PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24399"
FT                   /db_xref="GOA:A0A384L6C7"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L6C7"
FT                   /protein_id="AAP24399.1"
FT                   /translation="MLKILYLLNVINRLILLIAVPIISILIISVVNYMNLQQMHKQLQT
FT                   VYVDRLQPIKWLGSIESSLYQEFSYVKELIITEDENRRTTILNKLNDTNKETEKLQAQY
FT                   ENTYITGEEKKLLSQYKEKLENYKKHRAQMLDFIKENKLNQAYSFYLTTVEHNLSATVG
FT                   ALKNLSDYNEKLAEGLYNDSEHSYKQVISITIILFITCLVLCILISLFTAKSIINPINS
FT                   LRSIMNTAGKGDLTIAVPKQYHHEFGHMFNSFDQMISNLQQIIKNVIQTSVQVKSSTNH
FT                   IVETATVSSSTMDNIANTMKQLSHHINDQSANIKDSSTAMDEIANGVQSIAESSTTISN
FT                   LAISTSDKANVGTEIIENSISQMTTIHTVMDEIYKVVDQLVIRTQDIDKALQTITYISE
FT                   QTNLLSLNAAIESARAGEHGKGFAVVSEEVRKLAEQSKQAATDITKLNLLVQNDTKDVV
FT                   NVMGKGQQEIQEGIHAVQNAKLAFHNIVNHINEVTDQIQDITASAEEMSASSEEINSAL
FT                   INISSISQNIVSETNHTSQSSQAQSVSIQDITNMSLQMQKLVDELEKSATQFKIKNL"
FT   gene            382527..383819
FT                   /locus_tag="BA_0370"
FT                   /old_locus_tag="BA0370"
FT   CDS_pept        382527..383819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0370"
FT                   /old_locus_tag="BA0370"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by similarity to EGAD:45917; match to
FT                   protein family HMM PF00015; match to protein family HMM
FT                   PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24400"
FT                   /db_xref="GOA:A0A347ZYI5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYI5"
FT                   /protein_id="AAP24400.1"
FT                   /translation="MEKERKAFSFGLRTQLMLFTTVLALITYSTSIFFIYVIYDYFQSY
FT                   VSQTAYNIIVMLLGVVWSGILAYGAAVFLIKPLRKLEEAARKAAEGDIREDVPLPKTDD
FT                   EIKSLSVAFNMMLGNLRGMVKNIDTTFSYTYNQVQQIRKQTGEATKQAQGVSETLAEIS
FT                   SGAEQSAASIQAIVSAVDTTTSIASEVEEKAKQSDELSSEMVQALGHSTRVFTSLIQGI
FT                   QTLAKENEDSMQNVQKLEERMKQVEHIVSVVSEIASQTNLLALNASIEAARAGEHGRGF
FT                   AVVAEEVRKLADESDHSARNISQLLRNMQEEVQQVAMKMTEQVKIAKEEARRGEATELI
FT                   LKEMSSSVMEVADATKQISSYMNEQVSHIHQTGAQTKAVAAIAEETSAGSQEVACVTVQ
FT                   QSKNMVVIDQLLKDLEKQAADLKQTIERFSM"
FT   gene            384056..385720
FT                   /locus_tag="BA_0371"
FT                   /old_locus_tag="BA0371"
FT   CDS_pept        384056..385720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0371"
FT                   /old_locus_tag="BA0371"
FT                   /product="glycosyl hydrolase family protein"
FT                   /note="identified by similarity to SP:P21332; match to
FT                   protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24401"
FT                   /db_xref="GOA:A0A347ZYI6"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYI6"
FT                   /protein_id="AAP24401.1"
FT                   /translation="MNKTWWKEAVAYQIYPRSFMDSNGDGIGDLQGIIAKLDYLKDLGI
FT                   DVIWICPMYKSPNDDNGYDISDYQDIMDEFGTMEDFDALLDEVHKRDMKLIIDLVINHT
FT                   SDEHPWFIESRSSKDNPKRDWYIWHDGKDGAEPNNWESIFNGSAWEYDEVTGQYYLHLF
FT                   SRKQPDLNWENKEVREVLYDTVNWWLDKGIDGFRVDAISHIKKEDGFKDMPNPKGLKYV
FT                   PSFDKHMNVDGIQPLLEELKENTFSKYDIMTVGEANGVKIEDAELWVGEEQGKFNMVFQ
FT                   FEHLSLWDAEKKKDLDVVGLKKVLTKWQKGLENKGWNALYIENHDKPRIVSTWGDDKQY
FT                   WRESATALGAMYFFMHGTPFIYQGQEIGMTNVQFPNIEDYDDVAIKNLYREKIAEGVSH
FT                   QDMMEIIWASCRDNSRTPMHWDDEINAGFTTGTPWFGMNQNYKEINVAKQKNEENSIFN
FT                   FYKKMIALKKEHDVLNYGTYDLLLEDDPQIYAYTRTLNDEKIVVISNISKEEAVYNEDL
FT                   FALERKRLLLNNYEVAEHEQLTTITLKPYETRVYRIS"
FT   gene            385893..387530
FT                   /locus_tag="BA_0372"
FT                   /old_locus_tag="BA0372"
FT   CDS_pept        385893..387530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0372"
FT                   /old_locus_tag="BA0372"
FT                   /product="PTS system, IIBC component"
FT                   /note="identified by match to protein family HMM PF00367;
FT                   match to protein family HMM PF02378; match to protein
FT                   family HMM TIGR00826; match to protein family HMM
FT                   TIGR02003"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24402"
FT                   /db_xref="GOA:A0A2P0H9D3"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011300"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H9D3"
FT                   /protein_id="AAP24402.1"
FT                   /translation="MKITSFDFWQKFGKALLVVVAVMPAVGLMISIGKLIGMSAGDINA
FT                   VHTIARVMEDIGWAIITNLHILFAVAIGGSWAKDRAGGAFAALLAFVLTNRITGAIFGV
FT                   NAEMLADSKAKVSSVLAGDLIVKDYFTSVLGAPALNMGVFVGIITGFLGATLYNKYYNY
FT                   NKLPQALAFFNGKRFVPFVVIVWSTVTAIVLSLLWPFIQSGLNEFGRWIAASKDSAPVV
FT                   APFVYGTLERLLLPFGLHHMLTIPMNYTELGGTYTMLTGSKIGQVVAGQDPLWLAWITD
FT                   LNNLLANGDTKAYNDLLNNVVPARFKAGQVIGSTAALMGIAFAMFRNVDKEKRAKYKPM
FT                   FLSAALAVFLTGVTEPIEFMFMFIAPVLYVVYAITTGLAFALADLINLRVHAFGFIELI
FT                   TRTPMMVNAGLTRDLINFVIVSLVFFGLNFTLFNFLIKKFNLPTPGRAGNYIDNEDEAS
FT                   EGTGNVQEGSLATKVIDLLGGKENIADVDACMTRLRVTVKDLDVVAPEAQWKQNGALGL
FT                   IVKDKGVQAVYGPKADVLKSDIQDMLGA"
FT   gene            387535..388326
FT                   /locus_tag="BA_0373"
FT                   /old_locus_tag="BA0373"
FT   CDS_pept        387535..388326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0373"
FT                   /old_locus_tag="BA0373"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /note="identified by similarity to OMNI:NTL02SP0669; match
FT                   to protein family HMM PF03372"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24403"
FT                   /db_xref="GOA:A0A2P0H9C2"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H9C2"
FT                   /protein_id="AAP24403.1"
FT                   /translation="MKLLTLNCHSWQEENQIEKIKYLAKVIQEEEYDVVALQEVSQSIG
FT                   AKNVCGNKKEDNFGLLLLEELKALHVKDYNITWDFSHIGYDVYEEGLAIITKHNVVKED
FT                   TFFISENKDTTYWKTRKIVSATIAYNGKNITFYSCHLGWWNDEEELFKGQVNRLMERVD
FT                   SNELSFLMGDFNNNARLQGEGYEYMMQEGLYDTYELAIEKDEGTTVQGEIAGWDENKHN
FT                   LRIDLILCNRSEKIRSSKVVFNGTNRKIISDHFGVEVQVDI"
FT   gene            388632..391457
FT                   /locus_tag="BA_0374"
FT                   /old_locus_tag="BA0374"
FT   CDS_pept        388632..391457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0374"
FT                   /old_locus_tag="BA0374"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GP:16413093; match to
FT                   protein family HMM PF01061; match to protein family HMM
FT                   TIGR03061; match to protein family HMM TIGR03062"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24404"
FT                   /db_xref="GOA:A0A347ZYI9"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYI9"
FT                   /protein_id="AAP24404.1"
FT                   /translation="MKQIWRIYKTDLRNVAKHWAAIVIVVGLMILPSLYAWFNIKASWD
FT                   PYGNTKEVPIAVSNQDAGSNLRGKDINIGNEIVDSLKKNKNLGWKFVDEKQAIYGVERG
FT                   DYYASITIPKDFSEKIATVLDENPQKPELDYYVNEKVNAIAPKITAKGASGITEEISKN
FT                   FVKTANGEIFKIFNDLGIDLETNLPSIEKVKDLVFKLEAQFPEMNTLMDKALDDATRAE
FT                   DLVKVAQKELPVVESVINDGQEALTNLDKFFANNDQTLQNAPGTIRNHLTAAKNVMDKA
FT                   NAFTDFLMHPGIDFSGMKGLPEFPARPDLSKLNDEGYKNIARNINQTVNNVLNSARAGT
FT                   TYGKSVVNGLQNGQFDPEKAKQDLNAVSENLQGRTDSIAYLINVFTELQKSATTDFGQS
FT                   FFQGRVDRLTKLKSGMENANNGIKDIVNVIGTGQEVKKDVTDVANQKLDAANGLIDQAE
FT                   KDYNETFVADYKKAVSTVDQAKADANEAYDSVKNEYDKFKNGVEDAKANISNKGVTDLE
FT                   WAKVSLNDLNGQLQATNNLIGDAIPVLESTNKVLADVNSGKNLNGGIAKLNKIQNSVQK
FT                   GIDATNKATTLINNGQKPTKEVVESINEATQNASAQLGDFLATYDSEIVPNFNTAIERT
FT                   KRMSKNTSQILKEADKKLPDVKKLLEDSSKGLVDGRKKLADIKAEMPATEKKIKELADK
FT                   IRDFESEEDLKDIIRLLKNDVEKQSDYFANPVNLKENKLFAMPNYGSAMSPFYTVLALW
FT                   VGALLMVSLLTVEVHEEGANYKSHEIYFGRLLTFLTMGLSQAFIVSMGDIFLLGTYVVD
FT                   KFWFVLFSLFIGGVFVCIVYSLVSIFGNVGKSMAIILLVLQVAGSGGTFPIQMTPAFFQ
FT                   AIYPFLPFTYAISAIRETVGGMLWDIVTRDLLVLSAFVVVMIVAALLLKTPINKSSEKF
FT                   VENAKGSKIIH"
FT   gene            complement(391498..393687)
FT                   /gene="topB1"
FT                   /locus_tag="BA_0375"
FT                   /old_locus_tag="BA0375"
FT   CDS_pept        complement(391498..393687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topB1"
FT                   /locus_tag="BA_0375"
FT                   /old_locus_tag="BA0375"
FT                   /product="DNA topoisomerase III"
FT                   /EC_number="5.99.1.2"
FT                   /note="identified by similarity to EGAD:107325; match to
FT                   protein family HMM PF01131; match to protein family HMM
FT                   PF01751; match to protein family HMM TIGR01056"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24405"
FT                   /db_xref="GOA:Q81Z97"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81Z97"
FT                   /protein_id="AAP24405.1"
FT                   /translation="MAKSVVIAEKPSVARDIARVLKCDKKGNGYLEGSKYIVTWALGHL
FT                   VTLADPESYDVKYKKWNLEDLPMLPERLKLTVIKQTGKQFNAVKSQLLRKDVNEIIVAT
FT                   DAGREGELVARWIIDKVRINKPIKRLWISSVTDKAIKDGFANLKPGKAYDNLYASAVAR
FT                   SEADWYIGLNATRALTTRFNAQLNCGRVQTPTVAMIANREDEIKNFKAQTYYGIEAQTT
FT                   NQLKLTWQDANGNSRSFNKEKIDGIVKGLDKHNATVLEIDKKQKKSFSPGLYDLTELQR
FT                   DANKKFGYSAKETLNIMQKLYEQHKVLTYPRTDSRYISSDIVGTLPERLKACGVGEYRP
FT                   LAHKVLQKPIKANKSFVDDSKVSDHHAIIPTEGYVNFSAFTDKERKIYDLVVKRFLAVL
FT                   FPAFEYEQLTLRTKVGNETFIARGKTILHAGWKEVYENRFEDDDVTDDVKEQLLPRIEK
FT                   GDTLTVKLIMQTSGQTKAPARFNEATLLSAMENPTKYMDTQNKQLADTLKSTGGLGTVA
FT                   TRADIIDKLFNSFLIEKRGKDIHITSKGRQLLDLVPEELKSPTLTGEWEQKLEAIAKGK
FT                   LKKEVFISEMKNYTKEIVSEIKSSDKKYKHDNISTKSCPDCGKPMLEVNGKKGKMLVCQ
FT                   DRECGHRKNVSRTTNARCPQCKKKLELRGEGAGQIFACKCGYREKLSTFQERRKKESGN
FT                   KADKRDVQKYMKQQKKEEEPLNNPFAEALKKLKFD"
FT   gene            394096..394902
FT                   /gene="thiM"
FT                   /locus_tag="BA_0376"
FT                   /old_locus_tag="BA0376"
FT   CDS_pept        394096..394902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiM"
FT                   /locus_tag="BA_0376"
FT                   /old_locus_tag="BA0376"
FT                   /product="hydroxyethylthiazole kinase"
FT                   /EC_number="2.7.1.50"
FT                   /note="identified by similarity to SP:P39593; match to
FT                   protein family HMM PF02110; match to protein family HMM
FT                   TIGR00694"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24406"
FT                   /db_xref="GOA:Q81Z96"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81Z96"
FT                   /protein_id="AAP24406.1"
FT                   /translation="MNTKEISKVVDLVRESNPLVHNITNVVVTNFTANGLLALGASPVM
FT                   AYAKEEVAEMASIAGALVLNMGTLRPDEVEAMLLAGKSANRNDVPVLFDPVGAGATSYR
FT                   TEVARHIPAEIELAIIRGNAAEIANVINEKWEIKGVDAGAGNGNVVSIAKQAADELNTV
FT                   AVITGKEDVVTDGERTIVIRNGHSILTKITGTGCLLTSVIGAFVAVEKDYVKAAVAALT
FT                   FYGVAAELAAAKTVEKGPGSFQIEFLNQLANTTSGDIEKYGKIEVI"
FT   gene            394919..395578
FT                   /gene="thiE"
FT                   /locus_tag="BA_0377"
FT                   /old_locus_tag="BA0377"
FT   CDS_pept        394919..395578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="BA_0377"
FT                   /old_locus_tag="BA0377"
FT                   /product="thiamine-phosphate diphosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="identified by similarity to SP:P39594; match to
FT                   protein family HMM PF02581; match to protein family HMM
FT                   TIGR00693"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24407"
FT                   /db_xref="GOA:Q81Z95"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81Z95"
FT                   /protein_id="AAP24407.1"
FT                   /translation="MSRISKAEMSKLLSVYFIMGSNNCTKDPLQVLREALEGFITIFQF
FT                   REKGEGALTGEERICFAKELQAICKEYGVPFIVNDDVELALELDADGVHVGQDDEGITS
FT                   VREKMGDKIVGVSTHTIEEARWVIENGADYLGVGPIFPTSTKKDTKAVQGTKGLAHFRE
FT                   QGITIPIVGIGGISIENTASVIEAGADGVSVISAISLAESAYESTKKLVEEVSRSL"
FT   gene            complement(395694..397007)
FT                   /locus_tag="BA_0378"
FT                   /old_locus_tag="BA0378"
FT   CDS_pept        complement(395694..397007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0378"
FT                   /old_locus_tag="BA0378"
FT                   /product="anaerobic C4-dicarboxylate membrane transporter"
FT                   /note="identified by similarity to EGAD:17560; match to
FT                   protein family HMM PF03605; match to protein family HMM
FT                   TIGR00770"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24408"
FT                   /db_xref="GOA:A0A1T3V2X5"
FT                   /db_xref="InterPro:IPR004668"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1T3V2X5"
FT                   /protein_id="AAP24408.1"
FT                   /translation="MFWLQFLTLLLCIFIGARLGGVGLGVMGGVGMAILVFVFHLQPTA
FT                   PPIDVMLMILAVITAAGALQAAGGMDYLVHLAEKALRKNPKRITFFAPIVTYLFTLCAG
FT                   TGHVAYSVLPVIAEVSRESGIRPERPMSIAVIASQQAITASPISAATVALLAMLADYKI
FT                   TLLDILKVSIPSTFIACMIAAFVASKMGKELNEDPEYLKRLKEGMIPKIEEKKEFVGVK
FT                   GAKLSVILFLVGTFLVVLLGSFEALRPGWIVDGKLARLSMPNTIEMVMLTIAALIIIFC
FT                   KPNVESIVSGNVFKAGATAVVAIFGIAWMGDTFFNGNLNMIQGSIQHLVTSAPWLFAIA
FT                   LFILSILLYSQAATVRALMPLGLSLGIPPALLIAMFPAVNGYFFIPNYGTIVAAINFDR
FT                   TGTTGIGKYVLNHSFMIPGLIATFTSIGIGMLLISIMF"
FT   gene            397518..399257
FT                   /locus_tag="BA_0379"
FT                   /old_locus_tag="BA0379"
FT   CDS_pept        397518..399257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0379"
FT                   /old_locus_tag="BA0379"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24409"
FT                   /db_xref="GOA:A0A384KHT9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KHT9"
FT                   /protein_id="AAP24409.1"
FT                   /translation="MKKYWHKLSFLQKNVLLTVLVILTLVGTMGALSFNMFQNSMMSIF
FT                   ERHSFETGDTVLHKLDEEIVRDVTKDPVAQREKREKLTEKLDEATEELNSVGQTYIVGA
FT                   KKNEKGELLIVDLSTDLANVVEVRPGEYYKQLDLWMEAYDKVMSTKKANMTVVYEDLLG
FT                   TWVTILEPIKDGEGNIVAIVAADVDASIVPSTKEKFIIQGLMFICISVLIATVIQFLIV
FT                   RNALAPLRDLREGLRRVGEGDLNIKLEERSDDIGIINSYFNNTIEKFKGIIDKVKQTAE
FT                   QVSSSSQELSVSTKENSMAVQEIVSSMVELRAGAQLQETSVPQYLGIVYEVEDKMEEIT
FT                   NAAKQMEKVSEGIEHHSVKGNGVTKQAINQMNIIQNAVQDLSSIIYSLEVRSKEISDIV
FT                   TVITSISNQTNSLALHATIEASRAEETGEGFAVVADEVRKLAEQMEASAKDIANLIRET
FT                   QAGTEEAVVSIRKASKEVESGMKLVEMNGAFFEEISKSAQSVTNQVRVVSSNSSDILQN
FT                   SQNIVRVVNELSLIANTYTNSSSNVEESMKEQEMSVQDIAELASSLSWLSQELQELIGE
FT                   FKS"
FT   gene            399521..399841
FT                   /locus_tag="BA_0380"
FT                   /old_locus_tag="BA0380"
FT   CDS_pept        399521..399841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0380"
FT                   /old_locus_tag="BA0380"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:15024336; match to
FT                   protein family HMM PF01910"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24410"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1T3V2Z3"
FT                   /protein_id="AAP24410.1"
FT                   /translation="MSQQVTMSFSVVPQAKTKDVYSVVDKAIEVVQQSGVRYEVGAMET
FT                   TLEGELDVLLDVVKRAQQACVDAGAEEVITSIKIHYRPSTGVTIDEKVWKYRDEYAKPE
FT                   AI"
FT   gene            399813..400586
FT                   /locus_tag="BA_0381"
FT                   /old_locus_tag="BA0381"
FT   CDS_pept        399813..400586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0381"
FT                   /old_locus_tag="BA0381"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="identified by similarity to GP:15024337; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24411"
FT                   /db_xref="GOA:A0A3P1TYS9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TYS9"
FT                   /protein_id="AAP24411.1"
FT                   /translation="MNMQNQKQSKIITTIWLILLIAIWEGSVSLFKIEPWILPKPSAIV
FT                   QELIGMKDLLLPNTMQTLQEVIIGLFFAILIGTSIAILMDVIPLFRILINPLLVISQTI
FT                   PIVVLAPLFIIWFGYGMLPKVMVVILVCFFPIALSILEGFQTVDKNMLKLLQTMKATKW
FT                   QVYQKVKFPAVLPYFFSGLKIAVTYSVMGAIIGEWLGASEGLGVMLTRATKSFLTARVF
FT                   GVAAIIVMVTLCLYFIVEFMARITAPWIYRKDGRK"
FT   gene            400583..401581
FT                   /locus_tag="BA_0382"
FT                   /old_locus_tag="BA0382"
FT   CDS_pept        400583..401581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0382"
FT                   /old_locus_tag="BA0382"
FT                   /product="putative ABC transporter, substrate-binding
FT                   protein"
FT                   /note="identified by similarity to GP:15024338; match to
FT                   protein family HMM PF09084"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24412"
FT                   /db_xref="GOA:A0A2B6CBY3"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2B6CBY3"
FT                   /protein_id="AAP24412.1"
FT                   /translation="MKKGLKVMLAALLAVGVAGCNPAKKEESASKDQKVKVVLDWFPNT
FT                   NHTGLYVAQAKDYYKKQGLDVEIIQPGDNVTAEQMIASGKADFAISAQENVTLARVEGI
FT                   PVVSVGAIIQHNTSAFASLKKDNMTSPKDFEGKRYGGWGGPAEEATLKTIMDKHQADFN
FT                   KVEKIILGQTDFFKSIGRDADFEWIYYGWDGIEAKRQGKELNTIMVKDLDPALDFYSPV
FT                   MITSEKHTKQDKDFVKKFMSATTEGYNFAIKEPKEAADILIKAVPDVNKDLVQESQKWL
FT                   STKYQDDAKAWGVQKEEVWTNYMNFLYDNKVIKKKIDVKDAFTNEFLPSEK"
FT   gene            401578..402327
FT                   /locus_tag="BA_0383"
FT                   /old_locus_tag="BA0383"
FT   CDS_pept        401578..402327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0383"
FT                   /old_locus_tag="BA0383"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to GP:15024339; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24413"
FT                   /db_xref="GOA:A0A347ZYJ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYJ8"
FT                   /protein_id="AAP24413.1"
FT                   /translation="MRGLQIKDIVKSFDGNNVLANISASIREGEFVSFVGPSGCGKSTL
FT                   LNMIANVENPTSGSVTYNDKHIQEQDVVSYMPQQDLLLPWRSALQNIVLPLEIEGKPKK
FT                   QRLTEGMEALKQFELDEYADHYPDELSGGMRQRISFLRTYLCEKPIMLLDEPFGKLDAF
FT                   TKMEVHSWLLNSWHQEKQTIVMVTHDLDEAILLSDRVFILSQRPASIVGEVQVKLPRPR
FT                   TMDMLTSIELKKDKEEILRVLAPYMKK"
FT   gene            402619..404163
FT                   /locus_tag="BA_0384"
FT                   /old_locus_tag="BA0384"
FT   CDS_pept        402619..404163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0384"
FT                   /old_locus_tag="BA0384"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24414"
FT                   /db_xref="GOA:A0A2P0H998"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H998"
FT                   /protein_id="AAP24414.1"
FT                   /translation="MSILTVENLSHSYGEKTILYNACFRLLKGEHVGVVGGNGIGKSTL
FT                   LRILTGELIHDDGNIEWFPHVKIGFLQQHMDLQEGMTIEGYLQSAFADLYAIECEMLKI
FT                   AEEMNGAGEVEKLLVKYGELQTILESSNFYHIHAEVEEVAIGLGLFEIGLKKDVSKLSG
FT                   GQRTKLLLGKLLLEKADVLLLDEPTNYLDTAHIEWLQSYLRLYEKAYVIISHDELFLNS
FT                   ITNVIFHLEGGKVKRYVGNYEKFVQSYQVQKKQLQSAYVKQQKEISQLETFIQKNKIRK
FT                   AKQAKSREKVLEKMQRIEKIHPVPRSRFDFNVYEEPVSRILQAEKLRIGYSDPLCPELN
FT                   LQVKKGEKIAIIGHNGIGKTTMLKTLLGQIKPLSGSISVGERVNPAYFAQEEFASETTP
FT                   LEKVWAERPDMTKKEVRQALAKCGLKEEHVLKPIRLLSGGEQTKVRLCELIVTRSNVLI
FT                   LDEPTNHLDIETKKSLQEALQQYKGTVLLVSHEPSFYEAWITKVWNIEEWNAEQYE"
FT   gene            complement(404624..406648)
FT                   /locus_tag="BA_0385"
FT                   /old_locus_tag="BA0385"
FT   CDS_pept        complement(404624..406648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0385"
FT                   /old_locus_tag="BA0385"
FT                   /product="chitinase B"
FT                   /note="identified by similarity to SP:P20533; match to
FT                   protein family HMM PF00041; match to protein family HMM
FT                   PF00553; match to protein family HMM PF00704"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24415"
FT                   /db_xref="GOA:A0A3P1TZR1"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TZR1"
FT                   /protein_id="AAP24415.1"
FT                   /translation="MKSKKFTLLLLSLLLFLPLFLTNFITPNVVLADSQKQDQKIVGYF
FT                   PSWGIYGRNYQVADIDASKLTHLNYAFADICWNGKHGNPSTHPDNPNKQTWNCKESGVP
FT                   LQNKEVPNGTLVLGEPWADVTKSYPGSGTTWEDCDKYARCGNFGELKRLKAKYPHLKTI
FT                   ISVGGWTWSNRFSDMAADEKTRKVFADSTVDFLREYGFDGVDLDWEYPGVETIPGGSYR
FT                   PEDKQNFTLLLQDVRNALTKAGAEDGKQYLLTIASGASQRYADHTELKKISQILDWINI
FT                   MTYDFHGGWEATSNHNAALYKDPNDPAADTKFYVDGAIDIYTNEGVPADKLVLGVPFYG
FT                   RGWKSCGKENNGQYQPCKPGSDGKLASKGTWDDYSTGDTGVYDYGDLAANYVNKNGFVR
FT                   GWNDVAKVPYLYNATTGTFISYDDNESMKYKTDYIKTKGLSGAMFWELSGDCRTSPKYS
FT                   CSGPKLLDTLVKELLGGPITQKDIEPPTNVKNIAVTNKNSNSVQLNWTASTDNVGVTEY
FT                   EITAGEEKWSTTTNSIAIKNLKPNTEYTFSILAKDAAGNKSQPTSILVKTDDANTTPPG
FT                   GNSNATFSVTSNWGSGYNFSIVIKNSGTTPIKNWKLEFDYNGNLTQVWDSKISSKINNH
FT                   YVITNAGWNGEIPPGGSITIGGAGTGTPAELVNASISEN"
FT   gene            407020..407391
FT                   /locus_tag="BA_0386"
FT                   /old_locus_tag="BA0386"
FT   CDS_pept        407020..407391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0386"
FT                   /old_locus_tag="BA0386"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01BH0861; match
FT                   to protein family HMM PF09350"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24416"
FT                   /db_xref="InterPro:IPR018961"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RMV4"
FT                   /protein_id="AAP24416.1"
FT                   /translation="MDVFLNIAEEKIRQAIRNGDLDNIPGKGKPLQLEDLSMVPPELRM
FT                   SYKILKNAGMIPPEMELQKDILKIEDLIACCYDEEERKKLQQELTAKTLRFQQVMEKRK
FT                   IKDSSAFRMYQDKVFHKLR"
FT   gene            407402..407716
FT                   /locus_tag="BA_0387"
FT                   /old_locus_tag="BA0387"
FT   CDS_pept        407402..407716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0387"
FT                   /old_locus_tag="BA0387"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:109878"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24417"
FT                   /db_xref="GOA:A0A2P0H9D8"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H9D8"
FT                   /protein_id="AAP24417.1"
FT                   /translation="MKKFETIEELATYIEEQQLVLLFIKTENCGVCDVMLRNVNYVLEN
FT                   YDYVEKIEILLQDMQEVAGRYAVFTGPTILLFHNGKEILRESRFISLENLERTIQLFEE
FT                   "
FT   gene            407730..407981
FT                   /locus_tag="BA_0388"
FT                   /old_locus_tag="BA0388"
FT   CDS_pept        407730..407981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0388"
FT                   /old_locus_tag="BA0388"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24418"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1U0E9"
FT                   /protein_id="AAP24418.1"
FT                   /translation="MEFIIFILLFVVIGIIVTAVRSNKKKVNLMKQNNIHNSSNSSSPL
FT                   FFFAGSDNDSSHGGSHDCGGSFGGDSGGSCDGGGGGGD"
FT   gene            408264..408845
FT                   /locus_tag="BA_0389"
FT                   /old_locus_tag="BA0389"
FT   CDS_pept        408264..408845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0389"
FT                   /old_locus_tag="BA0389"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by similarity to GP:17943283; match to
FT                   protein family HMM PF00440; match to protein family HMM
FT                   PF08360"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24419"
FT                   /db_xref="GOA:A0A3P1U077"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013571"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1U077"
FT                   /protein_id="AAP24419.1"
FT                   /translation="MRRSAEEIKKEIAYKAEILFSQKGYAATSMEEICEITERSKGSIY
FT                   YHFKSKEELFLFVVKQHTYDWLEKWNEKEKLYSTSTEKLYALAEYHVEDIQQPISNAIE
FT                   EFSMSQVVSKEILDEMLALTRESYVMFETLIEAGIQSGEFREDNTRDLMYIVNGLLSGL
FT                   GVLYYELDYKELKRIYKKAIDVLLKGMAAE"
FT   gene            408912..410144
FT                   /locus_tag="BA_0390"
FT                   /old_locus_tag="BA0390"
FT   CDS_pept        408912..410144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0390"
FT                   /old_locus_tag="BA0390"
FT                   /product="MFS transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24420"
FT                   /db_xref="GOA:A0A3P1TYR6"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TYR6"
FT                   /protein_id="AAP24420.1"
FT                   /translation="MNALFKNRAFMLVMASDILQQFAIWIRNMALLYFIMERTNNDPVS
FT                   VSLLSVMEYAPIFIFSFIGGALADRWNPKRTMVAGDVLSVLSIIGIVLLLKLDYWQAIF
FT                   FATLISAIVGQFSQPSSSRIFKRYVKEEQVANAIAFNQTLQSLFMIFGPVVGSLVYTQL
FT                   GLFTSLYSLIILFLLSAIALSFLPKWVEQEQVARDSLKNDIKEGWKYVLHTKNLRMITI
FT                   TFTIMGLAVGLTNPLEVFLVIERLGMEKEAVQYLAAADGIGMLIGGIVAAVFASKVNPK
FT                   KMFVFGMSILAMSFLVEGLSTSFWITSFMRFGTGICLACVNIVVGTLMIQLVPENMVGR
FT                   VNGTILPLFMGAMLIGTALAGGLKEMTSLVIVFCIAMALILLAIGPVLRMQIKKEDVTT
FT                   KEELTNSLASK"
FT   gene            410258..410452
FT                   /locus_tag="BA_0391"
FT                   /old_locus_tag="BA0391"
FT   CDS_pept        410258..410452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0391"
FT                   /old_locus_tag="BA0391"
FT                   /product="DNA-binding protein"
FT                   /note="identified by similarity to OMNI:NTL01LL0334; match
FT                   to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24421"
FT                   /db_xref="GOA:A0A0J1HRB7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1HRB7"
FT                   /protein_id="AAP24421.1"
FT                   /translation="MKNQIYELRTENNISQGALADKCKVSRQTINAIENNKYDPSLALA
FT                   FRLAEVLGTTVDKLFLYKQ"
FT   gene            410465..410857
FT                   /locus_tag="BA_0392"
FT                   /old_locus_tag="BA0392"
FT   CDS_pept        410465..410857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0392"
FT                   /old_locus_tag="BA0392"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24422"
FT                   /db_xref="GOA:A0A3P1TYS7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TYS7"
FT                   /protein_id="AAP24422.1"
FT                   /translation="MGKEKISLFVTILVAIGTLLYALYYWLTELQVNWYALFICSIALH
FT                   YLFKSSASHSVEGETEENQDLEKHVLKTSANVTYYVLVVFIFGLFFASVGFNRWIDFHN
FT                   IPLLFALCAAIVVKPAVEFLIVRRYR"
FT   gene            complement(410884..412167)
FT                   /locus_tag="BA_0393"
FT                   /old_locus_tag="BA0393"
FT   CDS_pept        complement(410884..412167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0393"
FT                   /old_locus_tag="BA0393"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24423"
FT                   /db_xref="GOA:A0A0J1HR69"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1HR69"
FT                   /protein_id="AAP24423.1"
FT                   /translation="MKKMSRQEKSWILYDWANSVYSLVITTALFPIYFKAAAKEAGLSG
FT                   ATSTAYWGYANSFATLLISILAPILGTVADYKGFKKRFFTFFFGLGIVFTSMLAVVPTS
FT                   QWYLLLGCYMLALVGFAGANIFYDAFLVDVTSEDRMDRISTRGFALGYIGSTIPFIGCI
FT                   ALIILAQKGTIPLSVGIASQISFAITALWWGLFTIPMLKNVEQTHYIERHPKPIAMSFK
FT                   RLADTFKNIKEYKTVFMFLIAYFFYIDGVDTIITMSTAYGTDLGISATNLLIILFVTQI
FT                   VACPFALLYGKLSTTFTGKKMLYVGIIIYIIICIYAYFLKTTLDFWILAMLVATSQGGI
FT                   QALSRSYFAKLVPKESANEFFGFYNIFGKFAAIMGPVLVGVTTQLTGKTNAGVLSIIVL
FT                   FIIGGFLLTRVPENNTSVTPPNPKTKTL"
FT   gene            complement(412276..413589)
FT                   /locus_tag="BA_0394"
FT                   /old_locus_tag="BA0394"
FT   CDS_pept        complement(412276..413589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0394"
FT                   /old_locus_tag="BA0394"
FT                   /product="type I phosphodiesterase/nucleotide
FT                   pyrophosphatase family protein"
FT                   /note="identified by match to protein family HMM PF01663"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24424"
FT                   /db_xref="GOA:A0A347ZYK9"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYK9"
FT                   /protein_id="AAP24424.1"
FT                   /translation="MDKALTNRVIILSFDCLSALDFPILQKLPHFQSLIKKGTVVEKVE
FT                   PIYPSVTYPSHSTIVTGNYPNKHGVVSNTLLQPGRESPDWHWYRKSIKGTTLYDEAHKA
FT                   NLTTAALLWPVTGRANIDYNLPEIFPNRPWQNQVLVSLFSGSPLYQLDLNRRFGHIRNG
FT                   LSQPELDDFVLASAVHTIQTKKPNVMFVHFTDLDTQRHYHGFESKETIAAIHRHDERLG
FT                   QIIQALKDSDLYEESTIIALGDHSALSENKAIQLNVLFHQKGLISVNSKGNLVDWKVYC
FT                   QSCDGSAYVYVKDKNDTDTIREVQLLLEELLQHKQNGIEFILHDEDAKECGADGNCLFM
FT                   LEAREGYYFTENYTGDFIKEITEKDVTPSKKYTFGTHGYSPTKPNYETIFIAAGKGIKS
FT                   GVTIPYMRLIDESPTIARLLGLHLGETDGSIVEDLLQL"
FT   gene            413725..414036
FT                   /locus_tag="BA_0395"
FT                   /old_locus_tag="BA0395"
FT   CDS_pept        413725..414036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0395"
FT                   /old_locus_tag="BA0395"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24425"
FT                   /db_xref="GOA:A0A3Q0PR83"
FT                   /db_xref="InterPro:IPR025434"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0PR83"
FT                   /protein_id="AAP24425.1"
FT                   /translation="MEGGNSMDWLDGFGIFYIIGGITIILVFAISYLLKKRFPDKQFDI
FT                   IFALSLILLCLASFPVTMMVIGGWEGMGYGFIGFFVLLGTLIGMIAHQLVKISRKSYV"
FT   gene            414384..415910
FT                   /gene="proS1"
FT                   /locus_tag="BA_0396"
FT                   /old_locus_tag="BA0396"
FT   CDS_pept        414384..415910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS1"
FT                   /locus_tag="BA_0396"
FT                   /old_locus_tag="BA0396"
FT                   /product="proline--tRNA ligase"
FT                   /EC_number="6.1.1.15"
FT                   /note="identified by similarity to SP:Q9L4Q8; match to
FT                   protein family HMM PF00587; match to protein family HMM
FT                   PF03129; match to protein family HMM PF09180; match to
FT                   protein family HMM TIGR00408"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24426"
FT                   /db_xref="GOA:Q81Z76"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81Z76"
FT                   /protein_id="AAP24426.1"
FT                   /translation="MAKEQVQAITKMEEDFAQWYTDIVKKAELVDYSSVKGCMILRPYG
FT                   YALWENMQKVMDEKLKATGHENVYMPMFIPESLLQKEKDHVEGFAPEVAWVTHGGDEKL
FT                   AERLCVRPTSETLFCEHFSKIVQSYNDLPKLYNQWCSVVRWEKTTRPFLRTTEFLWQEG
FT                   HTIHETAEESQAETLNILNLYASFCEDYLAIPVIKGQKTEKEKFAGAKATYTIESLMHD
FT                   GKALQTGTSHNFGTNFSEAFDIKFLDRNGKWQYVHQTSWGVSTRMIGGLIMVHSDNNGL
FT                   VMPPKVAPVQVVIVPIAQHKEGVLAKATELQGHIQKVARVKIDASNKTPGWKFNEYEMK
FT                   GIPIRLEVGPKDIEKNQVVLVRRDTKEKEFISMDQLEERIPALLEEIHNSLFNKAKVFR
FT                   DENTYSVTNFEEMKKLADEKQGFIKAMWCGELACEEKLKEEVASRCMPFEQEHLAEECV
FT                   CCVNKWCIGEKRINALLDRKDEKDFGLHNKCNPKSFLVLQFVSCIFKMEG"
FT   gene            complement(415915..416688)
FT                   /locus_tag="BA_0397"
FT                   /old_locus_tag="BA0397"
FT   CDS_pept        complement(415915..416688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0397"
FT                   /old_locus_tag="BA0397"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="identified by match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24427"
FT                   /db_xref="GOA:A0A0F7RMI6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RMI6"
FT                   /protein_id="AAP24427.1"
FT                   /translation="MTKIFILASTLSLSFFSGLNIGNAATENFSPITNAIVQNNDYFVE
FT                   GNSKDNNKPPGNGGSQDDSGSDGNGSDGSGSGDNGSGDNGSGGNGSGGNGSGENGSGGN
FT                   GSGSSGSGDNGSGGNGSGGNGSGSSGSGENGSGGNGSGSSGSGENGSGGNGSGSSGSGE
FT                   NGSGGNGSGGNGSGGNSSGGSGSGGSGSQGGNRVKGDSSSQGGNGSQGGNVKDNAKKQG
FT                   DKLPNTATHYPASILMGLSTFLIGMLLFIRRKNAK"
FT   gene            416891..417769
FT                   /locus_tag="BA_0398"
FT                   /old_locus_tag="BA0398"
FT   CDS_pept        416891..417769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0398"
FT                   /old_locus_tag="BA0398"
FT                   /product="ROK family protein"
FT                   /note="identified by similarity to OMNI:SP1675; match to
FT                   protein family HMM PF00480"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24428"
FT                   /db_xref="GOA:A0A384K909"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384K909"
FT                   /protein_id="AAP24428.1"
FT                   /translation="MKEYIAFDIGGTQIKYGIVSETGIVLKHKTVPTEIHLGGEQIIQK
FT                   LILLSKKLMSEHTISGIGISTAGIVDVNRGVVTGGADHIPGYSTIPIINRLQEVLKVPV
FT                   SIENDVNCAALGEKWNGIGREKENFIMLTLGTGIGGAIFIDRELYRGHSYSAGEWGNML
FT                   IEGKTFEEVASISGLIHLVRNYKGKGNWNGKTIFELYDKGDREVTQAVEVFFKHLAIGI
FT                   SNLAYIFNPETIIIGGGITDRGNQFLKEVKEEVGRYLNKEIYSDCEIELAQNGNRAGMI
FT                   GAIYHFLHHHK"
FT   gene            417898..418494
FT                   /locus_tag="BA_0399"
FT                   /old_locus_tag="BA0399"
FT   CDS_pept        417898..418494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0399"
FT                   /old_locus_tag="BA0399"
FT                   /product="putative tellurium resistance protein"
FT                   /note="identified by match to protein family HMM PF02342"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24429"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2B6CCP7"
FT                   /protein_id="AAP24429.1"
FT                   /translation="MPIILEKGQKIDLTKGQPKVAKLQVGLGWDPIGQSGGFLSSLFGS
FT                   KPNVDCDASVVMLEGDRFLNKNDLVYFGNKLSTCGSIIHSGDNLTGEGAGDDETIFVEL
FT                   HKVPSRINRLVFVVNIYDCVNRRQDFGMIRNAYIRIQNPQTGEELARYNLSDNYAGKTT
FT                   LIAGEMYRHGSEWKFSAVGEGTQDKNLSEIVSRYQ"
FT   gene            418518..419102
FT                   /locus_tag="BA_0400"
FT                   /old_locus_tag="BA0400"
FT   CDS_pept        418518..419102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0400"
FT                   /old_locus_tag="BA0400"
FT                   /product="tellurium resistance protein"
FT                   /note="identified by similarity to EGAD:10152; match to
FT                   protein family HMM PF02342"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24430"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1HMQ0"
FT                   /protein_id="AAP24430.1"
FT                   /translation="MASISLKKGQKVDLTKTNPGLSKVLVGLGWDTNRYDGQNDFDLDV
FT                   SIFLVGANGKVSGAEDFVFYNNPKGANGAVEHLGDNRTGEGEGDDESIKVDLKNVPAHI
FT                   ERICFTITIYDGEGRSQNFGQVSNSFVRILDEEKNAELIRYDLGEDFSIETAVVVGELY
FT                   RHAGEWKFNAIGSGFQGGLASLCNNFGLDVE"
FT   gene            419183..419767
FT                   /locus_tag="BA_0401"
FT                   /old_locus_tag="BA0401"
FT   CDS_pept        419183..419767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0401"
FT                   /old_locus_tag="BA0401"
FT                   /product="tellurium resistance protein"
FT                   /note="identified by similarity to EGAD:10152; match to
FT                   protein family HMM PF02342"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24431"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYL6"
FT                   /protein_id="AAP24431.1"
FT                   /translation="MVIQLQKGQKIDLGKTSPGLTKAVIGLGWDIKSYDGGSDFDLDAS
FT                   AFLLDANGKCTKETDFIFYNNLQSPCGSVLHTGDNRTGEGEGEGDDEQLVVDLKKVPAD
FT                   VHRIAITVTIYDAEGRSQNFGQVGNAFVRLANEETNEEVLRFDLGEDFSIETAVVFCEL
FT                   YRHNGQWKFNAVGSGFQGGLGALVRAYGLDA"
FT   gene            419841..420632
FT                   /locus_tag="BA_0402"
FT                   /old_locus_tag="BA0402"
FT   CDS_pept        419841..420632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0402"
FT                   /old_locus_tag="BA0402"
FT                   /product="putative tellurium resistance protein"
FT                   /note="identified by similarity to SP:O34447; match to
FT                   protein family HMM PF03741"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24432"
FT                   /db_xref="GOA:A0A2B6CC05"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022493"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2B6CC05"
FT                   /protein_id="AAP24432.1"
FT                   /translation="MSILQGILDTYAQFFDLDMWIKVLQDPVSWGLIGTLVVLEGLLSA
FT                   DNALVLAVMVKHLPEEKRKKALFYGLIGAYVFRFIAIGIGMFLIKLAWVKVLGALYLAW
FT                   LSVKYFIDKRKGNAEEEEAHGMNQNSILFRMFGVFWGTVAMVELMDIAFSVDSVLAAFG
FT                   VSNEVWILLLGGMLGILMMRGIAGVFLKLLERIPELETTAYILILIIAAKMLLSVIHIE
FT                   VSHTLFFIILVVAFGATFILHYVKNSGQAKEEVAATKNNHK"
FT   gene            420742..422373
FT                   /locus_tag="BA_0403"
FT                   /old_locus_tag="BA0403"
FT   CDS_pept        420742..422373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0403"
FT                   /old_locus_tag="BA0403"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:108707"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24433"
FT                   /db_xref="InterPro:IPR025647"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYL8"
FT                   /protein_id="AAP24433.1"
FT                   /translation="MFSRFTLQPYALKDESDLKHFETLLEKRPQYELTENEMKFSYIAC
FT                   RILGVPNDVDEYFNELFDYSEAKGIEVLHEQNLNKVIDSEKLRHIQEVFGLHQEAPNGL
FT                   TVNRLVAHLSGKQLLPKVDNPDLQHYIHTTFISVLKLYEKQHNQSLKTEGFRRFLIDMI
FT                   KLSENYVAKWFSTINYKKQMPRIIWYGDAQESRIYFLYFLIMLGCDVLYYHPEGKDGFE
FT                   NIDEEARTFVVSHSSRISLEPFPDRRRERVATVAYQASKEIEQVLHHDNSLLYKPWQFR
FT                   SYTPVARTLKTTYDELFLITKEKAFVRPTFFVENKHIYIPSLFAKISGVSKNDKEYFQR
FT                   LKAVTSFDNSLLINTFPFTKEQKANFQYHYRDALDRGGKLHPDLIMNSHWWPHKRLPEG
FT                   LQHGIAEAIIHTCESEMCKPIAKETKQDVALYVFAQLSQIPPNILEQLEKFDYSQDVPK
FT                   IVIFNNEKSGELTRSDAVLLLFLNQIGVDVFHFNPTGRNDIEPYIEAGAFDSHWLEEVN
FT                   FDFEFHGSSAYKNLSQTIKGLFRPFL"
FT   gene            422392..423474
FT                   /locus_tag="BA_0404"
FT                   /old_locus_tag="BA0404"
FT   CDS_pept        422392..423474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0404"
FT                   /old_locus_tag="BA0404"
FT                   /product="putative tellurite resistance protein"
FT                   /note="identified by similarity to EGAD:143199; match to
FT                   protein family HMM PF05816"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24434"
FT                   /db_xref="InterPro:IPR008863"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1U0P1"
FT                   /protein_id="AAP24434.1"
FT                   /translation="MNNPVVLDSKTELNEQTAQDVRLQLRQDADVQRIYNAVDIKDQLE
FT                   LIELGKEPSMEISRFADQILHTMSLSKIEDSGELLKQLGKIMDRFDSKDFAEEKSGFFS
FT                   RMFKKADKMIEQIFSKYQTMGREIDKVYVEITKYQDEMKKSIGTLDGLYEQNLKYYLDL
FT                   EKYVVAGEMLLERLNTELVPMYEERVRNNDQLAGIELESLKNSVEILEQRIDDLEKARM
FT                   VALLTAPQIRMIQRGNNKLIGKINTAFITTIPIFKNGIIQAVNAKRQKLVADSMAELDR
FT                   RTNELLKKNAQNIATQSVEVARLSGSSSIKMETLEETWNIISRGMQETQQIEEQNKRER
FT                   EESRKRMATLTENIKKELQG"
FT   gene            complement(423510..426176)
FT                   /locus_tag="BA_0405"
FT                   /old_locus_tag="BA0405"
FT   CDS_pept        complement(423510..426176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0405"
FT                   /old_locus_tag="BA0405"
FT                   /product="cation-transporting ATPase, E1-E2 family"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00689; match to protein
FT                   family HMM PF00690; match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01494"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24435"
FT                   /db_xref="GOA:A0A3P1TY20"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TY20"
FT                   /protein_id="AAP24435.1"
FT                   /translation="MSNWYSKTKDQTLIDLETNEQHGLTEEIVNERLTQYGANELATKQ
FT                   KRSLWQRIFAQINDVLVYVLIIAALISAFVGEWADASIIALVVVLNAVIGVVQESKAEQ
FT                   ALEALKKMATPKAIVKRDGELKEIPSEHVVPGDIVMLDAGRYIPCDLRLIETANLKVEE
FT                   SALTGESVPVDKDAIYHPSMQSDEQVPLGDQKNMAFMSTLVTYGRGVGVAVETGMNSQI
FT                   GKIATLLHEADDDMTPLQKSLAQVGKYLGFVAVAICIVMFLIGFLQGRDTLEMFMTAIS
FT                   LAVAAIPEGLPAIVSIVLAIGVQRMIKQNVIIRKLPAVEALGSVTIICSDKTGTLTQNK
FT                   MTVTHFYSDNTYDQLERLNVNNDTQRLLLENMVLCNDASYNNESQTGDPTEIALLVAGS
FT                   TFNMQKDHLEKIHERVNELPFDSDRKMMSTVHTYDESYYSMTKGAIDKLLPLCTHIFKN
FT                   GKIEGLTEDDKNQILEAAEVMSQEALRVLSFAFKQYNSSDVDIDHLEENLIFIGLVGMI
FT                   DPPRTEVKDSISECKKAGIRTVMITGDHKDTAFAIAKELGIAEEISEIMIGTELDNISD
FT                   TELANKINHLHVFARVSPEHKVKIVKALRAKGNIVSMTGDGVNDAPSLKQADVGVAMGI
FT                   TGTDVAKGAADVVLTDDNFSSIVKAVEEGRNIYRNIKKSILFLLSCNFGEIIALFLAIL
FT                   LGWATPLRPIHILWVNLITDTLPALSLGVDPEDPDVMKEKPRHAKESLFSGSVPFLIFN
FT                   GFVIGLLTLIAFIAGAKFYTGDTNLFPLFPERIDEDALLHAQTMAFVVLSFSQLVHSFN
FT                   LRSRTKSIFSIGIFTNKYLVFSLLIGVLMQVCIISIPPLANIFGVHALTMRDWGFVLLL
FT                   SIIPLVVNEFIKLVKRN"
FT   gene            complement(426368..426592)
FT                   /locus_tag="BA_0406"
FT                   /old_locus_tag="BA0406"
FT   CDS_pept        complement(426368..426592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0406"
FT                   /old_locus_tag="BA0406"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01BH2491; match
FT                   to protein family HMM PF06569"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24436"
FT                   /db_xref="GOA:Q81Z66"
FT                   /db_xref="InterPro:IPR009507"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81Z66"
FT                   /protein_id="AAP24436.1"
FT                   /translation="MDLSVKSEENVEYMVEAIKEKLRMVNAGAMRAASFNEEMYEDLRD
FT                   IYEHVMKRETFSISEMQAITEELGTLIKK"
FT   gene            426767..427231
FT                   /locus_tag="BA_0407"
FT                   /old_locus_tag="BA0407"
FT   CDS_pept        426767..427231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0407"
FT                   /old_locus_tag="BA0407"
FT                   /product="low molecular weight phosphotyrosine protein
FT                   phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF01451"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24437"
FT                   /db_xref="GOA:A0A347ZYM2"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYM2"
FT                   /protein_id="AAP24437.1"
FT                   /translation="MVQVLFVCLGNICRSPMAEAIFRDLVVKEGLEEKIVIDSAGTGDW
FT                   HVGHPPHKGTQKILKENAVTFEGIKARQVEKEDLTKFDYIIAMDNKNIADLKSLGKTGG
FT                   YIGRLSDFVPDGGWTDVPDPYYTGNFQEVYDLVTEGCAKLLAFIRNEQGI"
FT   gene            427285..427767
FT                   /locus_tag="BA_0408"
FT                   /old_locus_tag="BA0408"
FT   CDS_pept        427285..427767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0408"
FT                   /old_locus_tag="BA0408"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:107999"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24438"
FT                   /db_xref="InterPro:IPR025276"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RNN6"
FT                   /protein_id="AAP24438.1"
FT                   /translation="MAKKNNIARNIAIGVAAGVAVSMLKKENREKVKNTAEKAKTKMIE
FT                   IGENAKIKEKVQTVTDKGRELADLNVVKAKVAEIKKLTPSVVETLKETKEIFSKKKVEP
FT                   AEKPETIEIQAVSPKVDELKVEEEPVVAEDGGMKESRELFMKDSNVEEKKLKRTLS"
FT   gene            427806..428675
FT                   /locus_tag="BA_0409"
FT                   /old_locus_tag="BA0409"
FT   CDS_pept        427806..428675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0409"
FT                   /old_locus_tag="BA0409"
FT                   /product="YihY family protein"
FT                   /note="identified by match to protein family HMM PF03631;
FT                   match to protein family HMM TIGR00765"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24439"
FT                   /db_xref="GOA:A0A3P1TXY5"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TXY5"
FT                   /protein_id="AAP24439.1"
FT                   /translation="MRKILEKVRRNRTYSFGKDLYDRTMRDDVAGLAAQLAYFFLLAIF
FT                   PGLVFLITLLGFIDLQTESVLNLLEPYVPEDAMSLIEVNVDKVVNEQNGGLLSFGLLSM
FT                   LWFASNGVNAVMNAFNRAYDVTETRSFIKTRALSIVFTLAIIFMIVFALIVPVFGQVIG
FT                   AAVFKAIGLSDSFSYVWSITRLVASFFVLFALFSFLYTFAPDRKLKRREVISGATFATV
FT                   GWIVVSYSFAYYVDKFANYANTYGGLGGIIILMLWFYLTGWVILLGGEINGLLHHYRTG
FT                   DNNSRNEK"
FT   gene            complement(428860..430785)
FT                   /locus_tag="BA_0410"
FT                   /old_locus_tag="BA0410"
FT   CDS_pept        complement(428860..430785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0410"
FT                   /old_locus_tag="BA0410"
FT                   /product="heavy metal-transporting ATPase"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00702; match to protein
FT                   family HMM TIGR01494; match to protein family HMM
FT                   TIGR01512; match to protein family HMM TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24440"
FT                   /db_xref="GOA:A0A2P0H9F0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H9F0"
FT                   /protein_id="AAP24440.1"
FT                   /translation="MNSEVKTLQVQKSISHPSLWDTLKKHYELIFAITSGIFILAGWLF
FT                   TKNDVMNVGITCYILAYIVGGYAKAKEGIEDTIEEKELNVEMLMLIAAIGAAMIGYWAE
FT                   GAILIFIFALSGAMESYTLSKSQKEISALLDLQPEEALRISNGTEERVPVGRLQINDII
FT                   LIKPGERVPADGTIHSGETNIDEAAITGEPIPNEKKHGDEVFAGTVNLRGAIEVKITKP
FT                   SDQTLFQKIIRLVQSAQSEKSPSQLFIEKFEGTYVKGVLLVVTLMMFVPHFLLDWSWNE
FT                   TFYRAMILLVVASPCALVAAITPATLSAISNGARNGILFKGGIHLERLASVKAIAFDKT
FT                   GTLTEGKPTVTDVYVRENMTEKEVLSITAAIESHSTHPLAESIVKYAQHTYDITLKKPE
FT                   NVEDVTGFGLKGIFESKAYKIGKADFIGEETKTFHNGVSASLEKEGKTVVYISDEEGIL
FT                   GLIALKDTLRQETIAAIRELQSIGVEAIMITGDNEETAKAIASESNIKEYYASCLPETK
FT                   VETIKKLKEKYGTVAMVGDGINDAPALATASIGVAMGEGTDVALETADVVLMKNELSRL
FT                   SQAIRLSKRMNRIVKQNVIFSLAVIAMLICSNFLQFLALPFGVIGHEGSTILVILNGLR
FT                   LLKGNN"
FT   gene            431056..432006
FT                   /locus_tag="BA_0411"
FT                   /old_locus_tag="BA0411"
FT   CDS_pept        431056..432006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0411"
FT                   /old_locus_tag="BA0411"
FT                   /product="transporter, EamA family"
FT                   /note="identified by similarity to SP:O32256; match to
FT                   protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24441"
FT                   /db_xref="GOA:A0A347ZYM7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYM7"
FT                   /protein_id="AAP24441.1"
FT                   /translation="MKTEKFFTHPIGVFIAAIVATFLWGSAFPFIKLSYAELGIQPKEV
FT                   GEQILFAGYRFFLSGVMLLFFFKLLGKDMNFKKGTGKQLVQIGLFQTFLQYICFYIGMS
FT                   YSSGIEGAIISGTSSFFQIILAHFLYKDDALNMRKIIGVSIGFCGVVLVNVPSDGSLSF
FT                   HFGIGSLLLLSAAMLYSYGNILAKEGSKTLDVGYMTAYQMIFGSIGLLCIGALQVGIMP
FT                   FTFSVHAILMLIYLSFLSAAGFCIWNTIMKYNKVGKVSMYMFFIPVFGVLLSSMILGEA
FT                   IHSFVLFGLACVAAGIIVVNRTPAKQKIEQEKQVA"
FT   gene            432129..432809
FT                   /locus_tag="BA_0412"
FT                   /old_locus_tag="BA0412"
FT   CDS_pept        432129..432809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0412"
FT                   /old_locus_tag="BA0412"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:7301806; match to
FT                   protein family HMM PF07947"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24442"
FT                   /db_xref="GOA:A0A2P0H9H1"
FT                   /db_xref="InterPro:IPR012506"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H9H1"
FT                   /protein_id="AAP24442.1"
FT                   /translation="MNLLYMVLIGQIILFLIGAIYAIGQTKKTTNNIPLPLAVRLILSF
FT                   SLTASAIWIWLQDPSVEYSTWVALGMTLSTVGDLFMAGLIPIGHRLIGGMITFALAHCF
FT                   YVKAFLQTGISWNGFWIGLLVYGLFLIIGWFFFIRNEKQDKLFTIGALIYGLWVGGMAC
FT                   FAFALYYENTGIWWIPAFGGLLFVISDFIIGVTDIGGRKLKYEPLWIWFTYVAAQMCIV
FT                   YVGL"
FT   gene            433039..433574
FT                   /pseudo
FT                   /gene="sipS1"
FT                   /locus_tag="BA_0413"
FT                   /old_locus_tag="BA0413"
FT                   /note="signal peptidase I S, authentic frameshift; an
FT                   automated process has identified a potential problem with
FT                   this gene model; it may contain one or more premature stops
FT                   and/or frameshifts"
FT   gene            complement(433618..436380)
FT                   /locus_tag="BA_0414"
FT                   /old_locus_tag="BA0414"
FT   CDS_pept        complement(433618..436380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0414"
FT                   /old_locus_tag="BA0414"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24443"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TZH0"
FT                   /protein_id="AAP24443.1"
FT                   /translation="MTIENQFIQKVYYKTFLTEETSTPVSDVLGEAYINESTNEFSNIS
FT                   NIRFAQGELYYQNKDFEAAIFKWEKVNNELALWATKNIADAYFELGFLPKAEEMYQSIQ
FT                   TEDTTLTMEVSLQLLSLYIEQDRLGLAFKTISEAVAFQPDYPNITSIARSFYEKQEDWN
FT                   NAIELAVQEGIRTKSLHWFDTLINYVNQGFTKQIKPEYFYESLKALYAIDQVQFKELVI
FT                   TLWNSYQNEKLHLPWIETINHLFLHIETDNNDDWHEIVERYQDTYFELITGEHFMHEMQ
FT                   GLVPDLLTNWFSLTRAKDALFVSAAVLAWNEVSPTTLESLLVKSAGALLSNSTAETNVN
FT                   METVSHLFETIAVWAEKNDVDLSHQFTLLVHELCDLNVTQLLIAGTSDHDKLSFVNSIL
FT                   GENILTETITTPILFKDDSQTEITEFTALDVHNIPNFDEFHQIMATSDQSELENKCIEI
FT                   KLPSRFLRKNKFAFLVTPSVQGQVDKNSSYFEYLQAADSLIYVLNSASPLHGKELDTLL
FT                   YLREQVPNLQIHFVLHTNSADKNEKLMSKIKVHFPNAQFFPYSPSQESSQQLGDVTESI
FT                   LSNLATRDIEQERIEKLIWFTQKTIAYLVNERVELENTLVKSVRWNKHISVKLNGFINN
FT                   LTALEKDKIRSITESYLLTKEEITRDIHSQIPELLQSCSDLVQEDSDFKLVHEELNTAM
FT                   NERIQKHVQQVLLPKFTGFIQEWIETAHNEFIQAQSYLDEMSETFNKLYKEERMKLPCD
FT                   FKLLDDWHRDVVRMTNRITVSNINILLRFTPTQFFLKSAGKLFGNMQKNQSMLANKYKQ
FT                   YIETEDYTEIAQTISKQFFLQFEVFEGALERDIMMFFKDPLSILKQNVEAAQLEIQEDE
FT                   QTLATLRSNPETYHDPLAFFKLQLLQHKFILSTHKNNEDIYEFNESPTI"
FT   gene            436855..437445
FT                   /locus_tag="BA_0415"
FT                   /old_locus_tag="BA0415"
FT   CDS_pept        436855..437445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0415"
FT                   /old_locus_tag="BA0415"
FT                   /product="dedA family protein"
FT                   /note="identified by match to protein family HMM PF09335"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24444"
FT                   /db_xref="GOA:A0A3P1TXY1"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TXY1"
FT                   /protein_id="AAP24444.1"
FT                   /translation="MEQHIGELIAHYGYFGIIIALAGGIVGLPIPDEFLLTFVGYNVSK
FT                   GVMSGTAAFLSGMAGAMLGITLSYILGLKLGLPVLKKYGPKIRIKEHHIEKTHILFEKY
FT                   GPFLLMIGYFIPGVRHLTAYFAGMSNLTIWRFCLYAYGGALIWISVFIGLGWKLGEKWR
FT                   FVEYSLHHYGIWILSISVVVTCVVWFYIKKNRE"
FT   gene            complement(437454..437882)
FT                   /locus_tag="BA_0416"
FT                   /old_locus_tag="BA0416"
FT   CDS_pept        complement(437454..437882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0416"
FT                   /old_locus_tag="BA0416"
FT                   /product="transporter, EamA family"
FT                   /note="identified by similarity to SP:P29939; match to
FT                   protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24445"
FT                   /db_xref="GOA:A0A2B6CCR7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2B6CCR7"
FT                   /protein_id="AAP24445.1"
FT                   /translation="MSSWLLFALLSAIAAALVSIFGKIGLDGIDANVATTVRSIIMALF
FT                   MVGVIIIQGKFQNIGDVLLNKKALLFITLSGVAGASSWLFYFLALKTGKVSQVAPVDKL
FT                   SVVFSIILAMIILGEKLNFMTGIGVVFITAGVLFIAFS"
FT   gene            complement(437989..438138)
FT                   /locus_tag="BA_0417"
FT                   /old_locus_tag="BA0417"
FT   CDS_pept        complement(437989..438138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0417"
FT                   /old_locus_tag="BA0417"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01BH0510"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24446"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0PPT6"
FT                   /protein_id="AAP24446.1"
FT                   /translation="MMKREERKNMIEFIEKKKGIERDELLFMTDDEVEHIYNVTYFLYE
FT                   EIAE"
FT   gene            complement(438289..438705)
FT                   /locus_tag="BA_0418"
FT                   /old_locus_tag="BA0418"
FT   CDS_pept        complement(438289..438705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0418"
FT                   /old_locus_tag="BA0418"
FT                   /product="general stress protein 26"
FT                   /note="identified by similarity to EGAD:107318; match to
FT                   protein family HMM PF01243"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24447"
FT                   /db_xref="GOA:A0A2P0H9H6"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR038725"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H9H6"
FT                   /protein_id="AAP24447.1"
FT                   /translation="MHLKEKITTIIQGQRTGVLSTVRNDKPHSAFMMFFHEDFVLYVAT
FT                   DRQSKKITDIENNPNVHVLLGREGKKLDEDYIEVEGLASIEEDSTLKNKFWNNSLKRWL
FT                   LRPEDPNYVLIKINPDTIYYIDGAGTTEPEFLRL"
FT   gene            438876..439940
FT                   /gene="cax"
FT                   /locus_tag="BA_0419"
FT                   /old_locus_tag="BA0419"
FT   CDS_pept        438876..439940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cax"
FT                   /locus_tag="BA_0419"
FT                   /old_locus_tag="BA0419"
FT                   /product="calcium/proton exchanger"
FT                   /note="identified by match to protein family HMM PF01699;
FT                   match to protein family HMM TIGR00378; match to protein
FT                   family HMM TIGR00846"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24448"
FT                   /db_xref="GOA:A0A3Q0PQP9"
FT                   /db_xref="InterPro:IPR004713"
FT                   /db_xref="InterPro:IPR004798"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0PQP9"
FT                   /protein_id="AAP24448.1"
FT                   /translation="MESMFNKIFLIVALIGVPLSVLGKTLHWPQTIMFAVYCITIIALA
FT                   GFMGRATESLAIVSGPRIGGLLNATFGNAVELIISIFALQAGLIEVVLASLTGSVLGNL
FT                   LLVGGLSFFIGGLKYKRQSFNVYDARHNSALLIFAVVVAFVIPEIFSMKMDAGKTYQLS
FT                   IGVSIIMIIMYLAALLFKLVTHRGVYQHKSDEVAHEEEPEWSKGKALLILAIATIAVAY
FT                   VSEALVHTFETVAKSFGWSELFIGVIIVAIVGNAAEHASAIIMAYKNKVNIAVEIAVGS
FT                   TLQIAMFVAPVLVLLSMFFAQRMPLVFTIPELVSMITAVFLTIAISNDGDTNWFEGGTL
FT                   LAAYVIMGIGFYLL"
FT   gene            440022..440819
FT                   /locus_tag="BA_0420"
FT                   /old_locus_tag="BA0420"
FT   CDS_pept        440022..440819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0420"
FT                   /old_locus_tag="BA0420"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24449"
FT                   /db_xref="InterPro:IPR025548"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2B6CCR9"
FT                   /protein_id="AAP24449.1"
FT                   /translation="MKRVYSICLSTMVSFILLFPNMSFAKTTVETKMPSSVLNISKDNT
FT                   FPNDAQDLPRLQPSKFAQELLKTANIKIENPDLIRMFNETTISNAPLAVGYRAKIYLGQ
FT                   WALHYESIDTSINWEYKQVNRNVYDNRGGDRLYPLRYKQETQKTVEGDLTADMKDATDV
FT                   KKMMLLKALEKVQLPLSFKTTIGYGTGHERVYNISPSQLGYLYAYTPAVNEKGKVTFGE
FT                   VYLVLKGNQKRLVVKNITSQGIGAAIPIHDHLYFKFISSSHSQ"
FT   gene            complement(440854..441981)
FT                   /locus_tag="BA_0421"
FT                   /old_locus_tag="BA0421"
FT   CDS_pept        complement(440854..441981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0421"
FT                   /old_locus_tag="BA0421"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:10173504; match to
FT                   protein family HMM PF04055; match to protein family HMM
FT                   PF08756"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24450"
FT                   /db_xref="GOA:A0A384LDL7"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014866"
FT                   /db_xref="InterPro:IPR031004"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LDL7"
FT                   /protein_id="AAP24450.1"
FT                   /translation="MTISQKMKPITPSYDPWEAYMDLEEYGKLLLTNVEFTTTTLCNMR
FT                   CEHCAVGYTLQPKDPNPLPMDLLLKRLDEIPHLRSLSITGGEPMLSKKSVDNYVTPLLK
FT                   YAHERGVPTQINSNLTIDLARYEQIIPYLDVLHISHNWGTIDDFVEGGFAMMERKPTYE
FT                   QRAKLFERMITNSKALSDAGVLVSAETMLNKRTLPHIEHIHRQIVDEMGCKRHEVHPMY
FT                   PSDFASNLEILTKAEIRDAIEHLLEIRDENVWMLFGTLPFYACSDDERDIATFRKLQES
FT                   KNVTVRNDPDGRSRLNVNIFDGNIIVTDFGDVPLLGNIQTNTLQEAYEKWSASKTAKSL
FT                   SCHCPTVKCLGPNVLVKNSYYPTEDFLSKTANITL"
FT   gene            442195..442377
FT                   /locus_tag="BA_0422"
FT                   /old_locus_tag="BA0422"
FT   CDS_pept        442195..442377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0422"
FT                   /old_locus_tag="BA0422"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:108017"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24451"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A8KYB9"
FT                   /protein_id="AAP24451.1"
FT                   /translation="MGKAIQDKDTQLVYLKERLNMFIEVIDTIEPEEVELEDVDRLLAM
FT                   LDELELKCEQFKKDE"
FT   gene            442584..444104
FT                   /gene="fumA"
FT                   /locus_tag="BA_0423"
FT                   /old_locus_tag="BA0423"
FT   CDS_pept        442584..444104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fumA"
FT                   /locus_tag="BA_0423"
FT                   /old_locus_tag="BA0423"
FT                   /product="fumarate hydratase, class I"
FT                   /EC_number="4.2.1.2"
FT                   /note="identified by similarity to SP:Q04718; match to
FT                   protein family HMM PF05681; match to protein family HMM
FT                   PF05683; match to protein family HMM TIGR00722; match to
FT                   protein family HMM TIGR00723"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24452"
FT                   /db_xref="GOA:A0A3Q0PRH4"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR011167"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0PRH4"
FT                   /protein_id="AAP24452.1"
FT                   /translation="MEKLQESMYQLIVETSTNLPKDVRRAIQQAKERENAGTRSAMALG
FT                   TITNNIKMADDNISPICQDTGMPTFKIYTPVGVNQLKLKEAIYHALERATKDGKLRPNS
FT                   VDSLFGDNSGNNLGPGTPVIKFEQWEKDYIDARLILKGGGCENKNIQYSLPCELEGLGR
FT                   AGRDLEGIRKCLLHAVYQAQGQGCSAGVIGVGIGGDRTSGYELAKNQLFRTLDDVNPIP
FT                   ELQQLEEYVLENANKLGIGTMGFGGETTLLGCKIGVYNRLPASFYVSVAYNCWAYRRLG
FT                   VTIHPETGEIMDWLYQEGDDTLQQEAQEKTEQREIVLQAPITEEQIRKLRVGDVVTING
FT                   MMYTGRDAIHKHLMDNDCPVDLNGQVIYHCGPVVVKDENDNWQIKAAGPTTSIREEPYQ
FT                   GDIMKKFGIRAVIGKGGMGAKTLAALEEHGGVYLNAIGGAAQYYAECIKEVKDVDFLQF
FT                   GIPEAMWHLRIEGFKAVVTMDSHGNSLHADVDKTSLEKLASFKEPVFK"
FT   gene            444231..445013
FT                   /gene="pdaA"
FT                   /locus_tag="BA_0424"
FT                   /old_locus_tag="BA0424"
FT   CDS_pept        444231..445013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdaA"
FT                   /locus_tag="BA_0424"
FT                   /old_locus_tag="BA0424"
FT                   /product="delta-lactam-biosynthetic de-N-acetylase"
FT                   /EC_number="3.5.-.-"
FT                   /note="identified by match to protein family HMM PF01522;
FT                   match to protein family HMM TIGR02884"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24453"
FT                   /db_xref="GOA:A0A347ZYP1"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR014235"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYP1"
FT                   /protein_id="AAP24453.1"
FT                   /translation="MKHKWLYIGLIFSIMMALVPVSALAYTNTPHNWGIPRPKNETVPD
FT                   AGKLYTDLLQKNGGFYLGDTKKKDIYLTFDNGYENGYTGKILDVLKEKKVPATFFVTGH
FT                   YIKTQKDLLLRMKDEGHIIGNHSWSHPDFTAVNDEKLREELTSVTEEIKKVTGQKEVKY
FT                   VRPPRGVFSERTLALTKEMGYYNVFWSLAFLDWKVDEQRGWQYAHNNVMTMIHPGSILL
FT                   LHAISKDNAEALAKIIDDLREKGYHFKSLDDLVKSNQP"
FT   gene            445061..445936
FT                   /pseudo
FT                   /locus_tag="BA_0425"
FT                   /old_locus_tag="BA0425"
FT                   /note="endonuclease III domain protein, authentic point
FT                   mutation; an automated process has identified a potential
FT                   problem with this gene model; it may contain one or more
FT                   premature stops and/or frameshifts"
FT   gene            445947..447326
FT                   /locus_tag="BA_0426"
FT                   /old_locus_tag="BA0426"
FT   CDS_pept        445947..447326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0426"
FT                   /old_locus_tag="BA0426"
FT                   /product="RNA methyltransferase, TrmA family"
FT                   /note="identified by match to protein family HMM PF01938;
FT                   match to protein family HMM PF05958; match to protein
FT                   family HMM TIGR00479"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24454"
FT                   /db_xref="GOA:Q81Z48"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81Z48"
FT                   /protein_id="AAP24454.1"
FT                   /translation="MIQKQHESKLEVGQTFPVTIKRLGINGEGVGYFKRQVVFIPGALP
FT                   GEEVVAETTKIQRGFAEAKVKKVRKASPHRVKAPCPVYEECGGCQLQHLDYKEQLNQKR
FT                   DIVVQAFEKYMKNSMEEKIRPTLGMENPWHYRNKSQLQVGRKDEKVITGLYKQNSHQLI
FT                   DIAHCMIQHKATNEATKVVRRILEKLNVSIYNEKKQKGLVRTIVTRTAVQTGEVQVTLI
FT                   TTKEELPNKEQFIAEVQKQMPAVKSIMQNVNWRKTSVIFGDKTFKLAGKEVIQETLGDL
FT                   SFELSARAFFQLNPEQTVVLYNEAKKAAALTGNEKIVDAYCGVGTIGLWLANDAAEVRG
FT                   MDVIPEAIADARKNAKRHGFTNTKYEAGKAEQWLPKWVKEGWRPDVIVVDPPRTGCDDK
FT                   LLETILKVKPKQVVYVSCNPSSLARDVQALMKSYEVEYVQPVDMFPHTAHVENVVKLTL
FT                   K"
FT   gene            complement(447387..448511)
FT                   /locus_tag="BA_0427"
FT                   /old_locus_tag="BA0427"
FT   CDS_pept        complement(447387..448511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0427"
FT                   /old_locus_tag="BA0427"
FT                   /product="prophage LambdaBa04, site-specific recombinase,
FT                   phage integrase family"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24455"
FT                   /db_xref="GOA:A0A3P1TY01"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR028259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TY01"
FT                   /protein_id="AAP24455.1"
FT                   /translation="MKGYFRKRGEKWSFTIDIGKDPITGKRKQKTASGFKTKKEAERAC
FT                   NELIHQFNTGSLVDDKNFTLSEYLQEWLENTAKQRVRETTFTNYKRAINSRIIPVLGSH
FT                   KLKDLKPLHGQRFVKSLIDEGLSPAYIEYIFIVLKGSLEDAVRWELLFKNPFQHVEIPR
FT                   PRKVVNSTWSIEETKKFLNRTKFENVIYYHLFLLALNTGMRRGEILGLKWKNFDLNEGK
FT                   ISVTETLIYDENGFRFTEPKTHGSKRLISIDQNLCKEFKSYKAKQNEFKLLFGQSYEDN
FT                   DLVFAKETGQPILPRTMTTTFNQFIKKADVPQIRFHDLRHTHATILLKLGINPKIVSER
FT                   LGHSSIKTTLDTYSHVTIDMQESAVLKLSEALKS"
FT   gene            complement(449227..449571)
FT                   /locus_tag="BA_0428"
FT                   /old_locus_tag="BA0428"
FT   CDS_pept        complement(449227..449571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0428"
FT                   /old_locus_tag="BA0428"
FT                   /product="prophage LambdaBa04, DNA-binding protein"
FT                   /note="identified by similarity to OMNI:NTL01SPL1443; match
FT                   to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24456"
FT                   /db_xref="GOA:A0A3P1TXU6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TXU6"
FT                   /protein_id="AAP24456.1"
FT                   /translation="MRHFGQILKKLRKSRGLTQEQLSHKLNLSRSQIKNWETDRYQPDI
FT                   DTLVIIASFFNVSVDALIGFTNEFDEEPLTELLSNVQTTYAALNEQQRERFCKQVSVLI
FT                   NMLEDNQDIF"
FT   gene            450106..451281
FT                   /locus_tag="BA_0429"
FT                   /old_locus_tag="BA0429"
FT   CDS_pept        450106..451281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0429"
FT                   /old_locus_tag="BA0429"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01BS2084"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TXW5"
FT                   /protein_id="AAP24457.1"
FT                   /translation="MWKVLNVLEGELYVAGIKKNKLADYWGVKPATVTKVFKGANDISF
FT                   GYLSKTLILLKKSLISQAKIVNDYVTNTDPKPENLREAMEDLAIRGKFELLKAIIDQEI
FT                   HSDVAENREFAEVYEIIFRRYHDGLNASAYFKLLRQKNKNVKTIEMEVLTEILLCQAQY
FT                   QSGNYKTLYERLKSVSEKINEITNKFIKECLLLRYKEAIAVTSLQGGEVVESRSICRDI
FT                   LDELEWDDFFSLPKLNAYLKIGESLIFEPDNYDSAKFYLEKTLELLGNPSCKGLEKKWK
FT                   LVQQTLSFLKIHQQRDLNTLEFVHPSEKAYSMILEGDVLGAKKILLDLKEKNGEWTDIQ
FT                   TAYYALTCEGEERESLLKKSLLMCQKSGNIHYSQLPKNILGFNLKKWYNYL"
FT   gene            451278..451445
FT                   /locus_tag="BA_0430"
FT                   /old_locus_tag="BA0430"
FT   CDS_pept        451278..451445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0430"
FT                   /old_locus_tag="BA0430"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24458"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KYD9"
FT                   /protein_id="AAP24458.1"
FT                   /translation="MKEEVEILKKILALLPILLVAGLFTFSADNQQTKDKQEASEPVVQ
FT                   RMMTDPGGGW"
FT   gene            451613..451747
FT                   /locus_tag="BA_0431"
FT                   /old_locus_tag="BA0431"
FT   CDS_pept        451613..451747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0431"
FT                   /old_locus_tag="BA0431"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24459"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KB08"
FT                   /protein_id="AAP24459.1"
FT                   /translation="MKKEQLARELMVKWVLENKETNSEEVLKEITSHTYTEEKLKEAN"
FT   gene            complement(451775..452116)
FT                   /locus_tag="BA_0432"
FT                   /old_locus_tag="BA0432"
FT   CDS_pept        complement(451775..452116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0432"
FT                   /old_locus_tag="BA0432"
FT                   /product="prophage LambdaBa04, DNA-binding protein"
FT                   /note="identified by similarity to OMNI:NTL01BS01252; match
FT                   to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24460"
FT                   /db_xref="GOA:A0A347ZYP9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYP9"
FT                   /protein_id="AAP24460.1"
FT                   /translation="MTFGEKLKQLRGKRTQGDVANLLNISRATYSHLENNRIEPSMTVL
FT                   NSIADLFCVSTDYLLGRSSDPRLTEEQDKTADEMARRFMELVADLPKEEQENAWKQAAM
FT                   YVNFTKNQK"
FT   gene            452291..452512
FT                   /locus_tag="BA_0433"
FT                   /old_locus_tag="BA0433"
FT   CDS_pept        452291..452512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0433"
FT                   /old_locus_tag="BA0433"
FT                   /product="prophage LambdaBa04, DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24461"
FT                   /db_xref="GOA:A0A3P1TZH3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TZH3"
FT                   /protein_id="AAP24461.1"
FT                   /translation="MNNILKNERKKMKFTQKQLAEKLGISTIYVRKIESGYIPRPDIMV
FT                   KYQEVFDISVKELFPDYFSAFNDKKFII"
FT   gene            452530..453261
FT                   /locus_tag="BA_0434"
FT                   /old_locus_tag="BA0434"
FT   CDS_pept        452530..453261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0434"
FT                   /old_locus_tag="BA0434"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:EF2037; match to
FT                   protein family HMM PF09669; match to protein family HMM
FT                   TIGR02681"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24462"
FT                   /db_xref="InterPro:IPR014054"
FT                   /db_xref="InterPro:IPR018878"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TZF0"
FT                   /protein_id="AAP24462.1"
FT                   /translation="MNQLQDLRHPVSEFVFTERNQVVTDSLTMAQMFGKEHKNVIRDIE
FT                   VQLEKLIEANETEWGQLNFEPTQYQHYQNKQWYPKFNLTEDAFAIVAMSYITPEAMKMK
FT                   IKFLQEFKRMKEHIQKVQQQPKSVEDAIIYSMTELKQIKSRQDHTEEEMNKMKLLVDNE
FT                   LWLTEQHKGSVQRKVKQRVFELKKEGYDNASYQGIYGALKRHFGVAKYDKIPRKYYQNA
FT                   MRFIAGWYPPERPNTLDDYVS"
FT   gene            453306..453656
FT                   /locus_tag="BA_0435"
FT                   /old_locus_tag="BA0435"
FT   CDS_pept        453306..453656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0435"
FT                   /old_locus_tag="BA0435"
FT                   /product="putative prophage LambdaBa04, DNA binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24463"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TXW0"
FT                   /protein_id="AAP24463.1"
FT                   /translation="MKNSTVQIALAVTKFSAQKGWSDEEFWEAIELLRFNKEDARQTAI
FT                   EKLDTIPVTYDNTNDYPIMLKVDHVAEVLGISQRKAYDIMDQKGFPLVKIGRKKVVPRD
FT                   AFFNWLERGVSA"
FT   gene            453629..453820
FT                   /locus_tag="BA_0436"
FT                   /old_locus_tag="BA0436"
FT   CDS_pept        453629..453820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0436"
FT                   /old_locus_tag="BA0436"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24464"
FT                   /db_xref="GOA:A0A2P0H9E4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H9E4"
FT                   /protein_id="AAP24464.1"
FT                   /translation="MARKGGVSMMEDTTSLVAFAMFIAFSILLLYITYEPIKRWAWSNV
FT                   EQNKKTHGSGSFKKKQLS"
FT   gene            453850..454035
FT                   /locus_tag="BA_0437"
FT                   /old_locus_tag="BA0437"
FT   CDS_pept        453850..454035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0437"
FT                   /old_locus_tag="BA0437"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24465"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1U0L3"
FT                   /protein_id="AAP24465.1"
FT                   /translation="MDLIKYQVLLPNKFWDLAESKDELKKMIEQYFKNSYPHYKIKEII
FT                   RSGESHIAICERKWLI"
FT   gene            454161..454904
FT                   /locus_tag="BA_0438"
FT                   /old_locus_tag="BA0438"
FT   CDS_pept        454161..454904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0438"
FT                   /old_locus_tag="BA0438"
FT                   /product="putative prophage LambdaBa04, DnaD replication
FT                   protein"
FT                   /note="identified by similarity to GP:12829835; match to
FT                   protein family HMM PF04271; match to protein family HMM
FT                   TIGR01446"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24466"
FT                   /db_xref="InterPro:IPR006343"
FT                   /db_xref="InterPro:IPR034829"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H9H4"
FT                   /protein_id="AAP24466.1"
FT                   /translation="MVYWYKPTEVRDEHSNNVRYKQKFKADTLQKSYQQFADSFGFTKR
FT                   QVKDACDYLKDRRLVHIEFRTIFVNGTRCNNVMFIEPIPEEIQKISILYWENGTPPTLE
FT                   RKRVLQQNEPPSYDKKEEPPTFKRKTNTENTTKNTTENVSSSSIFSFYENNFGILNSFI
FT                   AENISQWVNDTSEELVQAAMERALKQQKKWNYAEGILKQWVNNNVKTLKDVDALETEYQ
FT                   RNKGVKKRVGINRKSDDSDSEYIGL"
FT   gene            454873..455676
FT                   /locus_tag="BA_0439"
FT                   /old_locus_tag="BA0439"
FT   CDS_pept        454873..455676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0439"
FT                   /old_locus_tag="BA0439"
FT                   /product="putative prophage LambdaBa04, DNA replication
FT                   protein DnaC"
FT                   /note="identified by similarity to EGAD:7684; match to
FT                   protein family HMM PF01695"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24467"
FT                   /db_xref="GOA:A0A2A7D4L6"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A7D4L6"
FT                   /protein_id="AAP24467.1"
FT                   /translation="MTRIVNTSACSEETEGYTCEHCNKYIAAITVEVPQLRIKNKILPT
FT                   CECVVEREEAKIREAQNFAKKREIEKLFSISNLGERFSKSTFESFLDRNGSETAYKVAV
FT                   KYVKTFKEWNGESLMLWGEPGNGKTHLAAAIVNELSKKGYIVVFQSVPELLQRIRSTFN
FT                   SENKENETQIMRALLECDLLILDDIGAEKTTEWVEEKLFNIIDGRYRKELPTLYTSNLE
FT                   PKELKNQVGKRSYDRMVETSLTVKNEAASYRREIAKQRLQRFIEA"
FT   gene            455692..455886
FT                   /locus_tag="BA_0440"
FT                   /old_locus_tag="BA0440"
FT   CDS_pept        455692..455886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0440"
FT                   /old_locus_tag="BA0440"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24468"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H9H7"
FT                   /protein_id="AAP24468.1"
FT                   /translation="MCVLCHDTGIIRKETYPGVIETNGCNCEVAKRQQAENDKRWQAWL
FT                   IKFESMKQELERSKQQKAS"
FT   gene            455911..456084
FT                   /locus_tag="BA_0441"
FT                   /old_locus_tag="BA0441"
FT   CDS_pept        455911..456084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0441"
FT                   /old_locus_tag="BA0441"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:16414921"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24469"
FT                   /db_xref="InterPro:IPR025017"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TYZ9"
FT                   /protein_id="AAP24469.1"
FT                   /translation="MKPTKVEIDVTDNKIYVVKNGEVTPLNPPATGFGEQIITWQGGKV
FT                   DRVSTTITEKIK"
FT   gene            456365..456781
FT                   /locus_tag="BA_0442"
FT                   /old_locus_tag="BA0442"
FT   CDS_pept        456365..456781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0442"
FT                   /old_locus_tag="BA0442"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GP:5730276"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24470"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TYX0"
FT                   /protein_id="AAP24470.1"
FT                   /translation="MFNRWLTDEEYQQAESNGISRRVLYMRMYRYGWELQEALTTPPRT
FT                   YWHMGEGKHNKWLKLAEKNGVNSSTFYSRVNNGWDPKDAASIPTRKQMDRKELVKIAES
FT                   NGISVSTFRSRLSYGWDPMKAATTPAKSKNKNIS"
FT   gene            456797..457261
FT                   /locus_tag="BA_0443"
FT                   /old_locus_tag="BA0443"
FT   CDS_pept        456797..457261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0443"
FT                   /old_locus_tag="BA0443"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:15281706; match to
FT                   protein family HMM PF03819"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24471"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TY73"
FT                   /protein_id="AAP24471.1"
FT                   /translation="MNIMENGVLEATKLISEARKEATVLQIASILSIGELNDYQEATLR
FT                   TWNNKTDFGGRVSNAALGLTGEAGEVADIVKKAIYHGHGFQPSHCPGEEDGNTYKLALE
FT                   LGDILYYLSIMAHELGYTLQDIAEMNIAKLAKRYPDGFSREASQARVDVK"
FT   gene            457299..457478
FT                   /locus_tag="BA_0444"
FT                   /old_locus_tag="BA0444"
FT   CDS_pept        457299..457478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0444"
FT                   /old_locus_tag="BA0444"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24472"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TZG6"
FT                   /protein_id="AAP24472.1"
FT                   /translation="MNMYVVTLSHYTDEAYFEIECVCPTKELAKEQVDKLQREKDPTHS
FT                   EWKYSWDIVKVISE"
FT   gene            457521..457811
FT                   /locus_tag="BA_0445"
FT                   /old_locus_tag="BA0445"
FT   CDS_pept        457521..457811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0445"
FT                   /old_locus_tag="BA0445"
FT                   /product="prophage LambdaBa04, transactivating regulatory
FT                   domain protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   premature stop; identified by similarity to GB:AAA91935.1"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24473"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0PQN3"
FT                   /protein_id="AAP24473.1"
FT                   /translation="MVMNIKVDELKENEDGIKGGKITITNEAHTITIHSQHVDDAYYLA
FT                   GNLEDCANKIEVKQNCEKCCHCDGKGVGLDWGAMKFWECDVCDGTGELDSK"
FT   gene            458011..458610
FT                   /locus_tag="BA_0446"
FT                   /old_locus_tag="BA0446"
FT   CDS_pept        458011..458610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0446"
FT                   /old_locus_tag="BA0446"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:13491646"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24474"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TZE1"
FT                   /protein_id="AAP24474.1"
FT                   /translation="MEYIEKATKEIRENWFGDHVAEIQGEEGLQVIYWGKPGTGSYRAK
FT                   FVLSGYNVFVSGDIGEAVYNLTCPATLENIKGCNLGYFTGKLTAFCEERWNFDQDKAKE
FT                   ELNEFWEEYEMNETKDGKEIYDDIVSAIDESSSMESYHFWVGNVYHNSSLESDTMECIW
FT                   DFGKRLPRRLIGYWLGLQMAIEQLEKNKPAAEAVTL"
FT   gene            458648..458818
FT                   /locus_tag="BA_0447"
FT                   /old_locus_tag="BA0447"
FT   CDS_pept        458648..458818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0447"
FT                   /old_locus_tag="BA0447"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24475"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LHK2"
FT                   /protein_id="AAP24475.1"
FT                   /translation="MAKTEKFSVVLELPRDIEVGSTVRQKGKILTITSIRKIECISSRL
FT                   ILVSGNATVQK"
FT   gene            458831..459016
FT                   /locus_tag="BA_0448"
FT                   /old_locus_tag="BA0448"
FT   CDS_pept        458831..459016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0448"
FT                   /old_locus_tag="BA0448"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KJF2"
FT                   /protein_id="AAP24476.1"
FT                   /translation="MKRIGINDKCIGCGAEVDDPECECEWRTCSCCGYPDCFVYEEGRY
FT                   YHCKNCDHSTDPGHYM"
FT   gene            459042..459179
FT                   /locus_tag="BA_0449"
FT                   /old_locus_tag="BA0449"
FT   CDS_pept        459042..459179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0449"
FT                   /old_locus_tag="BA0449"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24477"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LJ67"
FT                   /protein_id="AAP24477.1"
FT                   /translation="MRERENWDVLCEECDKVIIIGVKTESGDHYCEACYDKLAYGNKDK
FT                   "
FT   gene            459223..459627
FT                   /locus_tag="BA_0450"
FT                   /old_locus_tag="BA0450"
FT   CDS_pept        459223..459627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0450"
FT                   /old_locus_tag="BA0450"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24478"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TXU9"
FT                   /protein_id="AAP24478.1"
FT                   /translation="MKTYEELVEKCKELVEKGWTPESVRECFEAYSEFGIDAIQSAMNE
FT                   ALLNNGCSDNVLDYRPNLENLKALGLEEDYVFQALAYMGNASQFMSWANTVLALVDDVP
FT                   EQLKQDIKKVHSGIYEMQEKLREYKKEDDE"
FT   gene            460114..460296
FT                   /locus_tag="BA_0452"
FT                   /old_locus_tag="BA0452"
FT   CDS_pept        460114..460296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0452"
FT                   /old_locus_tag="BA0452"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24479"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYS0"
FT                   /protein_id="AAP24479.1"
FT                   /translation="MGTLVVNCGEYEFTRFESAVRTLEQEYGYEGEAWEMVVASGDLEI
FT                   LSDFLNSDGLNAEIE"
FT   gene            460328..460702
FT                   /locus_tag="BA_0453"
FT                   /old_locus_tag="BA0453"
FT   CDS_pept        460328..460702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0453"
FT                   /old_locus_tag="BA0453"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24480"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TXT2"
FT                   /protein_id="AAP24480.1"
FT                   /translation="MTVVSRSHRALKRKYRPIRKEFKKDILEATKNNRAFAMMIIETYT
FT                   ASQHRTHIMKVWELLGIHHREAYKDYCDKLMGKHLTGRDEIMRSIYFADKVLYDKYHRK
FT                   LPECYAMGDALGIAYKVLKQ"
FT   gene            460808..461164
FT                   /locus_tag="BA_0454"
FT                   /old_locus_tag="BA0454"
FT   CDS_pept        460808..461164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0454"
FT                   /old_locus_tag="BA0454"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24481"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TYY9"
FT                   /protein_id="AAP24481.1"
FT                   /translation="MSKVIEGQEVYVSTSGGWVGKSEPNLRKYIVVRANKTSFYANPEG
FT                   VEDKSPYRFNQKDLSHNTGWGYHYQAYRTEKEYWDMIERGKEKAQLRKELKDTVDKMSL
FT                   IELRKLKEVLFVTK"
FT   gene            461355..461507
FT                   /locus_tag="BA_0455"
FT                   /old_locus_tag="BA0455"
FT   CDS_pept        461355..461507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0455"
FT                   /old_locus_tag="BA0455"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24482"
FT                   /db_xref="InterPro:IPR025041"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0PPS8"
FT                   /protein_id="AAP24482.1"
FT                   /translation="MINIESEVKRMKPLKKRKVRKAIARRAKAVEKHQVDKAWRNIFVR
FT                   NGYLK"
FT   gene            461623..461793
FT                   /locus_tag="BA_0456"
FT                   /old_locus_tag="BA0456"
FT   CDS_pept        461623..461793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0456"
FT                   /old_locus_tag="BA0456"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24483"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LF71"
FT                   /protein_id="AAP24483.1"
FT                   /translation="MKVLKDQLREWKKQSNQMKKKPKKKRKEKLSTRDIEGLMGIHGPR
FT                   YERRRGALRQK"
FT   gene            461821..462303
FT                   /locus_tag="BA_0457"
FT                   /old_locus_tag="BA0457"
FT   CDS_pept        461821..462303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0457"
FT                   /old_locus_tag="BA0457"
FT                   /product="phage transcriptional regulator, ArpU family"
FT                   /note="identified by match to protein family HMM TIGR01637"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24484"
FT                   /db_xref="InterPro:IPR006524"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H9G3"
FT                   /protein_id="AAP24484.1"
FT                   /translation="MTKQLSFLPKIDRTATQEELEGVLESVRIHRQFGMMRKEMKVTPS
FT                   YEIREHGPTHTVGKPLEDVAIANIQQSKREEWLERMSVRIDQFLNRLGNGRAGSIQRDI
FT                   IYKRYLEEEDVCDYMVYNEIGMSERTYRRWKSKAFYKLAFALGLEVYETEETGGNE"
FT   gene            462303..462845
FT                   /pseudo
FT                   /locus_tag="BA_0458"
FT                   /note="prophage LambdaBa04, site-specific recombinase,
FT                   phage integrase family, authentic point mutation; an
FT                   automated process has identified a potential problem with
FT                   this gene model; it may contain one or more premature stops
FT                   and/or frameshifts"
FT   gene            462978..463088
FT                   /locus_tag="BA_0459"
FT                   /old_locus_tag="BA0459"
FT   CDS_pept        462978..463088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0459"
FT                   /old_locus_tag="BA0459"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24485"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0PPZ2"
FT                   /protein_id="AAP24485.1"
FT                   /translation="MGKSLVKKYIREEYKNKWQSRDRFLAGNVPVVLEST"
FT   gene            complement(463157..463255)
FT                   /locus_tag="BA_0460"
FT                   /old_locus_tag="BA0460"
FT   CDS_pept        complement(463157..463255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0460"
FT                   /old_locus_tag="BA0460"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24486"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0PQU5"
FT                   /protein_id="AAP24486.1"
FT                   /translation="MLLAQRRAKALLINGNIQSVPSAGFGFYVPSL"
FT   gene            463434..463736
FT                   /locus_tag="BA_0461"
FT                   /old_locus_tag="BA0461"
FT   CDS_pept        463434..463736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0461"
FT                   /old_locus_tag="BA0461"
FT                   /product="prophage LambdaBa04, Gp54"
FT                   /note="identified by match to protein family HMM PF01844"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24487"
FT                   /db_xref="GOA:A0A347ZYS9"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYS9"
FT                   /protein_id="AAP24487.1"
FT                   /translation="MAKEYAKKFYKSTVWKKCRDSYFKFRHGLCERCTDPGKIVHHKNY
FT                   ITPENINDPEITLSFNNLELLCQDCHNREHHEKNSPVVEGVMFDENGDLIRREDI"
FT   gene            463733..463900
FT                   /locus_tag="BA_0462"
FT                   /old_locus_tag="BA0462"
FT   CDS_pept        463733..463900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0462"
FT                   /old_locus_tag="BA0462"
FT                   /product="putative prophage LambdaBa04, DNA binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24488"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYT0"
FT                   /protein_id="AAP24488.1"
FT                   /translation="MNTFFHNTIGVNDAAILLKVSPGHIKNMCAEGKIIAKKIGKTWVI
FT                   DRSKLKGVRK"
FT   gene            463897..464043
FT                   /locus_tag="BA_0463"
FT                   /old_locus_tag="BA0463"
FT   CDS_pept        463897..464043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0463"
FT                   /old_locus_tag="BA0463"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24489"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LHQ8"
FT                   /protein_id="AAP24489.1"
FT                   /translation="MSEENKFGCRNWVSPEANLAYEEKVPSKDVLEVKREVLKMKQSPP
FT                   IKK"
FT   gene            464144..464515
FT                   /locus_tag="BA_0464"
FT                   /old_locus_tag="BA0464"
FT   CDS_pept        464144..464515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0464"
FT                   /old_locus_tag="BA0464"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01SA1848"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TXS9"
FT                   /protein_id="AAP24490.1"
FT                   /translation="MASKKELTKEERVNKEIRRLKRIYKELPKDTLMVVEGLIVEAADL
FT                   RVRLEDIRKDLDENGYDEMFSQSENQEPYERERPAARRYIAMNKSYQTIMKQLGDYIPK
FT                   KPIENKEKDDGFDDFVTNR"
FT   gene            464512..466200
FT                   /locus_tag="BA_0465"
FT                   /old_locus_tag="BA0465"
FT   CDS_pept        464512..466200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0465"
FT                   /old_locus_tag="BA0465"
FT                   /product="putative prophage LambdaBa04, terminase, large
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF03354"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24491"
FT                   /db_xref="InterPro:IPR005021"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1U0J1"
FT                   /protein_id="AAP24491.1"
FT                   /translation="MRVQYPLSYNPIIEYYNKIESGEEIVGYKVKRIYKKLVDDIYDQD
FT                   SIYEYNPKRANHAMEFIENFCKHSKGKWAGKPIDLELWQKAFIGSLFGFIHKIDGTRKY
FT                   REALLIVARKNGKSTLSSGICLYLQIADGEGGAEVYAVATKEKQAKIVWSEAKRMVKKS
FT                   PVLSKRIKALVKELNADFNDSTFQPVGSDSDTLDGLNVHGASLDEIHAWKDKNLYDVIV
FT                   DGTSAREQPLILMITTAGTVRESVYDMKYEEAERLLLSLDDEKEYTDPTFLPIIYELDS
FT                   RKEWTDPKCWKKANPGLGTIKKIDNLQTKVNKAQANPLLVKNLLTKDFNVRETSSEAWL
FT                   TFEQLNNKQTFDVMELKPNYGIGGTDLSETTDLTAAKVIFMLPNDINVYVLQMYWLPEE
FT                   LLEQRSKEDKIPYDLWHEAGYLRTTPGNSIHPKFVTEWFLEIRDEYGIYLPWIGYDRWS
FT                   AKYWVEEMQGYFGKEAMVPVAQGKQTLSMPMKLLGADLEAKRIIYNNNPIDKWCLSNTA
FT                   IDIDKNLNIQPDKTNNQRRRIDGTAALLDAYVVLQEKKNDYLNMI"
FT   gene            466471..467436
FT                   /pseudo
FT                   /locus_tag="BA_0466"
FT                   /note="prophage LambdaBa04, portal protein, truncation;
FT                   comparison of this gene to its homologs suggests this gene
FT                   has been truncated; identified by similarity to
FT                   OMNI:SA0368"
FT   gene            467384..467974
FT                   /locus_tag="BA_0467"
FT                   /old_locus_tag="BA0467"
FT   CDS_pept        467384..467974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0467"
FT                   /old_locus_tag="BA0467"
FT                   /product="putative prophage LambdaBa04, prohead protease"
FT                   /note="identified by similarity to OMNI:NTL02EC1648; match
FT                   to protein family HMM PF04586; match to protein family HMM
FT                   TIGR01543"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24492"
FT                   /db_xref="GOA:A0A3Q0PPX4"
FT                   /db_xref="InterPro:IPR006433"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0PPX4"
FT                   /protein_id="AAP24492.1"
FT                   /translation="MGKLDKTETREIVTQKIEIREDDNGNRTLIGYAVKWEKKSVVMGY
FT                   YRKFREQFKNGAFTETLQNDDQRFLWSHDTSKVLGRTKNNTLRLNEDAVGLRFELDLPD
FT                   TTLGNDTYKSIKRGDVDGVSFGFSMISEEIQEPDDDLMLRTVTKAKLLEVSAVAFPAYP
FT                   DSEVSARGYDPYKHFTEEKKRSEKRRRLYLQTL"
FT   gene            467993..469183
FT                   /locus_tag="BA_0468"
FT                   /old_locus_tag="BA0468"
FT   CDS_pept        467993..469183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0468"
FT                   /old_locus_tag="BA0468"
FT                   /product="putative prophage LambdaBa04, major capsid
FT                   protein"
FT                   /note="identified by match to protein family HMM PF05065;
FT                   match to protein family HMM TIGR01554"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24493"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TXS1"
FT                   /protein_id="AAP24493.1"
FT                   /translation="MNKEQLLKRKSEIGELLSDETRSIDNLDTIETELRDINEQLAAIE
FT                   KREQLLNEARSINEGNAAGANKIETFNANLNLSNEKREIGTNTVEYRNAFMNYVLRGEA
FT                   IPAELRANAVTKTSDIGSVIPQTVLDKIIEKIEAVGMILPLITRTAIKGGVTVPTSAVK
FT                   PVATWVAESSGSDKQKKTTGSITFNYHKLRCAVAVSLEVETMSLAVFETTLINNIVEAM
FT                   TKAIEQAIVSGDGSGKPKGILAETPFEGQALDVAKINYKTLTDAEAALPLEYEASAIWT
FT                   MTKKTFMEFSAMTDADGQPIARTNYGISGKPERILLGRPVVLCNYVDSFATATEGTAFA
FT                   FLFNYKDYILNTNYQMGVKKYEDNETDDQVTKAIMIVDGKVVDKNSLVVLKKAPSA"
FT   gene            469199..469456
FT                   /locus_tag="BA_0469"
FT                   /old_locus_tag="BA0469"
FT   CDS_pept        469199..469456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0469"
FT                   /old_locus_tag="BA0469"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24494"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYT7"
FT                   /protein_id="AAP24494.1"
FT                   /translation="MNHFVLNTFIDKETKVGYSKGDMYESNDSERIAFLIEKGFLKGNK
FT                   EIPTFPKHTGGGWYELSNGEKVQGKEEAMSAEQSLKDKES"
FT   gene            469453..469725
FT                   /locus_tag="BA_0470"
FT                   /old_locus_tag="BA0470"
FT   CDS_pept        469453..469725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0470"
FT                   /old_locus_tag="BA0470"
FT                   /product="putative prophage LambdaBa04, DNA packaging
FT                   protein"
FT                   /note="identified by match to protein family HMM TIGR01560"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24495"
FT                   /db_xref="InterPro:IPR006450"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TXT5"
FT                   /protein_id="AAP24495.1"
FT                   /translation="MILKDVKKTLRISHDALDDEINDSIEAARHDLMLSGVSSVKANND
FT                   DDPLIKRAIKVYCKAEFVTEAKEAERFQASYNMLKNHLTLAGDYK"
FT   gene            469722..470021
FT                   /locus_tag="BA_0471"
FT                   /old_locus_tag="BA0471"
FT   CDS_pept        469722..470021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0471"
FT                   /old_locus_tag="BA0471"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:16415096; match to
FT                   protein family HMM TIGR01563"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24496"
FT                   /db_xref="InterPro:IPR008767"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TYV7"
FT                   /protein_id="AAP24496.1"
FT                   /translation="MNDILFFPVVTTTKDDLGQIEVSEDFTRQVFCEKKSISQNEFFQA
FT                   GQNGFKPKCVLIVYSLDYQEEQKVNYNNKTYSIYRTYERDDERIELYCEVKAGG"
FT   gene            470014..470370
FT                   /locus_tag="BA_0472"
FT                   /old_locus_tag="BA0472"
FT   CDS_pept        470014..470370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0472"
FT                   /old_locus_tag="BA0472"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:16415095"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24497"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYU0"
FT                   /protein_id="AAP24497.1"
FT                   /translation="MASIDSLANDIARELQRYGKEVEEKLEVEKEEVANNLVSDLKENS
FT                   PKNTGKYAKGWRKKKEGNGFIVHNALKPQLTHLLEKGHAQVNGGRVPAKVHIAPAEEKA
FT                   ENEFLERVERAIQQ"
FT   gene            470367..470696
FT                   /locus_tag="BA_0473"
FT                   /old_locus_tag="BA0473"
FT   CDS_pept        470367..470696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0473"
FT                   /old_locus_tag="BA0473"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:16415094"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24498"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYU1"
FT                   /protein_id="AAP24498.1"
FT                   /translation="MTLSELKKILDATGYPVAYSHFTATIGNPVPKPPFICYLVTGSPN
FT                   MIADSKVHFKISDVNIELYTAKKDLVAEAKLEKVLDDNEIPYESSEIYIDSEKLFQKIY
FT                   ETRLI"
FT   gene            470697..471266
FT                   /locus_tag="BA_0474"
FT                   /old_locus_tag="BA0474"
FT   CDS_pept        470697..471266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0474"
FT                   /old_locus_tag="BA0474"
FT                   /product="putative prophage LambdaBa04, major tail protein"
FT                   /note="identified by match to protein family HMM TIGR01603"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24499"
FT                   /db_xref="InterPro:IPR006490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H9K6"
FT                   /protein_id="AAP24499.1"
FT                   /translation="MENKVVFGLKKVHYSVITEDSSGKITYGTPAKLPGAVKMKLDPKG
FT                   EQSDFWADDSNYYTDSSNQGYEGTLNIANITEAFRTDVLGEILDEDDQVLTEVSNAKIK
FT                   RIALMFEFDGDVKATRHLLYNVSVSRPGFGSSTKSDKTEPNTTELKFVASQHPETLNVK
FT                   TSTKVTTPAGIYDAWYTKVYEKVVGA"
FT   gene            471271..471633
FT                   /locus_tag="BA_0475"
FT                   /old_locus_tag="BA0475"
FT   CDS_pept        471271..471633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0475"
FT                   /old_locus_tag="BA0475"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:16415092"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24500"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TXR8"
FT                   /protein_id="AAP24500.1"
FT                   /translation="MKKTIIIDEKAVLLKSTAGTAIRYKSQFRRDMFADILSLGVLSSY
FT                   ISTDGDQSNIDLSQVDLSKLDFEVIYNLVWAFAKTANKEVPDPLTWLDTFGEFPIAEII
FT                   TEIQDLIKSTVQSKKK"
FT   gene            471744..471857
FT                   /locus_tag="BA_0476"
FT                   /old_locus_tag="BA0476"
FT   CDS_pept        471744..471857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0476"
FT                   /old_locus_tag="BA0476"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:12724001"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24501"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0PQG2"
FT                   /protein_id="AAP24501.1"
FT                   /translation="MTIGDCLDYIDEYVELRNPKKEKENTRTATQDDFNNF"
FT   gene            471875..475810
FT                   /locus_tag="BA_0477"
FT                   /old_locus_tag="BA0477"
FT   CDS_pept        471875..475810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0477"
FT                   /old_locus_tag="BA0477"
FT                   /product="putative prophage LambdaBa04, tape measure
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24502"
FT                   /db_xref="GOA:A0A384KK05"
FT                   /db_xref="InterPro:IPR039686"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KK05"
FT                   /protein_id="AAP24502.1"
FT                   /translation="MVGRIKGITIEIGGETTGLQSALKDVNKRSSELSKELKDIERLLK
FT                   FNPGNVEALAQKQQLLTQQIENTTKKLDSLKSAQQQVQAQFESGAISEEQYRAFRREIE
FT                   FTEGQLNGFKNSLAGLKAEQEKAASSTRQLETLFSATGKSVDDFADALGNRLVNAIKNG
FT                   TASSRQLEQAIEIVGREALGAEADIGKLQQALRSVDDGNSIQNIRNDLNQLSQEAEEAS
FT                   ESVKGLGVELENVLGGIVAGGGIQEVIGQALDMSELKTKIDITFDVPESSKRSVEDAIR
FT                   TVVAYGGDAEEALEGVRRQWSLNKDASDAANTEIIKGAANIASSYSQIDFTELIQETNE
FT                   IGSELNISNKEALGLVNSLLKIGFPPEQLDIIAEYGAQLRRVGYTAQEVQSIMASAAKE
FT                   KSWNIDNLLDGLKEGRIRSVEMARGLSNSMKDAVRDAVDDTEKMSDAQISAMQKGFAKQ
FT                   ESALANSFSNQEKALSKSHSRRQNELAKSLDAEYNAVSKSYENQQKNLEKKLSAEYDAA
FT                   SKNYDRQQKALEKSLDAEVKAFEKSSEQKIKLIDKEYMERMKLIDEEKYNRLKAVDDQI
FT                   NSLDAKTAAEDKYFKDRENAEKRADLKVKISKAKNEEERQAAIKALRDLEEKMRLDKIR
FT                   EERKSQIDRLKEEKDSIKEASDAKKEALKSEFDSRKERVKEQINNEKEALKERQQEQKE
FT                   AFQQNKQENLKAISESNKAQLDSLREVNQANLSALKENHNERKQALSERLSDEMDAVRE
FT                   SHRAELESFKEMNAEKLELAKNPPDSAAVQEIFAQLEGWGKAIAKGGEEGKQAFVDMVK
FT                   WLDQIEDADLKEAIGVELFGTMWEDQGQKIINTILQTEQKQADLKQGIDDLQQSVSKTD
FT                   ASPMVKLKEAMNDLKQALEPILLIIADVVSAFAGFISAHPVLAAAITAITVAIGILVGI
FT                   CAALAPVIFLATSGAITFAGVMAALTSPIALVVAAIAGLIAIWVLFGDKIMAIYNEYFK
FT                   PTIDQIVSIIVSTLKPVFEQGFAIIKDVVQDAFIIIQRVWNEILSPVFSVITSIIKTVL
FT                   LPAFKFVFSAIGSVVSDAFSGIKDMWNNVLKPILNGIIDFISGIFSGNWEKAWGGIVKI
FT                   FSGVFEGIKSAAKAPINAVVSMLNGLIEGINSIEMPDWVPFVGGSKPSIPRIPMLATGG
FT                   HVLGDGSFIAGEAGPELFTKRGNRVSVTPLSSTEKSLGITGTMSRLIGDMSYSMASSMK
FT                   ELSGLKSVMSNVYGSMASSSQAMSRNASQRTAEGNSSSNANKSDSYNFADMFRGSTFVV
FT                   REEADVQKLAVELGKYIKASGRRVGQL"
FT   gene            475807..476616
FT                   /locus_tag="BA_0478"
FT                   /old_locus_tag="BA0478"
FT   CDS_pept        475807..476616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0478"
FT                   /old_locus_tag="BA0478"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01BH3522; match
FT                   to protein family HMM TIGR01633"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24503"
FT                   /db_xref="InterPro:IPR006520"
FT                   /db_xref="InterPro:IPR008841"
FT                   /db_xref="InterPro:IPR038675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H9M3"
FT                   /protein_id="AAP24503.1"
FT                   /translation="MSLTLDGKPLKQLGLALLPGYQHPAAPPVRDYTVSIPGRPGAYYF
FT                   GSDIDPMEFNLPLIIKPQENRYELAAAIRKMVDTFIDPYGKPKEVKLIYDYEPDKYYLA
FT                   RYSGSMSIERYFRMGKFELPMIAYDPYAYSIIDSTNGIKWGDPIPWMSDIPISAGDNSY
FT                   TINSPQNISLNNYGTLVVRPVINISGSAENLTLTLKGERFSLGTFTNSTFLLDAKHYTA
FT                   IKNGQNYLFQLKGDLEKLELIPGANVIKISGVNLNINITFEYRAKYI"
FT   gene            476631..480209
FT                   /locus_tag="BA_0479"
FT                   /old_locus_tag="BA0479"
FT   CDS_pept        476631..480209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0479"
FT                   /old_locus_tag="BA0479"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24504"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KUA5"
FT                   /protein_id="AAP24504.1"
FT                   /translation="MADAPKLTGEETIKQSYYKINMAIDNSNDALKTAKDSLTSPVSNA
FT                   RIDPKAVTKDKLGDDVDYQTTALGGAIIGDNVMWEKVAIFGPKSNMTEEFTDNNELEFG
FT                   KKLLKLTVTSTSNYKQLLNPGTSEHANAGVEIPVYAKRYKKISGALNYKINKATGETLI
FT                   RAGITVRYTDGTIQKSTMFKLKADGKEYADVFEQDIDNTKTISSMYLYISGGDVNDVIK
FT                   ISYVSFWMGKTNDNIFDKSLLLSKIGDVDSSVTIIKENNRINWFTDAKNIIQNKPMIKQ
FT                   GNELESSGSFLQKGIKNLNVNNIMGTPFWFEFECNSDSATPYFRFELPELMKKLHEIRQ
FT                   SGLKLSKVNATVELYFPYNLKHNVTYRLLSKKITGEWHFFPLKTITKNTGAQTITIQLN
FT                   EDIDSVIDTLGDYLTVYVTFQSALNTQKVYLGWMDIWMDDDKQVLFSENFDGRAILPGT
FT                   VVEQSLEKSLQEKINGTTVSNNPKKQLRVAMTGSSITWGKGLLDDGFVREIDYYLRDYL
FT                   SNTYLHSDPSLLFKGANSIITNEKFYKRTARKMTGTESSVSFSLVGDELSIVHGLERSN
FT                   KGAAIIELYVDGQLYDTFSNYNTEPYGNTVVNAIGDGTTVKFDLGRAFTYNHVVKVNGI
FT                   TLVGKINDAESGATFPNGHDYMIIRKYGQNPDTQETEVHHFLYLKNAPAARANIEVTMS
FT                   YGENIIYTKSTIGEITESIEGALESRYGDDEISFDPANPAALSSGLDFRETDERSVKTW
FT                   NFAEYKEREFMFKIKGYDPRANKTVSPYFILNFITNRMHYIMNAGIGGWTAEKLYNDNG
FT                   LRNYHYLMRFDPDILFVESGTNDDWDSANQFVATKTITDVTEAALRRYPTLWLKSSKYV
FT                   AVDNYTIETAALTIEEVTRNSVKINGTNTDLSSVKKGDYLIIGDYHFDEREVVTRIIDT
FT                   WDIATRTATFKKPLKPQEILNIRKLSDLTGRTVMVKRIDGFISWLDKVVDGVRQYNEDV
FT                   QIGLVSTGLCAFTTRLLLGYPDKIKELALQKECTFANAFDFIKRFQYNQTRVGSAFLNS
FT                   ANNTTSSGSNEYNLVNASGVDINVAQKLRGIRNYSIKVDGIERYGDGCYIDNAYGYYFK
FT                   PATTSSNLTIDNWNNKVTTKIAADYVTTKLVFTKDIPPNGAKIEVSFSTEKWSSDDCHM
FT                   GSLGGIHMYKNSLIDAMQIMICKSIG"
FT   gene            480275..480436
FT                   /locus_tag="BA_0480"
FT                   /old_locus_tag="BA0480"
FT   CDS_pept        480275..480436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0480"
FT                   /old_locus_tag="BA0480"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24505"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384K9S4"
FT                   /protein_id="AAP24505.1"
FT                   /translation="MHLFEVDRECTYKSVDYKVISVLDNDLLLVVPKEDLANEKFPLQT
FT                   YVIPEQIE"
FT   gene            480505..482139
FT                   /locus_tag="BA_0481"
FT                   /old_locus_tag="BA0481"
FT   CDS_pept        480505..482139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0481"
FT                   /old_locus_tag="BA0481"
FT                   /product="phage minor structural protein"
FT                   /note="identified by match to protein family HMM TIGR01665"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24506"
FT                   /db_xref="InterPro:IPR007119"
FT                   /db_xref="InterPro:IPR010572"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0PQF0"
FT                   /protein_id="AAP24506.1"
FT                   /translation="MKHIKLYDKQLQLKAYLENAFKIKYSPPLNELWTAGFSLPFTDPK
FT                   REEIETFDYVEIFDNGKRIGLFRIMDSEEEREVSQKIITYDCEHVLSTLMDSVLFGYHE
FT                   RINLTTRENIEYLLSKQRIKHWKLGQCDFVKYFQYSWENEDTILGPIYSIAKPFDEKFQ
FT                   WTWDDTSYPWTLNLVKYSDEITGELRYRKNMKGIKRKVEAKDVMTRIYPLGYGEGVNQL
FT                   NIKSVNNGLPYIDAPDFVRELQDGFDYIWVDRRFEDPKTLYASAKAMLLKACMPKVTYE
FT                   IDAIDYELIDPYKIEKYETGKLVRLYDEDFNISVDLRVMDRSKDDVTGNPLDVKLVLEN
FT                   KVTDIGTIQADIEKRQKVNEVYSQGTTNIDSQPFQDNCDPDHPAIIRFQIPNDVKNVNQ
FT                   LILTFETLRFRAYERAIKGGGAVVASTSAGGANVSSTSSGGGTVGSTSSGGSSVQASSS
FT                   GGGTVKASSSGGDHVHKMFHGGGIVPAEPSTIGLYTAFSDPGRNTSASFYAKGTGSSFY
FT                   TYGSSGNHTHDISIPNHTHSININHKI"
FT   gene            482157..482636
FT                   /locus_tag="BA_0482"
FT                   /old_locus_tag="BA0482"
FT   CDS_pept        482157..482636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0482"
FT                   /old_locus_tag="BA0482"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to OMNI:VC0742"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24507"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYU9"
FT                   /protein_id="AAP24507.1"
FT                   /translation="MQTIEIHTQGGLKHKVQTEVYNAEALNTKLNDNDLITVLIGDFII
FT                   QRIDVKRIIPLNMIDAEGAKRVEVHTNAGKVIEITTNDYDPIYLNEQLNNNNTITVVIG
FT                   DYIFSRIDVKQVVPVKEEPKEPEQPPVTEPEKPTEPVTPPGEGTEDDSITTTEQL"
FT   gene            482731..482970
FT                   /locus_tag="BA_0483"
FT                   /old_locus_tag="BA0483"
FT   CDS_pept        482731..482970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0483"
FT                   /old_locus_tag="BA0483"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:EF2804"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24508"
FT                   /db_xref="GOA:A0A3P1TXR5"
FT                   /db_xref="InterPro:IPR019715"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TXR5"
FT                   /protein_id="AAP24508.1"
FT                   /translation="MAELKHDDMKELLVGLTRVETKLDTLGNVKEVAIEAQQSAKSAHL
FT                   RVDRLDKLVFWLGTTVIGAVIVGAITALFKFAGK"
FT   gene            483043..483186
FT                   /locus_tag="BA_0484"
FT                   /old_locus_tag="BA0484"
FT   CDS_pept        483043..483186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0484"
FT                   /old_locus_tag="BA0484"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24509"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0PQP2"
FT                   /protein_id="AAP24509.1"
FT                   /translation="MLGFLFTKFGVPEAKSFLDELAPYLLSVGIALGIWSDHDVNSEGD
FT                   DK"
FT   gene            483186..483983
FT                   /locus_tag="BA_0485"
FT                   /old_locus_tag="BA0485"
FT   CDS_pept        483186..483983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0485"
FT                   /old_locus_tag="BA0485"
FT                   /product="putative prophage LambdaBa04, glycosyl hydrolase,
FT                   family 25"
FT                   /note="identified by match to protein family HMM PF01183"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24510"
FT                   /db_xref="GOA:A0A347ZYV1"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR021976"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYV1"
FT                   /protein_id="AAP24510.1"
FT                   /translation="MGHIIDISKWNGDINWSIAKQHIDFIIARVQDGSNYVDPLYKGYV
FT                   QAMKQHGIPFGNYAFCRFVSIADAKKEAQDFWNRGDKSATVWVADVEVKTMNDMRAGTQ
FT                   AFIDELYRLGAKKVGLYVGHHMYTPFGMANVKSDFVWIPRYGGNKPAYPCDIWQYTETG
FT                   NVPGIGKCDLNSLIGNKSLSWFTESATQESVQAPTQNIIQSGAFSPYETPDVTGALTSL
FT                   KMTAKFILKPDGLTYFISDPTSDAQLNAMKEYLDRKGWWYEVK"
FT   gene            complement(484037..484339)
FT                   /locus_tag="BA_0486"
FT                   /old_locus_tag="BA0486"
FT   CDS_pept        complement(484037..484339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0486"
FT                   /old_locus_tag="BA0486"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24511"
FT                   /db_xref="GOA:A0A2P0H9N2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H9N2"
FT                   /protein_id="AAP24511.1"
FT                   /translation="MQQLKQSEAASGEKLILKREDSKSEKTVLILCIILALPTIGISLL
FT                   FLVLYGLIKERNRKTYLVKNVATGERFHVDKEDFKQYEKEFKAKEKEVKKISDLQ"
FT   gene            484752..485489
FT                   /gene="truA2"
FT                   /locus_tag="BA_0487"
FT   CDS_pept        484752..485489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA2"
FT                   /locus_tag="BA_0487"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="identified by similarity to SP:Q45557; match to
FT                   protein family HMM PF01416; match to protein family HMM
FT                   TIGR00071"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ49994"
FT                   /db_xref="GOA:A0A347ZYV3"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYV3"
FT                   /protein_id="ACZ49994.1"
FT                   /translation="MNNYKLTIQYDGARFKGWQRLGNNDNTIQGKIESVISEMVGKETE
FT                   IIGCSRTDAGVHALNQVANFQSDEKLVEHKVKKYLNQYLPNDISITNVEEVHDRFHARY
FT                   NSKAKTYLYKIWNEEHTNPFMRKYSMHVNKKLNVKSMKEAAKHLVGSHDFTAFSNAKSK
FT                   KKSMVREVYSLEVMEEAGFVQIRVSGNGFLHNMVRKIVGALIEVGLGQLAAEAIPQILE
FT                   AKQRNQINCLAEASGLYLENVEF"
FT   gene            complement(485540..485743)
FT                   /locus_tag="BA_0488"
FT                   /old_locus_tag="BA0488"
FT   CDS_pept        complement(485540..485743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0488"
FT                   /old_locus_tag="BA0488"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24512"
FT                   /db_xref="GOA:A0A3P1TXR1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TXR1"
FT                   /protein_id="AAP24512.1"
FT                   /translation="MSNDNKLNLLQYLYFFPAILCMMLFINTDTSSFPYAKLLATISGS
FT                   FAAIMLAAFWNLKIRMKREKSS"
FT   gene            complement(485827..487230)
FT                   /gene="rocR1"
FT                   /locus_tag="BA_0489"
FT                   /old_locus_tag="BA0489"
FT   CDS_pept        complement(485827..487230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocR1"
FT                   /locus_tag="BA_0489"
FT                   /old_locus_tag="BA0489"
FT                   /product="arginine utilization regulatory protein RocR"
FT                   /note="identified by similarity to SP:P38022; match to
FT                   protein family HMM PF00158; match to protein family HMM
FT                   PF02954; match to protein family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24513"
FT                   /db_xref="GOA:A0A2P0H9N1"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H9N1"
FT                   /protein_id="AAP24513.1"
FT                   /translation="MRTEEINLKQIIEMNMLYETLLNELDIGIHIINEESKTIIYNRKM
FT                   MEIESMERSDVLYKSPLEVFAFEENKNSTLIEALKLGKTNKNIKQTYFNNKGQEITTIN
FT                   DTFPIIENGKIKGAIEISKEMNHLKQTIKMDSFRKQNTKFTFDHIIGDSEAIQSTIAEG
FT                   KRVIRTSSSILLVGETGTGKELFAQSIHNESQRSTKPFISQNCAAIPDTLMESLLFGTN
FT                   RGAFTGAIDKAGLFEEANGGTLLLDEINSLSPALQAKLLRAIQEKTIRRIGGTQEKEID
FT                   VRIIATINEDPLEAITHNRLREDLYYRLSVVTLCLPPLRERKEDIPALVQHFIEKYNIQ
FT                   FGLSVTDVDIHVREFLYAYDWPGNVRELEHIIEGSMNLVEDENIITAFHLPTRFREQIK
FT                   KEFNTQPFLTNNATDAPKTLKHTIAEMEKNYITQILKEYHGNISQAAKFLGLSRQNLQY
FT                   RIKKLHLHI"
FT   gene            487504..487758
FT                   /locus_tag="BA_0490"
FT                   /old_locus_tag="BA0490"
FT   CDS_pept        487504..487758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0490"
FT                   /old_locus_tag="BA0490"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01BH3947; match
FT                   to protein family HMM PF00364"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24514"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TXV2"
FT                   /protein_id="AAP24514.1"
FT                   /translation="MKTVIEGVYSPCYGKVEKLFVKESSYVYEWEKLALIETIDKQKVE
FT                   IKVGISGYIESLEVVEGQAIADQKLLITMRDDLLITGSD"
FT   gene            487863..489284
FT                   /locus_tag="BA_0492"
FT                   /old_locus_tag="BA0492"
FT   CDS_pept        487863..489284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0492"
FT                   /old_locus_tag="BA0492"
FT                   /product="amino acid permease family protein"
FT                   /note="identified by similarity to EGAD:24467; match to
FT                   protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24515"
FT                   /db_xref="GOA:A0A3P1TXQ7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TXQ7"
FT                   /protein_id="AAP24515.1"
FT                   /translation="MMNQNQGLKRELKSRHIFMIALGGVIGTGLFLGSGYTIHEAGPGG
FT                   AIVAYLVGGFVMYLTMLCLGELAVAMPDAGSYQTYATKHISPAAGYVVGWMSWLNWSAT
FT                   IGIELIAVSILMKRWFPDVPSWIWCVVFAVLLFAINALSSRSFAEVEFWFASIKVITII
FT                   AFIILGGAAMFGFLDMKGNEPAPMFSSFTDYGGLFPNGLSAILITMIAVNFSFQGTELV
FT                   GIAAGESENPEKTIPKAINNTVWRILVFFVLSIFILAGLFPWQQAGVIESPFVVVFDKI
FT                   GIPYAADIINFVIITAVLSVANSGLYATSRMLWSMSNQGMISPIFGKLSKNGVPIYALI
FT                   VSTIVGCLSLLSGIYAEDTVYLWLLSIAGFGAILVWASIALSNLLARRSYIKQGGDVKD
FT                   LKFKTPLYPFVPLLALVLNVTVIVGMAFIPEQRMALYCGIPFMIVCLLFYRATRNKAHK
FT                   VEHIEKTDTTEVDSL"
FT   gene            489380..490660
FT                   /locus_tag="BA_0493"
FT                   /old_locus_tag="BA0493"
FT   CDS_pept        489380..490660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0493"
FT                   /old_locus_tag="BA0493"
FT                   /product="putative acetylornitine deacetylase"
FT                   /note="identified by similarity to GP:2634363; match to
FT                   protein family HMM PF01546; match to protein family HMM
FT                   PF07687; match to protein family HMM TIGR01910"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24516"
FT                   /db_xref="GOA:A0A347ZYV8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYV8"
FT                   /protein_id="AAP24516.1"
FT                   /translation="MNEEVSQLLEQIDLRKDELLELTKTLIRFETPAPPARNTNEAQEF
FT                   VAEFLRKRNFSVDKWDVYPNDPNVVGVKKGTESDTHKSLIINGHMDVAEVSADEAWETN
FT                   PFEPFIKDGWLVGRGAADMKGGLAGALFAIQLLQEAGIELPGDVIFQSVIGEEVGEAGT
FT                   LQCCKRGYDADFAVVVDTSDLHMQGQGGVITGWITVKSPQTFHDATRRQMIHAGGRLFG
FT                   ASAIEKMMKIVQSLQELERHWAVMKTYEGYPSGTTTINPAVIEGGRHAAFIADECRLWI
FT                   TVHFYPNETHEQIIKEIEEYIGKVAAADPWLSENPPQFKWGGESMIVDRGEIFPSLEID
FT                   SEHAAVKTLSSVHESILSKNAILDMSATVTDGGWFSEFHIPAVIYGPGTLEEAHSINEK
FT                   VEIEQLIEFTKVITAFIYEWCHTKKID"
FT   gene            complement(490755..491408)
FT                   /locus_tag="BA_0494"
FT                   /old_locus_tag="BA0494"
FT   CDS_pept        complement(490755..491408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0494"
FT                   /old_locus_tag="BA0494"
FT                   /product="DNA-binding protein"
FT                   /note="identified by similarity to OMNI:NTL01BS03362; match
FT                   to protein family HMM PF01381; match to protein family HMM
FT                   PF06803"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24517"
FT                   /db_xref="GOA:A0A3P1TXR3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TXR3"
FT                   /protein_id="AAP24517.1"
FT                   /translation="MPKDNPNERLSKLIKKLLKERALSMRQLGMLTSIDPATISRIMNG
FT                   KQPPKQKHLQKFAECLQVPPQLLFDEMYPDSPHINKEKTDMYTSLDTIQQTLQSSNLFD
FT                   FDYTTTRVKQELENYERYAQTTEGEKRIHESFASKLEQIDSAGPFIEQLTDMYQQFCNE
FT                   TISKEERAVLGGALLYFILSTDIIPDYLFPIGYLDDAIAVELAKEKLIELKRKT"
FT   gene            491538..492149
FT                   /locus_tag="BA_0495"
FT                   /old_locus_tag="BA0495"
FT   CDS_pept        491538..492149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0495"
FT                   /old_locus_tag="BA0495"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:15022957; match to
FT                   protein family HMM TIGR02840"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24518"
FT                   /db_xref="GOA:A0A3P1TYT0"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR014205"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TYT0"
FT                   /protein_id="AAP24518.1"
FT                   /translation="MSTAGLFSIFLIGIASNLDNAGVGIAYGIRKIRISWFNNFIIAFL
FT                   GFLFTLLAGFFGNWIALFISEFTANLIGAIVLGIIGVFILCQPFLGQKNTVGSKDGNVL
FT                   MGILRDPEKADFDGSKTISFSEAVVLGVALSINNIAGGFDAGVTNLNLWLTATISGVFS
FT                   FICISGFAYVGKRFLAEYLGKWATVIAGLLLIFIGIDQLL"
FT   gene            492264..492422
FT                   /locus_tag="BA_0496"
FT                   /old_locus_tag="BA0496"
FT   CDS_pept        492264..492422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0496"
FT                   /old_locus_tag="BA0496"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24519"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384K8X2"
FT                   /protein_id="AAP24519.1"
FT                   /translation="MGRGKAFDHKKKGHDHQPPKGAFIHKDVNEHTLEEEELPVNIEAY
FT                   KNSLKKH"
FT   gene            complement(492445..492786)
FT                   /locus_tag="BA_0497"
FT                   /old_locus_tag="BA0497"
FT   CDS_pept        complement(492445..492786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0497"
FT                   /old_locus_tag="BA0497"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:SA1849"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24520"
FT                   /db_xref="InterPro:IPR025083"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2B0Y7B4"
FT                   /protein_id="AAP24520.1"
FT                   /translation="MKLIFQMGKQPVLEKTILLFILSIVESLKLKVVSLDEAHRYIFNL
FT                   EVLELLMDRNIDDQVLELIHFGMGLEDIHHVLPEELEHTIEELKWLCIQVLSEYSMHEE
FT                   SEQLIEDIR"
FT   gene            complement(492825..492977)
FT                   /locus_tag="BA_0498"
FT                   /old_locus_tag="BA0498"
FT   CDS_pept        complement(492825..492977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0498"
FT                   /old_locus_tag="BA0498"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24521"
FT                   /db_xref="GOA:A0A2P0H9P1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H9P1"
FT                   /protein_id="AAP24521.1"
FT                   /translation="MEHFLIQSYPAILAGFFHFIKISILSAIHDRTETVLKVSLYHAYL
FT                   LPPPE"
FT   gene            complement(492962..493891)
FT                   /gene="glsA1"
FT                   /locus_tag="BA_0499"
FT                   /old_locus_tag="BA0499"
FT   CDS_pept        complement(492962..493891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glsA1"
FT                   /locus_tag="BA_0499"
FT                   /old_locus_tag="BA0499"
FT                   /product="glutaminase A"
FT                   /EC_number="3.5.1.2"
FT                   /note="identified by similarity to SP:O87405; match to
FT                   protein family HMM PF04960"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24522"
FT                   /db_xref="GOA:Q81YY0"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81YY0"
FT                   /protein_id="AAP24522.1"
FT                   /translation="MQCIETNNLQQLLEQVKPYTKKGKLATYIPELGNANPDDLGIAIF
FT                   HKETEYIHAGNSQTLFTLQSISKVITLALALLDRGEEYVFSKVGMEPTGDPFNSIIKLE
FT                   TTSPSKPLNPMINAGALAITSMLAGKDNEEKMERILHFVREITDNPTINYSSKVANSEL
FT                   ETAYLNRSLCYYMKQNGIIDCDIEELMDLYTRQCAVEVNCIDLARIGLIFAMDGYDPYK
FT                   KKQIIPKHITKICKTFMVTCGMYNESGEFAIRVGIPAKSGVAGGIFGCVKGEMGIGIFG
FT                   PALDANGNSIAGFKILELLSAQEGWSIF"
FT   gene            493961..494074
FT                   /locus_tag="BA_0500"
FT                   /old_locus_tag="BA0500"
FT   CDS_pept        493961..494074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0500"
FT                   /old_locus_tag="BA0500"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H9P3"
FT                   /protein_id="AAP24523.1"
FT                   /translation="MKKWNDKTKVTCSILGLSFRVFYSEKGEFSFYITVWK"
FT   gene            494216..495709
FT                   /locus_tag="BA_0501"
FT                   /old_locus_tag="BA0501"
FT   CDS_pept        494216..495709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0501"
FT                   /old_locus_tag="BA0501"
FT                   /product="putative PTS system, N-acetylglucosamine-specific
FT                   IIBC component"
FT                   /note="identified by similarity to OMNI:NTL01EC00662; match
FT                   to protein family HMM PF00367; match to protein family HMM
FT                   PF02378; match to protein family HMM TIGR00826; match to
FT                   protein family HMM TIGR01998"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24524"
FT                   /db_xref="GOA:A0A347ZYW4"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010974"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYW4"
FT                   /protein_id="AAP24524.1"
FT                   /translation="MLQFLQRIGKALMLPIAVLPAAGLLLRLGQEDVFNIPVMAQAGAA
FT                   IFDNLALIFAIGVAIGLSVDGSGAAGLAGAIGYLVLQNTTNALSKTYSAAELNDKLKSV
FT                   QDLVGSVDPTKLADTMTKVSKAAALTPKINMAILGGIIAGVVAGLLYNKFHKIKLPEWL
FT                   GFFAGKRFVPIITSIVMLLLGLVFGQIWPTIQSGIDAVAHGIVNLGSIGAGLFGLLNRL
FT                   LIPIGLHHVMNTYFWFVLGDFTNAAGDIVHGDIARFFAKDPSAGMFMTGFFPVMMFGLP
FT                   AACFAMIAAAKPEKRKMVTGMLGGLALTSFLTGITEPIEFSFMFLSPVLYGIHAVLTGL
FT                   SLFITTTLGIHDGFSFSAGAIDYVLNFGIATKPLLLAGIGLIYAAIYFVVFYFLIKKFD
FT                   LKTPGREDEEEMAEGEEAPVAGSIGETYVAALGGKENLTVIDNCATRLRLQVKDAGQVN
FT                   EAALKRAGAKGVMKLSNTSVQVIVGTNVESVADDMKKHV"
FT   gene            495964..497202
FT                   /locus_tag="BA_0502"
FT                   /old_locus_tag="BA0502"
FT   CDS_pept        495964..497202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0502"
FT                   /old_locus_tag="BA0502"
FT                   /product="putative penicillin-binding protein"
FT                   /note="identified by similarity to EGAD:108570; match to
FT                   protein family HMM PF00144"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24525"
FT                   /db_xref="GOA:A0A3P1U0G8"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1U0G8"
FT                   /protein_id="AAP24525.1"
FT                   /translation="MDQEKNNANGKSRRPIVYIKRTIILVLLFSLVYFMYTKIVTHNKK
FT                   EEILKAAEMKKQEELKKKEEKKKQEAQKQKEQEEQVKQAQAAEQPAEGPPQEINENAQL
FT                   DQYLQNIGFSGTAVIVKNGKVLVNKGYGMANKEKQVPNNSETTFYIGSISKAFVATAIM
FT                   QLKDQHKLNVEDTIAKYIPDFPQGNSIQLKHLLTHTSGIPEYEQGAEDISHEELIKRIG
FT                   KQKRIGSPGEKWKYSDSNYSILAYIAEKVSGQPLEEYIKQHIFAPAGMKHSGFGRELEQ
FT                   TRFPSTGYKIVNNNMTTPNIPSMSQLYGCGDIYTSAHDLYLFNEALFSGKLISKESYDQ
FT                   MFTGGKKDYGFGWYVDPGSYSNHGVMPGWNCLNGFSKNGSVYVVLLSNIQNNIKSFGKV
FT                   NNDIYTMLRNIEV"
FT   gene            497356..497757
FT                   /locus_tag="BA_0503"
FT                   /old_locus_tag="BA0503"
FT   CDS_pept        497356..497757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0503"
FT                   /old_locus_tag="BA0503"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24526"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9VH01"
FT                   /protein_id="AAP24526.1"
FT                   /translation="MCLFGKYWKKLSRLFNRQLDYFLDNKLLPAVERLLFSQNFARFIQ
FT                   RNSKQATEEFIESSKFQSIICNILKECNTSPFKEIAEQYLGKNVEITVTVGQLTGVIVA
FT                   VGDDFLILQEGIGTEVLLPFASIISIKEA"
FT   gene            497774..497968
FT                   /locus_tag="BA_0504"
FT                   /old_locus_tag="BA0504"
FT   CDS_pept        497774..497968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0504"
FT                   /old_locus_tag="BA0504"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01OI0577"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24527"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1T3V339"
FT                   /protein_id="AAP24527.1"
FT                   /translation="MLFTDELRNHVGELVQVVTAVEIVSGVLLSVTDGAVSVRTSPSYG
FT                   PPEDVIVRIPVIAYVRLEG"
FT   gene            497943..499529
FT                   /locus_tag="BA_0505"
FT                   /old_locus_tag="BA0505"
FT   CDS_pept        497943..499529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0505"
FT                   /old_locus_tag="BA0505"
FT                   /product="glycosyltransferase, group 2 family"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24528"
FT                   /db_xref="GOA:A0A0F7RJJ5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RJJ5"
FT                   /protein_id="AAP24528.1"
FT                   /translation="MPMFAWKGKRDKSMKVSVVIPVHNEASTLSKVLAEVKKLEPYEII
FT                   IVDNGSTDGTKEIALQHHCRVIYYNHSLGNDVGRAIGAREAKGEIVLFLDGDIVMKSEE
FT                   LYPFIKGIQQGHQIVLNNLTWSVYLKVRPHYTTVGKYMLNRYLNKKEFVVGSLIAIPHA
FT                   ISREVIEKLGWWNLADPALFQAMAMSRGVDISDMASVDVIYTNKVRPVHTGTSPDSPYP
FT                   KATSRIMGDHLRALQYITETYGKRGGFSEGNRDREFIGKYKPVVLKKEKAKYSAIIPVS
FT                   EEKTTIRSVIQEVKKAGVDEIIIVANGADIETIKQVNLENVIVVEVTKTLGNNVARAIG
FT                   AMHATAEICLFVDGDYAIPAKKLVPFLRAIEDGSDMALNDLQCLLDIFHPADPISMGKY
FT                   FVNLVAKRPDLWNNSLTAVPHAIRKKVIEKIGYDSLIIPPLAQMKAILEGFSITTVEFV
FT                   DVIKTNRVRPEQHEFVNGRISAFDRIFGDQLEAIAYLLQHTDERGGFTDGDRDREIIQQ
FT                   LRREEENTNEY"
FT   gene            499519..500762
FT                   /pseudo
FT                   /locus_tag="BA_0506"
FT                   /old_locus_tag="BA0506"
FT                   /note="putative polysaccharide biosynthesis protein,
FT                   authentic frameshift; an automated process has identified a
FT                   potential problem with this gene model; it may contain one
FT                   or more premature stops and/or frameshifts"
FT   gene            500759..501724
FT                   /locus_tag="BA_0507"
FT                   /old_locus_tag="BA0507"
FT   CDS_pept        500759..501724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0507"
FT                   /old_locus_tag="BA0507"
FT                   /product="NAD-dependent epimerase/dehydratase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01073; match to protein
FT                   family HMM PF01370; match to protein family HMM PF02719;
FT                   match to protein family HMM PF04321; match to protein
FT                   family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24529"
FT                   /db_xref="GOA:A0A347ZYX1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYX1"
FT                   /protein_id="AAP24529.1"
FT                   /translation="MSKKCLITGGAGFIGSHLAEELVGRGYNVTIVDNFYKGKNKYHDE
FT                   LMKEIRVIPISVLDKNSIYELVNQHDVVFHLAAILGVKTTMEKSIELIETNFDGTRNIL
FT                   QAALKGKKKVVFASTSEVYGKAKPPFSEEGDRLYGATSKIRWSYAICKTLEETLCLGYA
FT                   LEGLPVTIVRYFNIYGPRAKDGPYAGVIPRFISAALQGEDILVYGDGEQTRCFTYVSDA
FT                   VEATIRAMDEKVNGEIINIGSENEKSIKEVAEVIKKLTDSSSKIVQVPFEEVYPHGFEE
FT                   IPNRRPDVTKLKDLVQFQAKVTWEDGLKETIKWFREEDNG"
FT   gene            501717..503261
FT                   /locus_tag="BA_0508"
FT                   /old_locus_tag="BA0508"
FT   CDS_pept        501717..503261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0508"
FT                   /old_locus_tag="BA0508"
FT                   /product="glycosyltransferase, group 2 family"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24530"
FT                   /db_xref="GOA:A0A2P0H9P5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H9P5"
FT                   /protein_id="AAP24530.1"
FT                   /translation="MAKSLSVIIPAWNEIDTISDVIQSVKGLNPLEIIVVANGCTDGTE
FT                   TVAEHLGCKVLRYTEKLGNDVGRAAGAKESIGDVLLFIDGDFAIQTSKLQLFLNPILYN
FT                   QADVVLNNLDALFLKRQKPNSITVWRQILNSILEREELKIDSLLAVPHALTKEVVQSIG
FT                   YECFVNPILAHLRLVQGKWRISRHCAIDVITPNKFRPTEHAAYGTDLSPSEKRMIGDHI
FT                   EAVAERIVGSDERGGYCDGNRKRDSVYHTLDFEDFYQGWGVTSNLYKGKQLSVIIPVQD
FT                   EEKTIGNVIEELRKIEPFEIIVVVNGSSDQTATIAKDKGATTIVYKEALGNDVGRSLGT
FT                   YFAKGEIVLFIDGDFVIPASELYPFAKAIADGTDVALNDLNHYLDLRVPLHLVTAFKYA
FT                   LNLACDRKDLGVGSLIAVPNAFSRKCLKQIGYRSLLAPCVAQVKAILSGFEVACVSRVE
FT                   VDKMNRIRPSEHFAKIGHPPAVLRIIGDHIEGLEQLIGLTGSRGGFHDGNRKRDIL"
FT   gene            503601..505850
FT                   /gene="pfl"
FT                   /locus_tag="BA_0509"
FT                   /old_locus_tag="BA0509"
FT   CDS_pept        503601..505850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfl"
FT                   /locus_tag="BA_0509"
FT                   /old_locus_tag="BA0509"
FT                   /product="formate C-acetyltransferase"
FT                   /EC_number="2.3.1.54"
FT                   /note="identified by match to protein family HMM PF01228;
FT                   match to protein family HMM PF02901; match to protein
FT                   family HMM TIGR01255"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24531"
FT                   /db_xref="GOA:A0A3P1TZC3"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TZC3"
FT                   /protein_id="AAP24531.1"
FT                   /translation="MTQVLENVKNAWENFKGEKWKAEIDVRDFILNNVNVYEGDESFLA
FT                   GATEATKQLWDQVMDLTTKERENGGVLDMDTKIVSSITSHEPGYLNKETEKVVGFQTDK
FT                   PFKRSLQPYGGIRMAEQACESYGYEMDKELSRIFRDWRKTHNQGVFDAYTPEMRAARKS
FT                   GVITGLPDAYGRGRIIGDYRRVALYGVDHLIEAKKADLNLTGGVMSEDTMRLREELSEQ
FT                   IRALQELKQMAASHGFDISKPATNAQEAFQWLYFAYLAAIKEQNGAAMSLGRTSTFLDI
FT                   YIERDLANGTLTEEDVQEIVDHFIMKLRLVKFARTPDYNELFSGDPTWVTESIGGMALD
FT                   GRPLVTKNSFRFLHTLDNLGPAPEPNLTVLWSKQLPQNFKNYCAKMSIKTSAIQYENDD
FT                   IMRADYGDDYGIACCVSAMRIGKQMQFFGARANLAKALLYAINGGKDEKSKAQVGPEYA
FT                   PITSEVLDYEEVMHKFDMTMEWLAGLYLNTLNVIHYMHDKYSYERIEMALHDTNVLRTM
FT                   ATGIAGLSVVADSLSAIKYAKVKPIRDENGIAVDFEIEGDFPKYGNNDDRVDEIAVNLV
FT                   KTFMNKLRKHKTYRNSVHTMSILTITSNVVYGKKTGNTPDGRRTGEPFAPGANPMHGRD
FT                   TKGALASLLSVAKLPYEDAQDGISNTFSIIPKALGKEDEVQVRNLVSMLDGYAVKEGHH
FT                   LNINVFNRETLMDAMEHPEKYPQLTIRVSGYAVNFIKLTREQQIDVINRTMHESM"
FT   gene            505920..506651
FT                   /gene="pflA"
FT                   /locus_tag="BA_0510"
FT                   /old_locus_tag="BA0510"
FT   CDS_pept        505920..506651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pflA"
FT                   /locus_tag="BA_0510"
FT                   /old_locus_tag="BA0510"
FT                   /product="pyruvate formate-lyase-activating enzyme"
FT                   /EC_number="1.97.1.4"
FT                   /note="identified by similarity to SP:P09374; match to
FT                   protein family HMM PF04055; match to protein family HMM
FT                   TIGR02493"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24532"
FT                   /db_xref="GOA:A0A2P0H9R0"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012838"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="InterPro:IPR034465"
FT                   /db_xref="InterPro:IPR040074"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H9R0"
FT                   /protein_id="AAP24532.1"
FT                   /translation="MVKGRIHSVESCGTVDGPGIRYVIFTQGCLLRCQYCHNADTWEIG
FT                   KGKEITVEEVMQDVTCYLPFIEASGGGITVSGGEPLLQLDFLIELFKKCKEIGIHTTID
FT                   SSGGCYSEETEFQNKLDILMEYTDLVLLDLKHIDSKKHRKLTGKPNEHILQFARYLSDK
FT                   NKPIWVRHVLVPGVTDNEEDLQKLSSFIQSLSNVQKIEVLPYHKLGVYKWEALGHKYPL
FT                   ANVEPPTEKNVEQARHILQAV"
FT   gene            507064..508230
FT                   /locus_tag="BA_0511"
FT                   /old_locus_tag="BA0511"
FT   CDS_pept        507064..508230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0511"
FT                   /old_locus_tag="BA0511"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:45732; match to
FT                   protein family HMM PF04101; match to protein family HMM
FT                   PF06925"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24533"
FT                   /db_xref="GOA:Q81YW9"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="InterPro:IPR009695"
FT                   /db_xref="InterPro:IPR023589"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81YW9"
FT                   /protein_id="AAP24533.1"
FT                   /translation="MIKNPKVLILTAHYGNGHVQVAKTLEQTFRQKGIKDVIVCDLFGE
FT                   SHPVITDITKYLYLKSYTIGKELYRLFYYGVEKIYDKKIASWYANFGRKRLKLLLQAEK
FT                   PDIVINTFPIIAVPELKKQTGISIPVYNVLTDFCVHKIWIHREVDRYFVATDHVKKVMV
FT                   DIGVPAEQIVETGIPIRSSFELKINPDIIYNKYQLCKNKKILLIVAGAHGVLGSVKELC
FT                   QSFMSVPDLQVVVVCGKNEALKQDLVGVQETNPDALKVFGYVENIDELFRVTSCMITKP
FT                   GGITLSEAAALQVPVILYKPVPGQENENAMYFERKGAAVVIRDDSEVFAKTEALLQDDM
FT                   KLLQMKEAMKSIYRPEPADHIVDTILAENHVEPNHIPIKSPALAQSFT"
FT   gene            complement(508595..508714)
FT                   /locus_tag="BA_0512"
FT                   /old_locus_tag="BA0512"
FT   CDS_pept        complement(508595..508714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0512"
FT                   /old_locus_tag="BA0512"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01BH0924"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24534"
FT                   /db_xref="InterPro:IPR025437"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2B3Y9N7"
FT                   /protein_id="AAP24534.1"
FT                   /translation="MDKKKRDKTKNALSSTQEVLYQREFRKADRAAGYRSKSI"
FT   gene            complement(508825..509382)
FT                   /locus_tag="BA_0513"
FT                   /old_locus_tag="BA0513"
FT   CDS_pept        complement(508825..509382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0513"
FT                   /old_locus_tag="BA0513"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01BH0925"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24535"
FT                   /db_xref="GOA:A0A3P1U0F9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1U0F9"
FT                   /protein_id="AAP24535.1"
FT                   /translation="MLKKRDLHDSHVLYELMVDPAVFPFVRQKAYSYEEYLFLTKQTIE
FT                   AEERGELISRTILDEWGNPIGTITLFDVQEKAGFLGTWLGKPYHGKGYNKLAKDSFFSE
FT                   LFYELDIETIFMRIRKINIRSIKAAEKLQYVNLANETRKAVYDEINANEEVYNLYEIPK
FT                   DQYTLATMRDTTFQDAHHLKEA"
FT   gene            complement(509624..510754)
FT                   /locus_tag="BA_0514"
FT                   /old_locus_tag="BA0514"
FT   CDS_pept        complement(509624..510754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0514"
FT                   /old_locus_tag="BA0514"
FT                   /product="chlorohydrolase family protein"
FT                   /note="identified by match to protein family HMM PF01979;
FT                   match to protein family HMM PF07969"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24536"
FT                   /db_xref="GOA:A0A347ZYX8"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYX8"
FT                   /protein_id="AAP24536.1"
FT                   /translation="MKILLKQAMVYPITSQKFQGDVLVIGEKIAEVKPFIQPTQDMTVI
FT                   DARALHLLPGFIDVHTHLGLYDEGTGWAGNDANETSEVSTPHIRSLDGIHPLDIAFQDA
FT                   VQNGITTVHVMPGSQNIIGGTTCVIKTAGTCIDHMIIQEPAGLKIAFGENPKKVHSNGT
FT                   KESITRMGIMGLLRESFYEAQHYGHEADFRMLPILKALRREIPVRIHAHRADDISSALR
FT                   FATEFNLDLRIEHCTEGHFIIEELSKHNLKVSVGPTLTRRSKIELKNKTWDTYHILSKN
FT                   GVEVSITTDHPYTPIQYLNLCAAVAVREGLDEKTALEGITIFPARNLRLEDRIGSIEVG
FT                   KDADLVLWTHHPFHYLAKPVLTMIDGKIIYKKNKKN"
FT   gene            complement(510895..511800)
FT                   /locus_tag="BA_0515"
FT                   /old_locus_tag="BA0515"
FT   CDS_pept        complement(510895..511800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0515"
FT                   /old_locus_tag="BA0515"
FT                   /product="cell division inhibitor-like protein"
FT                   /note="identified by match to protein family HMM PF01370;
FT                   match to protein family HMM PF08338; match to protein
FT                   family HMM TIGR01777"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24537"
FT                   /db_xref="GOA:A0A347ZYX9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYX9"
FT                   /protein_id="AAP24537.1"
FT                   /translation="MKIAISGGTGFIGTYLSTFFIQKGYTVYILTRKKTTETSHPNLQY
FT                   VQWTPDLQTFPLSSIDVVINLAGESINSRWTKKQKKIILNSRIQTTKGLIKQLQALPAK
FT                   PHTFINASAIGYYGTSETESFTEQHVTPGNDFLANTVYSWEQEASKARSLGIRTIYARF
FT                   GVILGPDGGALPKMLLPYQFYIGGTVGSGKQWLSWIHIDDVASMIDFIIHKKEIDGPLN
FT                   ITAPEPIRMKGFGETIATIMKKPHWLPVPSFMLHALLGEMSILVLEGQHVLPSKAIEHG
FT                   YQYTFPTIDHALQNILSHTM"
FT   gene            511882..512694
FT                   /locus_tag="BA_0516"
FT                   /old_locus_tag="BA0516"
FT   CDS_pept        511882..512694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0516"
FT                   /old_locus_tag="BA0516"
FT                   /product="recX domain protein"
FT                   /note="identified by similarity to GP:10173539; match to
FT                   protein family HMM PF02631"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24538"
FT                   /db_xref="GOA:Q81YW4"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81YW4"
FT                   /protein_id="AAP24538.1"
FT                   /translation="MAVITKIEVQKRSKERFNIYIDKGQGEEYGFSVNEVILIKHGLQK
FT                   GLEIDEIALGNILYNEEVQKAYLQAISYLSYQMRTKLEIEDFLRKKEVGQAIISEVVSK
FT                   LLHDRYINDKEYAILYTRTQSNVNRKGPTVIKRELLNKGVQDLIIMHSLQEYTKEKQIE
FT                   NALILIEKKKKSYQKHSFLQMKLKLDEMLVRKGYSRDVIQICLEELKDEKDDEKQQEAL
FT                   HYHGNKYYEKYKKYDGWTFENKMKQALYRKGFSIDEIEIFLQMKREEG"
FT   gene            512710..513021
FT                   /locus_tag="BA_0517"
FT                   /old_locus_tag="BA0517"
FT   CDS_pept        512710..513021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0517"
FT                   /old_locus_tag="BA0517"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:108273; match to
FT                   protein family HMM PF08838"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24539"
FT                   /db_xref="InterPro:IPR014938"
FT                   /db_xref="InterPro:IPR036289"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H9P4"
FT                   /protein_id="AAP24539.1"
FT                   /translation="MPKRYSEMTPYELREEIGVLKEQAIKAEQLGIVNEFDVLMRKIAM
FT                   ARAYMTDINKFHIGETYELVEEPGILFEITYFNGVFAWGHKQNDNEEIGIPISLLQEK"
FT   gene            complement(513086..513238)
FT                   /locus_tag="BA_0518"
FT                   /old_locus_tag="BA0518"
FT   CDS_pept        complement(513086..513238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0518"
FT                   /old_locus_tag="BA0518"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24540"
FT                   /db_xref="InterPro:IPR025413"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TYR5"
FT                   /protein_id="AAP24540.1"
FT                   /translation="MSYRDRLDSRSELFNHTWTRPKHAKAQVNGQTQQTQSLIILANEC
FT                   KKRQF"
FT   gene            complement(513282..513440)
FT                   /locus_tag="BA_0519"
FT                   /old_locus_tag="BA0519"
FT   CDS_pept        complement(513282..513440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0519"
FT                   /old_locus_tag="BA0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01BH0929; match
FT                   to protein family HMM PF08176; match to protein family HMM
FT                   TIGR03091"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24541"
FT                   /db_xref="GOA:Q81YW1"
FT                   /db_xref="InterPro:IPR012611"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81YW1"
FT                   /protein_id="AAP24541.1"
FT                   /translation="MGKQAEFWSESKNNSKIDGQPKAKSRFASKRPNGTINTHPQERMR
FT                   AANQQEE"
FT   gene            513562..513828
FT                   /locus_tag="BA_0520"
FT                   /old_locus_tag="BA0520"
FT   CDS_pept        513562..513828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0520"
FT                   /old_locus_tag="BA0520"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01BH0930"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24542"
FT                   /db_xref="InterPro:IPR026952"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2B6BYW7"
FT                   /protein_id="AAP24542.1"
FT                   /translation="MNDIYEALTKELLEKNDKLSYAQARAWVELLWEDFQTTYAKSGRY
FT                   QGEEMTEQVVRSWINNHGGRLHEMRTNNPKYSHLINQEDHLKH"
FT   gene            complement(513853..514833)
FT                   /locus_tag="BA_0521"
FT                   /old_locus_tag="BA0521"
FT   CDS_pept        complement(513853..514833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0521"
FT                   /old_locus_tag="BA0521"
FT                   /product="yfhP protein"
FT                   /note="identified by similarity to PIR:H69801; match to
FT                   protein family HMM PF04307"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24543"
FT                   /db_xref="GOA:A0A3P1TZ85"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TZ85"
FT                   /protein_id="AAP24543.1"
FT                   /translation="MDTATHLVMGVTLGSLATLDPAIAQSDIGPQAVMLATIAGSNIPD
FT                   IDTVLKLRNNAKYIRNHRGITHSIPAVILWSFLISGISFAFFSDAPYLHLLLWSFIAVF
FT                   LHVFVDIFNAYGTQALRPFTKKWVALGIINTFDTVIFFIHILAIACMLVGSHKGYTALA
FT                   AYILMIIYYIGRIIMHRNIRSVVHKRFKNVEKIIISPSYRFYHYHLAVVTADYYYVARW
FT                   HRGNIMIYDKFDRVPFPDNAIMRAAKQDENISAFLSFSPVYRWDIFDYDHYYEVRFIDL
FT                   RYRSKDYYPFVAIVQLDHNLNIISSYTGWIFSEEKLRKKLELLPH"
FT   gene            514983..516080
FT                   /gene="mutY"
FT                   /locus_tag="BA_0522"
FT                   /old_locus_tag="BA0522"
FT   CDS_pept        514983..516080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="BA_0522"
FT                   /old_locus_tag="BA0522"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="identified by similarity to OMNI:NTL01BH0933; match
FT                   to protein family HMM PF00633; match to protein family HMM
FT                   PF00730; match to protein family HMM TIGR01084"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24544"
FT                   /db_xref="GOA:A0A2P0H9M1"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H9M1"
FT                   /protein_id="AAP24544.1"
FT                   /translation="MTLEILNNFNIEQFQNDLIGWFEKEQRDLPWRKNKDPYRVWVSEI
FT                   MLQQTRVEAVKPYYANFMGKFPTLEALANADDEEVLKAWEGLGYYSRARNLHAAVKEVK
FT                   EVYGGIVPSDVKKIEKLKGVGPYTKGAILSIAYGIPEPAVDGNVVRVLSRILSVWDDIA
FT                   KPKTRKVFEEIVREIISAENPSYFNQGLMELGALICIPKNPACLLCPVREHCRGYAEGV
FT                   QKELPVKSKAKAPTMVPIVAGVLQTEDGRYVINKRPSTGLLANMWEFPNVELGEGIRNQ
FT                   KEQLIDYMKEKFELSISIEEYAMNVQHTFTHRTWDIFVFYGKVTGDIVETDTLKFVSKE
FT                   AFEQLPFSKSHRTIYENCVEKITMQ"
FT   gene            complement(516115..516402)
FT                   /locus_tag="BA_0523"
FT                   /old_locus_tag="BA0523"
FT   CDS_pept        complement(516115..516402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0523"
FT                   /old_locus_tag="BA0523"
FT                   /product="yfhS protein"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24545"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0PRB1"
FT                   /protein_id="AAP24545.1"
FT                   /translation="MKKFRIYLLLLIQTIENGGGNMYIGRDMTELTMVSKNEWKEDELA
FT                   YFHHSLQQILPYLNAEGQSIYKEIVIEIESRGGLQEGEASWTHGTKISYD"
FT   gene            516465..516752
FT                   /locus_tag="BA_0524"
FT                   /old_locus_tag="BA0524"
FT   CDS_pept        516465..516752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0524"
FT                   /old_locus_tag="BA0524"
FT                   /product="small acid-soluble spore protein, gamma-type"
FT                   /note="identified by match to protein family HMM PF04259;
FT                   match to protein family HMM TIGR01442"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24546"
FT                   /db_xref="GOA:A0A3P1TXS7"
FT                   /db_xref="InterPro:IPR006341"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TXS7"
FT                   /protein_id="AAP24546.1"
FT                   /translation="MSKKQQGYNKATSGASIQSTNASYGTEFATETNVQAVKQANAQSE
FT                   AKKAQASGASIQSTNASYGTEFATETDVHAVKKQNAQSAAKQSQSSSSNQ"
FT   gene            516941..517201
FT                   /locus_tag="BA_0526"
FT                   /old_locus_tag="BA0526"
FT   CDS_pept        516941..517201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0526"
FT                   /old_locus_tag="BA0526"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:108291"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24547"
FT                   /db_xref="InterPro:IPR025572"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A8LBT3"
FT                   /protein_id="AAP24547.1"
FT                   /translation="MNDFDKLVGEQLETMDELLKLQAHLEKYQQIEMSEKDTCDKKELH
FT                   FIRQEIYRTELALKLLHEKFEEQTNSVIQSFETEKMISNLG"
FT   gene            517434..517964
FT                   /locus_tag="BA_0527"
FT                   /old_locus_tag="BA0527"
FT   CDS_pept        517434..517964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0527"
FT                   /old_locus_tag="BA0527"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01BH0942; match
FT                   to protein family HMM PF04167"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24548"
FT                   /db_xref="GOA:Q81YV4"
FT                   /db_xref="InterPro:IPR007295"
FT                   /db_xref="InterPro:IPR016882"
FT                   /db_xref="InterPro:IPR035930"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81YV4"
FT                   /protein_id="AAP24548.1"
FT                   /translation="MGFPKEGEKVQIHSYKHNGSIHRMWKETTILKGTQSLVIGANDRT
FT                   VVTESDGRTWITREPAICYFHENYWFNVIGMLREEGVYYYCNLSSPFAYDSEALKYIDY
FT                   DLDIKVYPDMTYTLLDEDEYEKHSQIMQYPPVIDTILKRNVAQLTQWIHQRKGPFAPDF
FT                   VDMWYERYLMYRN"
FT   gene            518019..519779
FT                   /locus_tag="BA_0528"
FT                   /old_locus_tag="BA0528"
FT   CDS_pept        518019..519779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0528"
FT                   /old_locus_tag="BA0528"
FT                   /product="ABC transporter, permease/ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24549"
FT                   /db_xref="GOA:A0A384L0Q3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L0Q3"
FT                   /protein_id="AAP24549.1"
FT                   /translation="MQGIKRYLQFVKPYRWLIAITIMIGLVKFGIPLIMPWLLKYIIDD
FT                   VIQGAGSLQDKTSQLVTAIGIAFFIFAVLRPPIEYYRQYFAQRIANTILYDLRKHIFGH
FT                   LQKLSLRYYSNTKTGEIISRVIHDVEQTKDFVITGLMNVWLDTATIAIAIIVMFSMNIK
FT                   LTFVALLILPIYVVAVKYFFGRLRKLTKERSQALATMQGYLHERIQGMQVTRSFALEEY
FT                   EGKQFEKRNNEFLTKALTHTSWTARTFSAVNTLTDLGPLLVIGFAAYEVIQGQLTLGTM
FT                   VAFVGYMDSLYSPLRRLVNSSTTLTQSFASMDRVFELLDEKYDIVNVPSAVQTKKLNGE
FT                   VIFDNVSFRYNADEKEILHNLSLTMLPGEKVALVGASGGGKSSLASLIPRFYDVSSGAV
FT                   YVDGIDVRKYDMRNLRSHIGIVLQDNLLFSDTIGANILYGNPKATEEEVIAAAKAAQIH
FT                   DFIIELPDGYDTVVGERGVKLSGGQRQRVAIARVFLKNPSLLILDEATPALDLENERYI
FT                   QEALQTLAADRTTIIIAHRLATITHVDTIIYIEDGEIKETGSHEELMKKRGYYYNLYQL
FT                   QHITETAPLA"
FT   gene            complement(519793..520881)
FT                   /locus_tag="BA_0529"
FT                   /old_locus_tag="BA0529"
FT   CDS_pept        complement(519793..520881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0529"
FT                   /old_locus_tag="BA0529"
FT                   /product="putative lipoprotein"
FT                   /note="identified by similarity to EGAD:108295; match to
FT                   protein family HMM PF06081"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24550"
FT                   /db_xref="GOA:A0A3P1TYR1"
FT                   /db_xref="InterPro:IPR010343"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TYR1"
FT                   /protein_id="AAP24550.1"
FT                   /translation="MKLGARILKTGIAITLALFACILLNLPSPVFAGISAIFAVQPSVY
FT                   RSYLTALEQIQANVIGAVFAIAFATAFGHNPFIIGLTCILVIALTLQLRLENTISIALV
FT                   TVIAIMEYQGEDFFSFALLRFATIMVGIIAASLVNLVFMPPKYETKLYHRIVDNTEEIV
FT                   KWIRMNSRQASDFTTLKTDIDRMKEKMIKLNHYYLLYKEERSYTKKVQFAKIRKLVLFR
FT                   QMLATTSRALSTLKSLHRTENELRYMPEEFQESIQNELDSLTHYHEQVLLKFIGKAKKQ
FT                   QSVEMLDEVETGKQELIDIFMEYQNKDDEEAYKTWLHLFPLISAIINYSEEVEHLDLLV
FT                   DSFYTYHKPEAELKIDDKKEDE"
FT   gene            complement(521142..525578)
FT                   /locus_tag="BA_0530"
FT                   /old_locus_tag="BA0530"
FT   CDS_pept        complement(521142..525578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0530"
FT                   /old_locus_tag="BA0530"
FT                   /product="putative glutamate synthase, large subunit"
FT                   /note="identified by similarity to SP:P09831; match to
FT                   protein family HMM PF00310; match to protein family HMM
FT                   PF01493; match to protein family HMM PF01645; match to
FT                   protein family HMM PF04898"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24551"
FT                   /db_xref="GOA:A0A347ZYZ3"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYZ3"
FT                   /protein_id="AAP24551.1"
FT                   /translation="MLNKTNTWTPSLFRDYKNAEHDACGIVSVMEKRKIPTKENIDLCI
FT                   QSLVKMNHRAGFINGEGDGIGIHIDVPKALWNEKLKSSGYNPTIVDHPHFIVGHFFLNK
FT                   NENIVDLKNHIRTQLNNENFAILFESDNVINSDALGPLGKQEEPLFWQVALIAENEVVN
FT                   IEQTLFSVTIKIEENEAIHVASLSRDHVVYKVLGAGDTLVAYYNDLQHPLIASTMTLGH
FT                   NRYSTNTLSNFFRVQPFSILGHNGEINTIAKLRDQAEMIHVPLTAGGSDSQDLNRTLET
FT                   LLVQYGYSLFEAMDILFPPIINEIKLYETHLQDLYTYIREAWGHFAQGPAGIISRYKDE
FT                   AVFSVDSLGLRPVWKVEIESSYIFSSEPGVVSPTEYVAEPKPLAPGEKVGLKWNEQDEL
FT                   VLYEHDDYQTQVYNRFKKKVDVTNYHLHLSIPKTKEIPDACDSMQVETKQYVAFGWDRE
FT                   HIQLLEQMATKGVEPIRSLGHDSPLAALDTDRRNIADFIKESVAVVTNPAIDRDREVEH
FT                   FSTRTILGERPSLLSDAKKPFVVEMLSPIILEGSVAQSIAQELHTITYEQLIELFNTHS
FT                   SIATISATFSQAETLQCALSRISSEAITAVNDGASLLLIDDADAHLNERLWIDPHLVTA
FT                   KVHQVLSENKLRRNCSLVIRSGALRSLHDIVTLHGLGADSINPYLLFATVNDGTKTPIT
FT                   NLYNALNKGLEKVISTIGIHELRGYGRLYSSIGLHEEIANILQITNFLGSNDLAFSLES
FT                   LAEDAQMRADDYNDPKVRIRKSFHIFPRIWKAIGDVAKGNSYDDYRDKLSELEENNPIA
FT                   IRHLIQTKETKHVIPTEEVSISIQNHDLPFIISSMSFGSQNEIAFRAYAEAADQLNMIS
FT                   LNGEGGEIKDMIGKYPHTRGQQVASGRFGVNAELLNSSNLIEIKIGQGAKPGEGGHLPG
FT                   SKVTAKIAEARNATIGSDLISPSNNHDIYSIEDLAQMITEIKTANQLAKVAVKVPVVPN
FT                   IGTIAVGIAKAGADFINISGFDGGTGAARIHALQHVGLPVEIGVKAAHNALLEANMRHN
FT                   VEIWADGGIRSVNDALKIMLLGANRIGFGTLSMIAIGCTTCRGCHLDTCHVGIATQIES
FT                   EAQAKEHGLRRFVPRELESAVAGLLHLFTTFGEELKRLTGNLGYTNLQEIVGRSDLLEQ
FT                   VRGKNLLNLCNLLQTIEHPSVIKTEHVLEKQFEPIHSPHSKELVGVGVEQRVMGGLESC
FT                   YRVRSKLYEDTKLEPLTLKYTNGSIPGNGLGAYNSENLFIHVNGGAQDGIGKTSFGGGI
FT                   YITKAKGKDGLYYNGSVGKGFGYGAQKGALYVQGNADARAGIRLSGADMIIGGRMTKPL
FT                   REKEQGNIGAYSNIKGFAFEYMTNGRALVLGDPGPWICAGMTGGVVYLRHDSSLGLTEQ
FT                   ALKRRIAKGANVTLQPISKNGVRDVNELLLDYIRVLNEHEQYEEVALLTPLLDDMQQQF
FT                   FEIIPKKEQADPSISTE"
FT   gene            complement(525778..527082)
FT                   /gene="hemL1"
FT                   /locus_tag="BA_0531"
FT                   /old_locus_tag="BA0531"
FT   CDS_pept        complement(525778..527082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL1"
FT                   /locus_tag="BA_0531"
FT                   /old_locus_tag="BA0531"
FT                   /product="glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /EC_number="5.4.3.8"
FT                   /note="identified by similarity to SP:P71084; match to
FT                   protein family HMM PF00202; match to protein family HMM
FT                   TIGR00713"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24552"
FT                   /db_xref="GOA:Q81YV0"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="PDB:3L44"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81YV0"
FT                   /protein_id="AAP24552.1"
FT                   /translation="MVVKFTKSEALHKEALEHIVGGVNSPSRSFKAVGGGAPIAMERGK
FT                   GAYFWDVDGNKYIDYLAAYGPIITGHAHPHITKAITTAAENGVLYGTPTALEVKFAKML
FT                   KEAMPALDKVRFVNSGTEAVMTTIRVARAYTGRTKIMKFAGCYHGHSDLVLVAAGSGPS
FT                   TLGTPDSAGVPQSIAQEVITVPFNNVETLKEALDKWGHEVAAILVEPIVGNFGIVEPKP
FT                   GFLEKVNELVHEAGALVIYDEVITAFRFMYGGAQDLLGVTPDLTALGKVIGGGLPIGAY
FT                   GGKKEIMEQVAPLGPAYQAGTMAGNPASMASGIACLEVLQQEGLYEKLDELGAMLEKGI
FT                   LEQAAKHNIDITLNRLKGALTVYFTTNTIEDYDAAQDTDGEMFGKFFKLMLQEGVNLAP
FT                   SKYEAWFLTTEHTKEDIEYTIEAVGRAFAALADNK"
FT   gene            527204..528217
FT                   /locus_tag="BA_0532"
FT                   /old_locus_tag="BA0532"
FT   CDS_pept        527204..528217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0532"
FT                   /old_locus_tag="BA0532"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to OMNI:NTL01SPL0383; match
FT                   to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24553"
FT                   /db_xref="GOA:A0A0J1HMW4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1HMW4"
FT                   /protein_id="AAP24553.1"
FT                   /translation="MKSVIEVQGLRKEFTAYSSRPGLKGAFRDLLNRNYKIVPAVNDVS
FT                   FTVKQGEMVGYIGENGAGKSTTIKMLTGILTPTSGDILVNGMNPHKQREEFVRTIGVVF
FT                   GQRSQLWWDIAVQESFRLLKKVYGVSDAQYKEHMEHVIETLDIGPLLDKPVRKLSLGQR
FT                   MRCELAAALIHNPPLLFLDEPTIGLDVLVKLKIREFLKEMNERYKTTILLTTHDITDIE
FT                   ALCERVIMLDEGNIMYDGSLNNLRTQWGAEKEIHFQFVAPVSYQALSMVMPDSHVVWSK
FT                   AKEENAWIAKIPNEEVIISMLISKVVQAFQIKDLKINEVSTEEIIRNIYEEGIKHG"
FT   gene            528210..529001
FT                   /locus_tag="BA_0533"
FT                   /old_locus_tag="BA0533"
FT   CDS_pept        528210..529001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0533"
FT                   /old_locus_tag="BA0533"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF06182"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24554"
FT                   /db_xref="GOA:A0A2A7DE58"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A7DE58"
FT                   /protein_id="AAP24554.1"
FT                   /translation="MGKYIEMIRIRFLMMLAYRTNYYSGILIYTINIGAYYFLWQAIYS
FT                   GKENIESLSISQMTTYIAIAWMARAFYFNNIDREIAMEIQEGRVAVELIRPYNYLGMKV
FT                   MQGLGEGIFRFAFFSIPGMVIVTLLFSLQITTNFQTWLYFFLSLIFSFIINTQINLMTG
FT                   MLTFFLFNNSGIMYAKRVVIDLFSGLLLPISFYPLWAQKAMVFLPFQAISYIPSMIFSE
FT                   GIQGSKLYEALLFQVIWAIVLIIPIVLMWRTARKRLIVQGG"
FT   gene            529006..529791
FT                   /locus_tag="BA_0534"
FT                   /old_locus_tag="BA0534"
FT   CDS_pept        529006..529791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0534"
FT                   /old_locus_tag="BA0534"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF06182"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24555"
FT                   /db_xref="GOA:A0A2B3YA64"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2B3YA64"
FT                   /protein_id="AAP24555.1"
FT                   /translation="MIYIKLFLQYASQYIKTKLEYRGDFIVGLLSDLSLQAVNLIFILV
FT                   VFGHTQALKGWSREEVIFIYGFFLVPFAIFSAFFNIWDFNDRYIIKGEMDRILTRPIHS
FT                   LFQIILERMELESLIGAITGMIVMGYAAVELQLSFYWYDFFLFLLMVGGGALVYGGIFV
FT                   TLASLGFWSDAKSSIMPLMYNIGNYGRYPVNIYNRVIRFILTFVLPFAFVGVYPAAYFL
FT                   RKTEWNSYAFATPLVGVICFTIAITLWNQGVKRYRGAGN"
FT   gene            529864..530268
FT                   /locus_tag="BA_0535"
FT                   /old_locus_tag="BA0535"
FT   CDS_pept        529864..530268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0535"
FT                   /old_locus_tag="BA0535"
FT                   /product="putative potassium channel protein"
FT                   /note="identified by similarity to EGAD:6263; match to
FT                   protein family HMM PF07885"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24556"
FT                   /db_xref="GOA:A0A347ZYZ8"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYZ8"
FT                   /protein_id="AAP24556.1"
FT                   /translation="MLWGFILLIVAIAILRSVQLLWSSYSDSTRFFSLYNLATLFLIYT
FT                   TVLIAFGLSYVVLEEMGFAVLKEEGESLNAHSFQLVEICLYFSAVTLLSVGYGDISPIG
FT                   IGRWIAIGEALIGYTLPFAFVMRSVIDNEK"
FT   gene            530313..530768
FT                   /gene="bcP"
FT                   /locus_tag="BA_0536"
FT                   /old_locus_tag="BA0536"
FT   CDS_pept        530313..530768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcP"
FT                   /locus_tag="BA_0536"
FT                   /old_locus_tag="BA0536"
FT                   /product="bacterioferritin comigratory protein"
FT                   /note="identified by similarity to EGAD:18740; match to
FT                   protein family HMM PF00578; match to protein family HMM
FT                   PF08534"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24557"
FT                   /db_xref="GOA:A0A347ZYZ9"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZYZ9"
FT                   /protein_id="AAP24557.1"
FT                   /translation="MVTVGEMAPEFTLEGSNGEQVRLADFRGKNVVLYFYPKDMTPGCT
FT                   TEACDFRDSYGLFQEKDTVILGVSPDPANRHLKFIEKHELPFTLLVDEDHKVAELYDVW
FT                   KLKKNFGKEYMGIERSTFLINKDGELVKEWRKVKVKGHIEDVLSYIN"
FT   gene            531060..531494
FT                   /locus_tag="BA_0537"
FT                   /old_locus_tag="BA0537"
FT   CDS_pept        531060..531494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0537"
FT                   /old_locus_tag="BA0537"
FT                   /product="transcriptional regulator, Fur family"
FT                   /note="identified by similarity to GP:16414294; match to
FT                   protein family HMM PF01475"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24558"
FT                   /db_xref="GOA:A0A3P1TYS1"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TYS1"
FT                   /protein_id="AAP24558.1"
FT                   /translation="MTVVKEELKEALEMLKNTGVRITPQRHAILEYLVESMTHPTADDI
FT                   YKALEGKFPNMSVATVYNNLRVFKEVGLVKELTYGDASSRFDYVTSQHYHVICEKCGKI
FT                   VDFPYGGLEKLEEEAAKTTGFVINSHRLEIYGVCPECHKA"
FT   gene            complement(531693..532049)
FT                   /locus_tag="BA_0538"
FT                   /old_locus_tag="BA0538"
FT   CDS_pept        complement(531693..532049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0538"
FT                   /old_locus_tag="BA0538"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01BH0954"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24559"
FT                   /db_xref="GOA:Q81YU3"
FT                   /db_xref="InterPro:IPR020912"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81YU3"
FT                   /protein_id="AAP24559.1"
FT                   /translation="MSIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMM
FT                   VGFLAVIASTVVYFWIGMLSTKTVQIICPSCDKPTKMLGRVDACMHCNQPLTMDRDLEG
FT                   KEFDEKYNKKSYKS"
FT   gene            532369..532467
FT                   /locus_tag="BA_0539"
FT                   /old_locus_tag="BA0539"
FT   CDS_pept        532369..532467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0539"
FT                   /old_locus_tag="BA0539"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift; identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24560"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H9S3"
FT                   /protein_id="AAP24560.1"
FT                   /translation="MKTERNKQRETSIFILDARQTNFIGEFDPGSG"
FT   gene            532463..533968
FT                   /gene="rrsI"
FT                   /locus_tag="BA_5792"
FT   rRNA            532463..533968
FT                   /gene="rrsI"
FT                   /locus_tag="BA_5792"
FT                   /product="16S ribosomal RNA"
FT   gene            534140..537047
FT                   /gene="rrlI"
FT                   /locus_tag="BA_5793"
FT   rRNA            534140..537047
FT                   /gene="rrlI"
FT                   /locus_tag="BA_5793"
FT                   /product="23S ribosomal RNA"
FT   gene            537148..537263
FT                   /gene="rrfI"
FT                   /locus_tag="BA_5794"
FT   rRNA            537148..537263
FT                   /gene="rrfI"
FT                   /locus_tag="BA_5794"
FT                   /product="5S ribosomal RNA"
FT   gene            537272..537346
FT                   /locus_tag="BA_5795"
FT   tRNA            537272..537346
FT                   /locus_tag="BA_5795"
FT                   /product="tRNA-Asn"
FT   gene            537349..537440
FT                   /locus_tag="BA_5796"
FT   tRNA            537349..537440
FT                   /locus_tag="BA_5796"
FT                   /product="tRNA-Ser"
FT   gene            537458..537532
FT                   /locus_tag="BA_5797"
FT   tRNA            537458..537532
FT                   /locus_tag="BA_5797"
FT                   /product="tRNA-Glu"
FT   gene            537538..537613
FT                   /locus_tag="BA_5798"
FT   tRNA            537538..537613
FT                   /locus_tag="BA_5798"
FT                   /product="tRNA-Val"
FT   gene            537638..537714
FT                   /locus_tag="BA_5799"
FT   tRNA            537638..537714
FT                   /locus_tag="BA_5799"
FT                   /product="tRNA-Met"
FT   gene            537718..537793
FT                   /locus_tag="BA_5800"
FT   tRNA            537718..537793
FT                   /locus_tag="BA_5800"
FT                   /product="tRNA-Asp"
FT   gene            537803..537878
FT                   /locus_tag="BA_5801"
FT   tRNA            537803..537878
FT                   /locus_tag="BA_5801"
FT                   /product="tRNA-Phe"
FT   gene            537897..537972
FT                   /locus_tag="BA_5802"
FT   tRNA            537897..537972
FT                   /locus_tag="BA_5802"
FT                   /product="tRNA-Thr"
FT   gene            537983..538066
FT                   /locus_tag="BA_5803"
FT   tRNA            537983..538066
FT                   /locus_tag="BA_5803"
FT                   /product="tRNA-Tyr"
FT   gene            538074..538147
FT                   /locus_tag="BA_5804"
FT   tRNA            538074..538147
FT                   /locus_tag="BA_5804"
FT                   /product="tRNA-Trp"
FT   gene            538167..538242
FT                   /locus_tag="BA_5805"
FT   tRNA            538167..538242
FT                   /locus_tag="BA_5805"
FT                   /product="tRNA-His"
FT   gene            538306..538380
FT                   /locus_tag="BA_5806"
FT   tRNA            538306..538380
FT                   /locus_tag="BA_5806"
FT                   /product="tRNA-Gln"
FT   gene            538386..538460
FT                   /locus_tag="BA_5807"
FT   tRNA            538386..538460
FT                   /locus_tag="BA_5807"
FT                   /product="tRNA-Gly"
FT   gene            538475..538545
FT                   /locus_tag="BA_5808"
FT   tRNA            538475..538545
FT                   /locus_tag="BA_5808"
FT                   /product="tRNA-Cys"
FT   gene            538556..538640
FT                   /locus_tag="BA_5809"
FT   tRNA            538556..538640
FT                   /locus_tag="BA_5809"
FT                   /product="tRNA-Leu"
FT   gene            complement(538848..539168)
FT                   /locus_tag="BA_0540"
FT                   /old_locus_tag="BA0540"
FT   CDS_pept        complement(538848..539168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0540"
FT                   /old_locus_tag="BA0540"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:EF1407"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24561"
FT                   /db_xref="InterPro:IPR024979"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H9R9"
FT                   /protein_id="AAP24561.1"
FT                   /translation="MTHSNEKKPHGLKGIGEKLNPTIYQVRFMKLDEPIQFESFPELKK
FT                   LGDWLSTSTHMWACHSTMYKYNKEEFKKRFLEITNLTVDHVLISTGGVGFNFMSPGWRD
FT                   SL"
FT   gene            539521..540240
FT                   /locus_tag="BA_0541"
FT                   /old_locus_tag="BA0541"
FT   CDS_pept        539521..540240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0541"
FT                   /old_locus_tag="BA0541"
FT                   /product="DNA-binding regulatory protein, YebC/PmpR family"
FT                   /note="identified by similarity to EGAD:107673; match to
FT                   protein family HMM PF01709; match to protein family HMM
FT                   TIGR01033"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24562"
FT                   /db_xref="GOA:Q81YU1"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026562"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81YU1"
FT                   /protein_id="AAP24562.1"
FT                   /translation="MGRKWNNIKDKKASKDANTSRIYAKFGREIYVAAKQGEPDPESNQ
FT                   ALRVVLERAKTYNVPRTIIDRAVEKAKGGSEENYDELRYEGFGPNGAMVIVDTLTNNVN
FT                   RTAADVRAAFSKNSGNMGVNGSVAYMFDATAVIGLEGKTSDEVLEILMEADVDARDILE
FT                   EEDAVIVYAEPDQFHAVQSALKDAGVEEFTVAELTMLAQNDVTLPEDAQAQFEKMVDAL
FT                   EDLEDVQQVYHNVDLGE"
FT   gene            540358..540852
FT                   /locus_tag="BA_0542"
FT                   /old_locus_tag="BA0542"
FT   CDS_pept        540358..540852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0542"
FT                   /old_locus_tag="BA0542"
FT                   /product="mutT/nudix family protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   premature stop; identified by similarity to EGAD:8153;
FT                   match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24563"
FT                   /db_xref="GOA:A0A384LKM2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LKM2"
FT                   /protein_id="AAP24563.1"
FT                   /translation="MEYSLLLGGLHVEHKTPKHIVAVAGYLTNEKDEVLLAKVHWRADT
FT                   WELPGGQVEEGEALDQAVCREIKEETGLTVKPIGITGVYYNASMNILAVVFKVAYVSGE
FT                   IKIQHEEIQEAKFVALNEENIDEYITRPHMKSRTLDAMRSSHFIPYETWEVQPYNLIGR
FT                   L"
FT   gene            541339..542115
FT                   /locus_tag="BA_0543"
FT                   /old_locus_tag="BA0543"
FT   CDS_pept        541339..542115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0543"
FT                   /old_locus_tag="BA0543"
FT                   /product="penicillin-binding domain protein"
FT                   /note="identified by similarity to EGAD:6569; match to
FT                   protein family HMM PF00912"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24564"
FT                   /db_xref="GOA:A0A2B6CI83"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2B6CI83"
FT                   /protein_id="AAP24564.1"
FT                   /translation="MKERVLSRVNYHQKVALNPMTKFFYKAIILLLLLSFTLLFIGNVM
FT                   IEQSDISKLHVPAKLEVPESLTHAFIATEDKRFYHHNGLDYIAIIRASVENIKAGGVVQ
FT                   GGSTITQQLSKNAFLTNERTFSRKWKEIFYTKKIERTFTKDEILKLYVSNIYYGEGAWG
FT                   IEKAANLYFGKKVSQLTLAESAMMAAVVKAPAYYSPAQNYDKAVERRNVVLRLMEKEGY
FT                   INHDEYMQAVSEKLVIRHDIKTERSMLNHAREKAVS"
FT   gene            542303..542956
FT                   /locus_tag="BA_0544"
FT                   /old_locus_tag="BA0544"
FT   CDS_pept        542303..542956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0544"
FT                   /old_locus_tag="BA0544"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:2635861; match to
FT                   protein family HMM PF01323"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24565"
FT                   /db_xref="GOA:Q81YT8"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81YT8"
FT                   /protein_id="AAP24565.1"
FT                   /translation="MKSSNKLMALGIVFSIAVLIVIGTIVYSIINDKKDKGNEMFAYST
FT                   QQSLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDS
FT                   DLGAAAGEAIYKQDQDSFWIFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKIDVEQFK
FT                   KDLHSKEIKEKVRKDSDRAQKLKVQGAPSVYVNGNLANPDFDSLKKAIDKELKK"
FT   gene            543071..543144
FT                   /locus_tag="BA_5810"
FT   tRNA            543071..543144
FT                   /locus_tag="BA_5810"
FT                   /product="tRNA-Gly"
FT   gene            543343..544485
FT                   /locus_tag="BA_0545"
FT                   /old_locus_tag="BA0545"
FT   CDS_pept        543343..544485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0545"
FT                   /old_locus_tag="BA0545"
FT                   /product="putative iron-sulfur cluster-binding protein"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF03130; match to protein
FT                   family HMM PF08331; match to protein family HMM TIGR00276"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24566"
FT                   /db_xref="GOA:Q81YT7"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81YT7"
FT                   /protein_id="AAP24566.1"
FT                   /translation="MDFEQLKQDVIAYSKTIGIDKIGFASASPFEELKQRLIQQQQLNY
FT                   QSGFEEPDIEKRTNPQLLLSGAKSIIAIALAYPSKLKNAPLSKRGERRGIFCRASWGQD
FT                   YHLVLRDRLQKLEAYLIEKLPDIEVKSMVDTGELSDRAVSERAGIGWSGKNCSIITPEF
FT                   GSYVYLGEMITNVPFPPDQPIEDQCGSCTKCIDICPTGALIQGGQLDSKKCIAFLTQTK
FT                   GFLPEEYRDKIGNRIYGCDTCQTVCPKNKGMDFHNHPEMEPDPELVKPLLTPLLTISNR
FT                   DFKEKYGIMSGSWRGKKPLQRNAILALAHFKEASAIPDLIGVMKDDPRPVLRGTAAWAL
FT                   GKIGGDGVGEAIEKAMQREKDEEVLHEMNRGLELLAQKKE"
FT   gene            544530..545417
FT                   /locus_tag="BA_0546"
FT                   /old_locus_tag="BA0546"
FT   CDS_pept        544530..545417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0546"
FT                   /old_locus_tag="BA0546"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01BH1024"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24567"
FT                   /db_xref="InterPro:IPR024301"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1TJ90"
FT                   /protein_id="AAP24567.1"
FT                   /translation="MVVKINIEKQVQQFLAYVTEKRTNVDGIAEDLLQIAKRKRLLFQK
FT                   RNADIVKATADVSFMRQLNNSNHQEIDYQIHFKYLIKHKELFYIEEEQLKRRVCLNNSQ
FT                   VIGDYAIEAPEAVGMSETLEREVTKEKYGSYQYNRLEAVKYAERWWDDRNPVYRNFPDN
FT                   CTNFISQCLHTGEVPMNGYPNIRKGWWQRENQWSWSWAVAHSFYWYLSGATTGLRAEAV
FT                   ERPEDLILGDVIAYDFEDDGRWNHTTIVVAKDADGMPLVNAHSANSRRRYWNYEDSSKY
FT                   TPQMKYKFFHIING"
FT   gene            545476..545964
FT                   /locus_tag="BA_0547"
FT                   /old_locus_tag="BA0547"
FT   CDS_pept        545476..545964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0547"
FT                   /old_locus_tag="BA0547"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /note="identified by match to protein family HMM PF00588;
FT                   match to protein family HMM TIGR00185"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24568"
FT                   /db_xref="GOA:A0A347ZZ09"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZZ09"
FT                   /protein_id="AAP24568.1"
FT                   /translation="MGVHVVLYQPEIPANTGNIARTCAATGTELHLIRPLGFSTDDKML
FT                   KRAGLDYWQHVKITYYDSIEEFYEKNKDGEFFYLTKYGEKAHTAFDYSKREKDYYFVFG
FT                   RETNGLPANVIEENFDHCLRIPMTDKVRSLNLSNTAAILIYEAFRQQNYPGLDLEIVY"
FT   gene            546092..548161
FT                   /locus_tag="BA_0548"
FT                   /old_locus_tag="BA0548"
FT   CDS_pept        546092..548161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0548"
FT                   /old_locus_tag="BA0548"
FT                   /product="sensory box/GGDEF family protein"
FT                   /note="identified by match to protein family HMM PF00563;
FT                   match to protein family HMM PF00989; match to protein
FT                   family HMM PF00990; match to protein family HMM PF08447;
FT                   match to protein family HMM PF08448; match to protein
FT                   family HMM TIGR00229; match to protein family HMM
FT                   TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24569"
FT                   /db_xref="GOA:A0A347ZZ10"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZZ10"
FT                   /protein_id="AAP24569.1"
FT                   /translation="MKEQYSNQNTFLSMIDMDLIRRGLLHAIQDLVFIVKVIDDETFKY
FT                   IYVNKLGMDYAKLSEECYGKTFAEVLPEDTAEILQVQYAKVASEAKAHTFCDVVSLPKG
FT                   ELHYESSLNPVFDEEGVCQFIICITRDITAQIEEKMEIEEKQMLFKSLLEYNNDSIISI
FT                   DSIGRITYANPATYEIFGYRFEELNNKFIFEFINKEYEKDFQIIFKEAMQGRAKQIVSK
FT                   KYVHKEGYELYISLRTIPIIVNGEIVGVYIVTRDVTKQVLNEMRTEYLAYYDQLTGLMN
FT                   RISCTNKLNDFLNEKVAFAFIFIDLDEFHLINDTFGHKEGDKVLQKVTECLSSFQIPDM
FT                   HLFREHDDQFVMLIENITKERVEVFAKSIQKKISEHFVIEEEDVYLSASIGIVMAPTDG
FT                   EDEKILFQRVDAALEKAKEKGKGHYHFYGNGLDCEREKRFIIENQLHRAIEKNEFFLYY
FT                   QPQMNIETKKIASMEALIRWENKELGFVSPNQFIPLAERTGFIIKLDEWVINEVCRQIR
FT                   EWLNKGYEVVPIAVNISARHFRSITLIEMITRALHKYNVSAHLLAIEVTEGALIHKDIS
FT                   KRVLLQLKEQNLKIHLDDFGTGYSSLSYLKTYPIDTLKIDRSFMEGIHVDERDTNITAA
FT                   IIHLAHTLELDVIAEGVEKAEQIQFLKEKNVKFVQGYYYSRPLSKYDVENVYYK"
FT   gene            complement(548192..548287)
FT                   /locus_tag="BA_0549"
FT                   /old_locus_tag="BA0549"
FT   CDS_pept        complement(548192..548287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0549"
FT                   /old_locus_tag="BA0549"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01BH1026"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24570"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KXI1"
FT                   /protein_id="AAP24570.1"
FT                   /translation="MKLLLILGVSLTFLTAIFTSGYNDKPGTHKK"
FT   gene            548553..550448
FT                   /locus_tag="BA_0550"
FT                   /old_locus_tag="BA0550"
FT   CDS_pept        548553..550448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0550"
FT                   /old_locus_tag="BA0550"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01BS00896; match
FT                   to protein family HMM PF06798; match to protein family HMM
FT                   PF08298"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24571"
FT                   /db_xref="GOA:A0A2B0Y3H4"
FT                   /db_xref="InterPro:IPR010650"
FT                   /db_xref="InterPro:IPR013153"
FT                   /db_xref="InterPro:IPR016230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2B0Y3H4"
FT                   /protein_id="AAP24571.1"
FT                   /translation="MDILKKIEQHREAEERLQWEGTFAEYLELVKERPWVAQTAHSRIY
FT                   NMIKDAGIEEVDGRRKYNFFSNQLFGLEDALERLVEEYFHPSAKRLDVRKRILLLMGPV
FT                   SGGKSTLVTMLKRGLETYSRTDRGAIFAIKGCPMHEDPLHLIPHHLRDDFFDEYGVRIE
FT                   GNLSPLNVMRLEQEYGSRIEDVVVERIFFSEDRRTGIGTFSPSDPKSQDIADLTGSLDF
FT                   STIAEYGSESDPRAYRFDGELNKANRGMMEFQEMLKCDEKFLWHLLSLTQEGNFKAGRF
FT                   ALISADELIVAHTNETEYRSFIANKKNEALHSRIIVMPVPYNLRVSEEEHIYEKMIRES
FT                   DVSDVHIAPHTLRVAAMFTILTRLKDPKRPDIDLIKKMRLYDGETVEGYNAIDVEELQR
FT                   EYQDEGMKGIDPRYVINRISSTIIRKEVPSINALDVLRSLKDGLDQHPSISNEDRERYM
FT                   NFISLARKEYDEIAKKEVQKAFVYSYEESAKTLMDNYLDNVEAYCNKSKLRDPLTGEEM
FT                   SPDEKLMRSIEEQIGISENAKKAFREEILIRISAYARKGKRFDYNSHERLREAIQKKLF
FT                   ADLKDIVKITTSTKTPDENQLKKINDVVARLIDEHGYNSSSANELLRYVGSLLNR"
FT   gene            550894..552069
FT                   /locus_tag="BA_0551"
FT                   /old_locus_tag="BA0551"
FT   CDS_pept        550894..552069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0551"
FT                   /old_locus_tag="BA0551"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:29891; match to
FT                   protein family HMM PF04285; match to protein family HMM
FT                   TIGR02877"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24572"
FT                   /db_xref="GOA:Q81YT1"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="InterPro:IPR014230"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81YT1"
FT                   /protein_id="AAP24572.1"
FT                   /translation="MGEENQPNYTISQENWSLHRKGYDDQQRHQEKVQEAIKNNLPDLV
FT                   TEESIVMSNGKDVVKIPIRSLDEYKIRYNYDKNKHVGQGNGDSKVGDVVARDGSGGQKQ
FT                   KGPGKGQGAGDAAGEDYYEAEVSILELEQAFFKELELPNLKRKEMDENRIEHVEFNDIR
FT                   KTGLWGNIDKKRTMISAYKRNAMRGKASFHPIHQEDLKFRTWNEVLKPDSKAVVLAMMD
FT                   TSGSMGIWEKYMARSFFFWMTRFLRTKYETVDIEFIAHHTEAKVVPEEEFFSKGESGGT
FT                   ICSSVYKKALELIDNKYSPDRYNIYPFHFSDGDNLTSDNARCVKLVEELMKKCNMFGYG
FT                   EVNQYNRHSTLMSAYKNIKDENFRYYILKQKADVFHAMKSFFREESGEKMA"
FT   gene            552231..555443
FT                   /locus_tag="BA_0552"
FT                   /old_locus_tag="BA0552"
FT   CDS_pept        552231..555443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0552"
FT                   /old_locus_tag="BA0552"
FT                   /product="putative internalin"
FT                   /note="identified by similarity to SP:P25146; match to
FT                   protein family HMM PF00560; match to protein family HMM
FT                   PF00746; match to protein family HMM PF05031; match to
FT                   protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24573"
FT                   /db_xref="GOA:A0A3Q0PQ26"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR006635"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR037250"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0PQ26"
FT                   /protein_id="AAP24573.1"
FT                   /translation="MLVAATLSLPFAVYATPILAATAATENMAVQSPKKHVFDAVIKAY
FT                   KDNSDEESYATVYIKDPKLTIENGKRIITATLKDSDFFDYLKVEDSKEPGVFHDVKVLS
FT                   EDKRKHGTKVIQFEVGELGKRYNMQMHILIPTLGYDKEFKIQFEVNMRTFVESDIEEDE
FT                   EEQIEDTQNIIRDKRLQQAINKNVLNRKDVNEPIFEEDLKEIKELNIYAGQGIESLKGL
FT                   EYMENLERITIQGSDVRNIAPISQLKRLKVVDLSFNKIENVEPLVNLEKLDILELQNNR
FT                   IADVTPLSQLKKVRTINLSGNKISDIKPLYNVSSLRKLYVSNNKITDFTGIEQLNKLGT
FT                   LGVGSNGLVNIEPISQMSGIVELNLEKNDIKDITSLSKLTGLQSLNLEENYVSDVSSLS
FT                   NLINLYELKLATNEIRDIRPIQELGKRIKIDAQRQKVFLDEAYMNEEVKIPVYDVNGTA
FT                   LQNIEWKSEGGSITNGVIKWNSLGEKMYEFKMDAGESKIRFQGRVIQNIVEKREESSNV
FT                   IQDMKLRQYMNKHNFERKNVNTPITKEDLLTVKALKITDGKKEGITDFSGLEFMTNVEE
FT                   LTLQNVNMKNAEFISSLRNLKSVDLSYNQIEDIKPLHSLEDLEKLNVSDNGIKNVPELF
FT                   KMQKLKTLDLSNNKLDNAALDGIHQLENLDALLVNNNEINNLDEISKVSKLNKLEMMSN
FT                   KVRDISPLASLKNLQWLNLSDNKIQDISTLSSMLDLLSLKLAGNEIRDVRPVIQLAQWI
FT                   TVDIKNQKIVLEDGQMNQEIQIPIYDLEGEIFEDIELKSTDGIVTDRGTVVWKTPGAKI
FT                   YSFSLNGNYHGLSLLFSGTVTQNIVAKEEPKEPVEEVEGSKEEPIKEAEGSKEEPKEPA
FT                   KEVEGSKEEPKEPAKEVEGSKEEVKEPAKEVEGPKEEVKEPTKEVEGPKEEVKEPTKEV
FT                   EGPKEEVKEPMKEVEGSKEEVKGPTKEAEGSKEEVKEPTTEVEGSKEVKEPGKEVEGSK
FT                   DAINQSAVAQETNVNNQVGKEKVVENQNMKENKPAVTKQEESKKSLGATGGQENTSTLL
FT                   SGLALVLSALSMFVFRKRLFKK"
FT   gene            555598..556464
FT                   /locus_tag="BA_0553"
FT                   /old_locus_tag="BA0553"
FT   CDS_pept        555598..556464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0553"
FT                   /old_locus_tag="BA0553"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24574"
FT                   /db_xref="GOA:A0A347ZZ15"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZZ15"
FT                   /protein_id="AAP24574.1"
FT                   /translation="MHVSSILKIEEVASFIASMNKDATQYVGYCGDEKEELLQTIIQDF
FT                   SHIGWEKSFVVTYENNKIIGVLGFDVDEVKKCADIWGPFIKAENWEEVALHMWKELIEK
FT                   VPFHIEKFYGFYHVENNNCARLMKKLHVKEQGRHSIFSLSHNTVEERSICNVEEALPKV
FT                   FGQFVALHNYVFPNTYYEGNEIIGRLSDTNKLFVSMKNEKLEGYVYVEVNPEFQEANIE
FT                   FIATAENSRRKGVGERLLQAAIQYIFSFQGMREIELCLNTNNDRAVKLYKKVGFEEKAC
FT                   LQHYIIE"
FT   gene            complement(556568..558118)
FT                   /gene="opuD1"
FT                   /locus_tag="BA_0554"
FT                   /old_locus_tag="BA0554"
FT   CDS_pept        complement(556568..558118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opuD1"
FT                   /locus_tag="BA_0554"
FT                   /old_locus_tag="BA0554"
FT                   /product="glycine betaine transporter"
FT                   /note="identified by similarity to OMNI:NTL01BS03001; match
FT                   to protein family HMM PF02028; match to protein family HMM
FT                   TIGR00842"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24575"
FT                   /db_xref="GOA:A0A347ZZ16"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZZ16"
FT                   /protein_id="AAP24575.1"
FT                   /translation="MIKKENSVFYISILLTTLFIIWGITPASWIQGYDLQSVTSSLNSF
FT                   ILNKFGWFYSLLMTAMIILATYLAFSKYGSIRLGKDGEKPKYSYPSWLSMLFGAGMGIG
FT                   LLFYGIAEPISHFTDPLTGKAGTEESAKLAMQYSFFHWGLFPWALYAMVALTIAYFTFR
FT                   KQKGSTIGATVTPLFNRSKNSPIGKTVDILAVLATVFGIVPSVGIGAQQIAGGLSYLFP
FT                   SIHNTLLTQLVLIAIFAVLYLTSAQTGLDRGIKYLSNLNFSLTGILLVSFLLLGPTVFI
FT                   MKYFTSTLGSYIGALPSMGLNLGAFNEKSSSWIENWTIFYWGWWISWSPFVGTFIARIS
FT                   KGRTIKEFIFGVVLVPTLICTFWFAVFGGTAIHMEMFQSLGVADEIAKNGTEIGLFAVI
FT                   SHLPFSTFLTIIGLILVATFFVTSADSATFVVSMQTSNGSLSPKNSLKLIWGLTIAIIA
FT                   AILLQAGGLNALQIAAIIAALPFSIVVVLMVTSLFKELRKEDINSQTKEVPKKIKKVM"
FT   gene            558387..561284
FT                   /locus_tag="BA_0555"
FT                   /old_locus_tag="BA0555"
FT   CDS_pept        558387..561284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0555"
FT                   /old_locus_tag="BA0555"
FT                   /product="putative microbial collagenase"
FT                   /EC_number="3.4.24.3"
FT                   /note="identified by similarity to SP:P43153; match to
FT                   protein family HMM PF00801; match to protein family HMM
FT                   PF01752; match to protein family HMM PF04151; match to
FT                   protein family HMM PF08453"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24576"
FT                   /db_xref="GOA:A0A347ZZ17"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR002169"
FT                   /db_xref="InterPro:IPR007280"
FT                   /db_xref="InterPro:IPR013661"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="InterPro:IPR041379"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZZ17"
FT                   /protein_id="AAP24576.1"
FT                   /translation="MNKKSKINKVMLSISTMALSLGAIQTHVSAEEKVPYNVLHSKPVG
FT                   IEKPVDEIGHVSKAEETLSFQERLKVGDFSQRPASITNKVTVKQVKESYSMADLNKMNN
FT                   QELVETLGSIKWHQITDLFQFNEDAKAFYKDKGKMQVVIDELAHRGSTFTKDDSKGIQT
FT                   FTEVLRSAFYLAFYNNELSELNERSFQDKCLPALKAIAKNPNFKLGTTEQDTVVSAYGK
FT                   LISNASSDVETVQYASNILKQYNDNFTTYVNDRMKGQAIYDIMQGIDYDIQSYLIEARK
FT                   EANETMWYGKVDGFINEINRIALLNEVTQENKWLVNNGIYFASRLGKFHSNPNKGLEVV
FT                   TQAMHMYPRLSEPYFVAVEQITTNYNGKDYSGNTVDLEKIRKEGKEQYLPKTYTFDDGS
FT                   IVFKTGDKVSEEKIKRLYWAAKEVKAQYHRVIGNDKALEPGNADDILTIVIYNSPEEYQ
FT                   LNRQLYGYETNNGGIYIEETGTFFTYERTPEQSIYSLEELFRHEFTHYLQGRYEVPGLF
FT                   GRGDMYQNERLTWFQEGNAEFFAGSTRTNNVVPRKSIISGLSSDPASRYTAERTLFAKY
FT                   GSWDFYNYSFALQSYLYTHQFETFDKIQDLIRANDVKNYDAYRENLSKDLKLNEEYQEY
FT                   MQHLIDNQDKYNVPEVADDYLAEHTPKSLTAVEKEITETLPMKDAKMTKHSSQFFNTFT
FT                   LEGTYTGSVTKGDSEDWNAMSKKVNEALEQLAQKEWSGYKTVTAYFVNYGVNSSNQFEY
FT                   DVVFHGIAKDDEENKAPTVNINGPYNGLVKEGIQFKSDGSKDEDGKIVSYLWDFGDGST
FT                   SAEVNPVHVYESEGSYKVALIVKDDKGKESKSEITVTVKGGSLTESEPNNRPEEANRIG
FT                   LNTTIKGSLIGGDHTDVYTFNVASAKNIDISVLNEYGIGMTWVLHHESDMQNYAAYGQA
FT                   NGNHIEANFNAKPGKYYLYVYKYDNGDGTYELSVK"
FT   gene            561531..562079
FT                   /locus_tag="BA_0556"
FT                   /old_locus_tag="BA0556"
FT   CDS_pept        561531..562079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0556"
FT                   /old_locus_tag="BA0556"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to EGAD:108460; match to
FT                   protein family HMM PF01957"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24577"
FT                   /db_xref="GOA:A0A2P0H9V4"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H9V4"
FT                   /protein_id="AAP24577.1"
FT                   /translation="MVLFGYPLETIYLYGFIIATILTVIYIFFGDIFESIFSFGGGSVS
FT                   IVTLLLSFFAMLCGLSYIGEYLFSFNSILIFVAAFAISFIGVFIMKILILKPIAEAEQN
FT                   TVQRMDEFIGCKGEVITTIPTEGFGEVLISSQFGSNAIPAKTIGKKDISQGTEVIIEGV
FT                   QDGVLLVQNIAYSLKKPKL"
FT   gene            562092..563672
FT                   /locus_tag="BA_0557"
FT                   /old_locus_tag="BA0557"
FT   CDS_pept        562092..563672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0557"
FT                   /old_locus_tag="BA0557"
FT                   /product="SPFH domain/band 7 family protein"
FT                   /note="identified by similarity to EGAD:108459; match to
FT                   protein family HMM PF01145"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24578"
FT                   /db_xref="GOA:A0A347ZZ19"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR027705"
FT                   /db_xref="InterPro:IPR031905"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZZ19"
FT                   /protein_id="AAP24578.1"
FT                   /translation="MTIPLIIGGVLLAILILLILVFITKYRTVGPDEALIVTGNWLGGG
FT                   KNVVTTDDGKKIKIIRGGGTFVVPIMQRAEPLSLLNYKLEVGTRDTYTKQGVPVTVNGV
FT                   SIIKVGSTIEEVSTAAEQYLGKETEELKVEAKEVLEGHLRAILSSMTVEDAYSNREQFA
FT                   QKVHEVASTDLKKMGLRIVSFTIKEIMDKNGYLDALGQPQIATVKRDATIANAEREKEA
FT                   RIEKARAEKEAKEAEYQRDAQIAEAEKHKELKVQSYKREQEQARADADLSYELQQAKAQ
FT                   QGVTEEQMRVKIIEREKQIELEEKEIARREKQYDAEVKKKADADRYAVEQSAEAEKVKQ
FT                   IKKADADQYKIEAEARARAEEVRVEGLAKAEIEKAQGQAKAEVQKAQGTAEADVIRLKG
FT                   LAEAEAKQKIAEAFELYGQAAIMDMVLKMLPSYAKEVASPLSNIDKITVVDTGGGGKNS
FT                   GAGKIAGYATDLMATMQETLKASSGIDLKELLEGFAGKGAVQQLSSDKPVVSVVEDEKK
FT                   EVEKDKDKE"
FT   gene            563909..565885
FT                   /locus_tag="BA_0558"
FT                   /old_locus_tag="BA0558"
FT   CDS_pept        563909..565885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0558"
FT                   /old_locus_tag="BA0558"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by similarity to EGAD:16380; match to
FT                   protein family HMM PF00015; match to protein family HMM
FT                   PF00672; match to protein family HMM PF02743"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24579"
FT                   /db_xref="GOA:A0A3P1U4Q3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1U4Q3"
FT                   /protein_id="AAP24579.1"
FT                   /translation="MLQGKLRRSSLKAKLLVSFVIVLILPSIVIGWTSYQQAKTNFNET
FT                   ILQSAEDNVKILNNVINKEIDSKKVDAVYFTKLFNGVSYGTDQLQNVQNKLEEYNKLHP
FT                   EIEAIYTGSSTGQFIQSPSIQMPDGYNPTERDWYKEAAKKSGEVVITAPYKSSTTGNIV
FT                   ITIAKQNEDKSGVLGIDLIINDIVNTSKMVNIGKTGFVAIFDQSKHVIAHPTIKPGDKI
FT                   EEKVEKELYKQETGDFKFKLDGDDRNITFITNKQTGWKIAGIMPSKEIIEAANPIFYKT
FT                   LTVIGISLIIGGVLIYFIIASIISPLKQLVISSKKISEGDLTETITVHSKDEIGQLGES
FT                   FNEMAASLHHVISNINTSASHVAASSEELTASMKQTSEATEQITQAIEQVSSGAEIQTK
FT                   EVEEGATLLEEVTEGIQRVADSSSLVSTASMYTKKKAEDGGKLVEQTVNQMQLIHESVS
FT                   QSDKVIVLLDDKSKQIGAILEVIQHIAEQTNLLALNAAIEAARAGEQGRGFAIVADEVR
FT                   KLAEQSGQSSTEIGKLVKEIQFDIKETVSSMKLVGTEVQSGLVVANETKQSFAEILKST
FT                   DDTVVQIDNMVDVAKQMTVDARQVSASINEIAATIEENAASVQNIAGSSEEQLASVDEI
FT                   NAAAVHLSQMAEELQEMIGKFKV"
FT   gene            566037..567647
FT                   /locus_tag="BA_0559"
FT                   /old_locus_tag="BA0559"
FT   CDS_pept        566037..567647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0559"
FT                   /old_locus_tag="BA0559"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="identified by similarity to OMNI:NTL01BH3845; match
FT                   to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24580"
FT                   /db_xref="GOA:A0A3Q0PQ98"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0PQ98"
FT                   /protein_id="AAP24580.1"
FT                   /translation="MVLKFKKLKLQPRITLTISALILVVLMLTSYLFYYILSETVEEQI
FT                   GKRALHVAKTVAAIPEIKEAFQTENPASIIQPIAERIRMDTEADFIVVGNKEGIRYAHP
FT                   ERDKIGEAMIGGDNKGVLLEGKSYVSKATGSLGPSLRGKVPIRNQENEIIGVVSVGFSM
FT                   DDIHGAVEVYGKRVFWITIIGLLIGVIGSIYLAGSIKRMMFGMEPEEISSLYEEHSTVI
FT                   QSVREGIIVIDQNGMISLVNQAAYDILALDEQRNIIGEFILDIIPNSTILDVLQTGEEQ
FT                   FDRQLNIKGQAVIANRLPIKVKNKVTGVVSSLRLKSEMDQLTAELSQTKQYTEALRAQT
FT                   HEYNNLLYTLSGLIQLELYEDALELIHKETAVYQDFVQFIMKRIQNPWLGGILIGFYNR
FT                   ARELKIEFMLDRESSLDKLSPPIESNYVVSILGNLITNAFEAIERNEEHDKKVRMFVTD
FT                   IGEEIVIEVEDSGQGIHDEVITSIFYKGFSTKEGEKRGYGLAKVKELVEDLNGSIAIEK
FT                   GDLGGALFIIALPKERGDL"
FT   gene            567647..568338
FT                   /pseudo
FT                   /locus_tag="BA_0560"
FT                   /old_locus_tag="BA0560"
FT                   /note="response regulator, authentic frameshift; an
FT                   automated process has identified a potential problem with
FT                   this gene model; it may contain one or more premature stops
FT                   and/or frameshifts"
FT   gene            complement(568382..569686)
FT                   /locus_tag="BA_0561"
FT                   /old_locus_tag="BA0561"
FT   CDS_pept        complement(568382..569686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0561"
FT                   /old_locus_tag="BA0561"
FT                   /product="citrate transporter, CitM family"
FT                   /note="identified by similarity to EGAD:30764; match to
FT                   protein family HMM PF03600; match to protein family HMM
FT                   PF03606; match to protein family HMM PF06808; match to
FT                   protein family HMM TIGR00784"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24581"
FT                   /db_xref="GOA:A0A3P1U2Z9"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR014738"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1U2Z9"
FT                   /protein_id="AAP24581.1"
FT                   /translation="MLALLGFAMVFVFMFLIMKKRMSALVALILIPITFALIGGFYADM
FT                   GPMMLEGIQKLAPTGIMLMFAILYFGIMIDSGLFDPVISRILKFVKGDPLKIVVGTAIL
FT                   TIIVSLDGDGTTTYMITVSAMYPLYKRLGMNPLILAGVVMLGAGVTNLTPWGGPTARVM
FT                   SALGLDASELFTPLIPGMIAGALWVVFVAYYLGKKERKRLGIMDVQYLKQMQTTDEQAA
FT                   TVEAAVHKRPKLLWINFLLTATLLVCLILEVMPLPVLFTIAFAIAVMLNYPNLEQQKER
FT                   IASHAGNVLAVVSLVFAAGIFTGILSGTKMVDAMAKSVVTLIPDALGPQLPIITALLSM
FT                   PFTFFMSNDAFYFGVLPILTKAAATYGISAAEMGRASLLRQPVHLLSPLVASTYLLVGM
FT                   AKVDFGEHQRFTLLWAVGTTMVMLITGILIGVIPI"
FT   gene            569938..570192
FT                   /locus_tag="BA_0562"
FT                   /old_locus_tag="BA0562"
FT   CDS_pept        569938..570192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0562"
FT                   /old_locus_tag="BA0562"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01BH3947"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24582"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A8L9S4"
FT                   /protein_id="AAP24582.1"
FT                   /translation="MKTRMEEICSSYEGKVEEIFVNESSYVYEWEKLMMIRKNNGELEK
FT                   VAVGISGNIRLVNVVVGQQIHTDTLLVRLEDDLLITGCE"
FT   gene            570327..570830
FT                   /locus_tag="BA_0563"
FT                   /old_locus_tag="BA0563"
FT   CDS_pept        570327..570830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0563"
FT                   /old_locus_tag="BA0563"
FT                   /product="putative lipoprotein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   premature stop"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24583"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H9U0"
FT                   /protein_id="AAP24583.1"
FT                   /translation="MRTKYVMFAICLFFVFTIVGCGKKQAEAVAIDEKHDKCDICQIGV
FT                   MDNQFATEIILENGKALKFDDIGCMYKWMEINPGEKTKEKFVRDYDSKDWISLEDATYV
FT                   YDKTITTPMAYNVISFKNKKDAENFVSNYKGKVLSYKELAEHKWEMNKEMMGNQKKGNH
FT                   GGHH"
FT   gene            571366..571989
FT                   /locus_tag="BA_0564"
FT                   /old_locus_tag="BA0564"
FT   CDS_pept        571366..571989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0564"
FT                   /old_locus_tag="BA0564"
FT                   /product="ankyrin repeat domain protein"
FT                   /note="identified by match to protein family HMM PF00023"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24584"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H9R6"
FT                   /protein_id="AAP24584.1"
FT                   /translation="MDKQLLLSATLGDTETAMKLIQDGANINVEGDNGETPVLAATYQN
FT                   HVETVKALIGAGANIEIKDEKQSNPLLYASREGYTDIVKVLINAGVNTKETTKLGGTAL
FT                   ISASERGHVEVVKELLEHTDIDVNYKNARGGTALVEAIVLGNGSENHKKVIQMLIDHGA
FT                   DVSMANKENITPLQFAEKRGFKDIANMLRAAGANEVVEPQQPVE"
FT   gene            572548..573114
FT                   /locus_tag="BA_0565"
FT                   /old_locus_tag="BA0565"
FT   CDS_pept        572548..573114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0565"
FT                   /old_locus_tag="BA0565"
FT                   /product="putative glycerol uptake operon antiterminator
FT                   regulatory protein"
FT                   /note="identified by similarity to OMNI:NTL01BS00926; match
FT                   to protein family HMM PF04309"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24585"
FT                   /db_xref="GOA:A0A3P1U2Y2"
FT                   /db_xref="InterPro:IPR006699"
FT                   /db_xref="InterPro:IPR035928"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1U2Y2"
FT                   /protein_id="AAP24585.1"
FT                   /translation="MFKEPYIAMIKDWKGYNTYKKLPKTVFLMTGSMLELPERVYELQK
FT                   HGHDVFLHCDFIQGLNTNTEEALSYIQDVIGAQGIISTKGSTIRNANKIGLKTIQRISI
FT                   VDTLSLTKSIENCKTTKPNAVEIMPGIMPSIIKQLAEEIEFPIIAGGLIQTREDAEIAI
FT                   RSGASAISTSHYEVWIQEEKRSAIL"
FT   gene            573078..574208
FT                   /locus_tag="BA_0566"
FT                   /old_locus_tag="BA0566"
FT   CDS_pept        573078..574208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0566"
FT                   /old_locus_tag="BA0566"
FT                   /product="putative glycerol-3-phosphate ABC transporter,
FT                   ATP-binding protein"
FT                   /note="identified by similarity to SP:P10907; match to
FT                   protein family HMM PF00005; match to protein family HMM
FT                   PF08402"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24586"
FT                   /db_xref="GOA:A0A3Q0PQH7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0PQH7"
FT                   /protein_id="AAP24586.1"
FT                   /translation="MDTRRKKECNLVIELKNVSKVYQNAEETAVKGVSVHIKKGEFFVL
FT                   VGPSGCGKSTLLRMIAGLEEISSGDLIINERVANDLEPKDRNLSMVFQNYALYPHLSVE
FT                   ENILFGLKVRKVQKEERQKRLMEAVEMVGLKEYVKMKPGQLSGGQRQRVALARAIVSQA
FT                   PICLMDEPLSNLDAKLRAQMRIEIREIQQRLGITMIYVTHDQIEAMTMGDRIMVLNKGS
FT                   VQQVGTPLDIYNKPANEFVASFIGSPSMNMNDGEVDEEKGVLHIGQLQIPLSIGQLKQL
FT                   PAGTVRVGMRPEHIALSEEGQEVTLQSVEVLGNESILNFVINGTTWSAKVIGQLLLNKG
FT                   DKVKLLFSEEKLCFFHQNTNERLKVVAEEELKVVAK"
FT   gene            574208..575140
FT                   /locus_tag="BA_0567"
FT                   /old_locus_tag="BA0567"
FT   CDS_pept        574208..575140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0567"
FT                   /old_locus_tag="BA0567"
FT                   /product="putative glycerol-3-phosphate ABC transporter,
FT                   permease protein"
FT                   /note="identified by similarity to GP:10173692; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24587"
FT                   /db_xref="GOA:A0A3P1U4R2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1U4R2"
FT                   /protein_id="AAP24587.1"
FT                   /translation="MIEVSKLPVQTKVSKKKNLWGRTKDLRIGLLFLAPSILLFSIFLF
FT                   YPLFRTIYYSFYLTDIHGEANLFVGLENYQYLFSNPAFYKSIKSTLLFVLYTVPTSIIF
FT                   ALFLALIANGKVRGIGLFRVLFSSTMGISVAASAVIWLFLFHPSVGLFNNILASMNLPA
FT                   IAWLTSPDWALFSVSVTTVWVNTGFAFLVILGGLQNIDTSLYESASIDGASYLYKLRRV
FT                   TLPMLSPTLFFIVTVTLISAFQSFGQIDILTHGGPNDATNLIVYSIYKEAFVNHQFGTA
FT                   SAQAMVLFVFIFIATLLQFKFAERKVHYK"
FT   gene            575137..575958
FT                   /locus_tag="BA_0568"
FT                   /old_locus_tag="BA0568"
FT   CDS_pept        575137..575958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0568"
FT                   /old_locus_tag="BA0568"
FT                   /product="putative glycerol-3-phosphate ABC transporter,
FT                   permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24588"
FT                   /db_xref="GOA:A0A347ZZ30"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZZ30"
FT                   /protein_id="AAP24588.1"
FT                   /translation="MIVKQWKQNFLLYMLLIISAVMVFFPVLYAFLISFMTPDDIQMRR
FT                   IFPTQFTFDNFINIFQKVPLFAYLYNSLVVSTVVMIGQLIVSSLAAYAFVFLQFKGRNL
FT                   IFFLFISTMLIPWEATMVPNFLTIQNFGWINSFAGMTVPFFATAFGIFLLRQHFMTLPN
FT                   ELKEAAFIEGIGNVRFLFSVVIPYCKTSFITLGVYSFLTTWNMYLWPLLVTTDETVRTV
FT                   QIGVKQLQSQEVATDWGSVMAGVTVIVIPTLILLFLGQKQLQQGLTKGAIK"
FT   gene            575980..577356
FT                   /locus_tag="BA_0569"
FT                   /old_locus_tag="BA0569"
FT   CDS_pept        575980..577356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0569"
FT                   /old_locus_tag="BA0569"
FT                   /product="putative glycerol-3-phosphate ABC transporter,
FT                   glycerol-3-phosphate-binding protein"
FT                   /note="identified by similarity to OMNI:NTL01EC03376; match
FT                   to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24589"
FT                   /db_xref="GOA:A0A347ZZ31"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZZ31"
FT                   /protein_id="AAP24589.1"
FT                   /translation="MSLVKKGAALLMVATMALSSAACSNSKTEGKPEAQAKVAPVEKNG
FT                   DKTVIRFWHAMGGKTQGVLDGLVADYNKSQNKYEIKAEFQGTYEESLTKFKTMSATKEA
FT                   PALVQSSEITTKYMIDSKKITPIDSWIKKDKYDTSKLEKAITNYYSVDGKMYSMPFNSS
FT                   TPVLIYNKDAFAKAGLDPEKAPKTYAELQEAAKKLTIKEGGNVKQYGFSMLNYGWFFEE
FT                   LLATQGALYVDNENGRKDAAKKAVFNGKEGQKVFGMLDELNKAGALGKYGASWDDIRAA
FT                   FQSGQVAMYLDSSAGVRDLIDASKFNVGVSYIPYPEDSKQNGVVIGGASLWMTNMVSEE
FT                   TQQGAWDFMKYLTKPDVQAKWHTATGYFSINPDAYNEPLVKEQYEKYPQLKVTVDQLQA
FT                   TKQSPATQGALISVFPESRDAVVKALEAMYDGENSKEALDEAAKATDRAISISARTSQK
FT                   "
FT   gene            577772..578476
FT                   /locus_tag="BA_0570"
FT                   /old_locus_tag="BA0570"
FT   CDS_pept        577772..578476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0570"
FT                   /old_locus_tag="BA0570"
FT                   /product="putative serine/threonine phosphatase"
FT                   /note="identified by similarity to GP:16410044; match to
FT                   protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24590"
FT                   /db_xref="GOA:A0A347ZZ32"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZZ32"
FT                   /protein_id="AAP24590.1"
FT                   /translation="MKRILVISDIHGEIEKFEQLLEEAQYDAKQDQLILLGDYVDRGPN
FT                   ARAVIEKVKELKEDGALVLKGNHEDMMIKALTTDEERSWNHWVKRNGGDKTLYSYGFVE
FT                   EDIMVNEKDFRKPILQSLVLEEHVKFIQKLDHYIETEEYIFVHAGVEPLKRVSECEPYT
FT                   LMWIRNEFHSEYSGEKVVVFGHTETKTLHGNDNCNVYFGNNRIIGIDGGAVYGGQLNCL
FT                   ELPSKKVYVVKS"
FT   gene            578626..579297
FT                   /locus_tag="BA_0571"
FT                   /old_locus_tag="BA0571"
FT   CDS_pept        578626..579297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0571"
FT                   /old_locus_tag="BA0571"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24591"
FT                   /db_xref="GOA:A0A0J1HU92"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1HU92"
FT                   /protein_id="AAP24591.1"
FT                   /translation="MRLLVVEDNASLLESIVQILCDEFEVDTALNGEDGLFLALQNIYD
FT                   AILLDVMMPEMDGFEVIQKIRDEKIETPVLFLTARDSLEDRVKGLDFGGDDYIVKPFQA
FT                   PELKARIRALLRRSGSLTTKQTIRYKGIELFGKDKDVQVDGQSMKLTLKQYELLEYLVQ
FT                   NSGKILMREQIFDRVWGFDSDTTVAIVEVYVHHLRKKLEPFGYQKDIQTVRGIGYILKE
FT                   Q"
FT   gene            579294..580544
FT                   /locus_tag="BA_0572"
FT                   /old_locus_tag="BA0572"
FT   CDS_pept        579294..580544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0572"
FT                   /old_locus_tag="BA0572"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="identified by similarity to GP:17134690; match to
FT                   protein family HMM PF00512; match to protein family HMM
FT                   PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24592"
FT                   /db_xref="GOA:A0A384L3H6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L3H6"
FT                   /protein_id="AAP24592.1"
FT                   /translation="MKKGSMFQKTRIRLTILNSLVFIILIGVLGSIIYSYTYKRIYSGV
FT                   NESIEKAVQHRKNADDKKLPKKIRGYPPIGDPRIMELTWLGNTVEIDIENGKRRFIFED
FT                   NLEKFSPKKLGTLQDIEVQGRYFRIFAFQKDAKIVQIARDITAEKEMLHTLFLILVIGC
FT                   SIGSLCAIGIGFFLAGRALVPIQNSWEKQQQFVSDASHELRTPLAVIQSKTDILFQSPS
FT                   ATIEEKAMDISTISKECRRLSKLVANLLLLARSDSNQIEMDKKIFELDKLLEEIVEPYK
FT                   EIASYQEKEMILKVEYDISFMGDRERIHQMMVILLDNAMKYTNEGGHIQIDCTQTNSSI
FT                   RIRVKDDGIGVKGEDIPKLFDRFYQGDKARSASEGAGLGLSIANWIVEKHYGKISVESQ
FT                   WGEGTCFEVILPKNQRI"
FT   gene            580763..581572
FT                   /locus_tag="BA_0573"
FT                   /old_locus_tag="BA0573"
FT   CDS_pept        580763..581572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0573"
FT                   /old_locus_tag="BA0573"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24593"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H9V0"
FT                   /protein_id="AAP24593.1"
FT                   /translation="MMMVFTIGVMSLSILGGASPSETSKGKTDYKQRSKEQLNNGKIHA
FT                   VHTEEKAEKLGIETTGKEQITLEKEIHETEVGREAKQLGISIEGKDVGTLSEEIYETKV
FT                   EQEALKLGISIENTSIVNLINQINTIKINDEADKLGISTNGKEIEDIAEEIYGTKVREE
FT                   AGKLGISPKGKEIEVLAQEVYEQKVQEEAKEYHIDLYGKDIYQVLSEINEQKVLQMADE
FT                   LNMDKTNMNVQELAEKIKKDQPEKGKELNFVPVIRTDADAFYSYLTN"
FT   gene            581586..582332
FT                   /locus_tag="BA_0574"
FT                   /old_locus_tag="BA0574"
FT   CDS_pept        581586..582332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0574"
FT                   /old_locus_tag="BA0574"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:16410113"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24594"
FT                   /db_xref="GOA:A0A2P0H9S6"
FT                   /db_xref="InterPro:IPR016997"
FT                   /db_xref="InterPro:IPR039563"
FT                   /db_xref="InterPro:IPR039564"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H9S6"
FT                   /protein_id="AAP24594.1"
FT                   /translation="MIRKFKWYICMALLGIAVWGIYTNGITKYVEKLTFFNIQSGKQVE
FT                   FNRDEKVILSNVPFIQQLPELDRGCEVTSLAMMLQYAGITVDKMKLANEIKKVDFMNDG
FT                   VRGNPNEGFVGNIYTFSESGYGVYHGPLFQLAKKYLPNKAVDLTGKSIEELYKSVKAGQ
FT                   PVVIITNATFAPLDEDEFTTWETNNGDVSITYNEHCVVLIGYDQESVYIRDPLKDSLDV
FT                   KVPREKFEQAWVQMGSQAISYVKRSK"
FT   gene            582586..584568
FT                   /locus_tag="BA_0575"
FT                   /old_locus_tag="BA0575"
FT   CDS_pept        582586..584568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0575"
FT                   /old_locus_tag="BA0575"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by similarity to EGAD:16380; match to
FT                   protein family HMM PF00015; match to protein family HMM
FT                   PF00672; match to protein family HMM PF02743"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24595"
FT                   /db_xref="GOA:A0A3P1U5X1"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1U5X1"
FT                   /protein_id="AAP24595.1"
FT                   /translation="MQKIFNWVKCMSIKKKLIISFFLILTIPGLIIGGVSYQTAKTNFE
FT                   QQITGKAKENISILNTVISQNIEEKFVDAAYFADILTEDTYPNGQEEIVRTKLAQYIKL
FT                   HPEVEGIYIGTQTGKFIREPFIQMSDGYNPTDRDWYKEAHENKGKVIVTAPYQSASTKN
FT                   MVVTIAKEVKDGKGVIGINLNLDNILKISKMINIGEKGYAVILDQNKQIVSHPSRKPGA
FT                   KVTDPWIKPIYEDKQRNVAYTEKDDKKNLIFATNEKTGWKVVGVMFDEEITQAANPVFY
FT                   KTFIVIAIAIVFGSVLIYFITKSITRPLRKIADSAYKISKGDLTEKITIHSKDDIGKLG
FT                   NSFNEMSASLQDVITQISFSAEHVAASAEELTASVQQANDATDQITIAMEQVSGGAESQ
FT                   SQGVEEGAATLQQVNTAIQDVNGSAESISISSLHARERAKEGEDLVEQTATQMQSISRS
FT                   VSESDAIIKLLDEKSKQVGAISEAIQNIATQTNLLALNAAIEAARAGEQGRGFAIVADE
FT                   VRKLAEQSGESSGEIANLIAEIKADIEHTVKAMDNVNGEVQQGLDVVTKTKVSFTEILS
FT                   STTHIVSQVNEMVETTKRIAGDANEVTNAIDEIAAAAEENTASMQSVAASTEEQVNSME
FT                   EISSASQNLAEMAEELQAMTSKFKV"
FT   gene            584647..586251
FT                   /locus_tag="BA_0576"
FT                   /old_locus_tag="BA0576"
FT   CDS_pept        584647..586251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0576"
FT                   /old_locus_tag="BA0576"
FT                   /product="sensory box histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="identified by similarity to GP:10173010; match to
FT                   protein family HMM PF00989; match to protein family HMM
FT                   PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24596"
FT                   /db_xref="GOA:A0A2P0H9U8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H9U8"
FT                   /protein_id="AAP24596.1"
FT                   /translation="MKKRKRLWNLWKTITLLVCTVVIFSLLVTDILISHNVERTTEDSQ
FT                   AEKAKTIAHIVANDSIVIDGLIGKADTSAIQTYTNRILKNTGVQFIVVMDMNGIRKSHP
FT                   NPQKIGHHFIGGDEGPALKGKEHVSLAEGTLGISMRVFVPIFSETGEQLGAVAVGISAD
FT                   NVKERVKESRHIIYIGVGVGVLVGIIGAILLARHIKKSLFGLEPHRIAKILEERNTMLQ
FT                   SVKEGIIAVDKEARVTLINNEAKRLFKKSGLEEDFIGKDVELYMPNSRIKEVLQTGEVQ
FT                   LNEEQNIYGITIVTNRVPLYVKEEIVGAIATFRDKTEIRKLAEELTGIRLYAEALRAQS
FT                   HEFMNKMHVVLGLTHMKQYEELQKYISGMVSEHQYEIGGVMKRIKSPVFAGFLLGKLSY
FT                   AREKNIKLIISEDSYMPEIDDESITHELITIVGNLIDNALEAVTNCEKKRVEVKIQHED
FT                   ILTITVQDTGKGIQEKEIEELFTKGYSTKGDNRGYGLYLVKESIQRINGEIHMHSLVGK
FT                   GTTITIEIPKGRDERQI"
FT   gene            586248..586955
FT                   /locus_tag="BA_0577"
FT                   /old_locus_tag="BA0577"
FT   CDS_pept        586248..586955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0577"
FT                   /old_locus_tag="BA0577"
FT                   /product="response regulator"
FT                   /note="identified by similarity to GP:1934810; match to
FT                   protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24597"
FT                   /db_xref="GOA:Q81VC0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VC0"
FT                   /protein_id="AAP24597.2"
FT                   /translation="MIKVLIVEDDPMVAMLNTHYLEQVGGFELVQAVNSIKSAIEVLEE
FT                   SRIDLVLLDIFMPEETGFELLMYIRNQEKEIDIMMISAVHDMGSIKKALQYGVVDYLIK
FT                   PFTFERFKEALTIYREKLTFMKEQQKISQSELDSLILQKEKREPTVTKELPKGLTKQTL
FT                   QLIWQKIESLNGRVFTTDEMAQLVGISRVSIRKYVMFLTDIGVLENEMMYQHVGRPVSK
FT                   LRCVDQKKIEFYV"
FT   gene            587078..588424
FT                   /locus_tag="BA_0578"
FT                   /old_locus_tag="BA0578"
FT   CDS_pept        587078..588424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0578"
FT                   /old_locus_tag="BA0578"
FT                   /product="citrate cation symporter family"
FT                   /note="identified by similarity to GP:1146122; match to
FT                   protein family HMM PF03390"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24598"
FT                   /db_xref="GOA:A0A2P0H9T9"
FT                   /db_xref="InterPro:IPR004679"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H9T9"
FT                   /protein_id="AAP24598.1"
FT                   /translation="MGIQKNVEAVSFSEGNEVQRESFASKIMNVKIGVIPLPLYVVLAA
FT                   IIYGASVYNKLPADMIGGFAVIMIMGIFLGDIGMRIPILKNIGGPAILSLFIPSLLVFF
FT                   NWMNPASMEAATMLMKKSNFLYLYISCLVVGSILGMNRKVLVQGFVRMFIPLVVGTLAS
FT                   VAVGLLVGSLFGFEMKHTFFFIIVPIVSGGIGEGILPLSLAYSDILNESSATFVSQLIP
FT                   AAIIGNMFAIVSAGYMKRLGEKKPELSGNGVLVKTDNQAELLKEQNTEKPIDFSLMGAG
FT                   LLIACTFFIFGGFASKFIGIPGAIIMIFSAALVKYFKLMPAKMEQGAFHLYKFISKNLT
FT                   WPLMVGLGLLYIPLKDVAAVLSVGYVVVCASVVLTMVASGFLVGKVMKMYPVESAIVTG
FT                   CHSGLGGTGDVAILSASNRMELMPFAQISTRLGGAAMVVTATILLKMFS"
FT   gene            588484..589683
FT                   /locus_tag="BA_0579"
FT                   /old_locus_tag="BA0579"
FT   CDS_pept        588484..589683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0579"
FT                   /old_locus_tag="BA0579"
FT                   /product="putative malate dehydrogenase"
FT                   /note="identified by similarity to GP:10173012; match to
FT                   protein family HMM PF00390; match to protein family HMM
FT                   PF03949"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24599"
FT                   /db_xref="GOA:A0A384KM70"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KM70"
FT                   /protein_id="AAP24599.1"
FT                   /translation="MLANQINERSLLLHKELVGKIEITSKVEVNSADDLSLTYTPGVAE
FT                   SCKAIAADEETVYDYTARGNMVAVVSDGTAVLGLGNIGPKAAMPVMEGKSILFKKFANV
FT                   DAFPLCLGTTDVDEIVTLVKNLEPTFAGINLEDIAAPRCFEIEKRLKEETNIPVFHDDQ
FT                   HGTAIVVLAAVINALKVVSKQMDHVKIVINGAGSAGIAIGKLLLKAGAQHITLVSLEGI
FT                   VCEGEAWMNEAQIEVSKKTNREHVRGTLKEAIHQADIFIGVSAPNVLTKELVQMMNEKA
FT                   IVFAMANPIPEIFPEDALEAGAAVVGTGRSDYANQVNNVLAFPGIFRGALDVRATDITE
FT                   EMKLAAAYGIANIITDEERNANYVIPNPLDKRVVPSVAEAVAKAAIDSGVAQIMKIPSY
FT                   "
FT   gene            complement(589979..590503)
FT                   /locus_tag="BA_0580"
FT                   /old_locus_tag="BA0580"
FT   CDS_pept        complement(589979..590503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0580"
FT                   /old_locus_tag="BA0580"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24600"
FT                   /db_xref="InterPro:IPR032366"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H9W9"
FT                   /protein_id="AAP24600.1"
FT                   /translation="MKKIGTMLLFSILIAGCTQAQPDLKKPKKEAIATSSTQVNAPSFF
FT                   HLSVLKDVNWEETPSFIQEKIPLKGIEEKIAMADSPIIANEKNEIMWYFLDPEMPTGKL
FT                   SIIALKQGSVTPTPLLFQQESSEPTWTTSNTIDSTTNELPLTMSLPSSGLWVLNIYVNE
FT                   KYYDQFVITAE"
FT   gene            complement(590619..591545)
FT                   /locus_tag="BA_0581"
FT                   /old_locus_tag="BA0581"
FT   CDS_pept        complement(590619..591545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0581"
FT                   /old_locus_tag="BA0581"
FT                   /product="transporter, EamA family"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24601"
FT                   /db_xref="GOA:A0A347ZZ43"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZZ43"
FT                   /protein_id="AAP24601.1"
FT                   /translation="MNNSRRIGLIMIITGATLWGLSGPMIQWLFQHTNVSSVDFLTIRL
FT                   LLAGIFILSFLLIKKQNIFQIWKHPRYSIQLIIFSILGMLGAQYAFIETVHISNAVTAT
FT                   LFQFLGPVLITMYVAFEQRKSPAPIQLLAIITALTGTYFIITNGSIENIVLSKEAIIFG
FT                   LLTAIGFAFYTLHPASLIKECGTIVVIGWGMLIGGIALLICNRSFEWTQLSQTFTLKTF
FT                   SMLILIIISGTLSFLLYIGSLKYLAATETSILSSIEPLVAAIVSIAWLNESFGAYQLLG
FT                   GLCIVLSVIFLTMPQKENEATFSTEQI"
FT   gene            591666..593066
FT                   /locus_tag="BA_0582"
FT                   /old_locus_tag="BA0582"
FT   CDS_pept        591666..593066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0582"
FT                   /old_locus_tag="BA0582"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by similarity to OMNI:NTL01BH0579; match
FT                   to protein family HMM PF00155; match to protein family HMM
FT                   PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24602"
FT                   /db_xref="GOA:A0A347ZZ44"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZZ44"
FT                   /protein_id="AAP24602.1"
FT                   /translation="MLELTPNLNMNSKKALYVQLYEYIKKEIKDGTISAFTKLPAKRKL
FT                   AGYLQVSKNTIEAAYEQLLAEGYIESISRKGYFVCEFEQMMDVEGSEAEVEEIPFREGN
FT                   YTFDFTQTGVDTNTFPFTTYRKLINDVWQPHNNDLLFLGHPQGELSLREEIANYLYESR
FT                   GVRCSASQIVLGAGTQILVKLLFQLLKGSNYAVENPGYHRKMVVFEQGEKKVQMLSLDR
FT                   DGICMADLENSDANVVFVTPSHQFPYGMIMPITRRTQLLQWAKKEEDRYIIEDDYDSEF
FT                   RYSGRPIPALQGLDTDGKVIYMGTLSKALLPSLRMSYIVLPKNLIKKYQKEYLFYTQSV
FT                   SRMDQEVIRKFLNEGYWEKHIHKMRVVYRKKRDRLVFEIEKYFSNRVEVIGEDSGLHIL
FT                   LKVHNGMREEELIKAAAKYSIKIYPFSTYYKDDTAPENVVLLGFAILSEEEIAKAIQLL
FT                   HKAWFTRK"
FT   gene            complement(593100..593612)
FT                   /locus_tag="BA_0583"
FT                   /old_locus_tag="BA0583"
FT   CDS_pept        complement(593100..593612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0583"
FT                   /old_locus_tag="BA0583"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24603"
FT                   /db_xref="GOA:A0A347ZZ45"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZZ45"
FT                   /protein_id="AAP24603.1"
FT                   /translation="MDIHVLTKDEAEIYLELRVEGLKQNPEAFSSSYEDIINKECAIEY
FT                   KAQKLAQDENYTLGAFKDGKLIGVATLETKPYVKQEHKAKIGSVYVSPKARGLGAGKAL
FT                   IKECLELAKSLEVEQVMLDVVVGNDGAKKLYESLGFKTFGVQERSLKYNGQYWDEEHMV
FT                   LFLDENK"
FT   gene            complement(593759..595222)
FT                   /locus_tag="BA_0584"
FT                   /old_locus_tag="BA0584"
FT   CDS_pept        complement(593759..595222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0584"
FT                   /old_locus_tag="BA0584"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24604"
FT                   /db_xref="GOA:A0A2P0H9T4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H9T4"
FT                   /protein_id="AAP24604.1"
FT                   /translation="MSKLSLKIGTYFLILALCIETIAFVSFYKSISKMRIEEETLALLE
FT                   KGNRYSNKITRRAKWSAHAQEKKNIERTEYNKNPNRPIYPDFDIADEAEHLVESESISN
FT                   SDIAIIITDNNGKIISTSEPVTKAMQKQLTCKTEPIPKDGLIVEKNWKKSKFITTVSPI
FT                   HTTEFQGKLYMLLKTSFLENMLLKLMKQFLIISVLTIILTTISVFIFSRVITEPLIKMK
FT                   RATEKMSKLNKPIQLGIKRNDELGSLAKTIEDLSSELTYMKKERGEFLASVAHELLTPL
FT                   TYMKGYAKVAKRDSLTKEEREEYLQIIEDETDSVTDLVQDLFMLVQLEQHQFVIKKQKV
FT                   LLRPFLERMVEKTKTTLTNKQMQLHVYCKDDLEVCIDERRMEQVMLNLLHNAYQHSLEN
FT                   TTITIRVLAETNSFTISVQDEGEGIPEGDIPHIFDRFYRVDKSRTRATGGKGIGLAVAK
FT                   EIVELHNGSILVTSKLDVGTNFIIELPFE"
FT   gene            complement(595288..595959)
FT                   /locus_tag="BA_0585"
FT                   /old_locus_tag="BA0585"
FT   CDS_pept        complement(595288..595959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0585"
FT                   /old_locus_tag="BA0585"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by similarity to GP:3687663; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24605"
FT                   /db_xref="GOA:A0A384KF30"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KF30"
FT                   /protein_id="AAP24605.1"
FT                   /translation="MVKILLVDDEERMLRLLDLFLSPRGYFCMKATSGLEALKLIEQKD
FT                   FDIILLDVMMPNMDGWDTCYQIRQISNVPIIMLTARNQNYDMVKGLTMGADDYITKPFD
FT                   EHVLVARIEAILRRTKKDGFVSFNGIEWDKTKHTVTVYDEKISLTPIEFSLLRLFLQNT
FT                   NRAYSRDDLIEKIWGYETDIEYRTIDSHIRNIRDKLRKKGFPVENYLETVYKVGYKWKS
FT                   E"
FT   gene            596289..596411
FT                   /locus_tag="BA_0586"
FT                   /old_locus_tag="BA0586"
FT   CDS_pept        596289..596411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0586"
FT                   /old_locus_tag="BA0586"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS39584.1"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0586"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24606"
FT                   /db_xref="GOA:A0A384L0E2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L0E2"
FT                   /protein_id="AAP24606.1"
FT                   /translation="MNPKEEISKKEKQDRNTVVMCIAVSMVIIISCVNKIWGIL"
FT   gene            complement(596793..597299)
FT                   /locus_tag="BA_0587"
FT                   /old_locus_tag="BA0587"
FT   CDS_pept        complement(596793..597299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0587"
FT                   /old_locus_tag="BA0587"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24607"
FT                   /db_xref="GOA:A0A347ZZ49"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZZ49"
FT                   /protein_id="AAP24607.1"
FT                   /translation="MEIRLLTTEDAEIYLKVCMEGLTKNPEAFSSSYEDVLKHEDPVAA
FT                   MAKRLSNPDKYTLGVFKDKDLIGIATLETKPFIKQEHKAKIGSVFVSPKARGLGAGRAL
FT                   IKAIIENADKLHVEQLMLDVVVGNDAAKKLYESLGFQTYGVQERSLKHNGQYWDEEHMV
FT                   LFLND"
FT   gene            complement(597528..598334)
FT                   /gene="fdhD1"
FT                   /locus_tag="BA_0588"
FT                   /old_locus_tag="BA0588"
FT   CDS_pept        complement(597528..598334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdhD1"
FT                   /locus_tag="BA_0588"
FT                   /old_locus_tag="BA0588"
FT                   /product="formate dehydrogenase accessory protein FdhD"
FT                   /note="identified by match to protein family HMM PF02634;
FT                   match to protein family HMM TIGR00129"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0588"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24608"
FT                   /db_xref="GOA:A0A347ZZ50"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZZ50"
FT                   /protein_id="AAP24608.1"
FT                   /translation="MGPTQETYTIVRYHSGTFSKQIDEIVTESPITIKLNGEEYVTVVC
FT                   TPNYIEDMVIGFLISEGIISSYKDVGELWVQKDNGIVHVTSSKVNPLYQNLYNKRYITS
FT                   CCGKGRQGFIFANDAAKAKNLHNIHVTITPEECFHLMNTLQQSSTTFRQTGGVHNTALC
FT                   DRNNILLSRMDIGRHNALDKIYGHCLRNDISVKGKIIAFSGRISSEILLKVSKIGCEIV
FT                   LSKSAPTKLALQLAHDLGITVVGFIRNESCNIYTHPHRIDGYQSNN"
FT   gene            598638..601574
FT                   /locus_tag="BA_0589"
FT                   /old_locus_tag="BA0589"
FT   CDS_pept        598638..601574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0589"
FT                   /old_locus_tag="BA0589"
FT                   /product="molybdopterin oxidoreductase family protein"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF00111; match to protein
FT                   family HMM PF00384; match to protein family HMM PF01568;
FT                   match to protein family HMM PF04879; match to protein
FT                   family HMM TIGR01591"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24609"
FT                   /db_xref="GOA:A0A347ZZ51"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006478"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR041924"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZZ51"
FT                   /protein_id="AAP24609.1"
FT                   /translation="MAEQTVRVTVDGKEFSASGEKTILQLFNESNLEHPQICHVPEVDP
FT                   IQTCDTCIVEVDGKLMRACSTQIENGMHIERQSQRAKEAQTEAMDRILENHLLYCTVCD
FT                   NNNGNCKVHNTVHMMGIEEQKYPYEPKVSACEVDMSHPFYRYDPNQCIACGQCVEVCQN
FT                   LQVNETISIDWSLDRPRVIWDHGVSINDSSCVSCGQCVTVCPCNALMEKSMLGEAGFMT
FT                   GLKPDVLDPMIDFVKDVEPGYSSILAVSEVEAAMRKTKVNKTKTVCTFCGVGCSFEVWT
FT                   KDRHILKVQPVSDAPVNGISTCVKGKFGWDFVNSEDRITKPLIRQGDMFVEASWEEALE
FT                   VVASNMQHIKSAYGSDAFGFISSSKVTNEENYLMQKLARQIYGTNNVDNCSRYCQSPAT
FT                   DGLFKTVGMGGDAGTVKDIAEAGLVIIVGANPTEGHPVLATRVKRAHKLHEQKLIVADL
FT                   RKHEMAERADLFIHPRQGTDYVWLAGITKYIIDQDWHDKKFIAENVKNFDEYSKMVEKY
FT                   TLDYTEKITGISKENLKEMARMVYEADGTCVLWGMGVTQNTGGSTTSAAISNLLLVTGN
FT                   YRRPGAGAYPLRGHNNVQGACDMATLPNWLPGYQAVSDDTLRAKFEKAYGTTIPKAPGL
FT                   NNIAMLLAAEEGKLRGMYVMGEEMALVDSNANHVQHILANLDFLVVQDMFLSKTARFAD
FT                   VILPAAPSLEKEGTFTNTERRIQRLYEVLKPLGDSKPDWWILQKVARALGGDWNYESPS
FT                   EIMDEIASLAPLYSQATYDRLEGWNSLCWGSHDGSDTPLLYVDGFNFPDKLARLSLDEW
FT                   IPPVVAPDEYDLLLNNGRMLEHFHEGNMTNKSAGILSKVSEVFVEISPELAIERNVKDG
FT                   GLVELASPFGKIKVQALITDRVTGKELYLPMHATINEEAINILTGTATDLYTCTPAYKQ
FT                   TMVKMRVLREKGNRPLPPSNPRDKNRNPQNGVEIEQKWQRKQYVSLVD"
FT   gene            601587..602069
FT                   /pseudo
FT                   /locus_tag="BA_0590"
FT                   /old_locus_tag="BA0590"
FT                   /note="conserved hypothetical protein, authentic point
FT                   mutation; an automated process has identified a potential
FT                   problem with this gene model; it may contain one or more
FT                   premature stops and/or frameshifts"
FT   gene            602262..604097
FT                   /locus_tag="BA_0591"
FT                   /old_locus_tag="BA0591"
FT   CDS_pept        602262..604097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0591"
FT                   /old_locus_tag="BA0591"
FT                   /product="glycerophosphoryl diester phosphodiesterase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF03009"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0591"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24610"
FT                   /db_xref="GOA:A0A2P0H9X5"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR018476"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H9X5"
FT                   /protein_id="AAP24610.1"
FT                   /translation="MGHSFQTVKFAFWNVLTFQLAYKLLAAIVFVPLFGIIFNKLLYFG
FT                   GYANATNDELLAFLKTPYGILAIVILSLLALFLIFTEFAVLIIISYFAHKRQKVRLRPI
FT                   LYKTVTYLPTLFTYCLPGFILYAVVLLPLLNMGYETALIPQIQIPNFITGELFKTTMGQ
FT                   VGYYTFFAVVAYLNLRWIFVLPIVVLEQKPFRVAARKSAKLVKESFFKVLFFLVGFFIS
FT                   IGIVYVLFLGIYLLCLWGVYEFTNPKGTFALLAESTMSVFLTSTLYLFSFIVTPFYIMA
FT                   ITRLYLQKVPVEDVLLEEGLDYSKTKADKCFFQKHRWKFIGVYIVGIITAGMVVAFIVT
FT                   FITNTYKEPIIMAHRGYISKGVENTKEALQGAIDAKADYAEIDVLQTKDGELAVIHDLK
FT                   LKRLANANVHVSDLTMDELRQLTLSQDGFSGQISTLDEIIKLAKGKIKLNIEVKLHGGE
FT                   KDFVNKVLKTIKDNEFEKQCVIQTLHYPLIKEFKRANPNIKVGYILYASRAHLKNVKAD
FT                   FYVAEEYMLNKKLVKEARKLNKPIYVWTVNDMESLKGYYKLNVDGIITDYPEDARETIK
FT                   MLKEQEEEESDLFDKITETTDDLFSKLFISYPAAS"
FT   gene            604465..605598
FT                   /gene="ald1"
FT                   /locus_tag="BA_0592"
FT                   /old_locus_tag="BA0592"
FT   CDS_pept        604465..605598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ald1"
FT                   /locus_tag="BA_0592"
FT                   /old_locus_tag="BA0592"
FT                   /product="alanine dehydrogenase"
FT                   /EC_number="1.4.1.1"
FT                   /note="identified by match to protein family HMM PF01262;
FT                   match to protein family HMM PF01488; match to protein
FT                   family HMM PF05222; match to protein family HMM TIGR00518"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24611"
FT                   /db_xref="GOA:A0A347ZZ55"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZZ55"
FT                   /protein_id="AAP24611.1"
FT                   /translation="MRIGVPAEIKNNENRVAMTPAGVVHLIRNNHEVFIQKGAGLGSGF
FT                   TDAQYVEAGAKIVDTAEEAWNMEMVMKVKEPIESEYKHFSEGLILFTYLHLAPEPELTK
FT                   ALIEKKVVSIAYETVQLENRSLPLLAPMSEVAGRMAAQIGAQFLEKNKGGKGILLAGVP
FT                   GVKRGKVTIIGGGQAGTNAAKIAVGLGADVTIIDLSAERLRQLDDIFGNQVKTLMSNPY
FT                   NIAEAVKESDLVIGAVLIPGAKAPKLVTEEMIKSMEPGSVVVDIAIDQGGIFETTDRIT
FT                   THDNPTYEKHGVVHYAVANMPGAVPRTSTLALTNVTVPYAVQIANKGYKEACLGNSALL
FT                   KGINTLDGYVTFEAVAEAHGVEYKGAKELLEAETVSC"
FT   gene            605702..607117
FT                   /locus_tag="BA_0593"
FT                   /old_locus_tag="BA0593"
FT   CDS_pept        605702..607117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0593"
FT                   /old_locus_tag="BA0593"
FT                   /product="amino acid permease family protein"
FT                   /note="identified by similarity to GP:6759463; match to
FT                   protein family HMM PF00324; match to protein family HMM
FT                   PF03845"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24612"
FT                   /db_xref="GOA:A0A2C3GDG5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2C3GDG5"
FT                   /protein_id="AAP24612.1"
FT                   /translation="MANLFKKKSVTQLLGESKSKTLTKTLGAFDLTMLGIGAIIGTGVL
FT                   VLTGLVAARDAGPAVIFSFMIAAIVCGFAALCYAEVASTLPVSGSVYTYSYATIGEFIA
FT                   HLMGWTLLSVYVVTTAAVAGGWTGYFNNLVSGFGLEIPTELLKIPSQGGIVNLPAVVIT
FT                   LVLTWLLSRGTKESKRVNNIMVLIKIGIVILFIAVGAFYVQPENWTPFAPYGISGIFAG
FT                   GAAVFFAFLGFDALATSAEEVKNPQRDLPIGIIASLVICTIIYVVVCLVMTGMVSYKEL
FT                   DVPEAMAYVLEVVGQDKVAGVIAVGAVIGIMAVIFAYIYATTRVFFAMSRDGLLPKSFA
FT                   KINKKTEAPVFSTWLTGIGSALIAGFIDLKELSNLANIGALLTFAMVGVSVIILRKTHP
FT                   NLKRGFMVPLVPTLPLISIACCLFLMFNLPLTTWIYFGIWLAIGVVVYFVYSKKHSHLK
FT                   DDGSSQDNLEQAN"
FT   gene            607384..607761
FT                   /locus_tag="BA_0594"
FT                   /old_locus_tag="BA0594"
FT   CDS_pept        607384..607761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0594"
FT                   /old_locus_tag="BA0594"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="identified by similarity to OMNI:NTL01SS02736; match
FT                   to protein family HMM PF01022"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24613"
FT                   /db_xref="GOA:A0A2A7DE19"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A7DE19"
FT                   /protein_id="AAP24613.1"
FT                   /translation="MAGNKVETPQETCSQTIIHEEVVDQVKQTIPTDESLSKVAELFKV
FT                   LGDRTRTRILHALFEAEMCVCDLAYLLGMTQSSISHQLRVLKQAKLVKNRKEGKVVYYS
FT                   LADQHVIHIFEQAFEHVNEEE"
FT   gene            607786..610152
FT                   /locus_tag="BA_0595"
FT                   /old_locus_tag="BA0595"
FT   CDS_pept        607786..610152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0595"
FT                   /old_locus_tag="BA0595"
FT                   /product="heavy metal-transporting ATPase"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00403; match to protein
FT                   family HMM PF00702; match to protein family HMM TIGR01494;
FT                   match to protein family HMM TIGR01512; match to protein
FT                   family HMM TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0595"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24614"
FT                   /db_xref="GOA:A0A347ZZ58"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZZ58"
FT                   /protein_id="AAP24614.1"
FT                   /translation="MAEALVKKKLMLEGLDCANCAMKIEKGVGNIEGVNSCSVNFATKT
FT                   MVLETAQNKESEVVTEAKKLVTKLEPHIKVQEEKNTKVAKEVFILEGLDCANCAMKIEN
FT                   KVKEMPTVSAATVDFVSKKLRVEVANKRELEATVANITNVVQKLEPDVKVVREEKGGHD
FT                   HGHSHDHGEANVKKMVGRLVVGGILTAIAALAGLPQMITIPLFVLAYLLIGGDIVWRAV
FT                   RNITRGQVFDENFLMAIATLGAFAIQQYPEAVAVMLFYQVGELFQSIAVNRSRKSITSL
FT                   MDIRPDYANVKIGNETKQVSPEDVQIGDYIIVKPGEKVPLDGKVVEGTSMVDTSALTGE
FT                   SVPREVEVGNDVLSGFVNQNGVLTIEVTKEFGESTVSKILDLVQNASSKKAPTENFITK
FT                   FARYYTPVVVITAAIMAFIPPLILEGATFSDWIYRALVFLVISCPCALVVSIPLGFFGG
FT                   IGGASKSGVLVKGSNYLEALNDVKYIVFDKTGTLTKGVFKVTKMEPSEGITNEELLEYA
FT                   AFAEVYSNHPIAQSIRNAYRKSIDEKIIDDYNEISGHGTVVKVQGKEIFAGNAKLMRKE
FT                   NITFKQPETVGTLVHVAVDGKYAGYIVISDEVKEDSKQAIQKLKELGIKKTVMLTGDAK
FT                   LVGEAVGKELGLDEVHAELLPQQKVEEIEKIDAAKHGKEKVAFVGDGINDTPVLARADV
FT                   GIAMGGLGSDAAIEAADIVIMTDEPSKIATAVNIAKRTRRIVWQNIIFALGVKGLVLLL
FT                   GAFGIATMWEAVFSDVGVTLLAVLNAMRVLRVKDL"
FT   gene            complement(610356..611819)
FT                   /locus_tag="BA_0596"
FT                   /old_locus_tag="BA0596"
FT   CDS_pept        complement(610356..611819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0596"
FT                   /old_locus_tag="BA0596"
FT                   /product="putative nicotinate phosphoribosyltransferase"
FT                   /note="identified by match to protein family HMM PF04095;
FT                   match to protein family HMM TIGR01513"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24615"
FT                   /db_xref="GOA:A0A347ZZ59"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="InterPro:IPR041619"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZZ59"
FT                   /protein_id="AAP24615.1"
FT                   /translation="MTYYKDDSYALHTDLYQINMAYTYWKDGIHNRRSVFDLYFRKLPF
FT                   ENGYAVFAGLEKIVEYIENFSFTESDIAYLAELQFEEEFLHYLQNMKFTGTVRSMQEGE
FT                   VVFNNEPLLRVDAPLGEAQIIETALLNIVNYQTLIATKAARMKHAANNDELLEFGTRRA
FT                   HEFDAALWGTRAAFIGGFSSTSNVRAGKRFGIPVAGTHAHSFVQAYRDEYVAFKKYAET
FT                   HKKCVFLVDTYDTLKSGVPNAIRVAKEFGDRIDFYGIRLDSGDMAYLSKKARKLLDEAG
FT                   FTNTKIIASSDLDEYTIMHLKSQGAKINVWGVGTKLITSFEQPALGAVYKLVAIEDTDG
FT                   KLNDTIKISSNPEKITTPGLKRIYRIINRVNDHAEGDYIALDYEEPGKEERLKMFHPVH
FT                   TYISKFVTNFEARELHKDIFVNGERTYELPSILDIQKYNEQSLSLFWEEYMRTLNPEEY
FT                   PVDLSQECWDHKMNYIQTVREQVEKNIQK"
FT   gene            612020..613288
FT                   /locus_tag="BA_0597"
FT                   /old_locus_tag="BA0597"
FT   CDS_pept        612020..613288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0597"
FT                   /old_locus_tag="BA0597"
FT                   /product="transcriptional regulator/TPR domain protein"
FT                   /note="identified by similarity to GP:12655807; match to
FT                   protein family HMM PF00515; match to protein family HMM
FT                   PF01381; match to protein family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0597"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24616"
FT                   /db_xref="GOA:A0A3P1U5Z1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1U5Z1"
FT                   /protein_id="AAP24616.1"
FT                   /translation="MQQTLEKIGKQVFYKRLQQKMTQEELCQGICSVSYLSKIENGKIE
FT                   ASEEILQLLCTRLEIAVTDLRDVEEDVKGKLDEWLNALVHLDKPQVERIYEELQSEMKH
FT                   VLDFEIINYYKLLYTRYLIMKRDIATLEEELDRLKKVYKKYSPFQKLLYMYSRGLLCCL
FT                   QYRWKEGLDYLLKTEVMAKEQGYHETGLYYNIALVYTHLDIHHLAIHFVNIALEGFRSE
FT                   YKFRNIINCQILIAVSYTEKGQYEEALKMYESILRESASFADKDVLLAITLSNMGSIYY
FT                   KKGKYQQAKKYYLDSLQLQKQIDLNYLDTIYEMAVVCIKLEELEEAKALIDKGIDAAKQ
FT                   EERFNAKLYLLLMLRYKYFEEAKDYKAFLENEAIPLYKSAGNKIELKKVYIELAEHFSS
FT                   LSRFEESNRYYRLVIDLMNDKEE"
FT   gene            613291..613422
FT                   /locus_tag="BA_0598"
FT                   /old_locus_tag="BA0598"
FT   CDS_pept        613291..613422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0598"
FT                   /old_locus_tag="BA0598"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24617"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LN05"
FT                   /protein_id="AAP24617.1"
FT                   /translation="MKKMVFGALAFIVTLTVAGGIHQYSSKPDIVGQEAKTVQQINS"
FT   gene            613589..615289
FT                   /locus_tag="BA_0599"
FT                   /old_locus_tag="BA0599"
FT   CDS_pept        613589..615289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0599"
FT                   /old_locus_tag="BA0599"
FT                   /product="neutral protease"
FT                   /note="identified by similarity to SP:P05806; match to
FT                   protein family HMM PF01447; match to protein family HMM
FT                   PF02868; match to protein family HMM PF03413; match to
FT                   protein family HMM PF07504"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24618"
FT                   /db_xref="GOA:A0A347ZZ62"
FT                   /db_xref="InterPro:IPR001570"
FT                   /db_xref="InterPro:IPR011096"
FT                   /db_xref="InterPro:IPR013856"
FT                   /db_xref="InterPro:IPR023612"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZZ62"
FT                   /protein_id="AAP24618.1"
FT                   /translation="MKKKSLALVLATGMAVTTFGGTGSAFADSKNVLSTKKYNETVQSP
FT                   EFISGDLTEATGKKAESVVFDYLNAAKGDYKLGEKSAQDSFKVKQAKKDAVTDSTVLRL
FT                   QQVYEGVPVWGSTQVAHVSKDGSLKVLSGTVAPDLDKKEKLKNKNKIEGAKAIEIAQKD
FT                   LGVTPKYEVEPKADLYVYQNGEETTYAYVVNLNFLEPSPGNYYYFIEADSGKVLNKYNK
FT                   LDHVANEDKSPVKQEAPKQEAKPAVKPVTGTNAVGTGKGVLGDTKSLNTTLSASSYYLQ
FT                   DNTRGATIFTYDAKNRSTLPGTLWVDADNVFNAAYDAAAVDAHYYAGRTYDYYKATFNR
FT                   NSINDAGAPLKSTVHYGSRYNNAFWNGSQMVYGDGDGVTFTSLSGGIDVIGHELTHAVT
FT                   EYSSDLIYQNESGALNEAISDVFGTLVEYYDNRNPDWEIGEDIYTPGKAGDALRSMSDP
FT                   TKYGDPDHYSKRYTGTGDNGGVHTNSGIINKAAYLLANGGTHYGVTVNGIGKDKVGAIY
FT                   YRANTQYFTQSTTFSQARAGLVQAAADLYGASSAEVAAVKQSYSAVGVN"
FT   gene            complement(615352..615900)
FT                   /locus_tag="BA_0600"
FT                   /old_locus_tag="BA0600"
FT   CDS_pept        complement(615352..615900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0600"
FT                   /old_locus_tag="BA0600"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF09335"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24619"
FT                   /db_xref="GOA:A0A3P1U4U1"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1U4U1"
FT                   /protein_id="AAP24619.1"
FT                   /translation="MAETIQNFLTDYYSIAIPLSILINIIISLLGFIPSIFLTAINIQL
FT                   FGVTNGTIISIAGEALGAIISFYIYRIGLQKFTHSKVNKYPKVERLLYVKGKEAFLLVL
FT                   SFRLIPFIPSSIVTLFAALGKMSLLSFSIASTIGKIPALLIEVYSAYHVINGTNEAKWI
FT                   VTIAGAIGLFYLWKKWRKK"
FT   gene            616279..616797
FT                   /locus_tag="BA_0602"
FT                   /old_locus_tag="BA0602"
FT   CDS_pept        616279..616797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0602"
FT                   /old_locus_tag="BA0602"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0602"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24620"
FT                   /db_xref="InterPro:IPR041436"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1U4U7"
FT                   /protein_id="AAP24620.1"
FT                   /translation="MKRISSLFLSSLLALMLILSGCAGKEQKTEKQTGNQSTSVEKISD
FT                   NILDEMEGPPKNGHTIERHVGKSEEDLKNRLKTDKVSAASTYYDKETATKAVKDSLKQH
FT                   DKEIQDWLKNSKEARLVLNTTHSFPVGKTVIKKNMNVKDKLVKTVTVLARDKSGDLGYK
FT                   IITSYPSDK"
FT   gene            616813..617085
FT                   /locus_tag="BA_0603"
FT                   /old_locus_tag="BA0603"
FT   CDS_pept        616813..617085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0603"
FT                   /old_locus_tag="BA0603"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0603"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24621"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2B6CJI5"
FT                   /protein_id="AAP24621.1"
FT                   /translation="MYTTLQYFLKSYCTLSIHEDEIVGVMEEFIEQEDEEIVLKLRDEL
FT                   LYMKKKDAWEEACVLAARQGNRMWSLEETKDHLTTFLVLLQKKKA"
FT   gene            complement(617134..618396)
FT                   /locus_tag="BA_0604"
FT                   /old_locus_tag="BA0604"
FT   CDS_pept        complement(617134..618396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0604"
FT                   /old_locus_tag="BA0604"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:15023569; match to
FT                   protein family HMM PF04294"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24622"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="InterPro:IPR022029"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZZ66"
FT                   /protein_id="AAP24622.1"
FT                   /translation="MKLSKILIGSAIAGGILLCVGGVSGYQYVSKLNNQLDTTALPNTT
FT                   FEGISLDGKNKKDIQAIINQKITELDQKSLTYIFQNDKQTYTWKDLGINYKEKDIIDKI
FT                   FKEQEGNAINRYKMRKQAENGELKRDYKLTPQLNTTAYESFMKDKYNKTLKNPVNAELS
FT                   IEGTTVNISQSQNGEKIDKGKLTDLTKQAITSGTSDITLPVTLLKPERSTEDIQKMGIK
FT                   EVIAEYSTPMAGRNGNQSFNVNKSANTLSGVIVAPDETFSFNGRVGVTDAAHGYKSAAV
FT                   YSQGKVIQSAGGGVCQVSSTLYSAALRADLGIVSRSNHSMPVNYLPLGQDAAVADYGPD
FT                   LKFKNNTGNHIYIQAFSNGGSITTRIFGTNTGKNVEVSSQVISRTNDKITAVTYKKVTQ
FT                   NGEVISNGQISKSVYKSAPKQ"
FT   gene            complement(618631..619632)
FT                   /locus_tag="BA_0605"
FT                   /old_locus_tag="BA0605"
FT   CDS_pept        complement(618631..619632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0605"
FT                   /old_locus_tag="BA0605"
FT                   /product="transcription antiterminator, LytR family"
FT                   /note="identified by similarity to OMNI:NTL01BS03560; match
FT                   to protein family HMM PF03816; match to protein family HMM
FT                   TIGR00350"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0605"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24623"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H9X4"
FT                   /protein_id="AAP24623.1"
FT                   /translation="MNKDTRAKKGRSKKKRLLWFLLIPLLIIALGAGGYSFHIYSKAKS
FT                   ILSNAYSELGRGDKSSKREKAVKPMTDNISILIMGVDESDIRDKNYGKATRTDALLLAT
FT                   INKNDKSVKLVSIPRDSRVYIKSREKYDKITHAHVFGGVDSTIDTVENFLDVPVDYYVK
FT                   FNFKSFIKIVDSLGGITVDVPVEFTEQNSKDEADAIHLKKGRQHLNGEEALALARTRHI
FT                   DSDYMRGQRQQLVLEAIAEKALSLNSINKIGGLLDAVDKDLKTNLTFDDMMTIAKNSMG
FT                   SNLKMDKLQVEGTDKYIGGIYYYVPNEKSVNNISTTLQEHLGVTNKNEHKKL"
FT   gene            complement(619908..621086)
FT                   /locus_tag="BA_0606"
FT                   /old_locus_tag="BA0606"
FT   CDS_pept        complement(619908..621086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0606"
FT                   /old_locus_tag="BA0606"
FT                   /product="nucleoside transporter, NupC family"
FT                   /note="identified by similarity to OMNI:NTL01BS03934; match
FT                   to protein family HMM PF01773; match to protein family HMM
FT                   PF07662; match to protein family HMM PF07670; match to
FT                   protein family HMM TIGR00804"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24624"
FT                   /db_xref="GOA:A0A2P0H9V2"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H9V2"
FT                   /protein_id="AAP24624.1"
FT                   /translation="MKFITFFLGLIVVFFLAYIASNNKKHIKFKPIFIMLLIQLILTYL
FT                   LLNTEIGLILIRVISSLFTKLLEYAADGINFVFGGLANKGEMPFFLTVLLPIVFISVLI
FT                   GILQHFKILPFFIHWIGYFLSKINGLGKLESYNAIASAIVGQSEVFITVKKQLAQIPKH
FT                   RLYTLCASAMSTVSMSIVGAYMTMIEPKYVVTALVLNLFSGFIIVLIINPYDVKDDEDI
FT                   LEIKGEKQSFFEMLGEYILDGFRVAIVVGAMLIGFVALISCINDLFLIIFGITFQQLIG
FT                   YVFAPIAFLIGVPSSEIVAAGSIMATKLVTNEFVAMMDLSKISNSLSPRTVGIISVFLV
FT                   SFANFSSIGIISGAVKGLNEEQGNVVARFGLKLLYGATLVSILSAIIVSIML"
FT   gene            621178..621564
FT                   /locus_tag="BA_0607"
FT                   /old_locus_tag="BA0607"
FT   CDS_pept        621178..621564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0607"
FT                   /old_locus_tag="BA0607"
FT                   /product="glyoxylase family protein"
FT                   /note="identified by similarity to GP:17133605; match to
FT                   protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0607"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24625"
FT                   /db_xref="GOA:A0A347ZZ69"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037478"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZZ69"
FT                   /protein_id="AAP24625.1"
FT                   /translation="MNISRVHHVAIICSNYEVSKDFYTRILGFKAINEVYRKERDSYKL
FT                   DLCVGKEYQIELFSFPNPPKRPSFPEAAGLRHLAFAVTNIEEAVQDLSQCGVETEAIRI
FT                   DEITGKKFVFFQDPDGLPLELYEV"
FT   gene            621672..622757
FT                   /locus_tag="BA_0608"
FT                   /old_locus_tag="BA0608"
FT   CDS_pept        621672..622757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0608"
FT                   /old_locus_tag="BA0608"
FT                   /product="CBS domain protein"
FT                   /note="identified by similarity to EGAD:108547; match to
FT                   protein family HMM PF00571; match to protein family HMM
FT                   PF01595"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24626"
FT                   /db_xref="GOA:A0A347ZZ70"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZZ70"
FT                   /protein_id="AAP24626.1"
FT                   /translation="MDILKLLMVAILIGLTAFFVAVEFAIIKVRSSRIDQLVSEKRRGA
FT                   LAAKKVTSNLDEYLSACQLGITITALGLGWLGEPTIKHLLEPLFLKLNLSPAIASTVSF
FT                   IIAFAVITFLHVVIGELAPKTFAIQRAEQVSLLLSKPLIYFYRIMYPFIWALNGSARLV
FT                   TGLFGLHPASEHEVAHSEEELRLILSESYESGEINQREFKYVNNIFEFDNRVAKEIMVP
FT                   RTEVIGLYEDEPFETHIKIIAQEKYTRYPVFGEDKDEIIGMVNVKDLFIRYMDGNRDEE
FT                   CSITPYTRPVIEVLENIPIHDLLLQMQRKHIPLAVLYDEYGGTAGIVTLEDILEEIVGE
FT                   IRDEYDEDEHPPIEHISEGGH"
FT   gene            622841..624274
FT                   /gene="aspA1"
FT                   /locus_tag="BA_0609"
FT                   /old_locus_tag="BA0609"
FT   CDS_pept        622841..624274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspA1"
FT                   /locus_tag="BA_0609"
FT                   /old_locus_tag="BA0609"
FT                   /product="aspartate ammonia-lyase"
FT                   /EC_number="4.3.1.1"
FT                   /note="identified by similarity to EGAD:17758; match to
FT                   protein family HMM PF00206; match to protein family HMM
FT                   TIGR00839"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0609"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24627"
FT                   /db_xref="GOA:A0A347ZZ71"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A0A347ZZ71"
FT                   /protein_id="AAP24627.1"
FT                   /translation="MIATKDIRIEKDFLGEKEVPSIAYYGVQTLRAVENFPITGYRIHP
FT                   SLITAMAIVKKAAALANMDTGYLAKDIGHEIAEAAQEIVDGKFHDQFIVDPIQGGAGTS
FT                   INMNTNEVIANRALERMGYEKGEYAKISPNTHVNMAQSTNDAFPTGIHIATLMRLEELL
FT                   ITMEELHAAFRAKAKEFDHVIKMGRTHLQDAVPIRLGQEFEAYSRVLARDIKRIKQSRQ
FT                   HLYEVNMGATAVGTGLNANPTYIEQVVKHLRTFSGFPLVGAEHLVDATQNTDAYTEVSA
FT                   ALKVCMMNMSKIANDLRIMASGPRVGLAEIQLPARQPGSSIMPGKVNPVMAEVINQVAF
FT                   QVIGNDHTICLASEAGQLELNVMEPVLVFNLIQSISIMNNGFRVFREYCIKGITANEEL
FT                   LKQYVEKSVGIITAVNPHIGYEAASRIAREAIETGKSVRELCLEHGVLTEEELDIILDP
FT                   FEMTHPEIAGASLLKDKKM"
FT   gene            complement(624314..625933)
FT                   /gene="lldP1"
FT                   /locus_tag="BA_0610"
FT                   /old_locus_tag="BA0610"
FT   CDS_pept        complement(624314..625933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lldP1"
FT                   /locus_tag="BA_0610"
FT                   /old_locus_tag="BA0610"
FT                   /product="L-lactate permease"
FT                   /note="identified by similarity to EGAD:8633; match to
FT                   protein family HMM PF02652; match to protein family HMM
FT                   TIGR00795"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0610"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24628"
FT                   /db_xref="GOA:A0A2P0H9W3"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P0H9W3"
FT                   /protein_id="AAP24628.1"
FT                   /translation="MSTWTQIYDPLNNIWLSALIAALPIFCFIICLVGFKMKGYMAGLY
FT                   SVIVAIILAIFVYKMPTTAAVASAGFGVLSGFYPICTIVIAAIFLYKLTVKTEQFNVIR
FT                   DSISSITNDQRLQVLLIAYSFGAFLEGAAGFGVPVAITAALLVGMGFNPLKAAGICLVA
FT                   NIAGGAMGAMGIPVTVPAQLTGIDALTVGRQAVYILPFISIVLPFLLVSMVDGFKGIKE
FT                   TWQGILVSGVSFAITQFVVTYFLGAELTNIFAAVVSMVALALFLRVWQPKSSAKEEKQE
FT                   EKESHTFNQILYAWSPFVFLTAFVTIFNLKPIKALFAPDGPLANLVFNIQFPGLHNQVI
FT                   KTAPITKADTPFAAIFKLDVFSSTTTAIVLAIIVSLIVYRVNGKMIKELMIETIKELKV
FT                   PVYTICSVIALAYVENYSGMSSTLGLAFSSTGNAFPILSPILGWIGVFITGSVVSSGSL
FT                   FAPLQAVTADQLNIVPSTLVSLNVVGGTIAKMVSPQSVAVACAAVGLVGKESALFKTVM
FT                   KYSLIFLAIISLLQLNAVFNIF"
FT   gene            626770..627057
FT                   /locus_tag="BA_0612"
FT                   /old_locus_tag="BA0612"
FT   CDS_pept        626770..627057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0612"
FT                   /old_locus_tag="BA0612"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="identified by similarity to GP:14022747; match to
FT                   protein family HMM PF01022"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0612"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24629"
FT                   /db_xref="GOA:A0A3P1U4V2"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1U4V2"
FT                   /protein_id="AAP24629.1"
FT                   /translation="MSQNQFECRISEEDVQMLRALAHPLRLRLVMELMQRGTCNVTQLQ
FT                   EVLEIPQSTVSQHLTKLKQNKVVRFERRGLEVYYQIHNDKVSEVVKTLFS"
FT   gene            627172..627351
FT                   /locus_tag="BA_0613"
FT                   /old_locus_tag="BA0613"
FT   CDS_pept        627172..627351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0613"
FT                   /old_locus_tag="BA0613"
FT                   /product="small acid-soluble spore protein, H-type"
FT                   /note="identified by similarity to EGAD:108218; match to
FT                   protein family HMM PF08141; match to protein family HMM
FT                   TIGR02861"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0613"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24630"
FT                   /db_xref="GOA:Q81V87"
FT                   /db_xref="InterPro:IPR012610"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81V87"
FT                   /protein_id="AAP24630.1"
FT                   /translation="MDVKRVKQILSSSSRIDVTYEGVPVWIESCDEQSGVAQVYDVSNP
FT                   GESVHVHVNALEEK"
FT   gene            complement(627392..628750)
FT                   /locus_tag="BA_0614"
FT                   /old_locus_tag="BA0614"
FT   CDS_pept        complement(627392..628750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BA_0614"
FT                   /old_locus_tag="BA0614"
FT                   /product="proton/peptide symporter family protein"
FT                   /note="identified by similarity to EGAD:108941; match to
FT                   protein family HMM PF00854; match to protein family HMM
FT                   PF07690; match to protein family HMM TIGR00924"
FT                   /db_xref="EnsemblGenomes-Gn:BA_0614"
FT                   /db_xref="EnsemblGenomes-Tr:AAP24631"
FT                   /db_xref="GOA:A0A3P1U3K9"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3P1U3K9"
FT                   /protein_id="AAP24631.1"
FT                   /translation="MDAALKLDKAGEQQSPKKHPPGLYLLFLTEMWERFSYYGMRGLLV
FT                   LYLTTAAVS