(data stored in ACNUC8465 zone)

EMBL: AE017042

ID   AE017042; SV 1; circular; genomic DNA; STD; PRO; 4595065 BP.
XX
AC   AE017042;
XX
PR   Project:PRJNA10638;
XX
DT   09-AUG-2006 (Rel. 88, Created)
DT   17-MAY-2016 (Rel. 128, Last updated, Version 8)
XX
DE   Yersinia pestis biovar Microtus str. 91001, complete genome.
XX
KW   .
XX
OS   Yersinia pestis biovar Microtus str. 91001
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Yersiniaceae; Yersinia.
XX
RN   [1]
RP   1-4595065
RA   Yiqing M.;
RT   "Reannotation of Yersinia pestis strain 91001 based on omics data";
RL   Unpublished.
XX
RN   [2]
RP   1-4595065
RA   Song Y., Tong Z., Wang L., Han Y., Zhang J., Pei D., Wang J., Zhou D.,
RA   Han Y., Pang X., Zhai J., Chen F., Qin H., Wang J., Li S., Guo Z., Ye C.,
RA   Du Z., Lin W., Wang J., Yu J., Yang H., Wang J., Huang P., Yang R.;
RT   ;
RL   Submitted (24-APR-2003) to the INSDC.
RL   The Institute of Microbiology and Epidemiology, Academy of Military Medical
RL   Sciences, No. 20, Dongdajie Street, Fengtai District, Beijing 100071,
RL   People's Republic of China
XX
RN   [3]
RC   Protein update by submitter
RP   1-4595065
RA   Yiqing M.;
RT   ;
RL   Submitted (16-MAY-2016) to the INSDC.
RL   State Key Laboratory of Pathogen and Biosecurity, Beijing Institute of
RL   Microbiology and Epidemiology, Dongda Street, Beijing 100036, China
XX
DR   MD5; 47a8e87c83ad8c11dd4ddc4cd47cc560.
DR   BioSample; SAMN02602970.
DR   EnsemblGenomes-Gn; EBG00001180437.
DR   EnsemblGenomes-Gn; EBG00001180438.
DR   EnsemblGenomes-Gn; EBG00001180439.
DR   EnsemblGenomes-Gn; EBG00001180440.
DR   EnsemblGenomes-Gn; EBG00001180441.
DR   EnsemblGenomes-Gn; EBG00001180442.
DR   EnsemblGenomes-Gn; EBG00001180443.
DR   EnsemblGenomes-Gn; EBG00001180444.
DR   EnsemblGenomes-Gn; EBG00001180445.
DR   EnsemblGenomes-Gn; EBG00001180446.
DR   EnsemblGenomes-Gn; EBG00001180447.
DR   EnsemblGenomes-Gn; EBG00001180448.
DR   EnsemblGenomes-Gn; EBG00001180449.
DR   EnsemblGenomes-Gn; EBG00001180450.
DR   EnsemblGenomes-Gn; EBG00001180451.
DR   EnsemblGenomes-Gn; EBG00001180452.
DR   EnsemblGenomes-Gn; EBG00001180453.
DR   EnsemblGenomes-Gn; EBG00001180454.
DR   EnsemblGenomes-Gn; EBG00001180455.
DR   EnsemblGenomes-Gn; EBG00001180456.
DR   EnsemblGenomes-Gn; EBG00001180457.
DR   EnsemblGenomes-Gn; EBG00001180458.
DR   EnsemblGenomes-Gn; EBG00001180459.
DR   EnsemblGenomes-Gn; EBG00001180460.
DR   EnsemblGenomes-Gn; EBG00001180461.
DR   EnsemblGenomes-Gn; EBG00001180462.
DR   EnsemblGenomes-Gn; EBG00001180463.
DR   EnsemblGenomes-Gn; EBG00001180464.
DR   EnsemblGenomes-Gn; EBG00001180465.
DR   EnsemblGenomes-Gn; EBG00001180466.
DR   EnsemblGenomes-Gn; EBG00001180467.
DR   EnsemblGenomes-Gn; EBG00001180468.
DR   EnsemblGenomes-Gn; EBG00001180469.
DR   EnsemblGenomes-Gn; EBG00001180470.
DR   EnsemblGenomes-Gn; EBG00001180471.
DR   EnsemblGenomes-Gn; EBG00001180472.
DR   EnsemblGenomes-Gn; EBG00001180473.
DR   EnsemblGenomes-Gn; EBG00001180474.
DR   EnsemblGenomes-Gn; EBG00001180475.
DR   EnsemblGenomes-Gn; EBG00001180476.
DR   EnsemblGenomes-Gn; EBG00001180477.
DR   EnsemblGenomes-Gn; EBG00001180478.
DR   EnsemblGenomes-Gn; EBG00001180479.
DR   EnsemblGenomes-Gn; EBG00001180481.
DR   EnsemblGenomes-Gn; EBG00001180482.
DR   EnsemblGenomes-Gn; EBG00001180483.
DR   EnsemblGenomes-Gn; EBG00001180484.
DR   EnsemblGenomes-Gn; EBG00001180485.
DR   EnsemblGenomes-Gn; EBG00001180486.
DR   EnsemblGenomes-Gn; EBG00001180487.
DR   EnsemblGenomes-Gn; EBG00001180488.
DR   EnsemblGenomes-Gn; EBG00001180489.
DR   EnsemblGenomes-Gn; EBG00001180490.
DR   EnsemblGenomes-Gn; EBG00001180491.
DR   EnsemblGenomes-Gn; EBG00001180492.
DR   EnsemblGenomes-Gn; EBG00001180493.
DR   EnsemblGenomes-Gn; EBG00001180494.
DR   EnsemblGenomes-Gn; EBG00001180495.
DR   EnsemblGenomes-Gn; EBG00001180496.
DR   EnsemblGenomes-Gn; EBG00001180497.
DR   EnsemblGenomes-Gn; EBG00001180498.
DR   EnsemblGenomes-Gn; EBG00001180499.
DR   EnsemblGenomes-Gn; EBG00001180500.
DR   EnsemblGenomes-Gn; EBG00001180501.
DR   EnsemblGenomes-Gn; EBG00001180502.
DR   EnsemblGenomes-Gn; EBG00001180503.
DR   EnsemblGenomes-Gn; EBG00001180504.
DR   EnsemblGenomes-Gn; EBG00001180505.
DR   EnsemblGenomes-Gn; EBG00001180506.
DR   EnsemblGenomes-Gn; EBG00001180507.
DR   EnsemblGenomes-Gn; EBG00001180508.
DR   EnsemblGenomes-Gn; EBG00001180509.
DR   EnsemblGenomes-Gn; EBG00001180510.
DR   EnsemblGenomes-Gn; EBG00001180511.
DR   EnsemblGenomes-Gn; EBG00001180512.
DR   EnsemblGenomes-Gn; EBG00001180513.
DR   EnsemblGenomes-Gn; EBG00001180514.
DR   EnsemblGenomes-Gn; EBG00001180515.
DR   EnsemblGenomes-Gn; EBG00001180516.
DR   EnsemblGenomes-Gn; EBG00001180517.
DR   EnsemblGenomes-Gn; EBG00001180518.
DR   EnsemblGenomes-Gn; EBG00001180519.
DR   EnsemblGenomes-Gn; EBG00001180520.
DR   EnsemblGenomes-Gn; EBG00001180521.
DR   EnsemblGenomes-Gn; EBG00001180522.
DR   EnsemblGenomes-Gn; EBG00001180523.
DR   EnsemblGenomes-Gn; EBG00001180524.
DR   EnsemblGenomes-Gn; EBG00001180525.
DR   EnsemblGenomes-Gn; EBG00001180526.
DR   EnsemblGenomes-Gn; EBG00001180527.
DR   EnsemblGenomes-Gn; EBG00001180528.
DR   EnsemblGenomes-Gn; EBG00001180529.
DR   EnsemblGenomes-Gn; EBG00001180530.
DR   EnsemblGenomes-Gn; EBG00001180531.
DR   EnsemblGenomes-Gn; EBG00001180532.
DR   EnsemblGenomes-Gn; EBG00001180533.
DR   EnsemblGenomes-Gn; EBG00001180534.
DR   EnsemblGenomes-Gn; EBG00001180535.
DR   EnsemblGenomes-Gn; EBG00001180536.
DR   EnsemblGenomes-Gn; EBG00001180537.
DR   EnsemblGenomes-Gn; EBG00001180538.
DR   EnsemblGenomes-Gn; EBG00001180539.
DR   EnsemblGenomes-Gn; EBG00001180540.
DR   EnsemblGenomes-Gn; EBG00001180541.
DR   EnsemblGenomes-Gn; EBG00001180542.
DR   EnsemblGenomes-Gn; EBG00001180543.
DR   EnsemblGenomes-Gn; EBG00001180544.
DR   EnsemblGenomes-Gn; EBG00001180545.
DR   EnsemblGenomes-Gn; EBG00001180546.
DR   EnsemblGenomes-Gn; EBG00001180547.
DR   EnsemblGenomes-Gn; EBG00001180548.
DR   EnsemblGenomes-Gn; EBG00001180549.
DR   EnsemblGenomes-Gn; EBG00001180550.
DR   EnsemblGenomes-Gn; EBG00001180551.
DR   EnsemblGenomes-Gn; EBG00001180552.
DR   EnsemblGenomes-Gn; EBG00001180553.
DR   EnsemblGenomes-Gn; EBG00001180554.
DR   EnsemblGenomes-Gn; EBG00001180555.
DR   EnsemblGenomes-Gn; EBG00001180556.
DR   EnsemblGenomes-Gn; EBG00001180557.
DR   EnsemblGenomes-Gn; EBG00001180558.
DR   EnsemblGenomes-Gn; EBG00001180559.
DR   EnsemblGenomes-Gn; EBG00001180560.
DR   EnsemblGenomes-Gn; EBG00001180561.
DR   EnsemblGenomes-Gn; EBG00001180562.
DR   EnsemblGenomes-Gn; EBG00001180563.
DR   EnsemblGenomes-Gn; EBG00001180564.
DR   EnsemblGenomes-Gn; EBG00001180565.
DR   EnsemblGenomes-Gn; EBG00001180566.
DR   EnsemblGenomes-Gn; EBG00001180567.
DR   EnsemblGenomes-Gn; EBG00001180568.
DR   EnsemblGenomes-Gn; EBG00001180569.
DR   EnsemblGenomes-Gn; EBG00001180570.
DR   EnsemblGenomes-Gn; EBG00001180571.
DR   EnsemblGenomes-Gn; EBG00001180572.
DR   EnsemblGenomes-Gn; EBG00001180573.
DR   EnsemblGenomes-Gn; EBG00001180574.
DR   EnsemblGenomes-Gn; EBG00001180575.
DR   EnsemblGenomes-Gn; EBG00001180576.
DR   EnsemblGenomes-Gn; EBG00001180577.
DR   EnsemblGenomes-Gn; EBG00001180578.
DR   EnsemblGenomes-Gn; EBG00001180579.
DR   EnsemblGenomes-Gn; EBG00001180580.
DR   EnsemblGenomes-Gn; EBG00001180581.
DR   EnsemblGenomes-Gn; EBG00001180582.
DR   EnsemblGenomes-Gn; EBG00001180583.
DR   EnsemblGenomes-Gn; EBG00001180584.
DR   EnsemblGenomes-Gn; EBG00001180585.
DR   EnsemblGenomes-Gn; EBG00001180586.
DR   EnsemblGenomes-Gn; EBG00001180587.
DR   EnsemblGenomes-Gn; EBG00001180588.
DR   EnsemblGenomes-Gn; EBG00001180589.
DR   EnsemblGenomes-Gn; EBG00001180590.
DR   EnsemblGenomes-Gn; EBG00001180591.
DR   EnsemblGenomes-Gn; EBG00001180592.
DR   EnsemblGenomes-Gn; EBG00001180593.
DR   EnsemblGenomes-Gn; EBG00001180594.
DR   EnsemblGenomes-Gn; EBG00001180595.
DR   EnsemblGenomes-Gn; EBG00001180596.
DR   EnsemblGenomes-Gn; EBG00001180597.
DR   EnsemblGenomes-Gn; EBG00001180598.
DR   EnsemblGenomes-Gn; EBG00001180599.
DR   EnsemblGenomes-Gn; EBG00001180600.
DR   EnsemblGenomes-Gn; EBG00001180601.
DR   EnsemblGenomes-Gn; EBG00001180602.
DR   EnsemblGenomes-Gn; EBG00001180603.
DR   EnsemblGenomes-Gn; EBG00001180604.
DR   EnsemblGenomes-Gn; EBG00001180605.
DR   EnsemblGenomes-Gn; EBG00001180606.
DR   EnsemblGenomes-Gn; EBG00001180607.
DR   EnsemblGenomes-Gn; EBG00001180608.
DR   EnsemblGenomes-Gn; EBG00001180609.
DR   EnsemblGenomes-Gn; EBG00001180610.
DR   EnsemblGenomes-Gn; EBG00001180611.
DR   EnsemblGenomes-Gn; EBG00001180612.
DR   EnsemblGenomes-Gn; EBG00001180613.
DR   EnsemblGenomes-Gn; EBG00001180614.
DR   EnsemblGenomes-Gn; EBG00001180615.
DR   EnsemblGenomes-Gn; EBG00001180616.
DR   EnsemblGenomes-Gn; EBG00001180617.
DR   EnsemblGenomes-Gn; EBG00001180618.
DR   EnsemblGenomes-Gn; EBG00001180619.
DR   EnsemblGenomes-Gn; EBG00001180620.
DR   EnsemblGenomes-Gn; EBG00001180621.
DR   EnsemblGenomes-Gn; EBG00001180622.
DR   EnsemblGenomes-Gn; EBG00001180623.
DR   EnsemblGenomes-Gn; EBG00001180624.
DR   EnsemblGenomes-Gn; EBG00001180625.
DR   EnsemblGenomes-Gn; EBG00001180626.
DR   EnsemblGenomes-Gn; EBG00001180627.
DR   EnsemblGenomes-Gn; EBG00001180628.
DR   EnsemblGenomes-Gn; EBG00001180629.
DR   EnsemblGenomes-Gn; EBG00001180630.
DR   EnsemblGenomes-Gn; EBG00001180631.
DR   EnsemblGenomes-Gn; EBG00001180632.
DR   EnsemblGenomes-Gn; EBG00001180633.
DR   EnsemblGenomes-Gn; EBG00001180634.
DR   EnsemblGenomes-Gn; EBG00001180635.
DR   EnsemblGenomes-Gn; EBG00001180636.
DR   EnsemblGenomes-Gn; EBG00001180637.
DR   EnsemblGenomes-Gn; EBG00001180638.
DR   EnsemblGenomes-Gn; EBG00001180639.
DR   EnsemblGenomes-Gn; EBG00001180640.
DR   EnsemblGenomes-Gn; EBG00001180641.
DR   EnsemblGenomes-Gn; EBG00001180642.
DR   EnsemblGenomes-Gn; EBG00001180643.
DR   EnsemblGenomes-Gn; EBG00001180644.
DR   EnsemblGenomes-Gn; YP_56.
DR   EnsemblGenomes-Gn; YP_57.
DR   EnsemblGenomes-Gn; YP_58.
DR   EnsemblGenomes-Gn; YP_59.
DR   EnsemblGenomes-Gn; YP_r1.
DR   EnsemblGenomes-Gn; YP_r10.
DR   EnsemblGenomes-Gn; YP_r11.
DR   EnsemblGenomes-Gn; YP_r12.
DR   EnsemblGenomes-Gn; YP_r13.
DR   EnsemblGenomes-Gn; YP_r14.
DR   EnsemblGenomes-Gn; YP_r15.
DR   EnsemblGenomes-Gn; YP_r16.
DR   EnsemblGenomes-Gn; YP_r17.
DR   EnsemblGenomes-Gn; YP_r18.
DR   EnsemblGenomes-Gn; YP_r19.
DR   EnsemblGenomes-Gn; YP_r2.
DR   EnsemblGenomes-Gn; YP_r20.
DR   EnsemblGenomes-Gn; YP_r21.
DR   EnsemblGenomes-Gn; YP_r22.
DR   EnsemblGenomes-Gn; YP_r3.
DR   EnsemblGenomes-Gn; YP_r4.
DR   EnsemblGenomes-Gn; YP_r5.
DR   EnsemblGenomes-Gn; YP_r6.
DR   EnsemblGenomes-Gn; YP_r7.
DR   EnsemblGenomes-Gn; YP_r8.
DR   EnsemblGenomes-Gn; YP_r9.
DR   EnsemblGenomes-Gn; YP_s1.
DR   EnsemblGenomes-Gn; YP_s2.
DR   EnsemblGenomes-Gn; YP_s3.
DR   EnsemblGenomes-Gn; YP_s4.
DR   EnsemblGenomes-Gn; YP_s5.
DR   EnsemblGenomes-Gn; YP_s6.
DR   EnsemblGenomes-Gn; YP_s7.
DR   EnsemblGenomes-Gn; YP_t1.
DR   EnsemblGenomes-Gn; YP_t11.
DR   EnsemblGenomes-Gn; YP_t12.
DR   EnsemblGenomes-Gn; YP_t13.
DR   EnsemblGenomes-Gn; YP_t14.
DR   EnsemblGenomes-Gn; YP_t15.
DR   EnsemblGenomes-Gn; YP_t16.
DR   EnsemblGenomes-Gn; YP_t17.
DR   EnsemblGenomes-Gn; YP_t18.
DR   EnsemblGenomes-Gn; YP_t19.
DR   EnsemblGenomes-Gn; YP_t2.
DR   EnsemblGenomes-Gn; YP_t20.
DR   EnsemblGenomes-Gn; YP_t21.
DR   EnsemblGenomes-Gn; YP_t22.
DR   EnsemblGenomes-Gn; YP_t23.
DR   EnsemblGenomes-Gn; YP_t24.
DR   EnsemblGenomes-Gn; YP_t25.
DR   EnsemblGenomes-Gn; YP_t26.
DR   EnsemblGenomes-Gn; YP_t27.
DR   EnsemblGenomes-Gn; YP_t28.
DR   EnsemblGenomes-Gn; YP_t29.
DR   EnsemblGenomes-Gn; YP_t3.
DR   EnsemblGenomes-Gn; YP_t30.
DR   EnsemblGenomes-Gn; YP_t31.
DR   EnsemblGenomes-Gn; YP_t32.
DR   EnsemblGenomes-Gn; YP_t33.
DR   EnsemblGenomes-Gn; YP_t34.
DR   EnsemblGenomes-Gn; YP_t35.
DR   EnsemblGenomes-Gn; YP_t36.
DR   EnsemblGenomes-Gn; YP_t37.
DR   EnsemblGenomes-Gn; YP_t38.
DR   EnsemblGenomes-Gn; YP_t39.
DR   EnsemblGenomes-Gn; YP_t4.
DR   EnsemblGenomes-Gn; YP_t40.
DR   EnsemblGenomes-Gn; YP_t41.
DR   EnsemblGenomes-Gn; YP_t42.
DR   EnsemblGenomes-Gn; YP_t43.
DR   EnsemblGenomes-Gn; YP_t44.
DR   EnsemblGenomes-Gn; YP_t45.
DR   EnsemblGenomes-Gn; YP_t46.
DR   EnsemblGenomes-Gn; YP_t47.
DR   EnsemblGenomes-Gn; YP_t48.
DR   EnsemblGenomes-Gn; YP_t49.
DR   EnsemblGenomes-Gn; YP_t5.
DR   EnsemblGenomes-Gn; YP_t50.
DR   EnsemblGenomes-Gn; YP_t51.
DR   EnsemblGenomes-Gn; YP_t52.
DR   EnsemblGenomes-Gn; YP_t53.
DR   EnsemblGenomes-Gn; YP_t54.
DR   EnsemblGenomes-Gn; YP_t55.
DR   EnsemblGenomes-Gn; YP_t6.
DR   EnsemblGenomes-Gn; YP_t60.
DR   EnsemblGenomes-Gn; YP_t61.
DR   EnsemblGenomes-Gn; YP_t62.
DR   EnsemblGenomes-Gn; YP_t63.
DR   EnsemblGenomes-Gn; YP_t64.
DR   EnsemblGenomes-Gn; YP_t65.
DR   EnsemblGenomes-Gn; YP_t66.
DR   EnsemblGenomes-Gn; YP_t67.
DR   EnsemblGenomes-Gn; YP_t68.
DR   EnsemblGenomes-Gn; YP_t69.
DR   EnsemblGenomes-Gn; YP_t7.
DR   EnsemblGenomes-Gn; YP_t70.
DR   EnsemblGenomes-Gn; YP_t71.
DR   EnsemblGenomes-Gn; YP_t72.
DR   EnsemblGenomes-Gn; YP_t73.
DR   EnsemblGenomes-Gn; YP_t8.
DR   EnsemblGenomes-Gn; YP_t9.
DR   EnsemblGenomes-Tr; EBT00001758204.
DR   EnsemblGenomes-Tr; EBT00001758206.
DR   EnsemblGenomes-Tr; EBT00001758207.
DR   EnsemblGenomes-Tr; EBT00001758209.
DR   EnsemblGenomes-Tr; EBT00001758210.
DR   EnsemblGenomes-Tr; EBT00001758211.
DR   EnsemblGenomes-Tr; EBT00001758212.
DR   EnsemblGenomes-Tr; EBT00001758213.
DR   EnsemblGenomes-Tr; EBT00001758214.
DR   EnsemblGenomes-Tr; EBT00001758215.
DR   EnsemblGenomes-Tr; EBT00001758217.
DR   EnsemblGenomes-Tr; EBT00001758218.
DR   EnsemblGenomes-Tr; EBT00001758219.
DR   EnsemblGenomes-Tr; EBT00001758220.
DR   EnsemblGenomes-Tr; EBT00001758221.
DR   EnsemblGenomes-Tr; EBT00001758222.
DR   EnsemblGenomes-Tr; EBT00001758223.
DR   EnsemblGenomes-Tr; EBT00001758225.
DR   EnsemblGenomes-Tr; EBT00001758226.
DR   EnsemblGenomes-Tr; EBT00001758227.
DR   EnsemblGenomes-Tr; EBT00001758229.
DR   EnsemblGenomes-Tr; EBT00001758230.
DR   EnsemblGenomes-Tr; EBT00001758232.
DR   EnsemblGenomes-Tr; EBT00001758234.
DR   EnsemblGenomes-Tr; EBT00001758237.
DR   EnsemblGenomes-Tr; EBT00001758239.
DR   EnsemblGenomes-Tr; EBT00001758241.
DR   EnsemblGenomes-Tr; EBT00001758243.
DR   EnsemblGenomes-Tr; EBT00001758245.
DR   EnsemblGenomes-Tr; EBT00001758247.
DR   EnsemblGenomes-Tr; EBT00001758249.
DR   EnsemblGenomes-Tr; EBT00001758251.
DR   EnsemblGenomes-Tr; EBT00001758253.
DR   EnsemblGenomes-Tr; EBT00001758255.
DR   EnsemblGenomes-Tr; EBT00001758257.
DR   EnsemblGenomes-Tr; EBT00001758261.
DR   EnsemblGenomes-Tr; EBT00001758263.
DR   EnsemblGenomes-Tr; EBT00001758266.
DR   EnsemblGenomes-Tr; EBT00001758268.
DR   EnsemblGenomes-Tr; EBT00001758272.
DR   EnsemblGenomes-Tr; EBT00001758274.
DR   EnsemblGenomes-Tr; EBT00001758276.
DR   EnsemblGenomes-Tr; EBT00001758278.
DR   EnsemblGenomes-Tr; EBT00001758279.
DR   EnsemblGenomes-Tr; EBT00001758281.
DR   EnsemblGenomes-Tr; EBT00001758282.
DR   EnsemblGenomes-Tr; EBT00001758283.
DR   EnsemblGenomes-Tr; EBT00001758285.
DR   EnsemblGenomes-Tr; EBT00001758286.
DR   EnsemblGenomes-Tr; EBT00001758287.
DR   EnsemblGenomes-Tr; EBT00001758288.
DR   EnsemblGenomes-Tr; EBT00001758290.
DR   EnsemblGenomes-Tr; EBT00001758292.
DR   EnsemblGenomes-Tr; EBT00001758294.
DR   EnsemblGenomes-Tr; EBT00001758297.
DR   EnsemblGenomes-Tr; EBT00001758298.
DR   EnsemblGenomes-Tr; EBT00001758301.
DR   EnsemblGenomes-Tr; EBT00001758302.
DR   EnsemblGenomes-Tr; EBT00001758303.
DR   EnsemblGenomes-Tr; EBT00001758306.
DR   EnsemblGenomes-Tr; EBT00001758308.
DR   EnsemblGenomes-Tr; EBT00001758310.
DR   EnsemblGenomes-Tr; EBT00001758312.
DR   EnsemblGenomes-Tr; EBT00001758314.
DR   EnsemblGenomes-Tr; EBT00001758316.
DR   EnsemblGenomes-Tr; EBT00001758318.
DR   EnsemblGenomes-Tr; EBT00001758320.
DR   EnsemblGenomes-Tr; EBT00001758322.
DR   EnsemblGenomes-Tr; EBT00001758324.
DR   EnsemblGenomes-Tr; EBT00001758325.
DR   EnsemblGenomes-Tr; EBT00001758327.
DR   EnsemblGenomes-Tr; EBT00001758329.
DR   EnsemblGenomes-Tr; EBT00001758331.
DR   EnsemblGenomes-Tr; EBT00001758333.
DR   EnsemblGenomes-Tr; EBT00001758335.
DR   EnsemblGenomes-Tr; EBT00001758337.
DR   EnsemblGenomes-Tr; EBT00001758339.
DR   EnsemblGenomes-Tr; EBT00001758340.
DR   EnsemblGenomes-Tr; EBT00001758342.
DR   EnsemblGenomes-Tr; EBT00001758345.
DR   EnsemblGenomes-Tr; EBT00001758347.
DR   EnsemblGenomes-Tr; EBT00001758349.
DR   EnsemblGenomes-Tr; EBT00001758351.
DR   EnsemblGenomes-Tr; EBT00001758352.
DR   EnsemblGenomes-Tr; EBT00001758354.
DR   EnsemblGenomes-Tr; EBT00001758356.
DR   EnsemblGenomes-Tr; EBT00001758357.
DR   EnsemblGenomes-Tr; EBT00001758360.
DR   EnsemblGenomes-Tr; EBT00001758362.
DR   EnsemblGenomes-Tr; EBT00001758364.
DR   EnsemblGenomes-Tr; EBT00001758366.
DR   EnsemblGenomes-Tr; EBT00001758369.
DR   EnsemblGenomes-Tr; EBT00001758371.
DR   EnsemblGenomes-Tr; EBT00001758373.
DR   EnsemblGenomes-Tr; EBT00001758375.
DR   EnsemblGenomes-Tr; EBT00001758377.
DR   EnsemblGenomes-Tr; EBT00001758379.
DR   EnsemblGenomes-Tr; EBT00001758380.
DR   EnsemblGenomes-Tr; EBT00001758382.
DR   EnsemblGenomes-Tr; EBT00001758384.
DR   EnsemblGenomes-Tr; EBT00001758387.
DR   EnsemblGenomes-Tr; EBT00001758388.
DR   EnsemblGenomes-Tr; EBT00001758391.
DR   EnsemblGenomes-Tr; EBT00001758393.
DR   EnsemblGenomes-Tr; EBT00001758395.
DR   EnsemblGenomes-Tr; EBT00001758397.
DR   EnsemblGenomes-Tr; EBT00001758398.
DR   EnsemblGenomes-Tr; EBT00001758400.
DR   EnsemblGenomes-Tr; EBT00001758402.
DR   EnsemblGenomes-Tr; EBT00001758404.
DR   EnsemblGenomes-Tr; EBT00001758406.
DR   EnsemblGenomes-Tr; EBT00001758408.
DR   EnsemblGenomes-Tr; EBT00001758410.
DR   EnsemblGenomes-Tr; EBT00001758412.
DR   EnsemblGenomes-Tr; EBT00001758414.
DR   EnsemblGenomes-Tr; EBT00001758416.
DR   EnsemblGenomes-Tr; EBT00001758417.
DR   EnsemblGenomes-Tr; EBT00001758419.
DR   EnsemblGenomes-Tr; EBT00001758421.
DR   EnsemblGenomes-Tr; EBT00001758423.
DR   EnsemblGenomes-Tr; EBT00001758425.
DR   EnsemblGenomes-Tr; EBT00001758426.
DR   EnsemblGenomes-Tr; EBT00001758428.
DR   EnsemblGenomes-Tr; EBT00001758430.
DR   EnsemblGenomes-Tr; EBT00001758432.
DR   EnsemblGenomes-Tr; EBT00001758433.
DR   EnsemblGenomes-Tr; EBT00001758435.
DR   EnsemblGenomes-Tr; EBT00001758437.
DR   EnsemblGenomes-Tr; EBT00001758439.
DR   EnsemblGenomes-Tr; EBT00001758441.
DR   EnsemblGenomes-Tr; EBT00001758444.
DR   EnsemblGenomes-Tr; EBT00001758446.
DR   EnsemblGenomes-Tr; EBT00001758448.
DR   EnsemblGenomes-Tr; EBT00001758450.
DR   EnsemblGenomes-Tr; EBT00001758451.
DR   EnsemblGenomes-Tr; EBT00001758453.
DR   EnsemblGenomes-Tr; EBT00001758455.
DR   EnsemblGenomes-Tr; EBT00001758457.
DR   EnsemblGenomes-Tr; EBT00001758459.
DR   EnsemblGenomes-Tr; EBT00001758462.
DR   EnsemblGenomes-Tr; EBT00001758463.
DR   EnsemblGenomes-Tr; EBT00001758465.
DR   EnsemblGenomes-Tr; EBT00001758467.
DR   EnsemblGenomes-Tr; EBT00001758470.
DR   EnsemblGenomes-Tr; EBT00001758472.
DR   EnsemblGenomes-Tr; EBT00001758474.
DR   EnsemblGenomes-Tr; EBT00001758476.
DR   EnsemblGenomes-Tr; EBT00001758481.
DR   EnsemblGenomes-Tr; EBT00001758483.
DR   EnsemblGenomes-Tr; EBT00001758484.
DR   EnsemblGenomes-Tr; EBT00001758485.
DR   EnsemblGenomes-Tr; EBT00001758487.
DR   EnsemblGenomes-Tr; EBT00001758490.
DR   EnsemblGenomes-Tr; EBT00001758491.
DR   EnsemblGenomes-Tr; EBT00001758492.
DR   EnsemblGenomes-Tr; EBT00001758494.
DR   EnsemblGenomes-Tr; EBT00001758496.
DR   EnsemblGenomes-Tr; EBT00001758497.
DR   EnsemblGenomes-Tr; EBT00001758498.
DR   EnsemblGenomes-Tr; EBT00001758499.
DR   EnsemblGenomes-Tr; EBT00001758501.
DR   EnsemblGenomes-Tr; EBT00001758502.
DR   EnsemblGenomes-Tr; EBT00001758504.
DR   EnsemblGenomes-Tr; EBT00001758505.
DR   EnsemblGenomes-Tr; EBT00001758506.
DR   EnsemblGenomes-Tr; EBT00001758507.
DR   EnsemblGenomes-Tr; EBT00001758508.
DR   EnsemblGenomes-Tr; EBT00001758509.
DR   EnsemblGenomes-Tr; EBT00001758510.
DR   EnsemblGenomes-Tr; EBT00001758511.
DR   EnsemblGenomes-Tr; EBT00001758512.
DR   EnsemblGenomes-Tr; EBT00001758513.
DR   EnsemblGenomes-Tr; EBT00001758514.
DR   EnsemblGenomes-Tr; EBT00001758515.
DR   EnsemblGenomes-Tr; EBT00001758516.
DR   EnsemblGenomes-Tr; EBT00001758517.
DR   EnsemblGenomes-Tr; EBT00001758518.
DR   EnsemblGenomes-Tr; EBT00001758519.
DR   EnsemblGenomes-Tr; EBT00001758520.
DR   EnsemblGenomes-Tr; EBT00001758521.
DR   EnsemblGenomes-Tr; EBT00001758522.
DR   EnsemblGenomes-Tr; EBT00001758523.
DR   EnsemblGenomes-Tr; EBT00001758524.
DR   EnsemblGenomes-Tr; EBT00001758525.
DR   EnsemblGenomes-Tr; EBT00001758526.
DR   EnsemblGenomes-Tr; EBT00001758527.
DR   EnsemblGenomes-Tr; EBT00001758528.
DR   EnsemblGenomes-Tr; EBT00001758529.
DR   EnsemblGenomes-Tr; EBT00001758530.
DR   EnsemblGenomes-Tr; EBT00001758531.
DR   EnsemblGenomes-Tr; EBT00001758532.
DR   EnsemblGenomes-Tr; EBT00001758533.
DR   EnsemblGenomes-Tr; EBT00001758534.
DR   EnsemblGenomes-Tr; EBT00001758535.
DR   EnsemblGenomes-Tr; EBT00001758536.
DR   EnsemblGenomes-Tr; EBT00001758537.
DR   EnsemblGenomes-Tr; EBT00001758538.
DR   EnsemblGenomes-Tr; EBT00001758539.
DR   EnsemblGenomes-Tr; EBT00001758540.
DR   EnsemblGenomes-Tr; EBT00001758541.
DR   EnsemblGenomes-Tr; EBT00001758542.
DR   EnsemblGenomes-Tr; EBT00001758543.
DR   EnsemblGenomes-Tr; EBT00001758544.
DR   EnsemblGenomes-Tr; EBT00001758545.
DR   EnsemblGenomes-Tr; EBT00001758546.
DR   EnsemblGenomes-Tr; EBT00001758547.
DR   EnsemblGenomes-Tr; EBT00001758548.
DR   EnsemblGenomes-Tr; EBT00001758549.
DR   EnsemblGenomes-Tr; YP_56-1.
DR   EnsemblGenomes-Tr; YP_57-1.
DR   EnsemblGenomes-Tr; YP_58-1.
DR   EnsemblGenomes-Tr; YP_59-1.
DR   EnsemblGenomes-Tr; YP_r1-1.
DR   EnsemblGenomes-Tr; YP_r10-1.
DR   EnsemblGenomes-Tr; YP_r11-1.
DR   EnsemblGenomes-Tr; YP_r12-1.
DR   EnsemblGenomes-Tr; YP_r13-1.
DR   EnsemblGenomes-Tr; YP_r14-1.
DR   EnsemblGenomes-Tr; YP_r15-1.
DR   EnsemblGenomes-Tr; YP_r16-1.
DR   EnsemblGenomes-Tr; YP_r17-1.
DR   EnsemblGenomes-Tr; YP_r18-1.
DR   EnsemblGenomes-Tr; YP_r19-1.
DR   EnsemblGenomes-Tr; YP_r2-1.
DR   EnsemblGenomes-Tr; YP_r20-1.
DR   EnsemblGenomes-Tr; YP_r21-1.
DR   EnsemblGenomes-Tr; YP_r22-1.
DR   EnsemblGenomes-Tr; YP_r3-1.
DR   EnsemblGenomes-Tr; YP_r4-1.
DR   EnsemblGenomes-Tr; YP_r5-1.
DR   EnsemblGenomes-Tr; YP_r6-1.
DR   EnsemblGenomes-Tr; YP_r7-1.
DR   EnsemblGenomes-Tr; YP_r8-1.
DR   EnsemblGenomes-Tr; YP_r9-1.
DR   EnsemblGenomes-Tr; YP_t1-1.
DR   EnsemblGenomes-Tr; YP_t11-1.
DR   EnsemblGenomes-Tr; YP_t12-1.
DR   EnsemblGenomes-Tr; YP_t13-1.
DR   EnsemblGenomes-Tr; YP_t14-1.
DR   EnsemblGenomes-Tr; YP_t15-1.
DR   EnsemblGenomes-Tr; YP_t16-1.
DR   EnsemblGenomes-Tr; YP_t17-1.
DR   EnsemblGenomes-Tr; YP_t18-1.
DR   EnsemblGenomes-Tr; YP_t19-1.
DR   EnsemblGenomes-Tr; YP_t2-1.
DR   EnsemblGenomes-Tr; YP_t20-1.
DR   EnsemblGenomes-Tr; YP_t21-1.
DR   EnsemblGenomes-Tr; YP_t22-1.
DR   EnsemblGenomes-Tr; YP_t23-1.
DR   EnsemblGenomes-Tr; YP_t24-1.
DR   EnsemblGenomes-Tr; YP_t25-1.
DR   EnsemblGenomes-Tr; YP_t26-1.
DR   EnsemblGenomes-Tr; YP_t27-1.
DR   EnsemblGenomes-Tr; YP_t28-1.
DR   EnsemblGenomes-Tr; YP_t29-1.
DR   EnsemblGenomes-Tr; YP_t3-1.
DR   EnsemblGenomes-Tr; YP_t30-1.
DR   EnsemblGenomes-Tr; YP_t31-1.
DR   EnsemblGenomes-Tr; YP_t32-1.
DR   EnsemblGenomes-Tr; YP_t33-1.
DR   EnsemblGenomes-Tr; YP_t34-1.
DR   EnsemblGenomes-Tr; YP_t35-1.
DR   EnsemblGenomes-Tr; YP_t36-1.
DR   EnsemblGenomes-Tr; YP_t37-1.
DR   EnsemblGenomes-Tr; YP_t38-1.
DR   EnsemblGenomes-Tr; YP_t39-1.
DR   EnsemblGenomes-Tr; YP_t4-1.
DR   EnsemblGenomes-Tr; YP_t40-1.
DR   EnsemblGenomes-Tr; YP_t41-1.
DR   EnsemblGenomes-Tr; YP_t42-1.
DR   EnsemblGenomes-Tr; YP_t43-1.
DR   EnsemblGenomes-Tr; YP_t44-1.
DR   EnsemblGenomes-Tr; YP_t45-1.
DR   EnsemblGenomes-Tr; YP_t46-1.
DR   EnsemblGenomes-Tr; YP_t47-1.
DR   EnsemblGenomes-Tr; YP_t48-1.
DR   EnsemblGenomes-Tr; YP_t49-1.
DR   EnsemblGenomes-Tr; YP_t5-1.
DR   EnsemblGenomes-Tr; YP_t50-1.
DR   EnsemblGenomes-Tr; YP_t51-1.
DR   EnsemblGenomes-Tr; YP_t52-1.
DR   EnsemblGenomes-Tr; YP_t53-1.
DR   EnsemblGenomes-Tr; YP_t54-1.
DR   EnsemblGenomes-Tr; YP_t55-1.
DR   EnsemblGenomes-Tr; YP_t6-1.
DR   EnsemblGenomes-Tr; YP_t60-1.
DR   EnsemblGenomes-Tr; YP_t61-1.
DR   EnsemblGenomes-Tr; YP_t62-1.
DR   EnsemblGenomes-Tr; YP_t63-1.
DR   EnsemblGenomes-Tr; YP_t64-1.
DR   EnsemblGenomes-Tr; YP_t65-1.
DR   EnsemblGenomes-Tr; YP_t66-1.
DR   EnsemblGenomes-Tr; YP_t67-1.
DR   EnsemblGenomes-Tr; YP_t68-1.
DR   EnsemblGenomes-Tr; YP_t69-1.
DR   EnsemblGenomes-Tr; YP_t7-1.
DR   EnsemblGenomes-Tr; YP_t70-1.
DR   EnsemblGenomes-Tr; YP_t71-1.
DR   EnsemblGenomes-Tr; YP_t72-1.
DR   EnsemblGenomes-Tr; YP_t73-1.
DR   EnsemblGenomes-Tr; YP_t8-1.
DR   EnsemblGenomes-Tr; YP_t9-1.
DR   EuropePMC; PMC1142405; 15933207.
DR   EuropePMC; PMC1794563; 17076878.
DR   EuropePMC; PMC2289816; 18307761.
DR   EuropePMC; PMC2806259; 20017936.
DR   EuropePMC; PMC3017858; 20964857.
DR   EuropePMC; PMC3172189; 21931876.
DR   EuropePMC; PMC451624; 15262950.
DR   EuropePMC; PMC451627; 15262951.
DR   EuropePMC; PMC6620824; 31334249.
DR   GOA; P61475.
DR   GOA; Q8CKC6.
DR   GOA; Q8CZS4.
DR   GOA; Q8D079.
DR   GOA; Q8D1L4.
DR   GOA; Q8ZDM8.
DR   GOA; Q8ZFL4.
DR   GOA; Q8ZHH6.
DR   GOA; Q9ZFR5.
DR   InterPro; IPR001123; LeuE-type.
DR   InterPro; IPR002669; UreD.
DR   InterPro; IPR002696; Membr_insert_effic_factor.
DR   InterPro; IPR004777; Lys/arg_exporter.
DR   InterPro; IPR005624; Haem_degrading.
DR   InterPro; IPR006638; Elp3/MiaB/NifB.
DR   InterPro; IPR009006; Ala_racemase/Decarboxylase_C.
DR   InterPro; IPR010371; UPF0303.
DR   InterPro; IPR011079; Ala_racemase_C.
DR   InterPro; IPR011720; Thr_lead_pept.
DR   InterPro; IPR012565; His_leader.
DR   InterPro; IPR012567; IlvGEDA_leader.
DR   InterPro; IPR013704; UPF0313_N.
DR   InterPro; IPR022946; UPF0313.
DR   InterPro; IPR023445; Arg_export_ArgO_enterobac.
DR   InterPro; IPR024560; UPF0313_C.
DR   InterPro; IPR038084; GlcG-like_sf.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00033; MicF.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00369; sroC.
DR   RFAM; RF00382; DnaX.
DR   RFAM; RF00383; IS1222_FSE.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01396; isrN.
DR   RFAM; RF01405; STnc490k.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01728; STAXI.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01748; nuoG.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02074; STnc240.
DR   SILVA-LSU; AE017042.
DR   SILVA-SSU; AE017042.
DR   UniProtKB/Swiss-Prot; P61475; YIDD_YERPE.
DR   UniProtKB/Swiss-Prot; Q8CKC6; LPT_YERPE.
DR   UniProtKB/Swiss-Prot; Q8CZS4; Y674_YERPE.
DR   UniProtKB/Swiss-Prot; Q8D079; LPHI_YERPE.
DR   UniProtKB/Swiss-Prot; Q8D1L4; LPID_YERPE.
DR   UniProtKB/Swiss-Prot; Q8ZDM8; Y2534_YERPE.
DR   UniProtKB/Swiss-Prot; Q8ZFL4; BSR_YERPE.
DR   UniProtKB/Swiss-Prot; Q8ZHH6; ARGO_YERPE.
DR   UniProtKB/Swiss-Prot; Q9ZFR5; URED_YERPE.
XX
CC   On or before Aug 8, 2006 this sequence version replaced
CC   gi:45434720, gi:45434997, gi:45435249, gi:45435511, gi:45435773,
CC   gi:45436010, gi:45436270, gi:45436494, gi:45436743, gi:45437002,
CC   gi:45437263, gi:45437513, gi:45437749, gi:45437988, gi:45438182,
CC   gi:45438438.
CC   ##Genome-Assembly-Data-START##
CC   Assembly Method       :: Phred v. 2004
CC   Genome Coverage       :: missing
CC   Sequencing Technology :: Shotgun
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4595065
FT                   /organism="Yersinia pestis biovar Microtus str. 91001"
FT                   /sub_species="microtus"
FT                   /strain="91001"
FT                   /mol_type="genomic DNA"
FT                   /note="biovar: Microtus"
FT                   /db_xref="taxon:229193"
FT   gene            complement(21..461)
FT                   /gene="fldA1"
FT                   /locus_tag="YP_0001"
FT                   /old_locus_tag="YP0001"
FT   CDS_pept        complement(21..461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fldA1"
FT                   /locus_tag="YP_0001"
FT                   /old_locus_tag="YP0001"
FT                   /product="putative flavoprotein"
FT                   /note="similar to Yersinia pestis CO92 YPO0001 and Yersinia
FT                   pestis KIM mioC. Contains Flavodoxin-like domain
FT                   (Interpro|IPR001094, (GO:0006118), (GO:0008246)). Contains
FT                   Flavodoxin (Interpro|IPR001226, (GO:0006118),
FT                   (GO:0009457))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60282"
FT                   /db_xref="GOA:A0A3N4AXF4"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AXF4"
FT                   /protein_id="AAS60282.1"
FT                   /translation="MADITLISGSTLGSAEYVAEHLADKLEEAGFSTEILHGPELDELT
FT                   LNGLWLIVTSTHGAGDLPDNLQPLLEQIEQQKPDLSQVRFGAVGLGSSEYDTFCGAIIK
FT                   LDQQLIAQGAQRLGEILEIDVIQHEIPEDPAEIWVKDWINLL"
FT   gene            complement(554..1015)
FT                   /gene="asnC"
FT                   /locus_tag="YP_0002"
FT                   /old_locus_tag="YP0002"
FT   CDS_pept        complement(554..1015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnC"
FT                   /locus_tag="YP_0002"
FT                   /old_locus_tag="YP0002"
FT                   /product="regulatory protein"
FT                   /note="similar to Yersinia pestis CO92 asnC and Yersinia
FT                   pestis KIM asnC. Contains Bacterial regulatory proteins,
FT                   AsnC family (Interpro|IPR000485, (GO:0006355))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60283"
FT                   /db_xref="GOA:A0A3N4B0K9"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B0K9"
FT                   /protein_id="AAS60283.1"
FT                   /translation="MSEIYQIDNLDRSILKALMENARTPYAELAKNLAVSPGTIHVRVE
FT                   KMRQAGIITAACVHVNPKQLGYDVCCFIGIILKSAKDYPSALKKLESLEEVVEAYYTTG
FT                   HYSIFIKVMCKSIDALQQVLINKIQTIDEIQSTETLISLQNPIMRTIVP"
FT   gene            1185..2177
FT                   /gene="asnA"
FT                   /locus_tag="YP_0003"
FT                   /old_locus_tag="YP0003"
FT   CDS_pept        1185..2177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnA"
FT                   /locus_tag="YP_0003"
FT                   /old_locus_tag="YP0003"
FT                   /product="aspartate-ammonia ligase"
FT                   /note="similar to Yersinia pestis CO92 asnA and Yersinia
FT                   pestis KIM asnA. Contains Aspartate--ammonia ligase
FT                   (Interpro|IPR004618, (GO:0006529)). Contains
FT                   Aminoacyl-transfer RNA synthetase, class II
FT                   (Interpro|IPR006195, (GO:0006418))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60284"
FT                   /db_xref="GOA:Q8ZJT3"
FT                   /db_xref="InterPro:IPR004618"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJT3"
FT                   /protein_id="AAS60284.1"
FT                   /translation="MKKQFIQKQQQISFVKSFFSRQLEQQLGLIEVQAPILSRVGDGTQ
FT                   DNLSGSEKAVQVKVKSLPDSTFEVVHSLAKWKRKTLGRFDFGADQGVYTHMKALRPDED
FT                   RLSAIHSVYVDQWDWERVMGDGERNLAYLKSTVNKIYAAIKETEAAISAEFGVKPFLPD
FT                   HIQFIHSESLRARFPDLDAKGRERAIAKELGAVFLIGIGGKLADGQSHDVRAPDYDDWT
FT                   SPSAEGFSGLNGDIIVWNPILEDAFEISSMGIRVDAEALKRQLALTGDEDRLELEWHQS
FT                   LLRGEMPQTIGGGIGQSRLVMLLLQKQHIGQVQCGVWGPEISEKVDGLL"
FT   gene            complement(2276..3742)
FT                   /locus_tag="YP_0004"
FT                   /old_locus_tag="YP0004"
FT   CDS_pept        complement(2276..3742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0004"
FT                   /old_locus_tag="YP0004"
FT                   /product="hypothetical protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0004 and Yersinia
FT                   pestis KIM y0004. Contains Von Willebrand factor, type A
FT                   (Interpro|IPR002035)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60285"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR023481"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJT2"
FT                   /protein_id="AAS60285.1"
FT                   /translation="MLSLATLDMLLSISEGELIEEMVVGLLAAPQLAIFFEKFPRIKRA
FT                   LMKDIPGWKQNLQQRIREASVPPGLANEFSLYQQSLLEDSPQFYAHLPDIVAQLQDLHS
FT                   PFATQAKTLVQTADLAKNPPGGDSLQTLFLQRWRVSLILQTITIHHQLLEQEREQLLAE
FT                   LQRRLALSGALEPILTTNDNAAGRLWDMSQGHLQRGDYQLLLQYGDFLQQQPELIRLAE
FT                   QLGRSRSAKAQPAPDARYEPYTVMVRQPDSVPEEVSGIHQSNDILRLLPTELVMLGMSE
FT                   LEFEFYRRLLERRLLTYRLQGDNWQEKTQQRPVSLKQNDEQPRGPFIVCVDTSGSMGGF
FT                   NEQCAKAFCLALLRIALADNRRCYIMLFATEIIHYELSADNGIEQAIRFLNQHFRGGTD
FT                   LAACLANTLNKMEDREWYDADAVIISDFIAQRLPEELVRKIKIQQQAHQHRFHAVAMSA
FT                   YGKPGIMRIFDHIWRFDTSLKSRLIRRWKR"
FT   gene            complement(3746..5314)
FT                   /locus_tag="YP_0005"
FT                   /old_locus_tag="YP0005"
FT   CDS_pept        complement(3746..5314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0005"
FT                   /old_locus_tag="YP0005"
FT                   /product="MoxR-like ATPases"
FT                   /note="similar to Yersinia pestis CO92 YPO0005 and Yersinia
FT                   pestis KIM y0005. Contains Chaperonin clpA/B
FT                   (Interpro|IPR001270). Contains AAA ATPase
FT                   (Interpro|IPR003593, (GO:0000166))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60286"
FT                   /db_xref="GOA:Q8ZJT1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR022547"
FT                   /db_xref="InterPro:IPR023671"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041538"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJT1"
FT                   /protein_id="AAS60286.1"
FT                   /translation="MAQSSQLAERISRLSHALESGLYERQEAIRLCLLAALSGESVFLL
FT                   GPPGIAKSLIARRLKFAFRHARAFEYLMTRFSTPEEVFGPLSIQALKEEGRYQRMTGGY
FT                   LPEAEIVFLDEIWKAGPAILNTLLTAINERRFRNGDREDSIPMRLLVTASNELPDADSS
FT                   LEALYDRMLIRLWLDRVQEKQNFRSLLISRQNENHNPVAENLSITDEEFHQWQPLIDKI
FT                   TLPDHCFELIFQLRQRLSALEHAPYVSDRRWKKALRLLQASAFFSGRDEITPIDLILLK
FT                   DCLWHDLNSFKLLQQQLEQLLTEQGYQQQSLLMKLQDINSKWLQHQQQQSDHQALTVVK
FT                   QSGMFSRKAQYALPDNLTDSTLTLLLQKPLNLHDIQVNHLQVDKEALAQWLNKGGALRA
FT                   KLNGVGYAQSIDAEIDDQLHIIILDVSRQPSTLSLPGATTTSVPPELLLALTKLESTLA
FT                   EQRRLFSQHQPCLFTPSSWLAKIEASLLQVVEQLQFQQIQFQQIQFQQIQFQQRKFQQQ
FT                   KHSGH"
FT   gene            5588..7456
FT                   /gene="kup"
FT                   /locus_tag="YP_0006"
FT                   /old_locus_tag="YP0006"
FT   CDS_pept        5588..7456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kup"
FT                   /locus_tag="YP_0006"
FT                   /old_locus_tag="YP0006"
FT                   /product="potassium transport protein"
FT                   /note="similar to Yersinia pestis CO92 kup and Yersinia
FT                   pestis KIM kup. Contains K+ potassium transporter
FT                   (Interpro|IPR003855, (GO:0006813), (GO:0016020))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60287"
FT                   /db_xref="GOA:Q8ZJT0"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJT0"
FT                   /protein_id="AAS60287.1"
FT                   /translation="MSTEHKQYLSAVTLAAIGVVYGDIGTSPLYTLRECFSGHYGFDVR
FT                   PDVVFGFLSLIFWMLILVVSVKYLTYVMRADNAGEGGILTLMSLAGRNTSSRATSILVV
FT                   LGLIGGSFFYGEVVITPAISVMSAIEGLEIAAPALDPYIVPCSIAVLTLLFVIQKHGTG
FT                   SVGKLFAPVMLVWFLTLALLGLRSIIANPEVLAALNPKWAISFFVEYKSVSFFALGAVV
FT                   LAITGVEALYADMGHFGKFPIRLAWFTVVLPSLVLNYFGQGALLLKNPEAIKNPFFLLA
FT                   PDWALIPLLILATLATVIASQAVISGVFSLTRQAVRLGYLPPMRIIHTSEMESGQIYIP
FT                   VINWTLYLAVVLVIIGFERSSNLAAAYGIAVTGTMVITSILFCTVAWKNWHWNRFLVVF
FT                   LLMVLLIIDIPMFSANVLKLFSGGWLPLSLGLVMFIIMTTWKSERFSLLRRMHEHSNSL
FT                   EAMIASLEKSPPVRVPGTAVYMSRAMNVIPFALLHNLKHNKVLHERVVLLTMRTDDVPY
FT                   VHNVERVTIEQLSPTFWRVVARYGWRETPNVAEIFHRCGLEGLSCQMMETSFFMSHESL
FT                   ILTKRPWHLFLRGKLFIALSRNALRAPDQFEIPPNRVIELGTQVEI"
FT   gene            7661..8080
FT                   /gene="rbsD1"
FT                   /locus_tag="YP_0007"
FT                   /old_locus_tag="YP0007"
FT   CDS_pept        7661..8080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsD1"
FT                   /locus_tag="YP_0007"
FT                   /old_locus_tag="YP0007"
FT                   /product="ribose permease"
FT                   /note="similar to Yersinia pestis CO92 YPO0007 and Yersinia
FT                   pestis KIM rbsD"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60288"
FT                   /db_xref="GOA:Q7CLE5"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CLE5"
FT                   /protein_id="AAS60288.1"
FT                   /translation="MKKGVLLNADISAVISRLGHTDQIVIGDAGLPIPATTTRIDLALT
FT                   RGVPGFLQVVDVVTQEMQVENAYLAEEIVKNNPQLHEALLVLLTQLEQRQENQIALRYI
FT                   SHEAFKEQTKQSRAVIRSGECSPFANIILGSGVTF"
FT   gene            8131..9057
FT                   /gene="rbsK1"
FT                   /locus_tag="YP_0008"
FT                   /old_locus_tag="YP0008"
FT   CDS_pept        8131..9057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsK1"
FT                   /locus_tag="YP_0008"
FT                   /old_locus_tag="YP0008"
FT                   /product="ribokinase"
FT                   /note="similar to Yersinia pestis CO92 rbsK and Yersinia
FT                   pestis KIM rbsK. Contains Ribokinase (Interpro|IPR002139,
FT                   (GO:0006014)). Contains Carbohydrate kinase, PfkB
FT                   (Interpro|IPR002173)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60289"
FT                   /db_xref="GOA:A0A3N4AW72"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AW72"
FT                   /protein_id="AAS60289.1"
FT                   /translation="METGKLVVLGSINADHILNIEQFPRPGETVIGQQYNVAFGGKGAN
FT                   QAVAAGRSGADIAFIACVGDDDIGERVRQQLTADKIDTQPIEAIKGATTGVALIFVNSD
FT                   GENVIGINAGANSAVTPEYLRRYQQQVIDADALLMQLESPLDTVIAAAKLAKQHQTQVI
FT                   LNPAPARKLPDELLTLVDMITPNETEAERLTGIHIEQDDDAAKAAQILHDKGIATVIIT
FT                   LGSRGVWLSEQGKGKLVAGFKVNAVDTIAAGDTFNGALLTALLEGQSMDVAVRFAHAAA
FT                   AIAVTRPGAQPSIPWRAEIDSFLQERV"
FT   gene            9077..9280
FT                   /gene="purR1"
FT                   /locus_tag="YP_0009"
FT                   /old_locus_tag="YP0009"
FT   CDS_pept        9077..9280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purR1"
FT                   /locus_tag="YP_0009"
FT                   /old_locus_tag="YP0009"
FT                   /product="Transcriptional regulators"
FT                   /note="similar to Yersinia pestis KIM y0009"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60290"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLX5"
FT                   /protein_id="AAS60290.1"
FT                   /translation="MSPVWQGYRQAMARAGLPIIAGYEVVSDFEFGGGLVALKQRLNNP
FT                   EAEPQVLPLTPELIERGSVSLR"
FT   gene            complement(9277..10701)
FT                   /gene="proP1"
FT                   /locus_tag="YP_0010"
FT                   /old_locus_tag="YP0010"
FT   CDS_pept        complement(9277..10701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proP1"
FT                   /locus_tag="YP_0010"
FT                   /old_locus_tag="YP0010"
FT                   /product="putative membrane transport protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0009 and Yersinia
FT                   pestis KIM y0010. Contains Tetracycline resistance protein
FT                   TetB (Interpro|IPR001411, (GO:0016021)). Contains
FT                   Tetracycline resistance protein (Interpro|IPR001958,
FT                   (GO:0016021)). Contains Sodium:dicarboxylate symporter
FT                   (Interpro|IPR001991, (GO:0016020)). Contains Major
FT                   facilitator superfamily (MFS) (Interpro|IPR007114)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60291"
FT                   /db_xref="GOA:A0A3N4AXG8"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AXG8"
FT                   /protein_id="AAS60291.1"
FT                   /translation="MIKSARSMAGLPWIAAMAFFMQALDATILNTALPSIAESLNRSPL
FT                   TMQSAIISYTLTVAMLIPVSGWLADRFGTRRIFILAVSLFTFGSLLCALSGSLAFLVAS
FT                   RVIQGIGGAMMMPVARLALIRAYPRSELLPVLNFVTIPGLVGPVMGPLLGGLLVTYTTW
FT                   HWIFILNIPIGLLGIFYARKYMPNFTMPKRTFDFVGFLLFGISLVMISTSLEIMGRPEI
FT                   ADYLPAATLLGGLLMLIFYIFHAKGHPNPLIGLPLFKTRTFSVGIAGNVASRLGTGCVP
FT                   FLMPLMLQVGFGYSALIAGCMMAPTAIGSIMAKSAVTQVLRSLGYRKVLVGITLIIGVL
FT                   IASFALQSPGMSAWMMILPLFILGIAMSTQFTAMNTITLADLTDNNASSGNSVLAVTQQ
FT                   LSISFGIAISATVLRFYDGLSLGGNVDHFHYTFITMGIVTLLSSLVFLLLKPRDGDNLI
FT                   QGRNVKKVAPQVKNNV"
FT   gene            complement(10781..11470)
FT                   /gene="fadR1"
FT                   /locus_tag="YP_0011"
FT                   /old_locus_tag="YP0011"
FT   CDS_pept        complement(10781..11470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadR1"
FT                   /locus_tag="YP_0011"
FT                   /old_locus_tag="YP0011"
FT                   /product="putative GntR-famly transcriptional regulator"
FT                   /note="similar to Yersinia pestis CO92 YPO0010 and Yersinia
FT                   pestis KIM y0011. Contains Bacterial regulatory protein,
FT                   GntR family (Interpro|IPR000524, (GO:0006355))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60292"
FT                   /db_xref="GOA:A0A3N4B0M4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B0M4"
FT                   /protein_id="AAS60292.1"
FT                   /translation="MQLNTQQQAAQRNLSYLLAEKIGQRILAGEYEAGSILPGEIELGE
FT                   QFGVSRTAVREAVKMLAAKGMLLPRPRIGTRVMPQTNWNYLDQELLTWWMTKENFDQVM
FT                   QHFLILRTSLEPQACYLAATHANEKQRELLASLVAEMRALHSNFNREQWIQVDTQFHKL
FT                   IYEASGNPFLISFANLFSSVYYSYFRAITGDEVIKLQHHQNIVDTILAGDNQGALFACQ
FT                   VLLKTVD"
FT   gene            12057..13545
FT                   /locus_tag="YP_r1"
FT                   /old_locus_tag="16S_rRNA_1"
FT   rRNA            12057..13545
FT                   /locus_tag="YP_r1"
FT                   /old_locus_tag="16S_rRNA_1"
FT                   /product="16S ribosomal RNA"
FT   gene            13709..13784
FT                   /locus_tag="YP_t1"
FT                   /old_locus_tag="tRNA-Glu_1"
FT   tRNA            13709..13784
FT                   /locus_tag="YP_t1"
FT                   /old_locus_tag="tRNA-Glu_1"
FT                   /product="tRNA-Glu"
FT                   /note="codon recognized: GAA; Cove score 56.95"
FT   gene            14037..16943
FT                   /locus_tag="YP_r2"
FT                   /old_locus_tag="23S_rRNA_1"
FT   rRNA            14037..16943
FT                   /locus_tag="YP_r2"
FT                   /old_locus_tag="23S_rRNA_1"
FT                   /product="23S ribosomal RNA"
FT   gene            17053..17168
FT                   /locus_tag="YP_r3"
FT                   /old_locus_tag="5S_rRNA_1"
FT   rRNA            17053..17168
FT                   /locus_tag="YP_r3"
FT                   /old_locus_tag="5S_rRNA_1"
FT                   /product="5S ribosomal RNA"
FT   gene            17690..18898
FT                   /locus_tag="YP_0012"
FT                   /old_locus_tag="YP0012"
FT   CDS_pept        17690..18898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0012"
FT                   /old_locus_tag="YP0012"
FT                   /product="transposase for the IS285 insertion element"
FT                   /note="similar to Yersinia pestis CO92 YPO0011 and Yersinia
FT                   pestis KIM y2424. Contains Transposase, mutator family
FT                   (Interpro|IPR001207)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60293"
FT                   /db_xref="GOA:A0A0H2W0V6"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W0V6"
FT                   /protein_id="AAS60293.1"
FT                   /translation="MDEKKLKALAAELAKGLKTEADLNAFSRMLTKLTVETALNAELTE
FT                   HLGHEKNTPKSGSNTRNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQMD
FT                   SQILSLYAKSMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALYPIV
FT                   YMDCIVVKVRQNGSVINKAVFLALGINTEGQKELLGMWLAENEGAKFWLSVLTELKNRG
FT                   LQDILIACVDGLKGFPDAINSVYPQTHIQLCIIHMVRNSLKYVSWKDYKAVTSGLKMVY
FT                   QAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIES
FT                   VNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKWSMPIQNWRLAMSRFIIEFGDRLS
FT                   DHL"
FT   gene            complement(18956..19513)
FT                   /gene="mobB"
FT                   /locus_tag="YP_0013"
FT                   /old_locus_tag="YP0013"
FT   CDS_pept        complement(18956..19513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mobB"
FT                   /locus_tag="YP_0013"
FT                   /old_locus_tag="YP0013"
FT                   /product="putative molybdopterin-guanine dinucleotide
FT                   biosynthesis protein B"
FT                   /note="similar to Yersinia pestis CO92 mobB and Yersinia
FT                   pestis KIM mobB. Contains ATP/GTP-binding site motif A
FT                   (P-loop) (Interpro|IPR001687, (GO:0005524)). Contains
FT                   Molybdopterin-guanine dinucleotide biosynthesis protein
FT                   (Interpro|IPR004435, (GO:0006777))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60294"
FT                   /db_xref="GOA:Q8CZM2"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZM2"
FT                   /protein_id="AAS60294.1"
FT                   /translation="MGTKEKRPMMNYKSPPLLGIAAYSGTGKTTLLKSLIPLLQQRQVR
FT                   VGLIKHTHHNMEIDTPGKDSYELRKAGALQTLVASDCRWALMTETPEQQPLNLHYLASR
FT                   LDASTIDLILVEGFKHEPINKIALYRESIGKPFSGLIDKHVIALASDKPIETTVKQLDI
FT                   NQPEQITEFICTWLENISFEVR"
FT   gene            complement(19486..20127)
FT                   /gene="mobA"
FT                   /locus_tag="YP_0014"
FT                   /old_locus_tag="YP0014"
FT   CDS_pept        complement(19486..20127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mobA"
FT                   /locus_tag="YP_0014"
FT                   /old_locus_tag="YP0014"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A"
FT                   /note="similar to Yersinia pestis CO92 mobA and Yersinia
FT                   pestis KIM mobA."
FT                   /db_xref="EnsemblGenomes-Gn:YP_0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60295"
FT                   /db_xref="GOA:Q8ZJS4"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJS4"
FT                   /protein_id="AAS60295.1"
FT                   /translation="MLFTDTIPVSIGCSGAIEMQPNITGVILAGDRSSRMGGNDKGLIP
FT                   LNGKPLFQYVIDRFKPQVSDLVINANRNQGLYKESGIPVIDDIITGFVGPLAGMHAGLS
FT                   YASTEWVVFAPCDVPALPSDLVSQLWQGKKQALAAYANDDERAHPTFALMHISLKTQLA
FT                   DYLIRGDRKLMLFLDSINAQRVKFSGKADLFSNLNTPADCDLWEQKRRGQ"
FT   gene            20227..20496
FT                   /locus_tag="YP_0015"
FT                   /old_locus_tag="YP0015"
FT   CDS_pept        20227..20496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0015"
FT                   /old_locus_tag="YP0015"
FT                   /product="hypothetical protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0013a and
FT                   Yersinia pestis KIM y3814"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60296"
FT                   /db_xref="InterPro:IPR009383"
FT                   /db_xref="InterPro:IPR038134"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BKG9"
FT                   /protein_id="AAS60296.1"
FT                   /translation="MKCHRVNELIELLHPAWQQEPDLNLVQFLQKLAAEAGFKGDFSDL
FT                   TDDVLIYHLKMRGAASTEVIPGLKKDYEEDFKTALLRARGIIKD"
FT   gene            20587..21573
FT                   /locus_tag="YP_0016"
FT                   /old_locus_tag="YP0016"
FT   CDS_pept        20587..21573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0016"
FT                   /old_locus_tag="YP0016"
FT                   /product="Putative homoserine kinase type II (protein
FT                   kinase fold)"
FT                   /note="similar to Yersinia pestis CO92 YPO0014 and Yersinia
FT                   pestis KIM y3813"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60297"
FT                   /db_xref="GOA:A0A3N4BAM9"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BAM9"
FT                   /protein_id="AAS60297.1"
FT                   /translation="MNNSAFNFQTLSPDLIMDALEGAGLRVDSGLTALNSYENRVYQFM
FT                   DEESKRYVVKFYRPERWSSEQITEEHQFSLDLAESEIPVIAPLRLNGKTLHTHCGFFFA
FT                   VFPSVGGRQYEIDNLDQLEWVGRFLGRIHQAARNSLFVARPTMGIEEYLTEPRQLLANC
FT                   DLVPVKQRDKFLAAADLLITTIKQYWHTEWQPLRLHGDCHPGNILWRDGPMFVDLDDAR
FT                   NGPAIQDLWMLLHGDRRDQSMQLDILLEAYSEFADFDQRELALIEPLRAMRMVYYLAWV
FT                   ARRWQDPAFPKSFPWMAESDFWLQQTASFTEQVKLLQEPPLQLMPMY"
FT   gene            21601..22224
FT                   /gene="dsbA"
FT                   /locus_tag="YP_0017"
FT                   /old_locus_tag="YP0017"
FT   CDS_pept        21601..22224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbA"
FT                   /locus_tag="YP_0017"
FT                   /old_locus_tag="YP0017"
FT                   /product="secreted thiol:disulfide interchange protein
FT                   DsbA"
FT                   /note="similar to Yersinia pestis CO92 dsbA and Yersinia
FT                   pestis KIM dsbA. Contains DSBA oxidoreductase
FT                   (Interpro|IPR001853, (GO:0030288)). Contains Thioredoxin
FT                   type domain (Interpro|IPR006662, (GO:0006118)). Contains
FT                   Thioredoxin domain 2 (Interpro|IPR006663, (GO:0006118))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60298"
FT                   /db_xref="GOA:Q9XBV2"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9XBV2"
FT                   /protein_id="AAS60298.1"
FT                   /translation="MKNVWLALVGIVMAFSVTAAQFTDGKQYLTLDKPVTGEPQVLEFF
FT                   SFYCPHCYQFEEVYQVPKAVKKALPEGTKMTRYHVEFLGPLGKQLTQAWAVAMALGVEE
FT                   KITPLMFEGVQKTQTVQTPGDIRNVFIKAGISGEDYDAALNSFVVKSLVAQQQKAAEDL
FT                   QLRGVPAMFVNGKYMIKNDGMDTSSMDNYVKQYADVVTFLLTQK"
FT   gene            22716..25514
FT                   /gene="polA"
FT                   /locus_tag="YP_0018"
FT                   /old_locus_tag="YP0018"
FT   CDS_pept        22716..25514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="YP_0018"
FT                   /old_locus_tag="YP0018"
FT                   /product="DNA polymerase I"
FT                   /note="similar to Yersinia pestis CO92 polA and Yersinia
FT                   pestis KIM polA. Contains 5'3'-Exonuclease N- and I-domain
FT                   (Interpro|IPR000513, (GO:0004518)). Contains DNA-directed
FT                   DNA polymerase (Interpro|IPR001098, (GO:0006260)). Contains
FT                   DNA polymerase, family A (Interpro|IPR002298,
FT                   (GO:0006260)). Contains 5'-3' exonuclease
FT                   (Interpro|IPR002421, (GO:0008409)). Contains 3'-5'
FT                   exonuclease (Interpro|IPR002562, (GO:0008408)). Contains
FT                   Helix-hairpin-helix DNA-binding, class 2
FT                   (Interpro|IPR003584, (GO:0005622))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60299"
FT                   /db_xref="GOA:A0A0H2W286"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W286"
FT                   /protein_id="AAS60299.1"
FT                   /translation="MAQIAENPLILVDGSSYLYRAYHAFPPLTNGSGEPTGAMYGVLNM
FT                   LRSLLLQYRPSHVAVVFDAKGKTFRDELFAEYKSHRPPMPDDLRVQIEPLHQMVKAMGL
FT                   PLLVVSGVEADDVIGTLAREAEKAGHSVLISTGDKDMAQLVTPNITLINTMNNTILGPQ
FT                   DVCDKYGVPPELIIDFLALMGDSSDNIPGVPGVGEKTAQALLQGLGGLDTLFSNLDKIS
FT                   TLTFRGAKTMSAKLEQNKDVAYLSYKLATIKTDVELDVTCDELTVSPPDDKQLHQLFSR
FT                   YEFKRWLADVEAGKWLDSKKDRPTGQTSSQSFVAADTAPTAEVTAVLSQENYQTILDEK
FT                   ALADWIERLKAAEVFAFDTETDGLDTLSCNLIGMSFAVAPGEAAYLPLAHDYLDAPPQL
FT                   DRDWVLATLKPLLEDDKALKVGQNLKFDKSMLARYGIDLKGIAFDTMLESYVLDSVAGR
FT                   HDMDSLAERYLNHKTITFEEIAGKGKNQLTFNQIALEQAGPYAAEDADVTLQLHLVLWP
FT                   KLQQSEGLKRVFQEIEMPLLPILSRIERTGVLIDQNILAAHSKELTIRLDELEKQAHEL
FT                   AEEPFNLASPKQLQAILYEKQKLPILKKTPGGAASTNEEVLAELALDYPLPKVILEYRG
FT                   LAKLKSTYTDKLPLMINPVSGRVHTSYHQAVTATGRLSSRDPNLQNIPVRNEEGRRIRQ
FT                   AFIAPKGYCIMAADYSQIELRIMAHLSQDNGLLAAFAAGQDIHRATAAEVFGSPLEKVT
FT                   TEQRRSAKAINFGLIYGMSAFGLARQLGIPRGEAQRYMDLYFERYPGVLEYMERTRKQA
FT                   AEQGYVTTLDGRRLYLPDIHSRNANRRKAAEREAINAPMQGTAADIIKRAMIAVDGWLQ
FT                   QEPEPLVRVIMQVHDELVFEVHESVLQSAEQKIRELMEQSMQLAVPLKVDVGVGANWDQ
FT                   AH"
FT   gene            25663..25780
FT                   /gene="spf"
FT                   /locus_tag="YP_s1"
FT   ncRNA           25663..25780
FT                   /gene="spf"
FT                   /locus_tag="YP_s1"
FT                   /note="RNA feature: spf Spot 42 RNA"
FT                   /ncRNA_class="other"
FT   gene            25872..26381
FT                   /gene="tnp_1"
FT                   /locus_tag="YP_0019"
FT                   /old_locus_tag="YP0019"
FT   CDS_pept        25872..26381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnp_1"
FT                   /locus_tag="YP_0019"
FT                   /old_locus_tag="YP0019"
FT                   /product="transposase for the IS1541 insertion element"
FT                   /note="similar to Yersinia pestis CO92 tnp and similar to
FT                   Yersinia pestis KIM y0044 (residues 1 to 152 of 152 are
FT                   similar to residues 18 to 169 of 168 from Yersinia pestis
FT                   KIM). Contains Transposase, mutator family
FT                   (Interpro|IPR001207). Contains Transposase IS200-like
FT                   (Interpro|IPR002686)."
FT                   /db_xref="EnsemblGenomes-Gn:YP_0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60300"
FT                   /db_xref="GOA:Q74YC7"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q74YC7"
FT                   /protein_id="AAS60300.1"
FT                   /translation="MRSGNCKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAEYCVDHIHMLLEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGS
FT                   PFTGRK"
FT   gene            complement(26633..27283)
FT                   /locus_tag="YP_0020"
FT                   /old_locus_tag="YP0020"
FT   CDS_pept        complement(26633..27283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0020"
FT                   /old_locus_tag="YP0020"
FT                   /product="putative GTPases"
FT                   /note="similar to Yersinia pestis CO92 YPO0019 and Yersinia
FT                   pestis KIM y3809. Contains ATP/GTP-binding site motif A
FT                   (P-loop) (Interpro|IPR001687, (GO:0005524)). Contains
FT                   GTP-binding domain (Interpro|IPR005289)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60301"
FT                   /db_xref="GOA:Q8ZJS0"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJS0"
FT                   /protein_id="AAS60301.1"
FT                   /translation="MTIRNYNYHMTHFVISAPDIRHLPRDEGIEVAFAGRSNAGKSSAL
FT                   NTLTNQKGLARTSKTPGRTQLINLFEVVDGVRLVDLPGYGYAEVPEEMKLKWQRALGEY
FT                   LQKRNCLKGLVVLMDIRHPLKDLDQQMITWAVAVGTPVLLLLTKADKLASGARKAQLNL
FT                   VREAIIPFMGDIQVEAFSSLKKIGVDKLREKLDTWFSEIPPEVMAEEFDGEGE"
FT   gene            28028..28594
FT                   /locus_tag="YP_0021"
FT                   /old_locus_tag="YP0021"
FT   CDS_pept        28028..28594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0021"
FT                   /old_locus_tag="YP0021"
FT                   /product="hypothetical protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0020 and Yersinia
FT                   pestis KIM y3808"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60302"
FT                   /db_xref="GOA:Q8ZJR9"
FT                   /db_xref="InterPro:IPR007336"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJR9"
FT                   /protein_id="AAS60302.1"
FT                   /translation="MKQPNKAPRANIAAPKGTATPKRRRKTRDELDAEARDRKRQKKHS
FT                   GNRSGARTNVEGSNKKGHSQTQEKDPRVGSKVPVPLVIESQVKAKSMPKPVEKNVVKPR
FT                   LTPEEELAKLENDERLDALLDRLDNDEVLNKEDQAYVDLTLDRIDALMEQLGIELGDDE
FT                   DDVEREEKQEDILQLLKRGNPKDTF"
FT   gene            28771..30150
FT                   /gene="hemN1"
FT                   /locus_tag="YP_0022"
FT                   /old_locus_tag="YP0022"
FT   CDS_pept        28771..30150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemN1"
FT                   /locus_tag="YP_0022"
FT                   /old_locus_tag="YP0022"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /note="similar to Yersinia pestis CO92 hemN. Contains
FT                   Oxygen-independent coproporphyrinogen III oxidase HemN
FT                   (Interpro|IPR004558, (GO:0006779)). Contains Elongator
FT                   protein 3/MiaB/NifB (Interpro|IPR006638)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60303"
FT                   /db_xref="GOA:Q8CZM3"
FT                   /db_xref="InterPro:IPR004558"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZM3"
FT                   /protein_id="AAS60303.1"
FT                   /translation="MNMSEHAIVWDLSLIQKYNYSGPRYTSYPTALEFSEDYNESAFQQ
FT                   AVKRYPQRPLSLYVHIPFCHKLCYFCGCNKLVTRQQHKADEYLVVLEKEIRQRAALFTG
FT                   RQVSQMHWGGGTPTYLNKTQISHLMTVLREHFDFLPDAEQSIEVDPREIELDVLDHLRA
FT                   EGFNRLSMGVQDFNKEVQRLVNREQDEDFIFALIARAKALGFNSTNIDLIYGLPKQTPE
FT                   SFAFTLKRVAELNPDRLSVFNYAHLPSLFAAQRKIKDADLPTAEQRLDILQHTIRFLTE
FT                   SGYQFIGMDHFARPDDELAIAQQEGTLHRNFQGYTTQGESDLLGLGVSAISMLGDSYAQ
FT                   NEKDLETYYACVEQRGNALWRGLTMTEDDCLRRDVIKTLICHFQLSYQPIEQRYGIRFA
FT                   DYFAEDFELLAPFEQDGLVERNETGLRVTPRGRLLIRNICMCFDIYLRKQARKQQFSRV
FT                   I"
FT   gene            complement(30204..31685)
FT                   /gene="ntrC"
FT                   /locus_tag="YP_0023"
FT                   /old_locus_tag="YP0023"
FT   CDS_pept        complement(30204..31685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrC"
FT                   /locus_tag="YP_0023"
FT                   /old_locus_tag="YP0023"
FT                   /product="nitrogen regulation protein"
FT                   /note="similar to Yersinia pestis CO92 ntrC and Yersinia
FT                   pestis KIM glnG. Contains Response regulator receiver
FT                   (Interpro|IPR001789, (GO:0006355)). Contains Sigma-54
FT                   factor interaction domain (Interpro|IPR002078,
FT                   (GO:0000160), (GO:0003677), (GO:0006355)). Contains
FT                   Helix-turn-helix, Fis-type (Interpro|IPR002197,
FT                   (GO:0006355)). Contains AAA ATPase (Interpro|IPR003593,
FT                   (GO:0000166))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60304"
FT                   /db_xref="GOA:Q8CWG5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CWG5"
FT                   /protein_id="AAS60304.1"
FT                   /translation="MNLTVGQDTPSFRFTCLFASEVSMQRGIVWIVDDDSSIRWVLERA
FT                   LTGAGLNCVAFDSGNQVLDALATRTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIM
FT                   TAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAISHYQEQQQPARSQPVSGPTAD
FT                   IIGEAPAMQDVFRIIGRLSRSSISVLINGESGTGKELVAHALHRHSPRAKALFIALNMA
FT                   AIPKDLIESELFGHEKGAFTGANQVRQGRFEQADTGTLFLDEIGDMPLDVQTRLLRVLA
FT                   DGQFYRVGGYAPVKVDVRIIAATHQNLELRVQEGKFREDLFHRLNVIRVHLPPLRERSE
FT                   DIPRLARYFLHVAAKELGVESKNLHPETEAALTRLPWPGNVRQLENTCRWLTVMAAGQE
FT                   VLVQDLPSELFETHMPDASGQRAPDSWSTLLAQWADRALRSGHQDLLSEAQPEMERTLL
FT                   TTALRHTQGHKQEAARLLGWGRNTLTRKLKELGME"
FT   gene            complement(31624..32703)
FT                   /gene="ntrB"
FT                   /locus_tag="YP_0024"
FT                   /old_locus_tag="YP0024"
FT   CDS_pept        complement(31624..32703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrB"
FT                   /locus_tag="YP_0024"
FT                   /old_locus_tag="YP0024"
FT                   /product="Two component regulatory protein involved in
FT                   nitrogen assimilation"
FT                   /note="similar to Yersinia pestis KIM glnL and similar to
FT                   Yersinia pestis CO92 ntrB (residues 11 to 359 of 359 are
FT                   similar to residues 1 to 349 of 349 from Yersinia pestis
FT                   CO92 ntrB). Contains PAS domain (Interpro|IPR000014,
FT                   (GO:0007165)). Contains ATP-binding region, ATPase-like
FT                   (Interpro|IPR003594, (GO:0005524)). Contains Histidine
FT                   kinase A, N-terminal (Interpro|IPR003661, (GO:0016020)).
FT                   Contains Bacterial sensor protein, C-terminal
FT                   (Interpro|IPR004358, (GO:0007165)). Contains Histidine
FT                   kinase (Interpro|IPR005467, (GO:0007165), (GO:0016301))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60305"
FT                   /db_xref="GOA:Q8CZM4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZM4"
FT                   /protein_id="AAS60305.1"
FT                   /translation="MHRNCAGVCIMATGTLPDAGQILNTLINSILLLDDDLAIHYANPA
FT                   AQQLLAQSSRKLFGTPLPDLLGYFSLNIVLMRESLQAGQGFTDNEVTLVVDGRAHILSL
FT                   TAQSLAEGFILLELAPMDNQRRLSQEQLQHAQQVAARDLVRGLAHEIKNPLGGLRGAAQ
FT                   LLAKALPDPALLEYTQVIIEQADRLRNLVDRLLGPQRPGQHITQSIHQVAERVCQLVSL
FT                   EKPDNVTLIRDYDPSLPELAHDPDQIEQVLLNITRNALQALGETGGTITLRTRTAFQVT
FT                   LHGMRYRLAARIDIEDDGPGVPTQLQDTVFYPMVSGREGGTGLGLSIARNLIDQHSGKI
FT                   EFNSWPGHTEFSVYLPIRQ"
FT   gene            complement(32926..34335)
FT                   /gene="glnA"
FT                   /locus_tag="YP_0025"
FT                   /old_locus_tag="YP0025"
FT   CDS_pept        complement(32926..34335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="YP_0025"
FT                   /old_locus_tag="YP0025"
FT                   /product="glutamine synthetase"
FT                   /note="similar to Yersinia pestis CO92 glnA and Yersinia
FT                   pestis KIM glnA. Contains Glutamine synthetase class-I,
FT                   adenylation site (Interpro|IPR001637, (GO:0006807)).
FT                   Contains Glutamine synthetase (Interpro|IPR001691,
FT                   (GO:0009399)). Contains Glutamine synthetase type I
FT                   (Interpro|IPR004809, (GO:0009399))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60306"
FT                   /db_xref="GOA:A0A3N4B835"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B835"
FT                   /protein_id="AAS60306.1"
FT                   /translation="MSAEHVLTMLNEHEVKFVDLRFTDTKGKEQHITIPAHQVNADFFE
FT                   EGKMFDGSSIGGWKGINESDMVLMPDASTAVMDPFFADSTLIIRCDILEPGTMQGYDRD
FT                   PRSISKRAEDFLKSSGIADTVLFGPEPEFFLFDDIRFGSSINGSHVSIDDVEGAWNSST
FT                   KYEGGNKGHRPAVKGGYFPVPPVDSAQDLRSAMCLTMEEMGLVVEAHHHEVATAGQNEV
FT                   ATRFNTMTKKADEIQIYKYVVHNVAHAFGKTATFMPKPMFGDNGSGMHCHMSLSKNGNN
FT                   LFAGDKYGGLSEIALFYIGGIIKHAKAINALANPTTNSYKRLVPGYEAPVMLAYSARNR
FT                   SASIRIPVVASPKARRIEARFPDPAANPYLCFAALLMAGLDGIINKIHPGDAMDKNLYD
FT                   LPPEEEAEIPKVAGSLDEAMAALNEDREFLTRGGVFTDDAIDAYIELRREEMDRVRMTP
FT                   HPVEFELYYSV"
FT   gene            34897..36720
FT                   /gene="bipA"
FT                   /locus_tag="YP_0027"
FT                   /old_locus_tag="YP0027"
FT   CDS_pept        34897..36720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bipA"
FT                   /locus_tag="YP_0027"
FT                   /old_locus_tag="YP0027"
FT                   /product="putative GTPase"
FT                   /note="similar to Yersinia pestis CO92 bipA and Yersinia
FT                   pestis KIM y3803. Contains Elongation factor G, C-terminal
FT                   (Interpro|IPR000640, (GO:0006414)). Contains Elongation
FT                   factor, GTP-binding (Interpro|IPR000795, (GO:0006414)).
FT                   Contains ATP/GTP-binding site motif A (P-loop)
FT                   (Interpro|IPR001687, (GO:0005524)). Contains Elongation
FT                   factor Tu, domain 2 (Interpro|IPR004161, (GO:0005525)).
FT                   Contains Small GTP-binding protein domain
FT                   (Interpro|IPR005225). Contains GTP-binding protein TypA
FT                   (Interpro|IPR006298)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60308"
FT                   /db_xref="GOA:A0A3N4B906"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B906"
FT                   /protein_id="AAS60308.1"
FT                   /translation="MIENLRNIAIIAHVDHGKTTLVDKLLQQSGTFGERTEATERVMDS
FT                   NDLEKERGITILAKNTAINWKDYRINIVDTPGHADFGGEVERVMSMVDSVLLVVDAMDG
FT                   PMPQTRFVTKKAFAHGLKPIVVINKVDRPGARPDWVVDQVFDLFVNLDATDEQLDFPII
FT                   YASALMGIAGEDHNDMAEDMTPLYQAIIDHVPAPDVDSSGPLQMQISQLDYNNYVGVIG
FT                   IGRIKRGIVKPNQQVTVIDSEGKTRNGKVGKVLGHMGLERIETTQAEAGDIVAITGLGE
FT                   LNISDTICDVNAVEALPPLSVDEPTVTMYFCVNTSPFCGKEGKYVTSRQILDRLNKELI
FT                   HNVALRVEETEDADAFRVSGRGELHLSVLIENMRREGFELAVSRPKVINRIIDGRNQEP
FT                   FESVTLDIEEQHQGAVMQAMGERKGDVKDMIPDGKGRIRLDYMIPSRGLIGFRTEFMTM
FT                   TSGTGLLYSTFSHYDDVRPGDIGQRQNGVLISNGQGKAVAFALYKLQDRGKLFIGHGTE
FT                   VYEGQIIGIHSRSNDLTVNCLTGKQLTNMRASGTDEATTLVPFLKKTLEQALEFIDDDE
FT                   LVEVTPQSIRIRKRHLTENDRKRAGRGPREG"
FT   gene            37042..37632
FT                   /locus_tag="YP_0028"
FT                   /old_locus_tag="YP0028"
FT   CDS_pept        37042..37632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0028"
FT                   /old_locus_tag="YP0028"
FT                   /product="putative hydrolases of the HAD superfamily"
FT                   /note="similar to Yersinia pestis CO92 YPO0027 and Yersinia
FT                   pestis KIM y3802. Contains Haloacid dehalogenase-like
FT                   hydrolase (Interpro|IPR005834, (GO:0008152), (GO:0016787)).
FT                   Contains HAD-superfamily hydrolase, subfamily IA, variant 3
FT                   (Interpro|IPR006402)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60309"
FT                   /db_xref="GOA:A0A3N4B669"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B669"
FT                   /protein_id="AAS60309.1"
FT                   /translation="MLYIFDLGNVIVDIDFKRVLGVWSKLSSVPLATLNERFTMGEVFQ
FT                   QHERGEISDEDFAHQLSDEMGISLSFEQFAEGWQAIFVALRPEVIDIMNKLRREGNRVV
FT                   VLSNTNRLHCYYWPEHYPEVAAAADHMYLSQDLGMRKPEARIYQHVLNAENVPAEQAVF
FT                   FDDVEANVLAAKAVGINAIHVTDRQIIPTYFSL"
FT   gene            37669..38613
FT                   /gene="rbn1"
FT                   /locus_tag="YP_0029"
FT                   /old_locus_tag="YP0029"
FT   CDS_pept        37669..38613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbn1"
FT                   /locus_tag="YP_0029"
FT                   /old_locus_tag="YP0029"
FT                   /product="ribonuclease BN"
FT                   /note="similar to Yersinia pestis CO92 rbn and Yersinia
FT                   pestis KIM rbn. Contains Ribonuclease BN
FT                   (Interpro|IPR004664, (GO:0004540))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60310"
FT                   /db_xref="GOA:Q8ZJR1"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="InterPro:IPR023679"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJR1"
FT                   /protein_id="AAS60310.1"
FT                   /translation="MLTLITLAHPELYRVDRETNMASFRRFRLLSPLKPCVTFGRMLYT
FT                   RIDKDGLTMLAGHLAYVSLLSLVPLITVIFALFAAFPMFAEISIKLKAFIFANFMPATG
FT                   DIIQNYLEQFVANSNRMTVVGTCGLIVTALLLIYSVDSVLNIIWRSKIQRSLVFSFAVY
FT                   WMVLTLGPILVGASMVISSYLLSLHWLAHARVDSMIDEILRVFPLLISWVSFWLLYSVV
FT                   PTVRVPARDALIGALVAALLFELGKKGFAMYITLFPSYQLIYGVLAVIPILFLWVYWSW
FT                   CIVLLGAEITVTLGEYRAERHHAKSVTTQSPEM"
FT   gene            38620..39057
FT                   /gene="dtd"
FT                   /locus_tag="YP_0030"
FT                   /old_locus_tag="YP0030"
FT   CDS_pept        38620..39057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dtd"
FT                   /locus_tag="YP_0030"
FT                   /old_locus_tag="YP0030"
FT                   /product="D-Tyr-tRNAtyr deacylase"
FT                   /note="similar to Yersinia pestis CO92 YPO0029 and Yersinia
FT                   pestis KIM y3800. Contains D-tyrosyl-tRNA(Tyr) deacylase
FT                   (Interpro|IPR003732)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60311"
FT                   /db_xref="GOA:P58534"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58534"
FT                   /protein_id="AAS60311.1"
FT                   /translation="MIALIQRALSASVVVEGNIVGEIGPGLLVLLGVEQGDTEQKAQRL
FT                   CERVLGYRIFSDENDKMNLNVQQAGGSVLVVSQFTLVADTQKGMRPSFSRGAIPQEADR
FT                   LYQYFVAQCRERGVKTETGLFAADMKVSLVNDGPVTFWLQV"
FT   gene            complement(39131..39913)
FT                   /gene="dnaC_1"
FT                   /locus_tag="YP_0031"
FT                   /old_locus_tag="YP0031"
FT   CDS_pept        complement(39131..39913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaC_1"
FT                   /locus_tag="YP_0031"
FT                   /old_locus_tag="YP0031"
FT                   /product="putative IS100 transposase"
FT                   /note="similar to Yersinia pestis CO92 YPO1969 and Yersinia
FT                   pestis KIM y1853. Contains Chaperonin clpA/B
FT                   (Interpro|IPR001270). Contains ATP/GTP-binding site motif A
FT                   (P-loop) (Interpro|IPR001687, (GO:0005524)). Contains
FT                   Bacterial chromosomal replication initiator protein, DnaA
FT                   (Interpro|IPR001957, (GO:0006275)). Contains IstB-like
FT                   ATP-binding protein (Interpro|IPR002611). Contains AAA
FT                   ATPase (Interpro|IPR003593, (GO:0000166))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60312"
FT                   /db_xref="GOA:A0A3N4AY74"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AY74"
FT                   /protein_id="AAS60312.1"
FT                   /translation="MMMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLE
FT                   HLLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNE
FT                   NIVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGV
FT                   MAPRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALT
FT                   SAMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            complement(39910..40932)
FT                   /locus_tag="YP_0032"
FT                   /old_locus_tag="YP0032"
FT   CDS_pept        complement(39910..40932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0032"
FT                   /old_locus_tag="YP0032"
FT                   /product="transposase for insertion sequence IS100"
FT                   /note="similar to Yersinia pestis CO92 YPO1968 and Yersinia
FT                   pestis KIM y0110. Contains Integrase, catalytic domain
FT                   (Interpro|IPR001584, (GO:0006310)). Contains IS21-like
FT                   element transposase, HTH domain (Interpro|IPR007101)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60313"
FT                   /db_xref="GOA:A0A3N4B5E7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B5E7"
FT                   /protein_id="AAS60313.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            41326..42126
FT                   /gene="wecD1"
FT                   /locus_tag="YP_0033"
FT                   /old_locus_tag="YP0033"
FT   CDS_pept        41326..42126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wecD1"
FT                   /locus_tag="YP_0033"
FT                   /old_locus_tag="YP0033"
FT                   /product="conserved membrane protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0032 and Yersinia
FT                   pestis KIM y0109. Contains GCN5-related N-acetyltransferase
FT                   (Interpro|IPR000182, (GO:0008080))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60314"
FT                   /db_xref="GOA:A0A0H2W0W9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012660"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W0W9"
FT                   /protein_id="AAS60314.1"
FT                   /translation="MAHHQMVVDEQGKAVAIGRLYINADNEAAIRFLAVAPSVRNKGLG
FT                   TLVAMTLESVARQEGVKRVVCSAREDAVDFFAKLGFVCQGEITAPQTTPVRHFLMIKPV
FT                   ATMDDILHRPDWCGQLQQAWYDHIPLSEKMGVRISQYTGQRFVTTMPEAGNQNPHHTLF
FT                   AGSLFSLATLTGWGLIWLLLRERHLGGTIILADAHIRYSAPVTGRPRAVAELSSLSGDL
FT                   DRLARGRRARVQLNVNLFGDENQGAVFEGTYMVLPVAAGDDMAN"
FT   gene            complement(42261..43616)
FT                   /locus_tag="YP_0034"
FT                   /old_locus_tag="YP0034"
FT   CDS_pept        complement(42261..43616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0034"
FT                   /old_locus_tag="YP0034"
FT                   /product="putative exported protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0033 and Yersinia
FT                   pestis KIM y0108."
FT                   /db_xref="EnsemblGenomes-Gn:YP_0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60315"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W0T0"
FT                   /protein_id="AAS60315.1"
FT                   /translation="MQADTLQLTDMTLNTTVESKNATSQWKIAGQHVNGGLVPWQPIPG
FT                   NSFGENTQFHFSAGFLTINDISAQQIYLQGSIQKDILTLTNFGANIAQGELTGNARQSA
FT                   DGSWLVDRLRLSNIRLQTTASLEDVWNNVLQLPPITLKRFDLIDARVEGKGWAVNDVDL
FT                   TLKNITFKQGDWQSDDGELVFNASDIIKGNIHLIDPIATFTLSPEGVAINQFTTRWQDG
FT                   LLRTLGSWSRATHRLQLGELTVVALVYTLPNDWKQLWQQTLPDWLSEVYVGKLSANRNL
FT                   LIDISPDFPFQITSLDAAGSNLLLAKNHQWGVWSGSLVLNAGNATFNKNDIRRPSLALN
FT                   ANEQQITFSDLSAFTKEGLLEATASIDQTPDRALSLALTGRSVDLNFLHNWGWPALPLQ
FT                   GLGNLKLQIKGNLTADAPLKPTLNGSLQAIDSNGQQINQTVLHGVVQGTAEQ"
FT   gene            complement(44118..45527)
FT                   /gene="uraA"
FT                   /locus_tag="YP_0035"
FT                   /old_locus_tag="YP0035"
FT   CDS_pept        complement(44118..45527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uraA"
FT                   /locus_tag="YP_0035"
FT                   /old_locus_tag="YP0035"
FT                   /product="putative membrane permease"
FT                   /note="similar to Yersinia pestis CO92 YPO0034. Contains
FT                   Xanthine/uracil permease family (Interpro|IPR006042,
FT                   (GO:0016020)). Contains Xanthine/uracil/vitamin C permease
FT                   family (Interpro|IPR006043, (GO:0016020))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60316"
FT                   /db_xref="GOA:A0A0H2W1W7"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W1W7"
FT                   /protein_id="AAS60316.1"
FT                   /translation="MPIWKYHAMSTQSAELDTAPPSPAHPSELIYHLEDRPPLPQTLFA
FT                   ACQHLLAMFVAVITPGLLICQALGLPAEDTQRIISMSLFASGLASLLQIKTWGPVGSGL
FT                   LSIQGTSFNFVSPLIMGGLALKNGGADIPTMMAALFGTLMVASCTEILLSHVLHLARRI
FT                   ITPLVSGIVVMIIGLSLIQVGLTSIGGGYGAMSDNTFGAPKNLLLAGAVLGVIILLNRQ
FT                   RNPYLRVASLVIAMAVGYLLAWALGMLPESRPVVDTALITIPTPLYYGLSFDWNLLIPL
FT                   MLIFMVTSLETIGDITATSDVSEQPVRGPLYMKRLKGGVLANGLNSMLSAIFNTFPNSC
FT                   FGQNNGVIQLTGVASRYVGFVVAIMLIILGLFPAVAGFVQHIPEPVLGGATLVMFGTIA
FT                   ASGVRIVSRETLNRRAIMIMALSLAVGMGVAQQPLILQFAPDWIKTLFSSGIAAGGITA
FT                   IVLNLLFPQEK"
FT   gene            45741..46955
FT                   /gene="gltS"
FT                   /locus_tag="YP_0036"
FT                   /old_locus_tag="YP0036"
FT   CDS_pept        45741..46955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltS"
FT                   /locus_tag="YP_0036"
FT                   /old_locus_tag="YP0036"
FT                   /product="sodium/glutamate symport carrier protein"
FT                   /note="similar to Yersinia pestis CO92 gltS and Yersinia
FT                   pestis KIM gltS. Contains Sodium:dicarboxylate symporter
FT                   (Interpro|IPR001991, (GO:0016020)). Contains Kv channel
FT                   (Interpro|IPR003968, (GO:0008076)). Contains
FT                   Sodium/glutamate symporter (Interpro|IPR004445,
FT                   (GO:0016021))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60317"
FT                   /db_xref="GOA:A0A3N4BAK4"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BAK4"
FT                   /protein_id="AAS60317.1"
FT                   /translation="MFHLDTYGTLVAACLVLLLGRKLVQTVPFLKKYTIPEPVAGGLLV
FT                   AFMMLLVQKTLGWEVSFDMSLKDPLMLAFFATIGLNANLASLRAGGKALSIFVFIVVGL
FT                   LLVQNTIGIVLAKLMGLDPLMGLLAGSITLSGGHGTGAAWSKLFSERYGFENATEVAMA
FT                   CATFGLVLGGLIGGPVARYLVKHSSTPEGTPDDSAVPSAFEKPSAGRMITSLVLIETIA
FT                   MISICLMAGNLIAGWLQGTMFELPIFVCVLFVGVILSNTLSASGFYRVFDRAVSVLGNV
FT                   SLSLFLAMALMSLKLWELASLALPMLVILSVQALAMALYAIFVTYRIMGKNYDAAVLAA
FT                   GHCGFGLGATPTAIANMQAITDRFGPSHLAFLVVPMVGAFFIDIVNAIVIKLYLLLPIF
FT                   PAVTG"
FT   gene            complement(47321..49402)
FT                   /gene="recG"
FT                   /locus_tag="YP_0037"
FT                   /old_locus_tag="YP0037"
FT   CDS_pept        complement(47321..49402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="YP_0037"
FT                   /old_locus_tag="YP0037"
FT                   /product="ATP-dependent DNA helicase"
FT                   /note="similar to Yersinia pestis CO92 recG and Yersinia
FT                   pestis KIM recG. Contains DEAD/DEAH box helicase
FT                   (Interpro|IPR001410, (GO:0008026)). Contains Helicase,
FT                   C-terminal (Interpro|IPR001650, (GO:0005524)). Contains
FT                   ATP/GTP-binding site motif A (P-loop) (Interpro|IPR001687,
FT                   (GO:0005524)). Contains OB-fold nucleic acid binding domain
FT                   (Interpro|IPR004365, (GO:0003676)). Contains ATP-dependent
FT                   DNA helicase RecG (Interpro|IPR004609, (GO:0006310))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60318"
FT                   /db_xref="GOA:A0A2S9PHL0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PHL0"
FT                   /protein_id="AAS60318.1"
FT                   /translation="MKGRLLDAVPLSTLSGVGASQAGKLAKIGLETIQDLLLHLPLRYE
FT                   DRTRLYRIGDLLPGLSVTVEGEVLRSDISFGRRRMMTCQISDGSGVLTLRFFNFNAAMK
FT                   NSLSVGKHVIAYGEAKRGNNGPEIIHPEYRVHGENIGVELQESLTPVYPTTEGIRQATL
FT                   RKLIDQALAMLDTCVIAELLPIELSRSLISLPEAIHTLHRPPADIQLADLEQGKHPAQR
FT                   RLIMEELLAHNLSMLAVRAGAQSYRALPLMAEEQLKQRFLAALPFTPTQAQQRVVAEIE
FT                   RDMTQSFPMMRLIQGDVGSGKTLVAALAALRAIAHGKQVALMAPTELLAEQHATTFRQW
FT                   LEPLGFSVGWLAGKQKGKARLAQQEAVASGQVSMVIGTHAMFQEQVQFSGLALVIIDEQ
FT                   HRFGVHQRLTLWEKGEEQGFHPHQLIMTATPIPRTLAMTAYADLDTSVIDELPPGRTPV
FT                   TTVAIPDTRRSDVIQRVKNACLEEGRQAYWVCTLIEESELLEAQAAEVTCEELKIALPE
FT                   IKVGLVHGRMKGPEKQAIMLAFKQGELQLLVATTVIEVGVDVPNASLMIIDNPERLGLA
FT                   QLHQLRGRVGRGAVASHCVLLYKTPLSKTAQMRLQVLRDSNDGFVIAQRDLEIRGPGEL
FT                   LGTRQTGSAEFKVADLLRDQAMIPEVQRVARHLHQQYPEHAKALIERWLPERVRYTNA"
FT   gene            complement(49403..50095)
FT                   /gene="trmH"
FT                   /locus_tag="YP_0038"
FT                   /old_locus_tag="YP0038"
FT   CDS_pept        complement(49403..50095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmH"
FT                   /locus_tag="YP_0038"
FT                   /old_locus_tag="YP0038"
FT                   /product="tRNA (guanosine-2'-O-)-methyltransferase"
FT                   /note="similar to Yersinia pestis CO92 trmH and Yersinia
FT                   pestis KIM spoU. Contains tRNA/rRNA methyltransferase
FT                   (SpoU) (Interpro|IPR001537, (GO:0008173))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60319"
FT                   /db_xref="GOA:A0A3N4AWN1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR022724"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR033671"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AWN1"
FT                   /protein_id="AAS60319.1"
FT                   /translation="MNPQRYARICDMLATRQPDLTVCLEQVHKPHNVSAIIRTADAVGI
FT                   HQVHAIWPTTQMYTRLSAAAGSNSWVQVKTHPHIADAIAYLKSQDMQILATHLSDKAVD
FT                   FREIDYTRPTCILMGQEKTGISPEALALADQDIIIPMIGMVQSLNVSVASALILYEAQR
FT                   QRQNAGMYKRTHSVLAESEQQRLLFEGGYPVLAHVAKRKGLPQPHIDEQGQIIADAQWW
FT                   SAMQATES"
FT   gene            complement(50101..52209)
FT                   /gene="spoT"
FT                   /locus_tag="YP_0039"
FT                   /old_locus_tag="YP0039"
FT   CDS_pept        complement(50101..52209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoT"
FT                   /locus_tag="YP_0039"
FT                   /old_locus_tag="YP0039"
FT                   /product="guanosine-3',5'-bisbis(diphosphate)
FT                   3'-pyrophosphydrolase"
FT                   /note="similar to Yersinia pestis CO92 spoT and Yersinia
FT                   pestis KIM spoT. Contains Metal dependent phosphohydrolase,
FT                   HD region (Interpro|IPR003607, (GO:0003824)). Contains TGS
FT                   domain (Interpro|IPR004095). Contains RelA/SpoT family
FT                   protein (Interpro|IPR004811, (GO:0015969)). Contains
FT                   Metal-dependent phosphohydrolase, HD region
FT                   (Interpro|IPR006674)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60320"
FT                   /db_xref="GOA:A0A3N4BK11"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BK11"
FT                   /protein_id="AAS60320.1"
FT                   /translation="MYLFESLNLLIQRYLPEEQIKRLKQAYLVARDAHEGQTRSSGEPY
FT                   ITHPVAVACILAEMRLDYETLMAALLHDVIEDTPATYQDMEQLFGKSVAELVEGVSKLD
FT                   KLNFRDKKEAQAENFRKMIMAMVQDIRVILIKLADRTHNMRTLGSLRPDKRRRIARETL
FT                   EIYSPLAHRLGIHHLKTELEELGFEALYPNRYRVIKEVVKAARGNRKEMIQKILAEIEG
FT                   RLTEAGIPCRVSGREKHLYSIYCKMHLKEQRFHSIMDIYAFRVIVKEVDTCYRVLGQAH
FT                   SLYKPRPGRVKDYIAIPKANGYQSLHTSLIGPHGVPVEVQIRTEDMDQMAEMGVAAHWA
FT                   YKEQGESGTTAQIRAQRWMQSLLELQQSAGSSFEFIESVKSDLFPDEIYVFTPEGRIVE
FT                   LPAGATPVDFAYVVHTDIGHACVGARVDRQPYPLSQPLSSGQTVEIITAPGARPNAAWL
FT                   NFVVSSKARAKIRQLLKNLKRDESVSLGRRLLNHALGNGRKLSDISEENIKHELDRMKL
FT                   ATVDDLLAEIGLGNAMSVVVAKNLLGDPSTLGTSASGTRKLPIKGADGVLITFAKCCRP
FT                   IPGDPIIAHISPGKGLVIHHESCRNIRGYQKEPEKFMAVEWDQETEQEFIAEIKVDMFN
FT                   QQGALANLTAAINAAESNIQSLNTEEKDGRVYSAFIRLTTRNRVHLANIMRKIRIMPDV
FT                   VKVSRNRN"
FT   gene            complement(52229..52504)
FT                   /gene="rpoZ"
FT                   /locus_tag="YP_0040"
FT                   /old_locus_tag="YP0040"
FT   CDS_pept        complement(52229..52504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="YP_0040"
FT                   /old_locus_tag="YP0040"
FT                   /product="DNA-directed RNA polymerase, omega chain"
FT                   /note="similar to Yersinia pestis CO92 rpoZ and Yersinia
FT                   pestis KIM rpoZ. Contains RNA polymerase, omega subunit
FT                   (Interpro|IPR003716, (GO:0006350)). Contains RNA polymerase
FT                   Rpb6 (Interpro|IPR006110, (GO:0006351))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60321"
FT                   /db_xref="GOA:Q8ZJQ3"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJQ3"
FT                   /protein_id="AAS60321.1"
FT                   /translation="MARVTVQDAVEKIGNRFDLVLVAARRARQIQSGGKDALVPEENDK
FT                   VTVIALREIEEGLITNQILDVRERQEQQEQQAAEIQAVTAIAEGRR"
FT   gene            complement(52559..53182)
FT                   /gene="gmk"
FT                   /locus_tag="YP_0041"
FT                   /old_locus_tag="YP0041"
FT   CDS_pept        complement(52559..53182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="YP_0041"
FT                   /old_locus_tag="YP0041"
FT                   /product="guanylate kinase"
FT                   /note="similar to Yersinia pestis CO92 gmk and Yersinia
FT                   pestis KIM gmk. Contains Guanylate kinase
FT                   (Interpro|IPR000619). Contains Adenylate kinase
FT                   (Interpro|IPR000850, (GO:0005524)). Contains
FT                   ATP/GTP-binding site motif A (P-loop) (Interpro|IPR001687,
FT                   (GO:0005524))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60322"
FT                   /db_xref="GOA:Q8ZJQ2"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJQ2"
FT                   /protein_id="AAS60322.1"
FT                   /translation="MVQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSISHTTRAKR
FT                   PGENHGEHYFFVSEKEFCQMIDDDAFLEHAKVFENYYGTSRLAIEQVLATGVDVFLDID
FT                   WQGAQQIRAKMPTARSIFILPPSKTELDRRLRGRGQDSEEVIAKRMEQAVAEMAHYAEY
FT                   DYLIVNDDFNLALSDLKTIIRAERLRLGRQKQRHDALISKLLAD"
FT   gene            53583..55286
FT                   /gene="lig"
FT                   /locus_tag="YP_0042"
FT                   /old_locus_tag="YP0042"
FT   CDS_pept        53583..55286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lig"
FT                   /locus_tag="YP_0042"
FT                   /old_locus_tag="YP0042"
FT                   /product="putative DNA ligase"
FT                   /note="similar to Yersinia pestis CO92 YPO0041 and Yersinia
FT                   pestis KIM y0100. Contains Helix-hairpin-helix motif
FT                   (Interpro|IPR000445, (GO:0003677)). Contains TonB-dependent
FT                   receptor protein (Interpro|IPR000531, (GO:0016020)).
FT                   Contains NAD-dependent DNA ligase (Interpro|IPR001679,
FT                   (GO:0006281)). Contains NAD-dependent DNA ligase OB-fold
FT                   domain (Interpro|IPR004150, (GO:0006281))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60323"
FT                   /db_xref="GOA:Q7CLB2"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR020923"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CLB2"
FT                   /protein_id="AAS60323.1"
FT                   /translation="MNILNLKIIMFLLISNTIVVGGAWATSTCPDWPATRIAVEINALE
FT                   QQLNKWSAAYHQQGHSPVTDDIYDQLQDKLRVWQSCRGLPDKTESQPIPGKGQFLHPVA
FT                   HTGLKKLKDETALTRWMAGRKNLWVQPKVDGVAVTLVYHGGKLVQLLSRGNGVKGQNWT
FT                   EKAPFISAIPQYIANAPALLTLQGELFLLMDGHQQAKSGGVNARSTVAGALMRKSPSPL
FT                   LAQVGVFIWAWPDGPTTMKEKVALLQVMGFPFTAKYSEPVMSHLDVVQWRQFWFQAPLP
FT                   FVTDGVVVRQEEEPAGRYWQATPGQWSMAWKYPPLQHIAEVKDIHFTLGRTGKGTVVLE
FT                   VLPIKIDDKWIRRVNIGSVTRWKQWDIAPGDHITLALAGHGIPRLDNVVWRVHQRNTIT
FT                   APNWDKFHQLSCFQRLPHGCEPQFLSRLIWLSGPGGLDIGGIGGGFWQELIHHELINDL
FT                   VGWLLLTPEQIASIPGIGNARAEKIYQQFQRAKQQPFSRWLLALGFPQVVSVDAQWQVV
FT                   LRRSLSEWATMAGIGQMRAKQIKHFLDHPDVQALADFLSTQKVVGFELTE"
FT   gene            complement(55299..55922)
FT                   /locus_tag="YP_0043"
FT                   /old_locus_tag="YP0043"
FT   CDS_pept        complement(55299..55922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0043"
FT                   /old_locus_tag="YP0043"
FT                   /product="putative membrane protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0042 and Yersinia
FT                   pestis KIM y0099. Contains Tetracycline resistance protein
FT                   (Interpro|IPR001958, (GO:0016021)). Contains Domain of
FT                   unknown function UPF0126 (Interpro|IPR005115)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60324"
FT                   /db_xref="GOA:A0A3N4AY13"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AY13"
FT                   /protein_id="AAS60324.1"
FT                   /translation="MLLSVLYIIGITAEAMTGALAAGRRQMDMFGVIIIASATAIGGGS
FT                   VRDMLLGHYPLGWVKHPEYIVIVAIAAIVTTWMAPLMKQLRHLFLVLDAIGLIVFSIIG
FT                   AQIALDMGHSTIIAAIAAVITGVFGGVLRDMLCNCIPLVFQKEIYAGISFAAAWIYIAL
FT                   QYTPLSHNWVIIITLITGLALDYSPYDSGLACLYSNMSTQTIKL"
FT   gene            complement(56325..57188)
FT                   /locus_tag="YP_0044"
FT                   /old_locus_tag="YP0044"
FT   CDS_pept        complement(56325..57188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0044"
FT                   /old_locus_tag="YP0044"
FT                   /product="putative stress-induced protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0043 and Yersinia
FT                   pestis KIM y0098. Contains Conserved hypothetical protein
FT                   255 (Interpro|IPR005229)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60325"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B149"
FT                   /protein_id="AAS60325.1"
FT                   /translation="MIRSMTAYARRDIKGEWGNAAWELRSVNQRYLETYIRLPEQFRSL
FT                   EPVIRERIRSRLTRGKIECHLRFELDANAQSSLILNEKLAKQLVEAGNWVKMQSDEGEI
FT                   NPVDILRWPGVMSAEEQDLDAISTELMQALDTALDDFIVSRETEGAALKTLIEQRLEGV
FT                   SAEVVKVRAHMPNILQWQRERLLNKLEEAQVQLENTRLEQELVLMAQRIDVAEELDRLE
FT                   AHVKETYNILKKKEAVGRRLDFMMQEFNRESNTLASKSINAEVTNSAIELKVLIEQMRE
FT                   QIQNIE"
FT   gene            57315..58031
FT                   /gene="rph"
FT                   /locus_tag="YP_0045"
FT                   /old_locus_tag="YP0045"
FT   CDS_pept        57315..58031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="YP_0045"
FT                   /old_locus_tag="YP0045"
FT                   /product="ribonuclease PH"
FT                   /note="similar to Yersinia pestis CO92 rph and Yersinia
FT                   pestis KIM rph. Contains 3' exoribonuclease
FT                   (Interpro|IPR001247, (GO:0006396)). Contains Ribonuclease
FT                   PH (Interpro|IPR002381, (GO:0008033))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60326"
FT                   /db_xref="GOA:Q8ZJP8"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJP8"
FT                   /protein_id="AAS60326.1"
FT                   /translation="MRPADRAAQQVRPLTLTRNYTKHAEGSVLVEFGDTKVLCTATVEE
FT                   GVPRFLKGQGQGWITAEYGMLPRSTHSRNAREAAKGKQGGRTLEIQRLIARSLRAAVDL
FT                   KKLGEFTITLDCDVLQADGGTRTASISGACVALADALNKLVASGKLKANPMKGLVAAVS
FT                   VGIVKGEALCDLEYVEDSAAETDMNVVMMEDGRMIEVQGTAEGEPFSHEELLALLDLAR
FT                   GGIETIFQAQKAALES"
FT   gene            58198..58845
FT                   /gene="pyrE"
FT                   /locus_tag="YP_0046"
FT                   /old_locus_tag="YP0046"
FT   CDS_pept        58198..58845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="YP_0046"
FT                   /old_locus_tag="YP0046"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /note="similar to Yersinia pestis CO92 pyrE and Yersinia
FT                   pestis KIM pyrE. Contains Phosphoribosyltransferase
FT                   (Interpro|IPR000836, (GO:0009116)). Contains
FT                   Purine/pyrimidine phosphoribosyl transferase
FT                   (Interpro|IPR002375). Contains Orotate phosphoribosyl
FT                   transferase (Interpro|IPR004467, (GO:0006221))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60327"
FT                   /db_xref="GOA:Q8ZJP7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJP7"
FT                   /protein_id="AAS60327.1"
FT                   /translation="MKAYQREFIEFALNKQVLKFGEFTLKSGRISPYFFNAGLFNTGLD
FT                   LAKLGRFYAAALMDCGVEFDLLFGPAYKGIPIATTTAVALAEHHERDVPYCFNRKEAKT
FT                   HGEGGNLVGSPLQGRVMLVDDVITAGTAIRESMEIINAQGATLAGVMISLDRQERGRGE
FT                   ISAIQEVERDYHCKVIAIVTLNDVIRYLEDKPEMAEHLVAVRQYREQYGVTL"
FT   gene            complement(58980..59576)
FT                   /gene="ttk"
FT                   /locus_tag="YP_0047"
FT                   /old_locus_tag="YP0047"
FT   CDS_pept        complement(58980..59576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ttk"
FT                   /locus_tag="YP_0047"
FT                   /old_locus_tag="YP0047"
FT                   /product="TetR-family regulatory protein"
FT                   /note="similar to Yersinia pestis CO92 ttk and Yersinia
FT                   pestis KIM ttk. Contains Bacterial regulatory protein TetR,
FT                   HTH motif (Interpro|IPR001647, (GO:0006355))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60328"
FT                   /db_xref="GOA:Q8ZJP6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023769"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJP6"
FT                   /protein_id="AAS60328.1"
FT                   /translation="MAEKENTKRNRREEILQALAQMLESSDGSQRITTAKLAANVGVSE
FT                   AALYRHFPSKTRMFDSLIEFIEDSLMSRINLILQDEKETFNRLRLILLLVLGFAERNPG
FT                   LTRIMTGHALMFEQDRLQGRINQLFERIEMQLRQVLREKKLRDGQGFIHDEALLATQLL
FT                   AFCEGMLSRFVRSEFRYCPTQEFDSRWPLIVAQLQ"
FT   gene            complement(59698..60168)
FT                   /gene="dut"
FT                   /locus_tag="YP_0048"
FT                   /old_locus_tag="YP0048"
FT   CDS_pept        complement(59698..60168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="YP_0048"
FT                   /old_locus_tag="YP0048"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /note="similar to Yersinia pestis CO92 dut and to Yersinia
FT                   pestis KIM dut. Contains DeoxyUTP pyrophosphatase
FT                   (Interpro|IPR001428, (GO:0006399))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60329"
FT                   /db_xref="GOA:Q8ZJP5"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJP5"
FT                   /protein_id="AAS60329.1"
FT                   /translation="MSAVMMKKIDIKILDPRVGNEFPLPTYATEGSAGLDLRACLDHAV
FT                   ELQPGQTTLLPTGLAIHIGDSALAAVILPRSGLGHKHGIVLGNLVGLIDSDYQGQLMVS
FT                   VWNRGQQPFTIEPGERIAQMVFVPVVQAEFNLVEDFTDSERGTGGFGHSGRQ"
FT   gene            complement(60134..61351)
FT                   /gene="dfp"
FT                   /locus_tag="YP_0049"
FT                   /old_locus_tag="YP0049"
FT   CDS_pept        complement(60134..61351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dfp"
FT                   /locus_tag="YP_0049"
FT                   /old_locus_tag="YP0049"
FT                   /product="DNA/pantothenate metabolism flavoprotein"
FT                   /note="similar to Yersinia pestis CO92 dfp and Yersinia
FT                   pestis KIM dfp. Contains Flavoprotein (Interpro|IPR003382).
FT                   Contains DNA/pantothenate metabolism flavoprotein
FT                   (Interpro|IPR005252). Contains DNA/pantothenate metabolism
FT                   flavoprotein, C terminal (Interpro|IPR007085)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60330"
FT                   /db_xref="GOA:A0A384KQV0"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KQV0"
FT                   /protein_id="AAS60330.1"
FT                   /translation="MMTGLSGKHIVLGISGGIAAYKSPELVRRLRDKGADVRVVMTHAA
FT                   KAFIAPLTLQAVSGYPVSDDLLDPAAEAAMGHIELGKWADLVIIAPATADLLARMAAGM
FT                   ANDLLTTVCLATAAPIAAVPAMNQQMYRAPATQENLQTLSKWGVLLWGPDSGSQACGDI
FT                   GPGRMLDPQEIVALAYNHFSAKQDLQHLSVMITAGPTREPLDPVRFISNQSSGKMGFAI
FT                   AQALAARGSNVTLIAGPVNLSTPEGVKRIDVITALEMQQAVQKIAQQQNIFISCAAVAD
FT                   YRAEHVSDEKIKKQGDEITLKLVKNPDIVAGVASMAKNRPFVVGFAAETQNVEEYARQK
FT                   LARKNLDLICANDVSLAEHGFNSDTNALHLFWSTGEKRLPLSDKYLLSQRLIDEIVSRY
FT                   DEKNRH"
FT   gene            61545..62213
FT                   /gene="radC"
FT                   /locus_tag="YP_0050"
FT                   /old_locus_tag="YP0050"
FT   CDS_pept        61545..62213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radC"
FT                   /locus_tag="YP_0050"
FT                   /old_locus_tag="YP0050"
FT                   /product="putative DNA repair protein"
FT                   /note="similar to Yersinia pestis CO92 radC and Yersinia
FT                   pestis KIM radC. Contains DNA repair protein RadC
FT                   (Interpro|IPR001405, (GO:0006281))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60331"
FT                   /db_xref="GOA:Q8ZJP3"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR022820"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJP3"
FT                   /protein_id="AAS60331.1"
FT                   /translation="MDEWYGQVAPREKLLKYGAAVLTDAELLAIFLRTGIPGMHVMKMA
FT                   EYLIETFGSLHGLISADYQTLCAHKGIGASKYSQIQAIGELACRCFSSHLMRESVLLNP
FT                   GITQKFLQNILSHREREIFLVVFLDNQHRVIRHEEMFTGTISSVEVHPREIVREALKVN
FT                   AAALILAHNHPSGKAEPSQADRLITTQVIKACSLLDIRVLDHLVVGRGECVSFAERGWL
FT                   "
FT   gene            62476..62712
FT                   /gene="rpmB"
FT                   /locus_tag="YP_0051"
FT                   /old_locus_tag="YP0051"
FT   CDS_pept        62476..62712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="YP_0051"
FT                   /old_locus_tag="YP0051"
FT                   /product="50S ribosomal protein L28"
FT                   /note="similar to Yersinia pestis CO92 rpmB. Contains
FT                   Ribosomal protein L28 (Interpro|IPR001383, (GO:0006412))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60332"
FT                   /db_xref="GOA:Q8ZJP2"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJP2"
FT                   /protein_id="AAS60332.1"
FT                   /translation="MSRVCQVTGKRPMSGNNRSHAMNATKRRFLPNLHSHRFWVEGEKR
FT                   FVTLRVSAKGMRVIDKKGIETVLAEIRARGEKY"
FT   gene            62724..62891
FT                   /gene="rpmG"
FT                   /locus_tag="YP_0052"
FT                   /old_locus_tag="YP0052"
FT   CDS_pept        62724..62891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="YP_0052"
FT                   /old_locus_tag="YP0052"
FT                   /product="50S ribosomal protein L33"
FT                   /note="similar to Yersinia pestis CO92 rpmG and Yersinia
FT                   pestis KIM rpmG. Contains Ribosomal protein L33
FT                   (Interpro|IPR001705, (GO:0006412))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60333"
FT                   /db_xref="GOA:Q8ZJP1"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJP1"
FT                   /protein_id="AAS60333.1"
FT                   /translation="MAKGVREKIKLVSSAGTGHFYTTTKNKRTKPEKLELKKFDPVVRQ
FT                   HVLYKEAKIK"
FT   gene            62974..63783
FT                   /gene="mutM"
FT                   /locus_tag="YP_0053"
FT                   /old_locus_tag="YP0053"
FT   CDS_pept        62974..63783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="YP_0053"
FT                   /old_locus_tag="YP0053"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /note="similar to Yersinia pestis CO92 mutM and Yersinia
FT                   pestis KIM mutM. Contains Formamidopyrimidine-DNA glycolase
FT                   (Interpro|IPR000191, (GO:0006281)). Contains
FT                   Formamidopyrimidine-DNA glycolase, zinc binding domain
FT                   (Interpro|IPR000214, (GO:0006281), (GO:0008270))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60334"
FT                   /db_xref="GOA:Q8ZJP0"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJP0"
FT                   /protein_id="AAS60334.1"
FT                   /translation="MPELPEVETSRRGIEPYLVGQTILYAVVRNARLRWPVSDEILTLS
FT                   DQPVLSVQRRAKYLLLELPKGWIIIHLGMSGSLRVLSEETAAEKHDHVDLVVSNGKILR
FT                   YTDPRRFGAWLWAKDLETSNVLAHLGPEPLSDEFTAQYLFDKSRNKRTLIKPWLMDNKV
FT                   VVGVGNIYASESLFAAGILPDRAAGSLTDAESVLLVATIKAVLLHSIEQGGTTLRDFLQ
FT                   SDGKPGYFAQELQVYGRAGEPCRQCGHPIEIAKHGQRSTFFCRHCQH"
FT   gene            complement(63789..64268)
FT                   /gene="coaD"
FT                   /locus_tag="YP_0054"
FT                   /old_locus_tag="YP0054"
FT   CDS_pept        complement(63789..64268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /locus_tag="YP_0054"
FT                   /old_locus_tag="YP0054"
FT                   /product="phosphopantetheine adenylyltransferase"
FT                   /note="similar to Yersinia pestis CO92 coaD and Yersinia
FT                   pestis KIM kdtB. Contains Coenzyme A biosynthesis protein
FT                   (Interpro|IPR001980, (GO:0015937)). Contains
FT                   Cytidylyltransferase (Interpro|IPR004820, (GO:0009058),
FT                   (GO:0016779)). Contains Cytidyltransferase-related domain
FT                   (Interpro|IPR004821)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60335"
FT                   /db_xref="GOA:Q8ZJN9"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="PDB:3L92"
FT                   /db_xref="PDB:3L93"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJN9"
FT                   /protein_id="AAS60335.1"
FT                   /translation="MITKAIYPGTFDPITNGHLDLVTRASAMFSHVILAIADSSSKKPM
FT                   FTLDERVALAKKVTAPLKNVEVLGFSELMAEFAKKHNANILVRGLRSVSDFEYEWQLAN
FT                   MNRHLMPKLESVFLIPSEKWSFISSSLVKEVARHGGDITPFLPKPVTKALLAKLA"
FT   gene            complement(64265..65047)
FT                   /gene="kdtX"
FT                   /locus_tag="YP_0055"
FT                   /old_locus_tag="YP0055"
FT   CDS_pept        complement(64265..65047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdtX"
FT                   /locus_tag="YP_0055"
FT                   /old_locus_tag="YP0055"
FT                   /product="lipopolysaccharide core biosynthesis glycosyl
FT                   transferase"
FT                   /note="similar to Yersinia pestis CO92 kdtX and Yersinia
FT                   pestis KIM y0087. Contains Glycosyl transferase, family 2
FT                   (Interpro|IPR001173)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60336"
FT                   /db_xref="GOA:A0A3N4AY23"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AY23"
FT                   /protein_id="AAS60336.1"
FT                   /translation="MGTKKRLSVVMITKNEASLLTDCLASVAWADEIIVLDSGSEDETR
FT                   ALAQQFGAKVYSNINWPGYGKQRQLAQQYASGDYILMLDADERVTPELKIAIESVLLAP
FT                   EEGAVYSCSRRNLFLGRFMRHSGWYPDRVTRLYPHHQYRYNDNLVHESLDSGSAKVIPL
FT                   AGDLLHLTCRDFFAFQRKQLSYAEAWAIQRHQQGKSCSYFAILSHTLGAFSKTWLLRAG
FT                   FLDGKQGLLLAVVNAQYTFNKYAALWALSHQYQKSEKS"
FT   gene            complement(65048..66433)
FT                   /gene="kdtA"
FT                   /locus_tag="YP_0056"
FT                   /old_locus_tag="YP0056"
FT   CDS_pept        complement(65048..66433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdtA"
FT                   /locus_tag="YP_0056"
FT                   /old_locus_tag="YP0056"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /note="similar to Yersinia pestis CO92 kdtA and Yersinia
FT                   pestis KIM kdtA. Contains Glycosyl transferase, family 1
FT                   (Interpro|IPR001296, (GO:0009058))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60337"
FT                   /db_xref="GOA:A0A0H2W0T9"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W0T9"
FT                   /protein_id="AAS60337.1"
FT                   /translation="MNNHGSMWCSALLAGKSLFCPDMVLFLIIHINEIDRMLLRLYQVL
FT                   LYLIQPLIWLRLLLRSRKAPAYRKRWGERYGFCAGKVVAGGIMLHSVSVGETLAAIPLV
FT                   RALRHRYPSLPITVTTMTPTGSERVQSAFGKDVHHVYLPYDLPGSVNRFLDQVNPKLVI
FT                   IMETELWPNLINTLHRRKIPLVIANARLSARSAAGYKKIGSFIRTILQRITLIAAQNQE
FT                   DGDRFIELGLKRSQLTVTGSLKFDISVTPELAARAVTLRRQWAPHRPVWIATSTHDGEE
FT                   TILLEAHRQLLQQFPTLLLILVPRHPERFGKAVELTQKIGLSYTLRSKGEVPSSSTQVV
FT                   IGDTMGELMLLYGIADLAFVGGSLVERGGHNPLEAAAHAIPVLMGPHTFNFKDICAKLE
FT                   QAEGLITVTDTLSLVKEITVLLTDEDFRLYYGRHAVDVLHENQGALQRLLHLLEPYLPQ
FT                   RSH"
FT   gene            complement(66745..67734)
FT                   /gene="rfaC"
FT                   /locus_tag="YP_0057"
FT                   /old_locus_tag="YP0057"
FT   CDS_pept        complement(66745..67734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaC"
FT                   /locus_tag="YP_0057"
FT                   /old_locus_tag="YP0057"
FT                   /product="lipopolysaccharide heptosyltransferase-1"
FT                   /note="similar to Yersinia pestis KIM rfaC and similar to
FT                   Yersinia pestis CO92 rfaC (residues 9 to 329 of 329 are
FT                   similar to residues 1 to 321 of 321 from Yersinia pestis
FT                   CO92 rfaC). Contains Glycosyl transferase, family 9
FT                   (Interpro|IPR002201)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60338"
FT                   /db_xref="GOA:Q8D1S3"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011908"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1S3"
FT                   /protein_id="AAS60338.1"
FT                   /translation="MLSQRGRLMHVLIVKTSSMGDVLHTLPALTDAMNAIPGIRFDWVV
FT                   EEGFSQIPSWHPAVDKVIPVAIRRWRKNWFGSDTRQERCDFKRVVQQRSYDRVIDAQGL
FT                   IKSAALITRIAKGTKHGPDCKSAREPFASWFYNCRHEIDTKQHAVERIRQLFAKSLGYD
FT                   KPESYGDYAIAQRFLNQLPADAGQYLVFLHATTRDNKHWPESHWVQLIELVQPTGLKIK
FT                   LPWGAEHEHQRALRLAEHFPHVEVLPKLSLQQVAEVLAGAKAVVSVDTGLSHLTAALDR
FT                   PNITLFGPTDPGLIGGYGKNQIAVISEQKKMDSLSAPTIMARLETLIS"
FT   gene            complement(67710..68786)
FT                   /gene="rfaF"
FT                   /locus_tag="YP_0058"
FT                   /old_locus_tag="YP0058"
FT   CDS_pept        complement(67710..68786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaF"
FT                   /locus_tag="YP_0058"
FT                   /old_locus_tag="YP0058"
FT                   /product="ADP-heptose--LPS heptosyltransferase II"
FT                   /note="similar to Yersinia pestis CO92 rfaF and Yersinia
FT                   pestis KIM rfaF. Contains Glycosyl transferase, family 9
FT                   (Interpro|IPR002201)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60339"
FT                   /db_xref="GOA:Q8D1S4"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1S4"
FT                   /protein_id="AAS60339.1"
FT                   /translation="MINGMKILVIGPSWVGDMMMSQSLYRTLKAEYPAADIDVMAPAWC
FT                   RPLLARMPEVRHAIPMPLGHGAFAFEERRRLGLALRETEYDRAYVLPNSFKSALIPYFS
FT                   GIKRRIGWRGEMRYFLLNDLRILDKQAFPMMVQRYVALAYDKERIRSAADLPQPLLWPQ
FT                   LQVRDEEIAETTASFNLTDNRPIIGFCPGAEFGPAKRWPHYHYATLAQKLIDDGYQVIL
FT                   FGSAKDNEAGEDIRQALSDTDREYCLNLAGQTSLEQAVVLIAACSAVVSNDSGLMHVAA
FT                   ALNKPLVALYGPSSPDFTPPLSEKATVIRLITGYHKVRKGDSAQGYHQSLIDIQPEHVM
FT                   AALEKQLATQECSVKGGD"
FT   gene            complement(68805..69746)
FT                   /gene="rfaD"
FT                   /locus_tag="YP_0059"
FT                   /old_locus_tag="YP0059"
FT   CDS_pept        complement(68805..69746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaD"
FT                   /locus_tag="YP_0059"
FT                   /old_locus_tag="YP0059"
FT                   /product="ADP-L-glycero-D-manno-heptose-6-epimerase"
FT                   /note="similar to Yersinia pestis CO92 rfaD and Yersinia
FT                   pestis KIM rfaD. Contains NAD binding site
FT                   (Interpro|IPR000205). Contains NAD-dependent
FT                   epimerase/dehydratase (Interpro|IPR001509, (GO:0009225))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60340"
FT                   /db_xref="GOA:Q8ZJN4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJN4"
FT                   /protein_id="AAS60340.1"
FT                   /translation="MNTMIIVTGGAGFIGSNIVKALNNIGYKDILVVDNLKDGTKFVNL
FT                   VDLDIADYMDKEDFVASIVAGDDMGDIDAIFHEGACSSTTEWDGKYMMDNNYQYSKDIL
FT                   HFCLDRSIPFLYASSAATYGGRTDNFIEDRQYEQPLNVYGYSKFLFDQYVREILPQADS
FT                   QICGFRYFNVYGPREGHKGSMASVAFHLNNQINAGERPKLFAGSENFKRDFIYVGDVAD
FT                   VNLWFWQNGVSGIFNCGTGRAESFQAVADAVVDYHQSGPVEYIEFPEKLKGRYQAYTQA
FT                   DLTKLRAAGYGKPFKTVAEGVKEYLAWLNRSV"
FT   gene            69953..71194
FT                   /gene="kbl"
FT                   /locus_tag="YP_0060"
FT                   /old_locus_tag="YP0060"
FT   CDS_pept        69953..71194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kbl"
FT                   /locus_tag="YP_0060"
FT                   /old_locus_tag="YP0060"
FT                   /product="2-amino-3-ketobutyrate coenzyme A ligase"
FT                   /note="similar to Yersinia pestis CO92 kbl and Yersinia
FT                   pestis KIM kbl. Contains Aminotransferase, class-II
FT                   (Interpro|IPR001917, (GO:0008152), (GO:0016740)). Contains
FT                   Aminotransferase, class I and II (Interpro|IPR004839,
FT                   (GO:0009058))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60341"
FT                   /db_xref="GOA:A0A0H2W2A9"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011282"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W2A9"
FT                   /protein_id="AAS60341.1"
FT                   /translation="MQLPILEITEMSLPCNKHPFYQQLEQQLDTTRTEGLYKNERVITS
FT                   AQQANIAVADGSRVINFCANNYLGLANHPKLIAAAKAGMDSHGFGMASVRFICGTQDIH
FT                   KELEHKLASFLGMEDAILYSSCFDANGGLFETLLGPEDAIISDALNHASIIDGVRLCKA
FT                   KRYRYANNDMTELEAQLKQAKAEGARHIMIATDGVFSMDGVIANLKRVCDLADEYQALV
FT                   MVDDSHAVGVIGANGRGTHEYCEVMDRVDIITGTLGKALGGASGGYTAGRKELVEWLRQ
FT                   RSRPYLFSNSLAPAIVAASIEVLSLLEEGGALRDRIWANARLFREKMSAAGFTLAGADH
FT                   AIIPVMLGEAKLAQDFANALLKEGIYVTGFFFPVVPKGQARIRTQMSAGHTTEQVERAI
FT                   EAFVRIGKQLNVIA"
FT   gene            71204..72229
FT                   /gene="tdh1"
FT                   /locus_tag="YP_0061"
FT                   /old_locus_tag="YP0061"
FT   CDS_pept        71204..72229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdh1"
FT                   /locus_tag="YP_0061"
FT                   /old_locus_tag="YP0061"
FT                   /product="threonine 3-dehydrogenase"
FT                   /note="similar to Yersinia pestis CO92 tdh and Yersinia
FT                   pestis KIM tdh. Contains NAD binding site
FT                   (Interpro|IPR000205). Contains Zinc-containing alcohol
FT                   dehydrogenase superfamily (Interpro|IPR002085,
FT                   (GO:0008270)). Contains Zinc-containing alcohol
FT                   dehydrogenase (Interpro|IPR002328, (GO:0008270)). Contains
FT                   L-threonine 3-dehydrogenase (Interpro|IPR004627,
FT                   (GO:0008270), (GO:0008743))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60342"
FT                   /db_xref="GOA:Q8ZJN2"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR004627"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJN2"
FT                   /protein_id="AAS60342.1"
FT                   /translation="MKALSKLKAEEGIWMTDVPQPELGHNDIMIKIRKTAICGTDVHIY
FT                   NWDEWSQKTIPVPMVVGHEYVGEVVAIGQEVKGFNIGDRVSGEGHITCGHCRNCRGGRT
FT                   HLCRNTVGVGVNRPGSFAEYLVIPAFNAFKIPDNISDELAAIFDPFGNAVHTALSFDLV
FT                   GEDVLVSGAGPIGIMAAAVCKHVGARHVVIADVNEYRLDLARKMGVTRAVNVSKENLND
FT                   VMTELGMTEGFDVGLEMSGAPPAFRSLLNSMNHGGRIAMLGIPPSDMSIDWNQVIFKGL
FT                   FIKGIYGREMFETWYKMAALIQSGLDLTPIITHRFPIDEFQQGFDAMRSGKSGKVVLSW
FT                   D"
FT   gene            complement(72367..73301)
FT                   /pseudo
FT                   /locus_tag="YP_0062"
FT                   /old_locus_tag="YP0062"
FT                   /note="similar to gi|16766991|ref|NP_462606.1| (NC_003197)
FT                   putative periplasmic protein [Salmonella typhimurium LT2]
FT                   (len:320 aa).There is a frameshift after codon 97. The
FT                   sequece has been checked and believed to be correct.
FT                   Contains Protein of unknown function DUF610
FT                   (Interpro|IPR006837)"
FT   gene            complement(73325..74695)
FT                   /gene="nlpD1"
FT                   /locus_tag="YP_0063"
FT                   /old_locus_tag="YP0063"
FT   CDS_pept        complement(73325..74695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nlpD1"
FT                   /locus_tag="YP_0063"
FT                   /old_locus_tag="YP0063"
FT                   /product="putative membrane protein"
FT                   /note="similar to Yersinia pestis KIM y0078 and similar to
FT                   Yersinia pestis CO92 YPO0063. Contains Tropomyosin
FT                   (Interpro|IPR000533). Contains Peptidase M23/M37
FT                   (Interpro|IPR002886, (GO:0006508))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60343"
FT                   /db_xref="GOA:A0A3N4AWR1"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AWR1"
FT                   /protein_id="AAS60343.1"
FT                   /translation="MKDRELLAKSITTKDAVSDGRESPSLLSDKLSRLPWSTLYASVFC
FT                   AGVLLLPFSGQAVEPPVAAKASENKNQLKTLQQDIAEKEKSVQQQKKQRSSLLDQLKQQ
FT                   ENTISQTSRSLRETQATLAELSKDIASLTTSIEKLQNQQSQQQSILSKQLAAAFKQGKH
FT                   SSLQLILSGEESQRSERILAYFSYLNEARQKAIEELKQTRTTLSAEKKMLEQKQNQHKA
FT                   LLDEQKAQQQKLEQARIARQKTLTSLEASLEKDQQSLAELKLNESRLRDQIAKAEREAK
FT                   ARAEREAKEAARVREQVKVKEQQAKKTGSSYKPSESERSLMARTGGLGRPGGQALWPVR
FT                   GNVSHRFGEPLQGELRWKGMVITAPEGSEVKAIADGRVLLADWLQGYGLVVVIEHGKGD
FT                   MSLYGYNQSALVNVGAQVKAGQPIALVGTSGGQGEPSLYFEIRRQGQAVNPQPWLGR"
FT   gene            complement(74705..76252)
FT                   /gene="gpmI"
FT                   /locus_tag="YP_0064"
FT                   /old_locus_tag="YP0064"
FT   CDS_pept        complement(74705..76252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmI"
FT                   /locus_tag="YP_0064"
FT                   /old_locus_tag="YP0064"
FT                   /product="2,3-bisphosphoglycerate-independent
FT                   phosphoglycerate mutase"
FT                   /note="similar to Yersinia pestis CO92 YPO0064 and Yersinia
FT                   pestis KIM y0077. Contains Phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent (Interpro|IPR005995,
FT                   (GO:0006007)). Contains Metalloenzyme (Interpro|IPR006124,
FT                   (GO:0005505))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60344"
FT                   /db_xref="GOA:Q8ZJN0"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJN0"
FT                   /protein_id="AAS60344.1"
FT                   /translation="MSSTKKPLVLTILDGYGHREEQQDNAILNAKTPVMDVLWQQQPHT
FT                   LIAASGLDVGLPDGQMGNSEVGHVNLGAGRIVYQDLTRLDKEIKEGDFFTNPTLTAAVD
FT                   NAVKTGKAVHIMGLLSAGGVHSHEDHIMAMVELAAKRGATAIYLHAFLDGRDTPPRSAE
FT                   SSLKRFTAKFAELGNGRIASIIGRYYAMDRDNRWDRVQLAYDLLTQAKGEFTADNAVAG
FT                   LQAAYARGENDEFVKPTVIQATGEADAAMNEGDTLIFMNFRADRARQITRTFVNAEFDG
FT                   FKRDKVVNFGDFIMLTEYAADIKVACAYPPASLTNTFGEWLMKHDKTQLRISETEKYAH
FT                   VTFFYNGGVEEPFKGEDRILINSPKVATYDLQPEMSSAELTEKLVSAIGSGKYDVIICN
FT                   YPNGDMVGHTGDYDAAVKAVETLDNCIEQVVAAVKAADGQLLITADHGNAEQMRDPATG
FT                   QAHTAHTSLPVPLIYVGNKAVKAVEGGKLSDIAPTMLSLMEMEIPQEMTGKPLFIVE"
FT   gene            76649..77083
FT                   /gene="pspE1"
FT                   /locus_tag="YP_0065"
FT                   /old_locus_tag="YP0065"
FT   CDS_pept        76649..77083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pspE1"
FT                   /locus_tag="YP_0065"
FT                   /old_locus_tag="YP0065"
FT                   /product="putative membrane protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0065 and Yersinia
FT                   pestis KIM y0076. Contains Rhodanese-like
FT                   (Interpro|IPR001763)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60345"
FT                   /db_xref="GOA:A0A3N4AZG0"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AZG0"
FT                   /protein_id="AAS60345.1"
FT                   /translation="MLQEIMQFISQHPILSLAWVLLFGAVVFTSFKNSLSKVKEVTRGE
FT                   ATRLINKEDAVVVDIRTREDYRKGHIANSINLIPSDIKNGNLGELEKHKTQPIIVVCAM
FT                   GTTSRASADMLSKAGFERVFTLKEGISGWSGENLPLARGK"
FT   gene            77202..77450
FT                   /gene="grxC"
FT                   /locus_tag="YP_0066"
FT                   /old_locus_tag="YP0066"
FT   CDS_pept        77202..77450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grxC"
FT                   /locus_tag="YP_0066"
FT                   /old_locus_tag="YP0066"
FT                   /product="glutaredoxin"
FT                   /note="similar to Yersinia pestis CO92 grxC and Yersinia
FT                   pestis KIM grxC. Contains Glutaredoxin (Interpro|IPR002109,
FT                   (GO:0006118), (GO:0009491))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60346"
FT                   /db_xref="GOA:A0A3N4AY38"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AY38"
FT                   /protein_id="AAS60346.1"
FT                   /translation="MAKIEMYTKATCPFCHRAKALLNAKGAAFHEIAIDNDPAKREEMI
FT                   ARSGRTTVPQIFIDGQHIGGCDDLHALDARGGLDPLL"
FT   gene            77538..78014
FT                   /gene="secB"
FT                   /locus_tag="YP_0067"
FT                   /old_locus_tag="YP0067"
FT   CDS_pept        77538..78014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="YP_0067"
FT                   /old_locus_tag="YP0067"
FT                   /product="protein-export protein"
FT                   /note="similar to Yersinia pestis CO92 secB and Yersinia
FT                   pestis KIM secB. Contains Bacterial protein export
FT                   chaperone SecB (Interpro|IPR003708, (GO:0015031))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60347"
FT                   /db_xref="GOA:Q8ZJM7"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJM7"
FT                   /protein_id="AAS60347.1"
FT                   /translation="MSEQNNTEMAFQIQRIYTKDISFEAPNAPQVFQQDWQPEVKLDLD
FT                   TASSQLAEDVYEVVLRVTVTASLGEETAFLCEVQQGGIFSVAGIEGTQLAHCLGAYCPN
FT                   ILFPYARECITSLVSRGTFPQLNLAPVNFDALFMNYLQQQAEGEVEGVEQRQDA"
FT   gene            78014..79033
FT                   /gene="gpsA"
FT                   /locus_tag="YP_0068"
FT                   /old_locus_tag="YP0068"
FT   CDS_pept        78014..79033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="YP_0068"
FT                   /old_locus_tag="YP0068"
FT                   /product="glycerol-3-phosphate dehydrogenase"
FT                   /note="similar to Yersinia pestis CO92 gpsA and Yersinia
FT                   pestis KIM gpsA"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60348"
FT                   /db_xref="GOA:Q8ZJM6"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJM6"
FT                   /protein_id="AAS60348.1"
FT                   /translation="MNTNPASMAVIGAGSYGTALAITLARNGHQVVLWGHDPKHIQQLQ
FT                   QDRCNRAFLPDAAFPDTLRLETDLACALAASRDVLVVVPSHVFGAVLHQLKPHLRKDAR
FT                   IVWATKGLEAETGRLLQDVAREVLGEAIPLAVISGPTFAKELAAGLPTAIALASTDVQF
FT                   SEDLQQLLHCGKSFRVYSNPDFIGVQLGGAVKNVIAIGAGMSDGIGFGANARTALITRG
FT                   LAEMTRLGTALGADPSTFMGMAGLGDLVLTCTDNQSRNRRFGIMLGQGLGVKEAQDNIG
FT                   QVVEGYRNTKEVLALAQRHGVEMPITEQIYQVLYCHKNAREAALTLLGRTKKDEKIGI"
FT   gene            79296..80120
FT                   /gene="cysE"
FT                   /locus_tag="YP_0070"
FT                   /old_locus_tag="YP0070"
FT   CDS_pept        79296..80120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="YP_0070"
FT                   /old_locus_tag="YP0070"
FT                   /product="serine acetyltransferase"
FT                   /note="similar to Yersinia pestis CO92 cysE and Yersinia
FT                   pestis KIM cysE. Contains Bacterial transferase hexapeptide
FT                   repeat (Interpro|IPR001451). Contains Serine
FT                   O-acetyltransferase (Interpro|IPR005881, Cellular
FT                   Component: cytoplasm (GO:0005737), (GO:0006535),
FT                   (GO:0009001))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60350"
FT                   /db_xref="GOA:Q8D1S7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1S7"
FT                   /protein_id="AAS60350.1"
FT                   /translation="MMSSEELEQVWSNIKSEARALAECEPMLASFFHATLLKHENLGSA
FT                   LSYILANKLANPIMPAIAIREVVEEAYRSDAHMIVSAARDILAVRLRDPAVDKYSTPLL
FT                   YLKGFHALQAYRIGHWLWAQDRKALAIYLQNQVSVAFGVDIHPAATIGCGIMLDHATGI
FT                   VIGETAVVENDVSILQSVTLGGTGKTSGDRHPKIREGVMIGAGAKILGNIEVGRGAKIG
FT                   AGSVVLQSVPAHTTAAGVPARIVGKPESDKPSLDMDQHFNGSIQGFEYGDGI"
FT   gene            complement(80243..80731)
FT                   /gene="cspR"
FT                   /locus_tag="YP_0071"
FT                   /old_locus_tag="YP0071"
FT   CDS_pept        complement(80243..80731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspR"
FT                   /locus_tag="YP_0071"
FT                   /old_locus_tag="YP0071"
FT                   /product="putative methyltransferase"
FT                   /note="similar to Yersinia pestis CO92 YPO0071 and Yersinia
FT                   pestis KIM y0071. Contains tRNA/rRNA methyltransferase
FT                   (SpoU) (Interpro|IPR001537, (GO:0008173)). Contains RNA
FT                   methyltransferase TrmH family, group 2 (Interpro|IPR004440,
FT                   (GO:0009451))."
FT                   /db_xref="EnsemblGenomes-Gn:YP_0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60351"
FT                   /db_xref="GOA:Q74Y93"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="PDB:3N4J"
FT                   /db_xref="PDB:3N4K"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q74Y93"
FT                   /protein_id="AAS60351.1"
FT                   /translation="MLNIVLFEPEIPPNTGNIIRLCANTGCQLHLIKPLGFTWDDKRLR
FT                   RAGLDYHEFADIKHHHDYQAFLDSEKLDSTQPARLFALTTKGTPAHSAVSYQANDYLLF
FT                   GPETRGLPAYILDALPAQQKIRIPMQADSRSMNLSNAVSVVVYEAWRQLGYPGALLKE"
FT   gene            80920..81984
FT                   /gene="ada"
FT                   /locus_tag="YP_0072"
FT                   /old_locus_tag="YP0072"
FT   CDS_pept        80920..81984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ada"
FT                   /locus_tag="YP_0072"
FT                   /old_locus_tag="YP0072"
FT                   /product="bifunctional regulatory protein/DNA repair
FT                   protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0072 and Yersinia
FT                   pestis KIM ada. Contains Helix-turn-helix, AraC type
FT                   (Interpro|IPR000005, (GO:0006355)). Contains
FT                   Methylated-DNA-[protein]-cysteine S-methyltransferase
FT                   (Interpro|IPR001497, (GO:0006281)). Contains Metal binding
FT                   domain of Ada (Interpro|IPR004026, (GO:0008270))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60352"
FT                   /db_xref="GOA:A0A3N4BK88"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR016221"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BK88"
FT                   /protein_id="AAS60352.1"
FT                   /translation="MNNVKDPRWAAIINRDKTADGQFVYAVKTTGIYCRPSCPSRRAKA
FT                   ENIEFFIDNTAAEQAGYRPCKRCQPTQLSRAQQQVEKISQACRLIELAETPPKLNELAA
FT                   QLGLSTFYFHRLFKAITGLTPKGYANATRSERIRAQLSHGGSVTDAIFEAGYNSSSRFY
FT                   AQSQQLLGMTPTRYRKGGCDARLHFAVGESSLGAILVAKSELGVCAILLGDDPVRLVQQ
FT                   LQDKFPQANLVGGDAEFEQWVAQVVGCVEAPKLGLNLPLDIRGTAFQQRVWQALREIPI
FT                   GETASYADIASRIGSPTAVRAVAGACAANILAVAIPCHRVIRQDGALSGYRWGVERKRL
FT                   LLEREGVEKEAEDH"
FT   gene            complement(82033..83409)
FT                   /gene="cpxA"
FT                   /locus_tag="YP_0073"
FT                   /old_locus_tag="YP0073"
FT   CDS_pept        complement(82033..83409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpxA"
FT                   /locus_tag="YP_0073"
FT                   /old_locus_tag="YP0073"
FT                   /product="two component sensor kinase"
FT                   /note="similar to Yersinia pestis CO92 cpxA and Yersinia
FT                   pestis KIM cpxA. Contains ATP-binding region, ATPase-like
FT                   (Interpro|IPR003594, (GO:0005524)). Contains Histidine
FT                   kinase, HAMP region (Interpro|IPR003660, (GO:0016020)).
FT                   Contains Histidine kinase A, N-terminal
FT                   (Interpro|IPR003661, (GO:0016020)). Contains Bacterial
FT                   sensor protein, C-terminal (Interpro|IPR004358,
FT                   (GO:0007165)). Contains Histidine kinase
FT                   (Interpro|IPR005467, (GO:0007165), (GO:0016301))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60353"
FT                   /db_xref="GOA:A0A380PI87"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR032404"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038515"
FT                   /db_xref="UniProtKB/TrEMBL:A0A380PI87"
FT                   /protein_id="AAS60353.1"
FT                   /translation="MINSLTTRIFAIFWFTLALVLMLVLMVPKLDSRQLTVLLDSEQRQ
FT                   GTMLEQHIEAELANDPANDLMWWRRLHRAIEKWAPPGQHLILVTSEGRIIGVQRQEVQM
FT                   VRNFIGQSDNADQPKKKKYGRVEMVGPFSIRDGEDNYQLYLIRPANSPQSDFINLMFDR
FT                   PLLLLIATMLISAPLLLWLAWSLAKPARKLKNAADDVARGNLKQHPELESGPQEFLATG
FT                   ASFNQMISSLDRMVVAQQRLISDISHELRTPLTRLQLATALMRRRHGEGKELERIEMEA
FT                   QRLDSMINDLLVLSRSQHKNELHREPIKADELWSDVLENAQFEAEQMGKTLVVTAPPGP
FT                   WPLFCNPAALDSALENIVRNALRYSHHHIAVAFSIDNQGVTIIVDDDGPGVSPEDREQI
FT                   FRPFYRTDEARDRASGGTGLGLAIVETAVSQHRGWVKAEDSPLGGLRLIVWLPLHPLKS
FT                   "
FT   gene            complement(83406..84128)
FT                   /gene="cpxR1"
FT                   /locus_tag="YP_0074"
FT                   /old_locus_tag="YP0074"
FT   CDS_pept        complement(83406..84128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpxR1"
FT                   /locus_tag="YP_0074"
FT                   /old_locus_tag="YP0074"
FT                   /product="two component system response regulatory protein"
FT                   /note="similar to Yersinia pestis CO92 cpxR and Yersinia
FT                   pestis KIM cpxR. Contains Response regulator receiver
FT                   (Interpro|IPR001789, (GO:0006355)). Contains
FT                   Transcriptional regulatory protein, C terminal
FT                   (Interpro|IPR001867, (GO:0006355)). Contains Response
FT                   regulator receiver (Interpro|IPR001789, (GO:0006355)).
FT                   Contains Transcriptional regulatory protein, C terminal
FT                   (Interpro|IPR001867, (GO:0006355))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60354"
FT                   /db_xref="GOA:Q8D1S9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1S9"
FT                   /protein_id="AAS60354.1"
FT                   /translation="MRQRGEITMHKILLVDDDRELTSLLKELLEMEGFNVVVAYDGEQA
FT                   LSQLDSSIDLLLLDIMMPRKNGIETLKELRQHHQTPVIMLTARGSELDRVLGLELGADD
FT                   YLAKPFNDRELVARIRAILRRSNWSEQQQNAEQGAPTLEVDCLQLNPGRQEASFEGQPL
FT                   ELTGTEFTLLYLLAQHLGQVVSREHLSQEVLGKRLTPFDRAIDMHISNLRRKLPDRKDG
FT                   LPWFKTLRGRGYLMVSET"
FT   gene            84278..84766
FT                   /gene="cpxP"
FT                   /locus_tag="YP_0075"
FT                   /old_locus_tag="YP0075"
FT   CDS_pept        84278..84766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpxP"
FT                   /locus_tag="YP_0075"
FT                   /old_locus_tag="YP0075"
FT                   /product="putative exported protein"
FT                   /note="similar to Yersinia pestis CO92 cpxP and Yersinia
FT                   pestis KIM y0066."
FT                   /db_xref="EnsemblGenomes-Gn:YP_0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60355"
FT                   /db_xref="GOA:A0A3N4AZG7"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AZG7"
FT                   /protein_id="AAS60355.1"
FT                   /translation="MRKVTTLVMASMFVLGSSAAFAADNTKVTEGYHGDGKMMMNKKGD
FT                   RGHHNMFDGINLTEQQRQQMRDLMRQSHQSQPRLDLEDREAMHKLITADKFDEAAVRAQ
FT                   AEKMSQNQIERHVEMAKVRNQMYNLLTPEQKEALNKKHQERIEKLQQKPAAQPSSAQK"
FT   gene            85223..85399
FT                   /locus_tag="YP_0076"
FT                   /old_locus_tag="YP0076"
FT   CDS_pept        85223..85399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0076"
FT                   /old_locus_tag="YP0076"
FT                   /product="hypothetical protein"
FT                   /note="similar to Yersinia pestis KIM y0063."
FT                   /db_xref="EnsemblGenomes-Gn:YP_0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60356"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLW5"
FT                   /protein_id="AAS60356.1"
FT                   /translation="MPSLLASTLQISPLYECINVLTDAVTINNQETDIQQLVACKHYRV
FT                   ALMRTHAAPKSPQ"
FT   gene            85444..86403
FT                   /locus_tag="YP_0077"
FT                   /old_locus_tag="YP0077"
FT   CDS_pept        85444..86403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0077"
FT                   /old_locus_tag="YP0077"
FT                   /product="hypothetical protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0076 and Yersinia
FT                   pestis KIM y0062. Contains Putative transposase, YhgA-like
FT                   (Interpro|IPR006842)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60357"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WKL8"
FT                   /protein_id="AAS60357.1"
FT                   /translation="MIAQEDAHDYHRPMKTTPTPHDALFKNFMTQPATACDLLEFHLPP
FT                   ELRQLCDLSTLRLESGSFIENNLRACYSDVLYSLKTTVGDGYVYALIEHQSSPDKHMAF
FT                   RLMRYAIAAMQSHLEAGYDKLPLVIPILFYHGMVTPYPYPMSWLHAFNQPELAGQLYCG
FT                   NFPLVDVTVIPDHEIMTHRRIALLELLQKHIRQRDLSELLDQLVILIASGYTTEDQLKS
FT                   AINYIIQVGETAEPEVFIRSLAHRLPEHEESLMTIAQKLEQKGEARGIVKGRVEGRVEG
FT                   AQETALKIARTMLANGLDRATVMKMTGLSEEELTQIHH"
FT   gene            complement(86471..86593)
FT                   /locus_tag="YP_0078"
FT                   /old_locus_tag="YP0078"
FT   CDS_pept        complement(86471..86593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0078"
FT                   /old_locus_tag="YP0078"
FT                   /product="putative transposase"
FT                   /note="similar to Yersinia pestis KIM y0061."
FT                   /db_xref="EnsemblGenomes-Gn:YP_0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60358"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1T0"
FT                   /protein_id="AAS60358.1"
FT                   /translation="MIFIDDNIIRTHQHGTGAVSESDESIKKHRGVTRQKLISR"
FT   gene            86965..87867
FT                   /gene="mMT11"
FT                   /locus_tag="YP_0079"
FT                   /old_locus_tag="YP0079"
FT   CDS_pept        86965..87867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mMT11"
FT                   /locus_tag="YP_0079"
FT                   /old_locus_tag="YP0079"
FT                   /product="putative integral membrane protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0077 and Yersinia
FT                   pestis KIM y0060. Contains Cation efflux protein
FT                   (Interpro|IPR002524, (GO:0006812), (GO:0016020))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60359"
FT                   /db_xref="GOA:Q8ZJL7"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR023783"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJL7"
FT                   /protein_id="AAS60359.1"
FT                   /translation="MDPQYARWVKAAALSATALASILLIIKIFAWWHTGSVSLLAALVD
FT                   SLVDLAASLTNLFVVRYSLQPADEEHTFGHGKAESLAALAQSMFISGSALFLFLTGFRH
FT                   LASPEPLQDPSIGIGVTLVALFSTLILVTFQRWVVRKTHSQAIRADMLHYQSDVLMNGA
FT                   ILIALALSWYGFRRADALFALGIGVYILYSALRMGYEAVQSLLDRALPDDERQQIIDIV
FT                   TSWPGVIGAHDLRTRRSGQTRFIQLHLEMEDMMPLMEAHVLAEQVEHALLYRFPGADVL
FT                   IHQDPCSVVPKERHAHWEL"
FT   gene            88085..89068
FT                   /gene="pfkA"
FT                   /locus_tag="YP_0080"
FT                   /old_locus_tag="YP0080"
FT   CDS_pept        88085..89068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfkA"
FT                   /locus_tag="YP_0080"
FT                   /old_locus_tag="YP0080"
FT                   /product="6-phosphofructokinase"
FT                   /note="similar to Yersinia pestis CO92 pfkA and Yersinia
FT                   pestis KIM pfkA. Contains Phosphofructokinase
FT                   (Interpro|IPR000023, (GO:0006096))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60360"
FT                   /db_xref="GOA:Q8ZJL6"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012828"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJL6"
FT                   /protein_id="AAS60360.1"
FT                   /translation="MVKKIGVLTSGGDAPGMNAAIRGVVRAALSAGLDVFGIEDGYLGL
FT                   YENRMKKLDRYSVSDMINRGGTFLGSARFPEFRDPEVRKVALKNMHERGIDGLVVIGGD
FT                   GSYAGADLLTKEGGIHCVGLPGTIDNDVAGTDYTIGFFTALETVVEAIDRLRDTSSSHQ
FT                   RISIVEVMGRYCGDLTLAAAIAGGCEFIAIPEVEFKRDDLVAEIKAGIAKGKKHAIVAI
FT                   TEKLDDIDSLAKYIEKETGRETRGTVLGHIQRGGAPVAYDRILASRMGAYAVDLLLQDH
FT                   DYKKGGFCVGVQNEKMVHELISVCIAPENKKSKFKEDWYDTAKKLF"
FT   gene            89256..90278
FT                   /gene="sbp"
FT                   /locus_tag="YP_0081"
FT                   /old_locus_tag="YP0081"
FT   CDS_pept        89256..90278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbp"
FT                   /locus_tag="YP_0081"
FT                   /old_locus_tag="YP0081"
FT                   /product="exported sulfate-binding protein"
FT                   /note="similar to Yersinia pestis KIM sbp. Contains
FT                   Prokaryotic sulfate-/thiosulfate-binding protein
FT                   (Interpro|IPR000957, (GO:0030288)). Contains
FT                   Thiosulphate-binding protein (Interpro|IPR005669,
FT                   (GO:0008272), (GO:0030288)). Contains Bacterial
FT                   extracellular solute-binding protein, family 1
FT                   (Interpro|IPR006059, (GO:0006810))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60361"
FT                   /db_xref="GOA:Q8D1T1"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1T1"
FT                   /protein_id="AAS60361.1"
FT                   /translation="MITIIFLRSGSMRKWGVGLSLLVLASGAMAKDIQLLNVSYDPTRE
FT                   FYQEYNQAFSKYWQQQTGDKVTVRQSHGGSGKQATSVINGIEADVVTLALAYDVDAIAE
FT                   RGRIDKNWIKRLPDNSAPYTSTIVFLVRKGNPKQIHDWSDLVKPGTSVITPNPKTSGGA
FT                   RWNYLAAWGYALEHNNNDQAKAQEFVNALYKNVEVLDSGARGATNTFVERGIGDVLIAW
FT                   ENEALLAVNEVGNGQFDIVTPSVSILAEPTVSVVDKVVDKRGTRDVADAYLKYLYSPEG
FT                   QTIAAKNYYRPRDPVVAAKFAKEFPQLKLFTIDEVFGGWTQAQKTHFATGGVFDEISKR
FT                   "
FT   gene            complement(90528..91346)
FT                   /gene="modA1"
FT                   /locus_tag="YP_0082"
FT                   /old_locus_tag="YP0082"
FT   CDS_pept        complement(90528..91346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modA1"
FT                   /locus_tag="YP_0082"
FT                   /old_locus_tag="YP0082"
FT                   /product="ABC-type molybdate transport system, periplasmic
FT                   component"
FT                   /note="similar to Yersinia pestis CO92 YPO0080 and Yersinia
FT                   pestis KIM modA."
FT                   /db_xref="EnsemblGenomes-Gn:YP_0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60362"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AWR8"
FT                   /protein_id="AAS60362.1"
FT                   /translation="MACLLAQYNSGDILMKYSNVIVSGLCMSMVSLATAAPTEVPSDEP
FT                   VTLRIISSMATRQFLTEVIAQFAQQSKYQVELESVGGVDATKRVEAGEAFDVVILSANA
FT                   IDKLIDSGKILPNSRIDLVKSGVAIAVKEGAQIMDVSSEETVKQAVLAANTIAYSTGPS
FT                   GVYLTEVFEHWGIAEQIKDRIVKVPPGVPVGSLVAKGEVELGFQQLSELLHLKGIIILG
FT                   PLPTDIQIMTHFSAGVPLKTNQQKAIKVLLDFLASPAATEAKIKNGMEPI"
FT   gene            complement(91422..92849)
FT                   /gene="citT1"
FT                   /locus_tag="YP_0083"
FT                   /old_locus_tag="YP0083"
FT   CDS_pept        complement(91422..92849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citT1"
FT                   /locus_tag="YP_0083"
FT                   /old_locus_tag="YP0083"
FT                   /product="putative membrane transport protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0081 and Yersinia
FT                   pestis KIM y0056. Contains Sodium/sulphate symporter
FT                   (Interpro|IPR001898, (GO:0016020))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60363"
FT                   /db_xref="GOA:A0A3N4AWR9"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AWR9"
FT                   /protein_id="AAS60363.1"
FT                   /translation="MKNKIWKLCILVMIPLVIWFIPPPEGLTELSWRLSGFYLAAICGL
FT                   ILKPFSEAVVLLGVVGFAGFFLNNTSQILVGYATSTVWLVFAAFGISISFVKTGLGRRI
FT                   AFHMIRFCGSTTLRLGYVTAFLEFVISPVTPSNTARSGGIVFPIILSVVKALGSEPGDT
FT                   AKKAGSYLMSNIYFVMKVSSFMFITAMAPNLLAADFAAKILGIHLDWGVWALAMVVPGL
FT                   LLLLIVPAVGYYLDKPELKKVDNKKIADEGLAELGPITRNEKLLVGIFISALLGWALPS
FT                   LLGQLFGITLKIDATAVAIMAMALCILLGVIKWDDVLQNKGAWNTLLWFGGIIGLASAL
FT                   SKEKVFDWLANLIQNNVDFGHNPFIALTIIGFLSIIIRYFFASASSYAIAMLPVFLTVG
FT                   KVAGADPMALALVLAATNSYGGALTHYGGGSAPIIFGAGYNNVKQWWASGAVIATVCFI
FT                   VTMTVGYVWWQFLGFVK"
FT   gene            complement(92915..95587)
FT                   /pseudo
FT                   /locus_tag="YP_0084"
FT                   /old_locus_tag="YP0084"
FT                   /note="similar to Yersinia pestis CO92 YPO0082 and
FT                   Yersiniapestis KIM y0055; disrupted by the insertion of an
FT                   IS100 element"
FT   gene            complement(93209..93988)
FT                   /gene="dnaC_2"
FT                   /locus_tag="YP_0085"
FT                   /old_locus_tag="YP0085"
FT   CDS_pept        complement(93209..93988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaC_2"
FT                   /locus_tag="YP_0085"
FT                   /old_locus_tag="YP0085"
FT                   /product="insertion sequence IS100, ATP-binding protein"
FT                   /note="similar to Yersinia pestis CO92 YPO4009 and
FT                   Yersiniapestis KIM y4030. Contains Chaperonin clpA/B
FT                   (Interpro|IPR001270). Contains ATP/GTP-binding site motif A
FT                   (P-loop) (Interpro|IPR001687, (GO:0005524)). Contains
FT                   Bacterial chromosomal replication initiator protein, DnaA
FT                   (Interpro|IPR001957, (GO:0006275)). Contains IstB-like
FT                   ATP-binding protein (Interpro|IPR002611). Contains AAA
FT                   ATPase (Interpro|IPR003593, (GO:0000166))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60364"
FT                   /db_xref="GOA:A0A384L599"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L599"
FT                   /protein_id="AAS60364.2"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            complement(93988..95010)
FT                   /locus_tag="YP_0086"
FT                   /old_locus_tag="YP0086"
FT   CDS_pept        complement(93988..95010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0086"
FT                   /old_locus_tag="YP0086"
FT                   /product="transposase for insertion sequence IS100"
FT                   /note="similar to Yersinia pestis CO92 YPO4010 and Yersinia
FT                   pestis KIM y4031. Contains Integrase, catalytic domain
FT                   (Interpro|IPR001584, (GO:0006310)). Contains IS21-like
FT                   element transposase, HTH domain (Interpro|IPR007101)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60365"
FT                   /db_xref="GOA:A0A3N4B5E7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B5E7"
FT                   /protein_id="AAS60365.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            complement(95584..96405)
FT                   /locus_tag="YP_0087"
FT                   /old_locus_tag="YP0087"
FT   CDS_pept        complement(95584..96405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0087"
FT                   /old_locus_tag="YP0087"
FT                   /product="putative proteins, LmbE homologs"
FT                   /note="similar to Yersinia pestis CO92 YPO0083 and
FT                   Yersiniapestis KIM y0054. Contains LmbE-like protein
FT                   (Interpro|IPR003737)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60366"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLW6"
FT                   /protein_id="AAS60366.1"
FT                   /translation="MGNKTHYFPLIKPCQNPRQLKQQKKEKDMAMIPQKTALVVSAHSA
FT                   DFVWRAGGAIALHVEQGYQVHIVCLSYGERGESAKLWRKGDMTEERVKASRHTEAQAAA
FT                   NVLGASIEFFDMGDYPLRADKESLFRLADVFRRIQPHFVLTHSLADPYNYDHPLAANLA
FT                   QEARIIAQAEGYRPGEAIIGAPPVYCFEPHQPEQCGWKPDVLLDITSVWEKKYAAIQCM
FT                   AGQEHLWEYYTRVALQRGVQAKRNIGIASTKTIIHGEGYQSLFPRVTEDLS"
FT   gene            96398..97693
FT                   /gene="lysR1"
FT                   /locus_tag="YP_0088"
FT                   /old_locus_tag="YP0088"
FT   CDS_pept        96398..97693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysR1"
FT                   /locus_tag="YP_0088"
FT                   /old_locus_tag="YP0088"
FT                   /product="putative transcriptional regulator"
FT                   /note="similar to Yersinia pestis CO92 YPO0084 and Yersinia
FT                   pestis KIM y0053. Contains Bacterial regulatory protein
FT                   LysR, HTH motif (Interpro|IPR000847, (GO:0006355)).
FT                   Contains LysR substrate binding domain
FT                   (Interpro|IPR005119)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60367"
FT                   /db_xref="GOA:Q8D1T3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1T3"
FT                   /protein_id="AAS60367.1"
FT                   /translation="MPKRQVLFKLKKLNKITRRNMQKKNDRNSIKIMQIRAFCMTAEQG
FT                   AASLAALNLFRTQSAITRSIRDLEHTLAISLFERHAKGMLLTDLGNVILPRARSAMEEL
FT                   TRIPALLRRLQQRDDEGIEDLEPTWLFNERRLQIFLSLYRQQHALHVAQALDITQSAVS
FT                   AALKVLEKGAGMYLFHRTPKGMLPTPAGHEIAPCISRALNALHHIPEEITAHRGDLTGS
FT                   VRVGALPLSRARLLPQAMIKLISRHPGIKIVTNESGFTALIAELRAGDIDFIIGALRNE
FT                   KMLLDIHSEILFEEELILLARPNHPLSDRRVKNQELKDIQWVLPRNHAPSRHLLEVAFC
FT                   KMGLASPQPVVESGDPAVVRALLLGSDMVAAVSSHQLDFEVSEGILIPLQVNLTGTRRE
FT                   IGLMTRQKALNSPATDALINCVREVIQSSNDK"
FT   gene            complement(97925..98692)
FT                   /gene="tpiA"
FT                   /locus_tag="YP_0089"
FT                   /old_locus_tag="YP0089"
FT   CDS_pept        complement(97925..98692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpiA"
FT                   /locus_tag="YP_0089"
FT                   /old_locus_tag="YP0089"
FT                   /product="triosephosphate isomerase"
FT                   /note="similar to Yersinia pestis CO92 tpiA and Yersinia
FT                   pestis KIM tpiA. Contains Triosephosphate isomerase
FT                   (Interpro|IPR000652, (GO:0008152))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60368"
FT                   /db_xref="GOA:Q8ZJK9"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJK9"
FT                   /protein_id="AAS60368.1"
FT                   /translation="MRHPLVMGNWKLNGSTHMVNELIAGLRKELSTVDGCGVAIAPPAI
FT                   YLNQAKHELAGSRIALGAQNVDVNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHQE
FT                   SDELIAKKFGVLKEIGLIPVLCIGESEAENEAGQTEAVCAKQLDAVLNTLGVKAFEGAV
FT                   IAYEPIWAIGTGKSATPAQAQAVHKFIRDHIAKQDAAVAAQVIIQYGGSVNDKNAAELF
FT                   TQPDIDGALVGGASLKADAFAVIVKAAAKAKKA"
FT   gene            complement(98821..99456)
FT                   /locus_tag="YP_0090"
FT                   /old_locus_tag="YP0090"
FT   CDS_pept        complement(98821..99456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0090"
FT                   /old_locus_tag="YP0090"
FT                   /product="putative exported protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0086"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60369"
FT                   /db_xref="InterPro:IPR009918"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AY61"
FT                   /protein_id="AAS60369.1"
FT                   /translation="MRKEIVSMRIILLLAALLLITFMLITTINHAHADPTNDSSPPKEG
FT                   APPIAPYLLFNAPTFDLTLVKFRESYNRANPTLPINEFHAITVKEDSPPLTRAASKINE
FT                   NLYASTALEKGTGKIKTLQITYLPIKGNEEKTAKLLAINYMAALMRQFEPTLSVAQSLA
FT                   NVQKLLTEGKGSPFYAHTIGAIRYVVADNGEKGLTFAVEPIKLSLSEA"
FT   gene            99538..100038
FT                   /locus_tag="YP_0091"
FT                   /old_locus_tag="YP0091"
FT   CDS_pept        99538..100038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0091"
FT                   /old_locus_tag="YP0091"
FT                   /product="conserved membrane protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0087 and Yersinia
FT                   pestis KIM y0050."
FT                   /db_xref="EnsemblGenomes-Gn:YP_0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60370"
FT                   /db_xref="GOA:Q8D1T5"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1T5"
FT                   /protein_id="AAS60370.1"
FT                   /translation="MVSCDLEVHFAEIMLGKWICSSMTIQQWCFSFKGRIGRREFWIWM
FT                   GLWLLAMLVIFTLAGKEWLPIQSASFALVFLLWPTAAVVVKRLHDRNKAGWWALLAVLA
FT                   WMLMAGNWQMLTPIWQWGVGRFIPTLIFVMMFIDCGAFLGTEGDNRFGPEAVPVKFFAD
FT                   KAK"
FT   gene            complement(100379..101125)
FT                   /gene="fpr"
FT                   /locus_tag="YP_0092"
FT                   /old_locus_tag="YP0092"
FT   CDS_pept        complement(100379..101125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fpr"
FT                   /locus_tag="YP_0092"
FT                   /old_locus_tag="YP0092"
FT                   /product="ferredoxin--NADP reductase"
FT                   /note="similar to Yersinia pestis CO92 fpr and Yersinia
FT                   pestis KIM fpr. Contains TonB-dependent receptor protein
FT                   (Interpro|IPR000531, (GO:0016020)). Contains Phenol
FT                   hydroxylase reductase (Interpro|IPR001221, (GO:0006118)).
FT                   Contains Oxidoreductase FAD/NAD(P)-binding
FT                   (Interpro|IPR001433, (GO:0006118), (GO:0008246)). Contains
FT                   Flavoprotein pyridine nucleotide cytochrome reductase
FT                   (Interpro|IPR001709, (GO:0006118), (GO:0008246)). Contains
FT                   NADH:cytochrome b5 reductase (CBR) (Interpro|IPR001834,
FT                   (GO:0006118), (GO:0008246))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60371"
FT                   /db_xref="GOA:A0A0H2W0W3"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W0W3"
FT                   /protein_id="AAS60371.1"
FT                   /translation="MAEWVSGKITHIEHWTDALFSLQVNAPVDPFTAGQFAKLALDING
FT                   ERVQRAYSYVNAPSDHNLEFYLVTVPEGKLSPRLDQLSVGGEVMITKQAAGFFVLEEIP
FT                   DCDTLWMLATGTAIGPYLSILQEGQDLERFKHLVLVHAARFAHDLSYLPLMQQLEQRYN
FT                   GKLRIQTVVSREESPDSLTGRVPALIENGALEAAVGLKIDAKDSHVMLCGNPQMVRDTQ
FT                   QLLKEQREMRKHLRRKPGHMTSEQYW"
FT   gene            complement(101280..102398)
FT                   /gene="glpX"
FT                   /locus_tag="YP_0093"
FT                   /old_locus_tag="YP0093"
FT   CDS_pept        complement(101280..102398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpX"
FT                   /locus_tag="YP_0093"
FT                   /old_locus_tag="YP0093"
FT                   /product="fructose 1,6-bisphosphatase II"
FT                   /note="similar to Yersinia pestis KIM glpX. Contains GlpX
FT                   protein (Interpro|IPR004464, (GO:0006071))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60372"
FT                   /db_xref="GOA:Q8CLW7"
FT                   /db_xref="InterPro:IPR004464"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLW7"
FT                   /protein_id="AAS60372.1"
FT                   /translation="MRVKRVQLTPLRLQVRKVIEFLPIFSFSIPQSTGLTMKRELAIEF
FT                   SRVTEAAALAGYKWLGRGDKNAADGAAVQAMRIMLNQVNIDGRIVIGEGEIDEAPMLFI
FT                   GEHVGTGQGDAVDIAVDPIEGTRMTAMGQANALAVLAVGDQGTFLHAPDMYMEKLVVGP
FT                   AAKGAIDLNLPLEQNLCNIATALNKPLADLTVITLAKPRHDGIIAAMQQLGVKVFAIPD
FT                   GDVAASILTCMPESEVDVMYCIGGAPEGVISAAVIRALDGDMQGRLLPRHQVKGDSEDN
FT                   RRIGEQELLRCKSMGIEAGNVLQLGDMARNDNVIFSATGITKGDLLEGIYRKGNMATTE
FT                   TLLIRGKSRTIRRIRSTHFLDRKDPALHEFLL"
FT   gene            complement(102527..104050)
FT                   /gene="glpK1"
FT                   /locus_tag="YP_0094"
FT                   /old_locus_tag="YP0094"
FT   CDS_pept        complement(102527..104050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK1"
FT                   /locus_tag="YP_0094"
FT                   /old_locus_tag="YP0094"
FT                   /product="glycerol kinase"
FT                   /note="similar to Yersinia pestis KIM glpK. Contains
FT                   Carbohydrate kinase, FGGY (Interpro|IPR000577,
FT                   (GO:0005975)). Contains Glycerol kinase
FT                   (Interpro|IPR005999, (GO:0006072)). Contains Carbohydrate
FT                   kinase, FGGY (Interpro|IPR000577, (GO:0005975)). Contains
FT                   ATP/GTP-binding site motif A (P-loop) (Interpro|IPR001687,
FT                   (GO:0005524))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60373"
FT                   /db_xref="GOA:A0A0H2W035"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W035"
FT                   /protein_id="AAS60373.1"
FT                   /translation="MTTENTTQKKYIVALDQGTTSSRAVVLDHNANIVSVSQREFTQIY
FT                   PKAGWVEHDPMEIWATQSSTLIEVLAKAGINSDEIAGIGITNQRETTIVWDKVTGKPVY
FT                   NAIVWQCRRTADICEKLKKEGLEEYIRHNTGLVVDPYFSGTKVKWILDNVEGARERAER
FT                   GELLFGTVDTWLVWNMTQGRVHVTDYTNASRTMMFNIRTKEWDDRMLKALNIPRAMLPE
FT                   VRPSSEIYGKTNIGGKGGTRIPIAGIAGDQQAALFGQLCVQPGMAKNTYGTGCFLLMNT
FT                   GEEAVQSTHGLLTTIACGPRGEVNYALEGAVFIGGASIQWLRDELKLIGDATDSEYFAT
FT                   KVKNSNGVYVVPAFTGLGAPYWDPYARGAIFGLTRGVNSNHIIRATLESIAYQTRDVLD
FT                   AMQADSGARLKSLRVDGGAVANNFLMQFQADILGTRVERPAIRESTALGAAFLAGLATG
FT                   FWDDLDEVKSKASIEREFRPGIETTERDIRYKGWKKAVARARDWEEHDE"
FT   gene            complement(104227..105075)
FT                   /gene="glpF"
FT                   /locus_tag="YP_0095"
FT                   /old_locus_tag="YP0095"
FT   CDS_pept        complement(104227..105075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpF"
FT                   /locus_tag="YP_0095"
FT                   /old_locus_tag="YP0095"
FT                   /product="glycerol uptake facilitator protein"
FT                   /note="similar to Yersinia pestis CO92 glpF and Yersinia
FT                   pestis KIM glpF. Contains MIP family (Interpro|IPR000425,
FT                   (GO:0016020))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60374"
FT                   /db_xref="GOA:A0A3N4AWS2"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AWS2"
FT                   /protein_id="AAS60374.1"
FT                   /translation="MSQTASSTLKGQCIAEFLGTGLLIFFGAGCVAALKLAGASFGQWE
FT                   ISIIWGLGVAMAIYLTAAISGAHLNPAVTIALWLFACFERRKVLPYIVAQVAGAFCAAA
FT                   LVYGLYYSLFVDFEQTHQMVRGSTESLQLAGIFSTYPNPHISVVQAFLVETVITAILMC
FT                   LILALTDDGNGIPRGPLAPLLIGILIAVIGASMGPLTGFALNPARDLGPKAFSYLAGWG
FT                   DIAFTGGRDIPYFLVPIFGPIVGALLGAFGYRALIGRHLPCDVCTLEDEESTTITTERK
FT                   A"
FT   gene            105687..105926
FT                   /locus_tag="YP_0097"
FT                   /old_locus_tag="YP0097"
FT   CDS_pept        105687..105926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0097"
FT                   /old_locus_tag="YP0097"
FT                   /product="hypothetical protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0093 and Yersinia
FT                   pestis KIM y0045"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60376"
FT                   /db_xref="GOA:Q7CLC9"
FT                   /db_xref="InterPro:IPR009252"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CLC9"
FT                   /protein_id="AAS60376.1"
FT                   /translation="MSFEVFEKLEVKVQQAIDTITLLQMEIEELKEKNNTLTQEVQDAA
FT                   GSREALVRENEQLKQEQHVWQDRLRALLGKMEEV"
FT   gene            complement(106134..106643)
FT                   /gene="tnp_2"
FT                   /locus_tag="YP_0098"
FT                   /old_locus_tag="YP0098"
FT   CDS_pept        complement(106134..106643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnp_2"
FT                   /locus_tag="YP_0098"
FT                   /old_locus_tag="YP0098"
FT                   /product="transposase for the IS1541 insertion element"
FT                   /note="similar to Yersinia pestis CO92 tnp and Yersinia
FT                   pestis KIM y3861. Contains Transposase IS200-like
FT                   (Interpro|IPR002686)."
FT                   /db_xref="EnsemblGenomes-Gn:YP_0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60377"
FT                   /db_xref="GOA:Q74YC7"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q74YC7"
FT                   /protein_id="AAS60377.1"
FT                   /translation="MRSGNCKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAEYCVDHIHMLLEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGS
FT                   PFTGRK"
FT   gene            106769..106975
FT                   /locus_tag="YP_0099"
FT                   /old_locus_tag="YP0099"
FT   CDS_pept        106769..106975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0099"
FT                   /old_locus_tag="YP0099"
FT                   /product="hypothetical protein"
FT                   /note="no significant database match found"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60378"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W1Z7"
FT                   /protein_id="AAS60378.1"
FT                   /translation="MGAPMLAERGAISQMLLQDQAPYLQGQCQYFPIRAPLSRATLKIP
FT                   LWLNHPSSLIPHPSSLIPLPVIM"
FT   gene            complement(106984..109098)
FT                   /gene="sunT"
FT                   /locus_tag="YP_0100"
FT                   /old_locus_tag="YP0100"
FT   CDS_pept        complement(106984..109098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sunT"
FT                   /locus_tag="YP_0100"
FT                   /old_locus_tag="YP0100"
FT                   /product="putative secretion ATPase"
FT                   /note="similar to Yersinia pestis KIM y0286. Contains ABC
FT                   transporter, transmembrane region (Interpro|IPR001140,
FT                   (GO:0016020)). Contains ATP/GTP-binding site motif A
FT                   (P-loop) (Interpro|IPR001687, (GO:0005524)). Contains ABC
FT                   transporter (Interpro|IPR003439, (GO:0016020)). Contains
FT                   AAA ATPase (Interpro|IPR003593, (GO:0000166)). Contains
FT                   Peptidase family C39, N-terminal leader
FT                   (Interpro|IPR005074, (GO:0016021)). Contains ABC
FT                   transporter, transmembrane region (Interpro|IPR001140,
FT                   (GO:0016020)). Contains ATP/GTP-binding site motif A
FT                   (P-loop) (Interpro|IPR001687, (GO:0005524)). Contains ABC
FT                   transporter (Interpro|IPR003439, (GO:0016020)). Contains
FT                   AAA ATPase (Interpro|IPR003593, (GO:0000166))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60379"
FT                   /db_xref="GOA:A0A0H2W041"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033838"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W041"
FT                   /protein_id="AAS60379.1"
FT                   /translation="MNDTHFNEIKNRLNFSFRRKVPQVLQTEAAECGLACLVMTCRYHG
FT                   MDIDLFNLRQRFGISSHGATLALLINISAQLKFKTRALSLDLDELRQLKTPCILHWDMS
FT                   HFVVLVAVKGTRFIIHDPAFGRRTVSLSEMSQHFTGVALELWPNSEFTRQKSRTRLSLL
FT                   SLMRNISGLPGFLTKIFCLSLMVEAINLLLPVGTQLVMDHVIIAEDHDLLALICIGLLF
FT                   FILFRTFLSMLRSWTSLVMGSLVDVQWKAGLFDHLLKLPLAYFEKRKLGDIQSRFGSLD
FT                   IIRSTLTNNVVNGIIDGLMSIGVFIMMFLYGGWLVWVVLGFTAMYMILRLATYNQYRQA
FT                   SEEQIVKNAKASSHFMETLYGISTLKALGLAATRSQFWLNLNIDTTNANIRLTKLDMFF
FT                   GGVNTLIGTIDQVVILWLGASMVIDGQMTLGMFVAFNAYRGQFSDRATNLINMVLQLRM
FT                   LALHSERIADIVFTETEKEQTPRQLLSPNQPAVFEARNIAFQYDNLSKPIFSDLNIHVE
FT                   AGESVAITGPSGIGKTTLMKVIAGLLTPSQGHILIDGLDITTVGLNNYRDCIACVLQDD
FT                   KLFAGSIADNIASFDVNKDEQRILSCANHCNIHKEIMHMPMGYETLISELGGSLSGGQK
FT                   QRLLIARALYRQPSLLFLDEATSHLDLANEAHINNAIASLKITRIFIAHRPSTIASAQR
FT                   IINLEKQNVS"
FT   gene            complement(109091..110407)
FT                   /gene="acrA1"
FT                   /locus_tag="YP_0101"
FT                   /old_locus_tag="YP0101"
FT   CDS_pept        complement(109091..110407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrA1"
FT                   /locus_tag="YP_0101"
FT                   /old_locus_tag="YP0101"
FT                   /product="putative secretion permease"
FT                   /note="similar to Yersinia pestis KIM y0287. Contains
FT                   Gram-negative bacterial RTX secretion protein D
FT                   (Interpro|IPR003997, (GO:0009306), (GO:0016020)). Contains
FT                   Secretion protein HlyD (Interpro|IPR006143, (GO:0016020)).
FT                   Contains HlyD secretion protein, C-terminal
FT                   (Interpro|IPR006144, (GO:0016020))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60380"
FT                   /db_xref="GOA:Q8D1M2"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1M2"
FT                   /protein_id="AAS60380.1"
FT                   /translation="MMGITERGMSSNQIFRRDAVEYIRTKWLGKALLTSGYSTTFIAAL
FT                   CAIFLVLLITLIIYGTYTRRINVNGEVISQPHPINIFSPQQGFITKKWVEVGDIVRKGQ
FT                   HLYQIDVSRTTFSGNVSLNSLEAINNQLSQIDSIINNTQKNKELTLLNLRQQLAQYQKA
FT                   HKKSQELVDNAGKGMDDMRRTMASYGTYQRQGLITKDQLTNQRSLFYQQQNAFQSLNTQ
FT                   LIQESLQIAKLESEISTRASDFDNDISQYLFQKGDLKRQLAEVDASGMLLINSPSDGKI
FT                   ENMSVTQGQMVNVNDSLVQLTPSDNPYYCLVLWVPNNSVPYINTGDKVNIRYDAFPFEK
FT                   FGQFPGRIISISNVPVSQQEIASYNIAPRLPNGGLIEPYYKVIVALDDIHFRYQSKPLM
FT                   LSNGLKANVTLFLEKRPLYQWMLSPFYDIKKSVTGPVNE"
FT   gene            110596..110835
FT                   /locus_tag="YP_0102"
FT                   /old_locus_tag="YP0102"
FT   CDS_pept        110596..110835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0102"
FT                   /old_locus_tag="YP0102"
FT                   /product="hypothetical protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0100 and Yersinia
FT                   pestis KIM y0288."
FT                   /db_xref="EnsemblGenomes-Gn:YP_0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60381"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BAS4"
FT                   /protein_id="AAS60381.1"
FT                   /translation="MKELTQTEVMEVSGAGIVSDAGKVLGSGFGALIDAGASIFGIKPN
FT                   ASATIGKIGESIGSAFDAGISGVKQFFGLSAPQQ"
FT   gene            111010..111159
FT                   /locus_tag="YP_0103"
FT                   /old_locus_tag="YP0103"
FT   CDS_pept        111010..111159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0103"
FT                   /old_locus_tag="YP0103"
FT                   /product="putative membrane protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0101 and Yersinia
FT                   pestis KIM y0289"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60382"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B0A0"
FT                   /protein_id="AAS60382.1"
FT                   /translation="MKIAYRTIRFINLWIYAVFYSEFFGFELSHYLSTADMIFFGDYEF
FT                   ILYH"
FT   gene            111462..112049
FT                   /locus_tag="YP_0104"
FT                   /old_locus_tag="YP0104"
FT   CDS_pept        111462..112049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0104"
FT                   /old_locus_tag="YP0104"
FT                   /product="putative exported protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0102."
FT                   /db_xref="EnsemblGenomes-Gn:YP_0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60383"
FT                   /db_xref="InterPro:IPR025326"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W1Z9"
FT                   /protein_id="AAS60383.1"
FT                   /translation="MMQRGCCFLRSTTTAGVALIVAMTLSVSAWAISEQAKSEQATTVP
FT                   NNDIVCHVAHLNARFDDKEGLFEGASQSGTLLILRNISARACQVNAMPVISFEGAVGQQ
FT                   LAVFRKVPRGMRQEPVLSPVTVAAGAEVAVQLRWVASDAFDGNNCVTPEKVVVTLLGGT
FT                   LRLPFGRQMCAASGDTEFFSQAPVGPATNEVQ"
FT   gene            complement(112166..112651)
FT                   /gene="menG"
FT                   /locus_tag="YP_0105"
FT                   /old_locus_tag="YP0105"
FT   CDS_pept        complement(112166..112651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menG"
FT                   /locus_tag="YP_0105"
FT                   /old_locus_tag="YP0105"
FT                   /product="S-adenosylmethionine:2-demethylmenaquinone
FT                   methyltransferase"
FT                   /note="similar to Yersinia pestis CO92 menG and Yersinia
FT                   pestis KIM menG. Contains Dimethylmenaquinone
FT                   methyltransferase (Interpro|IPR005493)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60384"
FT                   /db_xref="GOA:Q8ZJJ7"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR010203"
FT                   /db_xref="InterPro:IPR014339"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJJ7"
FT                   /protein_id="AAS60384.1"
FT                   /translation="MKYDTSDLCDIYHEEVNVVEPLFSNFGGRTSFGGKITTVKCFEDN
FT                   GLLFDLLEENGLGRVLVVDGGGSVRRALINAELAELALKNEWEGIVVYGAVRQVDDLAE
FT                   LDIGIQAMAAIPVGAADEGVGESDIRVNFGGVTFFSGDHLYADNTGIILSEDPLDIE"
FT   gene            complement(112793..113722)
FT                   /gene="menA"
FT                   /locus_tag="YP_0106"
FT                   /old_locus_tag="YP0106"
FT   CDS_pept        complement(112793..113722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menA"
FT                   /locus_tag="YP_0106"
FT                   /old_locus_tag="YP0106"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /note="similar to Yersinia pestis KIM menA. Contains UbiA
FT                   prenyltransferase (Interpro|IPR000537). Contains
FT                   Sodium:dicarboxylate symporter (Interpro|IPR001991,
FT                   (GO:0016020)). Contains 1,4-dihydroxy-2-naphthoate
FT                   octaprenyltransferase (Interpro|IPR004657, (GO:0016021),
FT                   (GO:0016740))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60385"
FT                   /db_xref="GOA:Q8D1M1"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR004657"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1M1"
FT                   /protein_id="AAS60385.1"
FT                   /translation="MKRKMSLSINTSQTQAWLESLRPRTLPLAFASIVTGSALAVWLDS
FT                   FKPAVALLALLTAGLLQILSNLANDYGDAVKGSDTEERIGPLRGMQKGIISHQQMKVAL
FT                   IITVILTIISGIALIAVACEKPSDILGFLLLGLMAIVAAITYTVGRKPYGYMGLGDISV
FT                   LVFFGWLSVAGTYYLQAGHFDSIVMLPATACGLLATAVLNINNLRDIENDKANGKNTLA
FT                   VRLGPVVARYYHALLIGAAIFCLALFSILHLHSWHGWIFLLAIPLLGKHALFVLRDPTA
FT                   AGMRPMLEQMVKAALLTNILFAVGLVFS"
FT   gene            complement(113946..115277)
FT                   /gene="hslU"
FT                   /locus_tag="YP_0107"
FT                   /old_locus_tag="YP0107"
FT   CDS_pept        complement(113946..115277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="YP_0107"
FT                   /old_locus_tag="YP0107"
FT                   /product="ATP-binding heat shock protein"
FT                   /note="similar to Yersinia pestis CO92 hslU and Yersinia
FT                   pestis KIM hslU. Contains CbxX/CfqX superfamily
FT                   (Interpro|IPR000641, (GO:0005524)). Contains
FT                   ATP/GTP-binding site motif A (P-loop) (Interpro|IPR001687,
FT                   (GO:0005524)). Contains AAA ATPase (Interpro|IPR003593,
FT                   (GO:0000166)). Contains AAA ATPase, central region
FT                   (Interpro|IPR003959, (GO:0005524)). Contains Heat shock
FT                   protein HslVU (Interpro|IPR004491, (GO:0009377))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60386"
FT                   /db_xref="GOA:Q8ZJJ5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJJ5"
FT                   /protein_id="AAS60386.1"
FT                   /translation="MSEMTPREIVSELDSHIIGQDKAKRAVAIALRNRWRRMQLNEELR
FT                   HEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLT
FT                   DAAVKMVRHQSIEKMRYRAEELAEERILDVLIPPAKNNWGVPDESQEPSATRQTFRKKL
FT                   REGQLDDKEIEIDLAAAPMGVEIMAPPGMEEMTNQLQSMFQNIAGQKQKPRKIKIKEAL
FT                   KLLIEEEAAKLVNPEELKQQAIDAVEQHGIVFIDEIDKICKRGQTSGPDVSREGVQRDL
FT                   LPLVEGCTVSTKHGMVKTDHILFIASGAFQVSSPSDLIPELQGRLPIRVELQALTTDDF
FT                   ERILTEPSASLTEQYKALMATEGVTIEFTREGIRKIAEAAWQVNERTENIGARRLHTVL
FT                   ERLMEDISYDASESSGQSITIDAEYVGKHLDELVADEDLSRFIL"
FT   gene            complement(115348..115872)
FT                   /gene="hslV"
FT                   /locus_tag="YP_0108"
FT                   /old_locus_tag="YP0108"
FT   CDS_pept        complement(115348..115872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /locus_tag="YP_0108"
FT                   /old_locus_tag="YP0108"
FT                   /product="heat shock protein"
FT                   /note="similar to Yersinia pestis CO92 hslV and Yersinia
FT                   pestis KIM hslV. Contains Proteasome B-type subunit
FT                   (Interpro|IPR000243, (GO:0006511)). Contains Multispecific
FT                   proteasome protease (Interpro|IPR001353, (GO:0006511))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60387"
FT                   /db_xref="GOA:Q8ZJJ4"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJJ4"
FT                   /protein_id="AAS60387.1"
FT                   /translation="MTTIVSVRRDGHVVIGGDGQVTLGNTVMKGNAKKVRRLYNNKVIA
FT                   GFAGGTADAFTLFELFERKLEMHQGHLTKAAVELAKDWRTDRMLRKLEALLAVADETAS
FT                   LIITGNGDVVQPEDDLIAIGSGGPYAQSAARALLENTELGARDIVEKSLSIAGDICIYT
FT                   NRFQTIEELTY"
FT   gene            complement(115972..116817)
FT                   /gene="ftsN"
FT                   /locus_tag="YP_0109"
FT                   /old_locus_tag="YP0109"
FT   CDS_pept        complement(115972..116817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsN"
FT                   /locus_tag="YP_0109"
FT                   /old_locus_tag="YP0109"
FT                   /product="cell division protein"
FT                   /note="similar to Yersinia pestis CO92 ftsN and Yersinia
FT                   pestis KIM ftsN. Contains Proline-rich region
FT                   (Interpro|IPR000694)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60388"
FT                   /db_xref="GOA:A0A3N4AZJ2"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR011930"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AZJ2"
FT                   /protein_id="AAS60388.1"
FT                   /translation="MAQRDYVSRGRSGARRKSTSRKKRSAPIVSKTVMALAVALLVVFV
FT                   GGLYFITHNKPGELPLLPNHDPRTGNGLPPKPEERWRYIKELENRQIGVPMPTEPSAGG
FT                   EVNAKTELTNEQRQLLEQMQADMRQQPTQLSEVPYNQGMQQVPRSAVTIKPPATSVQPQ
FT                   PVTPPRQTTIPVQPQAPAPVRTPPAAPVTQAVTPPKVEKEKEKTQRWMVQCGSFKAVDQ
FT                   AESIRAQLAFAGIESRITSGGGWNRVVLGPYNSKAAADKALQRLQGAGQSGCIPLSVGG
FT                   "
FT   gene            complement(116883..117911)
FT                   /gene="cytR1"
FT                   /locus_tag="YP_0110"
FT                   /old_locus_tag="YP0110"
FT   CDS_pept        complement(116883..117911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cytR1"
FT                   /locus_tag="YP_0110"
FT                   /old_locus_tag="YP0110"
FT                   /product="transcriptional repressor"
FT                   /note="similar to Yersinia pestis CO92 cytR and Yersinia
FT                   pestis KIM cytR. Contains Bacterial regulatory protein
FT                   LacI, HTH motif (Interpro|IPR000843, (GO:0006355)).
FT                   Contains Periplasmic binding protein/LacI transcriptional
FT                   regulator (Interpro|IPR001761). Contains Bacterial
FT                   regulatory protein LacI, HTH motif (Interpro|IPR000843,
FT                   (GO:0006355)). Contains Periplasmic binding protein/LacI
FT                   transcriptional regulator (Interpro|IPR001761)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60389"
FT                   /db_xref="GOA:A0A3N4AY76"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AY76"
FT                   /protein_id="AAS60389.1"
FT                   /translation="MENKKEFTMTTMKDVAEMAGVSTATVSRALMNPEKVSTVTRQKVE
FT                   QAVLAVGYSPHALSRNIKRNESRTILVIVPDISDPFFADVIQGIEHAAAQQGYLILIGD
FT                   CAQQTQQERTFVNLIITKQIDGMLLLGSNLPFDASKEEQRNLPPMVMANEFAPELELPT
FT                   VHIDNLTAAYEAVNYLHELGHKRIACIAGPESLPLSHYRLQGYIQALRRNGITVDNDYI
FT                   IRGDFSYEAGAQSFAALMELPHPPTAIFSHNDVMAVGAIWQAKQLGLRIPQDVSLVGFD
FT                   DLKLSQFCDPPLTTVAQPRYQIGQQAMLLLLEQLQGHSVQSGSRLLDTELIIRESTAAP
FT                   KH"
FT   gene            complement(118264..120462)
FT                   /gene="priA"
FT                   /locus_tag="YP_0111"
FT                   /old_locus_tag="YP0111"
FT   CDS_pept        complement(118264..120462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="YP_0111"
FT                   /old_locus_tag="YP0111"
FT                   /product="primosomal protein n'"
FT                   /note="similar to Yersinia pestis CO92 priA and Yersinia
FT                   pestis KIM priA. Contains DEAD/DEAH box helicase
FT                   (Interpro|IPR001410, (GO:0008026)). Contains Helicase,
FT                   C-terminal (Interpro|IPR001650, (GO:0005524)). Contains
FT                   ATP/GTP-binding site motif A (P-loop) (Interpro|IPR001687,
FT                   (GO:0005524)). Contains Primosomal protein n
FT                   (Interpro|IPR005259)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60390"
FT                   /db_xref="GOA:A0A380PK94"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:A0A380PK94"
FT                   /protein_id="AAS60390.1"
FT                   /translation="MSVVQVALPVPLARTFDYRLDSAMACPVVGARVSVPFGKRKAIGI
FT                   VVGLSDTSTFPLEQLKTIDAILDNHSLFPPSLWRILCWATEYYHYPIGEVLFHALPILL
FT                   RQGRPAQSAPLWQWFVTEQGRATPPESLKRAPKQQQALAALLQKPVYRHQVNEMALTES
FT                   ALQALRSKGLIDLRAQEATTTDWRHSFSVLGERLRLNTEQATAVGAIRSEDNQFAAWLL
FT                   AGVTGSGKTEVYLSVLENILAQGRQALILVPEIGLTPQTIARFRERFNAPVEVLHSGLN
FT                   DSERLSVWLRARSGEAAIVIGTRSALFTPFSRLGVIIIDEEHDSSYKQQEGWRYHARDL
FT                   AVFRAREEGIPIVMGTATPALETLHNVQMGKYRQLTLTKRAGSAKPAAQHLLDLKGLPL
FT                   KVGLSQPLLKQMKTHLQAGNQVILFLNRRGYAPALLCHECGWIAECQRCDHYYTLHQNH
FT                   RQLRCHHCDSQRPVPQQCPKCGSTHLVSVGVGTEQLENELAPLFPETPITRIDRDTTSR
FT                   KGSLEQYLADVHQGGARILIGTQMLAKGHHFPDVTLVALLDVDGALFSADFRSAERFAQ
FT                   LYTQVSGRAGRAGKQGEVILQTHHPEHPLLQILLQQGYDAFAKQALEERKSVFLPPYTS
FT                   HIIVRSEDHDNQQSALFLQQLRNLLEASPLKDEALWIMGPVPALQAKRGGRFRWQLLLQ
FT                   HPSRQLLQRLIKTSQPLISTLPQARKVKWTIDVDPIDS"
FT   gene            120715..120930
FT                   /gene="rpmE1"
FT                   /locus_tag="YP_0112"
FT                   /old_locus_tag="YP0112"
FT   CDS_pept        120715..120930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE1"
FT                   /locus_tag="YP_0112"
FT                   /old_locus_tag="YP0112"
FT                   /product="50S ribosomal protein L31"
FT                   /note="similar to Yersinia pestis CO92 rpmE. Contains
FT                   Cytochrome c heme-binding site (Interpro|IPR000345,
FT                   (GO:0006118)). Contains Ribosomal protein L31
FT                   (Interpro|IPR002150, (GO:0006412))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60391"
FT                   /db_xref="GOA:P58471"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58471"
FT                   /protein_id="AAS60391.1"
FT                   /translation="MKQGIHPKYEQVTASCSCGNVIKINSTVGHDLNLDVCGECHPFYT
FT                   GKQRDVASGGRVDRFNKRFSVPGAKK"
FT   gene            complement(121473..121940)
FT                   /locus_tag="YP_0113"
FT                   /old_locus_tag="YP0113"
FT   CDS_pept        complement(121473..121940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0113"
FT                   /old_locus_tag="YP0113"
FT                   /product="hypothetical protein"
FT                   /note="similar to Yersinia pestis KIM y0300"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60392"
FT                   /db_xref="GOA:Q8D1M0"
FT                   /db_xref="InterPro:IPR008024"
FT                   /db_xref="InterPro:IPR038972"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1M0"
FT                   /protein_id="AAS60392.1"
FT                   /translation="MDLNMNPNYAKPSAAFTAASWSALLGGFVIFLIGLWNADMQLNER
FT                   GYYFAVLILGLFSAVSLQKTVRDKLEGLAITSIYYGLCWVAFIVAVLLLCIGLWNATLA
FT                   LSEKGFYGVTFFMTLFGAIAVQKNTRDSAMSSDTESASLFKKVRDQLKAED"
FT   gene            complement(122277..122594)
FT                   /gene="metJ"
FT                   /locus_tag="YP_0116"
FT                   /old_locus_tag="YP0116"
FT   CDS_pept        complement(122277..122594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metJ"
FT                   /locus_tag="YP_0116"
FT                   /old_locus_tag="YP0116"
FT                   /product="transcriptional repressor protein"
FT                   /note="similar to Yersinia pestis CO92 metJ and Yersinia
FT                   pestis KIM metJ. Contains Methionine repressor MetJ
FT                   (Interpro|IPR002084, (GO:0006555))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60395"
FT                   /db_xref="GOA:Q8ZJI8"
FT                   /db_xref="InterPro:IPR002084"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR023453"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJI8"
FT                   /protein_id="AAS60395.1"
FT                   /translation="MAEWNGEYVSPYAEHGKKSKQVKKITVSIPLKVLKILTDERTRRQ
FT                   VNNLRHATNSELLCEAFLHAFTGQPLPNDEDLRKERSDEIPEAAKILMRELGVDPDTWE
FT                   Y"
FT   gene            122891..124132
FT                   /gene="metC1"
FT                   /locus_tag="YP_0117"
FT                   /old_locus_tag="YP0117"
FT   CDS_pept        122891..124132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metC1"
FT                   /locus_tag="YP_0117"
FT                   /old_locus_tag="YP0117"
FT                   /product="Cystathionine beta-lyases/cystathionine
FT                   gamma-synthases"
FT                   /note="Best Blastp hit = gi|16131777|ref|NP_418374.1|
FT                   (NC_000913) cystathionine gamma-synthase [Escherichia coli
FT                   K12], gi|127030|sp|P00935|METB_ECOLI Cystathionine
FT                   gamma-synthase (CGS) (O-succinylhomoserine (Thiol)-lyase),
FT                   gi|68356|pir||SYECCG O-succinylhomoserine (thiol)-lyase (EC
FT                   4.2.99.9) - Escherichia coli, gi|146846|gb|AAA24167.1|
FT                   (K01547) cystathione gamma-synthase [Escherichia coli],
FT                   gi|305042|gb|AAB03071.1| (L19201) cystathionine
FT                   gamma-synthase [Escherichia coli],
FT                   gi|1790375|gb|AAC76921.1| (AE000468) cystathionine
FT                   gamma-synthase [Escherichia coli K12],(len:386 aa);.
FT                   Contains Cys/Met metabolism pyridoxal-phosphate-dependent
FT                   enzymes (Interpro|IPR000277, (GO:0006520))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60396"
FT                   /db_xref="GOA:A0A0H2W121"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR011821"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W121"
FT                   /protein_id="AAS60396.1"
FT                   /translation="MSRCIDVRNLCVYSGVTFSRSRLVEINMTRKQATIAVRSGLNDDE
FT                   QYGCVVPPIHLSSTYNFIDFNQPRTHDYSRRGNPTRDVVQRALAELEGGAGAVMTSSGM
FT                   SALHLVCTTFLQPGDLLVAPHDCYGGSYRLFDSLSKRGAYRVLFVDQGDEAALNCALAE
FT                   KPKLVLIETPSNPLLRVVDIAAICQAARAAGALTVCDNTFLSPALQQPLSLGADLVVHS
FT                   CTKYLNGHSDVVAGAVIAKDPELVVELAWWANNIGVTGAAFDSYLLLRGLRTLSPRMAQ
FT                   QQRNADDIVRYLQQQPLVKKLYHPSLPQHPGHEIACRQQSGFGAMLSFELDGDEQVMRR
FT                   FLSALELFTLAESLGGVESLISHAATMTHAGMAAEARIAAGITDSLLRISVGIEDSEDL
FT                   IADLDHAFQLAVTR"
FT   gene            124135..126570
FT                   /gene="metL"
FT                   /locus_tag="YP_0118"
FT                   /old_locus_tag="YP0118"
FT   CDS_pept        124135..126570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metL"
FT                   /locus_tag="YP_0118"
FT                   /old_locus_tag="YP0118"
FT                   /product="bifunctional aspartokinase/homoserine
FT                   dehydrogenase II"
FT                   /note="similar to Yersinia pestis CO92 metL and Yersinia
FT                   pestis KIM metL. Contains Aspartate/glutamate/uridylate
FT                   kinase (Interpro|IPR001048, (GO:0008652)). Contains
FT                   Aspartate kinase (Interpro|IPR001341, (GO:0008652)).
FT                   Contains Homoserine dehydrogenase (Interpro|IPR001342,
FT                   (GO:0008652)). Contains Homoserine dehydrogenase, NAD
FT                   binding domain (Interpro|IPR005106)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60397"
FT                   /db_xref="GOA:A0A380PJB4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041743"
FT                   /db_xref="UniProtKB/TrEMBL:A0A380PJB4"
FT                   /protein_id="AAS60397.1"
FT                   /translation="MNATAVAAAATGRQLHKFGGSSLADVKCYLRVANIMANYSHPGDL
FT                   MVVSAAGSTTNQLISWLKLSQNDRLSAHQVQQSLRRYQHDLINGLLPPEMAEPLISEFI
FT                   HDLERLAGLLDNKIDDVIYAEVVGHGEIWSARLMSALLNKLDMDAVWLDARRFLRAERA
FT                   AQPQIDESRSYPLLQQLMAQHPHQRLVVTGFISRNEAGETVLLGRNGSDYSATQVGALA
FT                   GAERVTIWSDVAGVYSADPRKVKDACLLPLLRLDEASELARLAAPVLHTRTLQPVSGSD
FT                   IDLQLRCSYQPEQGSTRIERVLASGLGAKIVTSHDDVCLIELQIASHHDFSLAQKEIDL
FT                   LLKRAQIKPLATGIHPDRNLLQLCYTSEVVNSALRVLEDAALPGKLSLREGLALVALVG
FT                   AGVSKNPLHSHRFYQQLKDQPVEFVWQAEDGISMVAVLRLGPTEHLIQGLHQSLFRAEK
FT                   RIGLMLFGKGNIGARWLELFAREQKSLSARSGFEFVLAGVVDSRRSLLSYDGLDASRTL
FT                   AFYNDEAKEQDEESLFLWMRAHPFDDLVVLDVTASPSLAEQYLDFASYGFHVISANKLA
FT                   GASSSNNYRQIRDAFAKTGRHWLYNATVGAGLPVNHTVRDLRDSGDSILAISGIFSGTL
FT                   SWLFLQFDGSVPFTELVDQAWQQGLTEPDPRVDLSGQDVMRKLVILAREAGYDIEPNQV
FT                   RVESLVPAGAESGSVDQFFENGEALNQQMIQRLEAAKEMGLVLRYVARFDANGKARVGV
FT                   EAVRTDHPLASLLPCDNVFAIESRWYRDNPLVIRGPGAGRDVTAGAIQSDLNRLSQLL"
FT   gene            126803..127687
FT                   /gene="metF1"
FT                   /locus_tag="YP_0119"
FT                   /old_locus_tag="YP0119"
FT   CDS_pept        126803..127687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metF1"
FT                   /locus_tag="YP_0119"
FT                   /old_locus_tag="YP0119"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /note="similar to Yersinia pestis CO92 metF and Yersinia
FT                   pestis KIM metF. Contains Methylenetetrahydrofolate
FT                   reductase (Interpro|IPR003171, (GO:0006555)). Contains
FT                   5,10-methylenetetrahydrofolate reductase
FT                   (Interpro|IPR004620, (GO:0009086))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60398"
FT                   /db_xref="GOA:A0A3N4AWV2"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AWV2"
FT                   /protein_id="AAS60398.1"
FT                   /translation="MSFFHANQREALNQSLSELQGQINVSFEFFPPRTSEMEDTLWSSI
FT                   DRLSTLKPKFVSVTYGANSGERDRTHSIIKGIKERTGLEAAPHLTCIDASPTQLRDIAI
FT                   DYWNSGIRHIVALRGDLPPNSGKPEMYACDLVGLLKDVGDFDISVAAYPEIHPEAKSAQ
FT                   ADLINLKRKIDAGANRAITQFFFDVESYLRFRDRCVATGIDVEIVPGILPVSNFKQLQR
FT                   FATMTNVRVPNWMTSIFDGLDNDPETRKMVGASVAMDMVKILSREGVKDFHFYTLNRAE
FT                   LSYAICHTLGVRP"
FT   gene            complement(127865..128650)
FT                   /gene="tra5A"
FT                   /locus_tag="YP_0120"
FT                   /old_locus_tag="YP0120"
FT   CDS_pept        complement(127865..128650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tra5A"
FT                   /locus_tag="YP_0120"
FT                   /old_locus_tag="YP0120"
FT                   /product="transposase for insertion sequence IS1661"
FT                   /note="similar to Yersinia pestis CO92 YPO4092 and Yersinia
FT                   pestis KIM y4108. Contains Integrase, catalytic domain
FT                   (Interpro|IPR001584, (GO:0006310))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60399"
FT                   /db_xref="GOA:A0A384L0V6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L0V6"
FT                   /protein_id="AAS60399.1"
FT                   /translation="MARSTYYYHASKPDGVIDDYADAVKAIGALSRRHAQRYGYRRMTV
FT                   ALRKEGFTLNHKTVRKLMNQHGLLSLIRRKKYRSYRADGGRASDNLLARNFTSEISGLK
FT                   WCTDVTEFRVGAQKLYLSVIQDLFNNEIISWHMSERAALILTCKTLEKALKVKGRKEGL
FT                   MLHSDQGWHYRTPMWRSMLVEAGIRQSMSRKGNCLDNAVMENFFSHLKAEMYHRKKYDS
FT                   ATVLKRDIVEYIHYYNTERISLKTGGMSPAEYRTQVEKQ"
FT   gene            complement(128704..129348)
FT                   /locus_tag="YP_0121"
FT                   /old_locus_tag="YP0121"
FT   CDS_pept        complement(128704..129348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0121"
FT                   /old_locus_tag="YP0121"
FT                   /product="insertion element IS1661 DNA-binding protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0996 and Yersinia
FT                   pestis KIM y3896."
FT                   /db_xref="EnsemblGenomes-Gn:YP_0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60400"
FT                   /db_xref="GOA:Q8CZK2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZK2"
FT                   /protein_id="AAS60400.1"
FT                   /translation="MIGFGCYGFTAHLASDEPTAKGAISALNPRSWIFLSMIWRFGSMK
FT                   HPFSTRLAAVQHYLSGKATLRETARQFSVGKSPLTRWIRAFRRQGEAGLEHHLSRTYTP
FT                   EFRLCVVRYMMANRCSAADASAHFNIPNETIIQNWMKRYREGGKEALNPSKTGPTMPKD
FT                   KYEHDSKPFSEMTHAELEKELEYLRAENAYLKKRKALREEKALREQQKKPE"
FT   gene            complement(129412..130170)
FT                   /gene="glpR1"
FT                   /locus_tag="YP_0122"
FT                   /old_locus_tag="YP0122"
FT   CDS_pept        complement(129412..130170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpR1"
FT                   /locus_tag="YP_0122"
FT                   /old_locus_tag="YP0122"
FT                   /product="glycerol-3-phosphate repressor protein"
FT                   /note="similar to Yersinia pestis CO92 glpR and Yersinia
FT                   pestis KIM glpR. Contains Bacterial regulatory protein,
FT                   DeoR family (Interpro|IPR001034, (GO:0006355))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60401"
FT                   /db_xref="GOA:A0A3N4AZK3"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AZK3"
FT                   /protein_id="AAS60401.1"
FT                   /translation="MKQTQRHDAIIELVRLQGYVSTEELVEHFAVSPQTIRRDLNELAD
FT                   QNKIHRHHGGAALPSSSVNAAYNDRKVMWSEEKARIAQRVASQIPDGATLFIDIGTTPE
FT                   AVAHALMNHKGLRVVTNNLNVATLLTAKEDFRLILAGGEVRTRDGGIIGEATLDFISQF
FT                   RLDYGILGISGIDMDGSLLEFDYHEVRTKRAIIENSRCVMLVTDHSKFGRNAMVNLGNM
FT                   NLIDYLFTDQQPPASVMKIIEQHEVQLELC"
FT   gene            complement(130205..131041)
FT                   /gene="glpG"
FT                   /locus_tag="YP_0123"
FT                   /old_locus_tag="YP0123"
FT   CDS_pept        complement(130205..131041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpG"
FT                   /locus_tag="YP_0123"
FT                   /old_locus_tag="YP0123"
FT                   /product="putative membrane protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0121 and Yersinia
FT                   pestis KIM glpG. Contains Rhomboid-like protein
FT                   (Interpro|IPR002610)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60402"
FT                   /db_xref="GOA:Q7CFX8"
FT                   /db_xref="InterPro:IPR022732"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR023662"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="InterPro:IPR038236"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CFX8"
FT                   /protein_id="AAS60402.1"
FT                   /translation="MTRVIVISNLRLAQAFVDYMATHHVALEIRPDAQGVEIWLADDEQ
FT                   LSAVQHELEQFLLDPLNPRYQAASWQAGNVNSNLPYQRFSYLQTLRSQAGPLTLSVMVL
FT                   CIAIYILMLITGDMAVMSWLAWPYNSSQYLQIWRWVSHAFLHFSLLHILFNLMWWWYLG
FT                   GQMEKRLGTSKLLVLTIVSAVFSGWGQSLFSGANFGGLSGVVYALMGYVWLTGERAPER
FT                   GISLPRGLMAFSVLWLIAGYFDILGLSIANAAHVSGLIIGLLMAFWDTRNSARTVQ"
FT   gene            complement(131059..131493)
FT                   /gene="glpE"
FT                   /locus_tag="YP_0124"
FT                   /old_locus_tag="YP0124"
FT   CDS_pept        complement(131059..131493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpE"
FT                   /locus_tag="YP_0124"
FT                   /old_locus_tag="YP0124"
FT                   /product="thiosulfate sulfurtransferase"
FT                   /note="similar to Yersinia pestis CO92 YPO0122 and Yersinia
FT                   pestis KIM glpE. Contains Rhodanese-like
FT                   (Interpro|IPR001763)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60403"
FT                   /db_xref="GOA:Q8ZJI3"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJI3"
FT                   /protein_id="AAS60403.1"
FT                   /translation="MFYGSLLAIIWIFIDDKLITMALLRIQSSLRVISSMEQFEAISVE
FT                   QAYLRWKEGKTALVDIRDPQSYEAGHAPGAFHLTNSSLHTFMQQTDFDQPVMVMCYHGN
FT                   SSKGAAQYLLQQGFDVVYSIDGGFEAWARSYPQDITSESR"
FT   gene            complement(131763..134474)
FT                   /gene="malT"
FT                   /locus_tag="YP_0125"
FT                   /old_locus_tag="YP0125"
FT   CDS_pept        complement(131763..134474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malT"
FT                   /locus_tag="YP_0125"
FT                   /old_locus_tag="YP0125"
FT                   /product="maltose regulon positive regulatory protein"
FT                   /note="similar to Yersinia pestis CO92 malT and Yersinia
FT                   pestis KIM malT. Contains Bacterial regulatory protein,
FT                   LuxR family (Interpro|IPR000792, (GO:0006355))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60404"
FT                   /db_xref="GOA:Q8ZJI2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR023768"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJI2"
FT                   /protein_id="AAS60404.1"
FT                   /translation="MLIPSKLSRPVRLQNTVVRDRLLVKLSSAANYRLTLINCPAGYGK
FT                   TTLIAQWAADQSNLGWYSLDESDNQSERFATYLIAAIQLATGGHCSKSEALSQKHQYAN
FT                   LSALFSQLFIELSNWDGPLYLVIDDYHLITNDAIHEAMRFFLRHQPENLTLIILSRTLP
FT                   SLGIANLRVRDQLLELGMQQLAFNHHEAQQFFECRLSSPLEQGDSSRLCDEVEGWVTAL
FT                   QLIALSSRQPNSSAQKSAKRLAGLNASHLSDYLVDEVLDQVDSKARAFLLRCSVLRSMN
FT                   DALIVRLTGEDNGQQLLEELERQGLFIHRMDDSAEWFCFHPLFATFLRQRCQWELALEL
FT                   PELHHAAAEGWMALGYPAEAIHHALAAGDVGMLRDILLQHAWSLFHHSELALLEQCLTA
FT                   LPYPLLVQNPELALLQAWLAQSQHRYSEVNTLLEQAELAMQERKIPVDEILRAEFGALR
FT                   AQVAINAGKPDEAEKLATDALKYLPMAHYYSRIVATSVTGEVHHCKGELARALPMMQQT
FT                   EQMARRHEAYHYALWALLQQSEILIAQGFLQAAYETQEKAFELIREQHLEQLPMHEFLL
FT                   RIRSQVLWSWSRLDEAEEAARKGVEILANYQPQQQLQCLAMLAKCSLARGDLDNANVYI
FT                   QRCEALQHGSQYHLDWITNADKPRVIHWQMTGDKVAAASWLRQTEKPGMADNHFLQGQW
FT                   RNIARVQIILGRFDEAEVVLDELNENARRLRLTSDLNRNLLLSNTLYWQTERKGEAQKA
FT                   LIESLTLANRTGFISHFVIEGEAMAQQLRQLIQLNALPELEQHRAQRILKDINQHHRHK
FT                   FAHFDEIFVDKLLTHPQVPELIRTSPLTQREWQVLGLIYSGYSNDQIANELDVAATTIK
FT                   THIRNLYQKLGVAHRQEAVQQAQRLLQMMGYV"
FT   gene            134792..137196
FT                   /pseudo
FT                   /gene="malP"
FT                   /locus_tag="YP_0126"
FT                   /old_locus_tag="YP0126"
FT                   /note="similar to gi|16766802|ref|NP_462417.1| (NC_003197)
FT                   maltodextrin phosphorylase [Salmonella typhimurium LT2]
FT                   (len:797 aa). Contains a frameshift after codon 107.The
FT                   sequence has been checked and is believed to be correct.
FT                   Contains Glycosyl transferase, family 35
FT                   (Interpro|IPR000811, (GO:0005975)) . Contains Glycosyl
FT                   transferase, family 35 (Interpro|IPR000811, (GO:0005975))"
FT   gene            137209..139305
FT                   /gene="malQ"
FT                   /locus_tag="YP_0127"
FT                   /old_locus_tag="YP0127"
FT   CDS_pept        137209..139305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malQ"
FT                   /locus_tag="YP_0127"
FT                   /old_locus_tag="YP0127"
FT                   /product="4-alpha-glucanotransferase"
FT                   /note="similar to Yersinia pestis CO92 malQ and Yersinia
FT                   pestis KIM malQ. Contains Glycoside hydrolase, family 77
FT                   (Interpro|IPR003385, (GO:0005975))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60405"
FT                   /db_xref="GOA:A0A3N4AWV9"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AWV9"
FT                   /protein_id="AAS60405.1"
FT                   /translation="MDRKSLDQAATLAGIAASYINAHGKPQATLAETKEQLLAAMGRSL
FT                   GAHDTQTANTPLPVVKVFTFGSPMQLPMAGSGDYHWQLQTENGELHQGRISAKKTLTLP
FT                   ASLPLGYHRLILEQDLQQWQCSIIVAPKRCYEPDALLQGKKLWGACVQLYTLRSEHNWG
FT                   IGDFGDLKQMLEQVGERGGSFIGLNPIHALYPANPHSASPYSPSSRRWLNVIYIDINRV
FT                   EEFQQSEAAQRWWHQAETQQALAKSRESEWVDYPLVMQLKLTALRLSFPLFTARKAKDA
FT                   QVQAFRHFVEQGGSSLHQQAVFDALHAHLSEHDPMMWGWPVWPEKYRDGHSSAVADFCR
FT                   EHADEVTFYLWLQWLAASQFDDCFQSSQQRKMPIGLYRDLAVGVAEGGAETWCDRELYC
FT                   LKASVGAPPDILGPLGQNWGLPPMDPHVMVARAYQPFIDLLRANMTSCGALRIDHVMAL
FT                   LRLWWIPYGHTADQGAYVKYPVDDLLAVLALESQRHHCMVIGEDLGTVPVEIVGKLRDS
FT                   GVYSYKVLYFEHDSENIFRAPQSYPVQAMATITTHDLPTLRGYWQADDLTLGNKLGLYP
FT                   DQQILKQLYLDRERAKQGLLEGLHRYDCVPKKVGHKAALLSMSPVLNRGLQRYVADSAS
FT                   ALLGLQPEDWLDMAAPVNIPGTTDEYPNWRRKLSASLEEIFADSQINRLLKDLDKRRKN
FT                   VSVG"
FT   gene            complement(139634..140209)
FT                   /locus_tag="YP_0128"
FT                   /old_locus_tag="YP0128"
FT   CDS_pept        complement(139634..140209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0128"
FT                   /old_locus_tag="YP0128"
FT                   /product="Thioredoxin-like proteins and domains"
FT                   /note="similar to Yersinia pestis CO92 YPO0127 and Yersinia
FT                   pestis KIM y3903. Contains Protein of unknown function,
FT                   HesB/YadR/YfhF (Interpro|IPR000361, (GO:0005554)). Contains
FT                   Nitrogen-fixing NifU, C-terminal (Interpro|IPR001075)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60406"
FT                   /db_xref="GOA:Q8ZJI0"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR017726"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJI0"
FT                   /protein_id="AAS60406.1"
FT                   /translation="MITITDAAQSHFAKLLANQEEGTQIRVFVINPGTPTAECGVSYCP
FT                   PDAVEATDTELKFEQLSAYVDELSVPYLQDAEIDFVTDQLGSQLTLKAPNAKMRKVDDS
FT                   APLMERVEYVLQSQINPQLAGHGGRVTLMEITPEGLAILQFGGGCNGCSMVDVTLKEGI
FT                   EKELLQKFPELKGVRDLTEHQRGEHSYY"
FT   gene            complement(140269..140970)
FT                   /gene="comFC"
FT                   /locus_tag="YP_0129"
FT                   /old_locus_tag="YP0129"
FT   CDS_pept        complement(140269..140970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comFC"
FT                   /locus_tag="YP_0129"
FT                   /old_locus_tag="YP0129"
FT                   /product="putative amidophosphoribosyltransferases"
FT                   /note="similar to Yersinia pestis CO92 YPO0128 and Yersinia
FT                   pestis KIM y3906"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60407"
FT                   /db_xref="GOA:A0A3N4BKD9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BKD9"
FT                   /protein_id="AAS60407.1"
FT                   /translation="MLTTVSQCWLCQQPLYHNRHGICCYCQRHLPVLPPCCPCCGLPST
FT                   STFLRCGRCLIAPPRWHHMTFVGDYAPPLSGLIKQLKFGGAPQLAPVLARLLLLRWLRH
FT                   WRETQCRKSDKAIKPQRIVSVPLHHWRCWRRGYNQTDLLARPLAHWLGCDYTPLTLQRI
FT                   HATPPQQQLTAAQRRKNVRGIFRCAESVRGQHIALLDDVVTTGSTLNEIAHLLWAQGIA
FT                   SLQIWSVCRTL"
FT   gene            141036..141833
FT                   /gene="bioH"
FT                   /locus_tag="YP_0130"
FT                   /old_locus_tag="YP0130"
FT   CDS_pept        141036..141833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioH"
FT                   /locus_tag="YP_0130"
FT                   /old_locus_tag="YP0130"
FT                   /product="putative biotin biosynthesis protein"
FT                   /note="similar to Yersinia pestis CO92 bioH and Yersinia
FT                   pestis KIM bioH. Contains Alpha/beta hydrolase fold
FT                   (Interpro|IPR000073). Contains
FT                   Esterase/lipase/thioesterase, active site
FT                   (Interpro|IPR000379, (GO:0003824)). Contains Alpha/beta
FT                   hydrolase (Interpro|IPR003089, (GO:0006725), (GO:0016787))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60408"
FT                   /db_xref="GOA:Q74Y45"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR010076"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q74Y45"
FT                   /protein_id="AAS60408.1"
FT                   /translation="MATGYYCMKQLYWYTCGEGDCDLVLLHGWGLNSGVWHCIIDRLAP
FT                   HFRLHLVDLPGYGRSQDYGAMSLADMAERVAQQAPKQALWLGWSMGGLVASQIALSQPE
FT                   CVRGLITVSSSPCFTARDEWPGIKPEVLAGFQHQLSDDFHRTVERFLALQTLGTESSRQ
FT                   DARLLKSVVLQHQMPDVEVLTGGLAILRTADLRTALAGFTLPFMRVYGHLDSLVPRKVA
FT                   SLLDSAWPQTQSVVMQGAAHAPFISHPNDFAKLILNFAEENKK"
FT   gene            141994..142272
FT                   /locus_tag="YP_0131"
FT                   /old_locus_tag="YP0131"
FT   CDS_pept        141994..142272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0131"
FT                   /old_locus_tag="YP0131"
FT                   /product="putative exported protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0130 and Yersinia
FT                   pestis KIM y3909."
FT                   /db_xref="EnsemblGenomes-Gn:YP_0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60409"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZK0"
FT                   /protein_id="AAS60409.1"
FT                   /translation="MFHMKLLKNMAVALVISGLSFAAIAAKEITKQEAEANNYEKIGTV
FT                   STTGEATSPMDVKKALSKLADEKGGKYYVIIAEREKGKFDADAEVYK"
FT   gene            complement(142410..142667)
FT                   /locus_tag="YP_0132"
FT                   /old_locus_tag="YP0132"
FT   CDS_pept        complement(142410..142667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0132"
FT                   /old_locus_tag="YP0132"
FT                   /product="hypothetical protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0131 and Yersinia
FT                   pestis KIM feoC"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60410"
FT                   /db_xref="GOA:Q7CFX5"
FT                   /db_xref="InterPro:IPR015102"
FT                   /db_xref="InterPro:IPR023732"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CFX5"
FT                   /protein_id="AAS60410.1"
FT                   /translation="MASLLQLRDAIALNGSAEASQLSRQLAIPLPLVNAMLEKLTAMGK
FT                   IERIELDHSGCLTGSCKSCPEGHQHCNTVIYQLKEPHAHQ"
FT   gene            complement(142703..145018)
FT                   /gene="feoB"
FT                   /locus_tag="YP_0133"
FT                   /old_locus_tag="YP0133"
FT   CDS_pept        complement(142703..145018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feoB"
FT                   /locus_tag="YP_0133"
FT                   /old_locus_tag="YP0133"
FT                   /product="ferrous iron transport protein B"
FT                   /note="similar to Yersinia pestis CO92 feoB and Yersinia
FT                   pestis KIM feoB. Contains Uridine kinase
FT                   (Interpro|IPR000764, (GO:0006224)). Contains
FT                   ATP/GTP-binding site motif A (P-loop) (Interpro|IPR001687,
FT                   (GO:0005524)). Contains Ferrous iron transport protein B
FT                   (Interpro|IPR003373, (GO:0016020)). Contains Small
FT                   GTP-binding protein domain (Interpro|IPR005225)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60411"
FT                   /db_xref="GOA:A0A3N4AY99"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AY99"
FT                   /protein_id="AAS60411.1"
FT                   /translation="MKALTIGLIGNPNAGKTTLFNQLTGARQRVGNWAGVTVERKEGHF
FT                   NTAQHQVTLVDLPGTYSLTTISEQTSLDEQIACHYILSGEADLLINVIDAVNLERNLYL
FT                   TLQLLELGIPCIVALNMLDIAESQHIEIDINTLSKKLGCPVIPLVSTRGRGIDELKNSI
FT                   DQFQPATCRTLVSYPPILLSEVDKLVAAMSDALPMQQRRWLALQILEGDIYSLNRAGVA
FT                   PSMVEQARQQLREQQHEDPALIIADARYQSIAHLCEAVGNSQQAEPNRLTQALDSVILN
FT                   RWLGVPIFLFVMYLMFVLAINIGGALQPIFDIGSAAIFIQGLQWVGHTLHFPPWLTIFL
FT                   AQGVGGGINTVLPLVPQIGMMYLFLSFLEDSGYMARAAFVMDRLMQALGLPGKSFVPLI
FT                   VGFGCNVPSIMGARTLDAQRERLITIMMAPFMSCGARLAIFAVFAAAFFGQDGASIVFS
FT                   LYLLGIAVAILTGLVLKYTIMRGEASPFVMELPVYHVPHLKSLLLQTWQRLKGFVLRAG
FT                   KVIVIASIFIGGLNSFSFNGKPVDSINDSALASVSKVLTPLLMPMGIHADNWQATVGLV
FT                   TGAMAKEVVVGTLNTLYTAEQINNDPFDAENFNLLDELAGAVDETWQGLKDTFSLSVLA
FT                   NPIEASKGDGEMTTGSMGMMSSKFGSSISAYSYLIFVLLYVPCVSVMGAIARETSRGWM
FT                   TFSILWGLNVAYSLATLFYQAATFRDHPQESLSIIVLVIVVNALILFGLRRARSRVTVR
FT                   LQNSEPANCCRSSGSNCH"
FT   gene            complement(145110..145337)
FT                   /gene="feoA"
FT                   /locus_tag="YP_0134"
FT                   /old_locus_tag="YP0134"
FT   CDS_pept        complement(145110..145337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feoA"
FT                   /locus_tag="YP_0134"
FT                   /old_locus_tag="YP0134"
FT                   /product="putative ferrous iron transport protein A"
FT                   /note="similar to Yersinia pestis CO92 feoA and Yersinia
FT                   pestis KIM feoA"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60412"
FT                   /db_xref="GOA:A0A3N4B1C8"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B1C8"
FT                   /protein_id="AAS60412.1"
FT                   /translation="MHLIPQRSYKIIGFSPEISPAYRQKLLSLGMLPGSSFNVVRLAPL
FT                   GDPIQIETRRVSLVVRKKDLDLLTLDLQPQ"
FT   gene            complement(145861..148236)
FT                   /locus_tag="YP_0135"
FT                   /old_locus_tag="YP0135"
FT   CDS_pept        complement(145861..148236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0135"
FT                   /old_locus_tag="YP0135"
FT                   /product="putative RNA binding protein, Contains S1 domain"
FT                   /note="similar to Yersinia pestis CO92 YPO0134 and Yersinia
FT                   pestis KIM y3913. Contains Ribosomal protein S1
FT                   (Interpro|IPR000110, (GO:0006412)). Contains RNA binding S1
FT                   (Interpro|IPR003029, (GO:0003723)). Contains Ribonuclease
FT                   RNase H fold containing (Interpro|IPR006641)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60413"
FT                   /db_xref="GOA:A0A3N4BAU7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BAU7"
FT                   /protein_id="AAS60413.1"
FT                   /translation="MNEPLSRIIASELQARPEQVISAIRLLDEGNTVPFISRYRKEVTG
FT                   GLDDIQLRQLESRLGYLRELEDRRQTILKSIEDQGKLTDQLAGAINATLSKTELEDLYL
FT                   PYKPKRRTRGQIAIEAGLEPLAERLWQDPQQDPEHTALAYVDADKGVADTKAALDGARY
FT                   ILMERFAEDATLLAKVRQYLWKNAHLVSKVVEGKEQEGAKFRDYFDHHEPIAQVPSHRA
FT                   LAMFRGRNEGVLQLALDPDPQFDEPPRESQGEQIIINHLDLRLNNAPADGWRKAVVNWT
FT                   WRIKVLLHLETELMSTLRERAEDEAINVFARNMQDLLMAAPAGMRATMGLDPGLRTGVK
FT                   VAVVDATGKLVAFDTIYPHTGQAAKAAAVVAALCIKHQVELVAIGNGTASRETERFFVE
FT                   LQQQYPAVTAQKVIVSEAGASVYSASELASQEFPDLDVSIRGAVSIARRLQDPLAELVK
FT                   IDPKSIGVGQYQHDVSQSQLAKKLDAVVEDCVNAVGVDLNTASVPLLTRVAGLTRMMAQ
FT                   NIVNWRDENGRFRNREQLLKVSRLGPKAFEQCAGFLRINHGDNPLDASTVHPEAYPVVE
FT                   RILAATEQALQDLMGNANALRNLNARDFTTERFGVPTVTDILRELEKPGRDPRSEFKTA
FT                   TFAEGVETLNDLTPGMILEGAVTNVTNFGAFVDIGVHQDGLVHISSLADKFVDDPHKVV
FT                   KAGDIVKVKVMEVDLQRKRIALTMRLDEQPGETHSRRSNNGTGSERTNNDNRGVNRPHN
FT                   DAKGHNAPNRAPAKGRSDSSSAGNSAMSDALAAAFKKR"
FT   gene            148770..149285
FT                   /gene="greB"
FT                   /locus_tag="YP_0136"
FT                   /old_locus_tag="YP0136"
FT   CDS_pept        148770..149285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greB"
FT                   /locus_tag="YP_0136"
FT                   /old_locus_tag="YP0136"
FT                   /product="transcription elongation factor"
FT                   /note="similar to Yersinia pestis CO92 greB and Yersinia
FT                   pestis KIM greB. Contains Prokaryotic transcription
FT                   elongation factor GreA/GreB (Interpro|IPR001437,
FT                   (GO:0006355)). Contains Prokaryotic transcription
FT                   elongation factor GreB (Interpro|IPR006358)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60414"
FT                   /db_xref="GOA:Q8ZJH2"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006358"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJH2"
FT                   /protein_id="AAS60414.1"
FT                   /translation="MAKSNYITREGWQALDRELHYLWREERPVVTQAVSEAAAMGDRSE
FT                   NAEYIYGKKRLREIDRRVRFLAKRLEVLKIVDPDPRQEGKVFFGAWVRVENEQEEQRIF
FT                   RLVGPDEFDPAKKWISIDSPVARALIGKQVDDEVTVQTPNGEATYWILEIRYRPFDEDR
FT                   PFNEDIDN"
FT   gene            149421..150140
FT                   /gene="ompR1"
FT                   /locus_tag="YP_0137"
FT                   /old_locus_tag="YP0137"
FT   CDS_pept        149421..150140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompR1"
FT                   /locus_tag="YP_0137"
FT                   /old_locus_tag="YP0137"
FT                   /product="transcriptional regulatory protein"
FT                   /note="similar to Yersinia pestis CO92 ompR and Yersinia
FT                   pestis KIM ompR. Contains Response regulator receiver
FT                   (Interpro|IPR001789, (GO:0006355)). Contains
FT                   Transcriptional regulatory protein, C terminal
FT                   (Interpro|IPR001867, (GO:0006355)). Contains Response
FT                   regulator receiver (Interpro|IPR001789, (GO:0006355)).
FT                   Contains Transcriptional regulatory protein, C terminal
FT                   (Interpro|IPR001867, (GO:0006355))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60415"
FT                   /db_xref="GOA:A0A3N4AWW8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AWW8"
FT                   /protein_id="AAS60415.1"
FT                   /translation="MQENHKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLT
FT                   RESFHLMVLDLMLPGEDGLSICRRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIP
FT                   KPFNPRELLARIRAVLRRQANELPGAPSQEEAIIAFGKFKLNLGTREMFREDEPMPLTS
FT                   GEFAVLKALVSHPREPLSRDKLMNLARGREYSAMERSIDVQISRLRRMVEEDPAHPRYI
FT                   QTVWGLGYVFVPDGNKA"
FT   gene            150137..151489
FT                   /gene="envZ"
FT                   /locus_tag="YP_0138"
FT                   /old_locus_tag="YP0138"
FT   CDS_pept        150137..151489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="envZ"
FT                   /locus_tag="YP_0138"
FT                   /old_locus_tag="YP0138"
FT                   /product="osmolarity sensor protein"
FT                   /note="similar to Yersinia pestis CO92 envZ and Yersinia
FT                   pestis KIM envZ. Contains Basic helix-loop-helix
FT                   dimerization domain bHLH (Interpro|IPR001092). Contains
FT                   ATP-binding region, ATPase-like (Interpro|IPR003594,
FT                   (GO:0005524)). Contains Histidine kinase, HAMP region
FT                   (Interpro|IPR003660, (GO:0016020)). Contains Histidine
FT                   kinase A, N-terminal (Interpro|IPR003661, (GO:0016020)).
FT                   Contains Bacterial sensor protein, C-terminal
FT                   (Interpro|IPR004358, (GO:0007165)). Contains Histidine
FT                   kinase (Interpro|IPR005467, (GO:0007165), (GO:0016301))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60416"
FT                   /db_xref="GOA:A0A0H2W065"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W065"
FT                   /protein_id="AAS60416.1"
FT                   /translation="MKWWRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQ
FT                   FNKVLAYEVRMLMTDRLQLEDGTLLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQH
FT                   YKFLSDQMAQQLGGPTDVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRY
FT                   TLAIMLLAVGGAWLFIRIQNRPLVELEHAALQVGKGNIPPPLREYGASEVRSVTRAFNQ
FT                   MAAGVKLLSDDRTLLMAGVSHDLRTPLTRIRLATEMMSDDDAYLSESINKDIEECNAII
FT                   EQFIDYLRTGQEMPTEPSDLNSVLGEVIAAESGYERVIETDLAEGEVLVDIHPLSIKRA
FT                   LTNMVVNAARYGNGWIKVSSGKELQRAWFQVEDDGPGIKPEDLKHLLQPFVRGDSARST
FT                   SGTGLGLAIVQRIIDAHAGSLEIGTSKRGGLRIRAYIPLPLDVKPKPPAVA"
FT   gene            complement(151624..153243)
FT                   /gene="pckA"
FT                   /locus_tag="YP_0139"
FT                   /old_locus_tag="YP0139"
FT   CDS_pept        complement(151624..153243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pckA"
FT                   /locus_tag="YP_0139"
FT                   /old_locus_tag="YP0139"
FT                   /product="phosphoenolpyruvate carboxykinase (ATP)"
FT                   /note="similar to Yersinia pestis CO92 pckA and Yersinia
FT                   pestis KIM pckA. Contains Phosphoenolpyruvate carboxykinase
FT                   (ATP) (Interpro|IPR001272, (GO:0006094)). Contains
FT                   ATP/GTP-binding site motif A (P-loop) (Interpro|IPR001687,
FT                   (GO:0005524))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60417"
FT                   /db_xref="GOA:Q8ZJG9"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJG9"
FT                   /protein_id="AAS60417.1"
FT                   /translation="MSVKGITPQELAAYGIHNVSEIVYNPSYDLLFEEETKPTLEGYER
FT                   GTLTTTGAIAVDTGIFTGRSPKDKYIVRDAITQDTVWWADQGKGKNDNKPLSQEIWNHL
FT                   KGLVTEQLSGKRLFVVDTFCGANADTRLQVRFITEVAWQAHFVKNMFIRPSDEELARFE
FT                   PDFIVMNGAKCTNPQWKEQGLNSENFVAFNLTERMQLIGGTWYGGEMKKGMFSMMNYLL
FT                   PLKGIASMHCSANVGEKGDVAIFFGLSGTGKTTLSTDPKRKLIGDDEHGWDDDGVFNFE
FT                   GGCYAKTIKLSEEAEPDIYHAIKRDALLENVVVLADGTVDFNDGSKTENTRVSYPIYHI
FT                   DNIVKPVSKAGHATKVIFLTADAFGVLPPVSRLTANQTQYHFLSGFTAKLAGTERGVTE
FT                   PTPTFSACFGAAFLSLHPTQYAEVLVKRMQAVGAQAYLVNTGWNGTGKRISIKDTRAII
FT                   DAILNGEIDKAETFTLPIFDLAVPMALPGVNPDILDPRDTYADKAQWQEKAEDLAKRFA
FT                   TNFDKYTDTPAGAALVSAGPKI"
FT   gene            complement(153440..154321)
FT                   /gene="hslO"
FT                   /locus_tag="YP_0140"
FT                   /old_locus_tag="YP0140"
FT   CDS_pept        complement(153440..154321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="YP_0140"
FT                   /old_locus_tag="YP0140"
FT                   /product="heat-shock chaperonin"
FT                   /note="similar to Yersinia pestis CO92 hslO and Yersinia
FT                   pestis KIM y3919. Contains Hsp33 protein
FT                   (Interpro|IPR000397)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60418"
FT                   /db_xref="GOA:Q8ZJG8"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJG8"
FT                   /protein_id="AAS60418.1"
FT                   /translation="MSNHDQLHRYLFANHAVRGELVSVNETYQQVLANHDYPPAVQKLL
FT                   GEMLVATSLLTATLKFDGDITVQLQGGDGPLTLAVINGNNRQEMRGVARVKGEISDDST
FT                   LQEMVGNGYLVITITPAQGERYQGVVALEGETIAACLENYFMQSEQLPTRLFIRTGHVA
FT                   DKAAAGGMLLQVLPAQERNEDEFDHLAQLTATIKAEELFTLPANEVLYRLYHQEEVTLY
FT                   EPQNVSFRCTCSRQRCADALVTLADDDVTEMLEQDGNIDMHCEYCGNHYLFDAVDIATL
FT                   KNGNSASSEQIH"
FT   gene            complement(154484..154891)
FT                   /gene="hslR"
FT                   /locus_tag="YP_0141"
FT                   /old_locus_tag="YP0141"
FT   CDS_pept        complement(154484..154891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslR"
FT                   /locus_tag="YP_0141"
FT                   /old_locus_tag="YP0141"
FT                   /product="heat shock protein 15"
FT                   /note="similar to Yersinia pestis CO92 hslR and Yersinia
FT                   pestis KIM y3920. Contains RNA-binding S4
FT                   (Interpro|IPR002942, (GO:0003723))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60419"
FT                   /db_xref="GOA:A0A3N4AWW1"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AWW1"
FT                   /protein_id="AAS60419.1"
FT                   /translation="MKDKISPAESVRLDKWLWAARFYKTRAIARDMVDGGKVHYNGQRS
FT                   KPSKLVELHAEIRLRQGNDERTVRVLALHSQRRGAEEAQTLYEETEASIANREKVAQAR
FT                   KLNALTMPHPDRRPDKKERRNLIKFKQGEPE"
FT   gene            complement(154920..155600)
FT                   /locus_tag="YP_0142"
FT                   /old_locus_tag="YP0142"
FT   CDS_pept        complement(154920..155600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0142"
FT                   /old_locus_tag="YP0142"
FT                   /product="putative hydrolases of the HAD superfamily"
FT                   /note="similar to Yersinia pestis CO92 YPO0141 and Yersinia
FT                   pestis KIM y3921. Contains Haloacid dehalogenase/epoxide
FT                   hydrolase (Interpro|IPR005833, (GO:0008152), (GO:0016787)).
FT                   Contains Haloacid dehalogenase-like hydrolase
FT                   (Interpro|IPR005834, (GO:0008152), (GO:0016787)). Contains
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3
FT                   (Interpro|IPR006402)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60420"
FT                   /db_xref="GOA:A0A2S9PJW3"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PJW3"
FT                   /protein_id="AAS60420.1"
FT                   /translation="MPPDFNWQEIDTVLLDMDGTLLDLAFDSHFWLKLVPETLSQRRGI
FT                   PLEQAHKIIHDEYNAVQHTLNWYCFDYWRERLDLDIYAMTTDIGSRARLRQDTVPFLSG
FT                   LRQHGLQTILLTNAHPHSLAVKIEHTALDQHLDLLLSTHTFGYPKEDQRLWQAVTQHTG
FT                   LNPARTLFVDDSEAILDAAQTFGIRYCLGVENPDSSCADKTFHRHPAINDYRKLLPALQ
FT                   LRCE"
FT   gene            complement(155744..157891)
FT                   /locus_tag="YP_0143"
FT                   /old_locus_tag="YP0143"
FT   CDS_pept        complement(155744..157891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0143"
FT                   /old_locus_tag="YP0143"
FT                   /product="putative membrane protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0142 and Yersinia
FT                   pestis KIM y3922"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60421"
FT                   /db_xref="GOA:P58722"
FT                   /db_xref="InterPro:IPR010771"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58722"
FT                   /protein_id="AAS60421.1"
FT                   /translation="MSTIVLILALLLTSLIAVGLLWWLRFRRPHPITAALPFVKLTHRK
FT                   LTPEERVSIENYLRNQQNKHGFNTQPAFDSHALAASTSSTPMLVLTPQSDNVYSVTRAI
FT                   TRYGVASDEPNKWRYYLDSIEVHLPSAWEQYITQDNDVELIQTQTIPLVISLNGHTLNN
FT                   HQSENTYQPILPSVSKNASIRKEDSEHIELLNIRKETPEEYALHGPNGLKEACAICIAL
FT                   LLLFFALSGPTVTLPWLVIVAVSLTCWACWYLFRPLSEKDLREVHCLNGTPKRWGLFGE
FT                   SNQGQINNISLGIVDLIYPAHWGPYFVHDLGKKTHIDIYLNRQVVRQGAFLSLHDEMKM
FT                   FPLQRWGKNLTLIVGSLLVLVLLLIYVPLGLPLKLSVAWLQGAQSQQVTSVAALDKMPL
FT                   RIGDMLKAQGNGMCYVPPNIQNTRGFVFTPFDCSGIYWNTASPLPQPESETIEKAAALV
FT                   ETINKQLHPQGSDASVNPKLATAIEKSGMILLDDFSDIVLKTQALCSENTDCIRLKNAL
FT                   VNLGNAKNWSALVKRAQSGNLEGMNVLLRPISADVLENLINTAASSFVYRETHLATEAL
FT                   NSPPPGGFLITSDEGKQLVNHPAPTLPLFDYSALEQWRELQRLSALLLDTPFKAEGIIT
FT                   NITTDANGTRHIALHSEPDIVTLGRYLATSLLLLVLIFCLVVNMVLLIQRAMKNRRRMD
FT                   NIQRYYDDCFNQTLTPPPFLR"
FT   gene            158171..158365
FT                   /locus_tag="YP_0144"
FT                   /old_locus_tag="YP0144"
FT   CDS_pept        158171..158365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0144"
FT                   /old_locus_tag="YP0144"
FT                   /product="hypothetical protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0143"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60422"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LMG7"
FT                   /protein_id="AAS60422.1"
FT                   /translation="MLKTSKLYLTGIAIKVLINAQCDQVLIYPLSLTLQGCWLRVLTRI
FT                   TDLSQLIGIRVLAAYLQSQ"
FT   gene            158478..159023
FT                   /gene="mutT1"
FT                   /locus_tag="YP_0145"
FT                   /old_locus_tag="YP0145"
FT   CDS_pept        158478..159023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT1"
FT                   /locus_tag="YP_0145"
FT                   /old_locus_tag="YP0145"
FT                   /product="putative hydrolase"
FT                   /note="similar to Yersinia pestis CO92 YPO0144 and Yersinia
FT                   pestis KIM y3923. Contains NUDIX hydrolase
FT                   (Interpro|IPR000086). Contains Isopentenyl-diphosphate
FT                   delta-isomerase (Interpro|IPR002667, (GO:0008299))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60423"
FT                   /db_xref="GOA:A0A2S9PJW8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PJW8"
FT                   /protein_id="AAS60423.1"
FT                   /translation="MKHLQKPKILKIETVACSRLFNVEAVELEFSNGVQRIYERMRPSN
FT                   REAVMIVPVIGNDLLLIREYAVGIEEYELGFPKGLIDPGEGVLEAANRELMEEVGYGAE
FT                   RFDFLAKLTMAPSYFSSKMNIVIAHGLYPQSLEGDEPEPLPQVRWPIANMMALLNEADF
FT                   REARNVSALFLAHTFLNQ"
FT   gene            complement(159159..161714)
FT                   /gene="mrcA1"
FT                   /locus_tag="YP_0146"
FT                   /old_locus_tag="YP0146"
FT   CDS_pept        complement(159159..161714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcA1"
FT                   /locus_tag="YP_0146"
FT                   /old_locus_tag="YP0146"
FT                   /product="penicillin-binding protein"
FT                   /note="similar to Yersinia pestis CO92 mrcA and Yersinia
FT                   pestis KIM mrcA. Contains Glycosyl transferase, family 51
FT                   (Interpro|IPR001264, (GO:0009274)). Contains
FT                   Penicillin-binding protein, transpeptidase domain
FT                   (Interpro|IPR001460, (GO:0008233), (GO:0008658),
FT                   (GO:0009273))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60424"
FT                   /db_xref="GOA:A0A3N4BAV8"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BAV8"
FT                   /protein_id="AAS60424.1"
FT                   /translation="MKFVKYFLILAVCCILLGAASIFGLYKYIEPQLPDVATLKDIRLQ
FT                   TPMQVYSAEGELIAQFGEKRRIPLTLNQIPPEMVHAFIATEDSRFYDHHGVDPVGILRA
FT                   VSIAMLSGRASQGASTITQQLARNFFLSPERTLMRKIKEAFLAIRIEQMLTKDEILELY
FT                   LNKIYLGYRAYGVGAAAQVYFGKEVHELTLSQIAMIAGLPKAPSTFNPLYSHDRAVARR
FT                   NVVLLRMLDEKYITQAQYDQARSEELVANYHVPQIAFSAPYLAEMVRQEMIKRYGENAY
FT                   TDGYQVYTTITRKLQLAAVDSLRANVLAYDMRHGYRGPSNVLWKVGESAWSREQIIDSL
FT                   KALPVYGPLLPAVVTEADAAQATAMLADGSNVTLPMVGIRWARPFKSDNAQGPVPKKAT
FT                   DVVQPGQQIWVRKVDDNWWLAQVPDVNSALVSIDPNNGAIKALVGGFDFNQSKFNRATQ
FT                   ALRQVGSNIKPFLYTAAMDKGLTLATILNDLPITRWDSGAGTDWRPKNSPPTYDGPIRL
FT                   RQGLGQSKNVVMVRAMRAMGVDYAAEYLQRFGFPAQNIVHSESLALGSASFTPLQLVRG
FT                   YAVLANGGYLVDPYFITKITDDVGNVLFETKPKVVCDNCNLPVIYGDTQRSVVLSDDNI
FT                   ENVATSQNQNASNVPMPELEQVTPAQTTLNSEQQYAPHVISTPLAFLMRDALNSNIFGE
FT                   PGWMGTGWRAGRDLKRKDIGGKTGTTNSSKDAWFSGYGPDTVTSVWIGFDDHRRNLGRS
FT                   TASGAIPDQISGAEGGAKTAQPAWNDFMKVALEGLPEKQVPPPPGIVSVVIDKQTGKLS
FT                   NGGPGSRSEYFIDGTQPTEHTVHEVGTTLMDNGQTHELF"
FT   gene            161789..162730
FT                   /gene="ftsA1"
FT                   /locus_tag="YP_0147"
FT                   /old_locus_tag="YP0147"
FT   CDS_pept        161789..162730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA1"
FT                   /locus_tag="YP_0147"
FT                   /old_locus_tag="YP0147"
FT                   /product="putative ATPases of the HSP70 class involved in
FT                   cell division"
FT                   /note="similar to Yersinia pestis CO92 YPO0146 and Yersinia
FT                   pestis KIM y3925"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60425"
FT                   /db_xref="GOA:A0A3N4B0D9"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B0D9"
FT                   /protein_id="AAS60425.1"
FT                   /translation="MDTFFYSVSTWRSIKMYSQYWQVGLDIQMEAIRALAVIRRRNGWQ
FT                   LRYWWHKILPSGVLREGILHQPDILSEQLKLLRKQLPRHISLRIALPAQRILQHTIHVP
FT                   DRRLREPERDGFIKASASRLFPVNSQALALDYCRETVASSELLITAARQSEVQQWQACL
FT                   EQAGLSSQVIDIAPCALRYMATATGLSGPYWLVHRLANEWLWVSSSDMPFHSGVVAIET
FT                   ECRTQENDIRLLSALLAQLNMRGAGEDGAPLPVYYSSVVKESLPENTRSWSPLTAFAHY
FT                   QPPLPALPAAFTLAGGLAVRAADSLSAAGAGY"
FT   gene            162748..163335
FT                   /locus_tag="YP_0148"
FT                   /old_locus_tag="YP0148"
FT   CDS_pept        162748..163335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0148"
FT                   /old_locus_tag="YP0148"
FT                   /product="putative membrane protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0147 and Yersinia
FT                   pestis KIM y3927."
FT                   /db_xref="EnsemblGenomes-Gn:YP_0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60426"
FT                   /db_xref="GOA:A0A0H2W141"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W141"
FT                   /protein_id="AAS60426.1"
FT                   /translation="MPWRIARQQARYRFWRNTMLIQGIGLALYLVVVLMQARSEHKHRQ
FT                   GTAAALSQQQAALSQRQQQVQQAMAQLQRIKQHIQRYHQAHQPARGYSILLQQLSQQIP
FT                   ERCWLMALRQQGDVLSFEVISRDYATINAFLAMLGRQPLLVNVSLQGITQQDEGGFRFV
FT                   VHASWRDENHHVEGHHAEGHDIDGHHVAGDYE"
FT   gene            163283..163909
FT                   /locus_tag="YP_0149"
FT                   /old_locus_tag="YP0149"
FT   CDS_pept        163283..163909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0149"
FT                   /old_locus_tag="YP0149"
FT                   /product="hypothetical protein"
FT                   /note="similar to Yersinia pestis KIM y3928. Contains Tumor
FT                   Necrosis Factor (Interpro|IPR006052, (GO:0016020))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60427"
FT                   /db_xref="GOA:Q8CK97"
FT                   /db_xref="InterPro:IPR006052"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CK97"
FT                   /protein_id="AAS60427.1"
FT                   /translation="MQKAMISTVIMWQGTMNKSLQRCMDRPGWQLCLWQWFFLSLLGVI
FT                   AYGGLLRPTWQQRSEAIAEVTKLQQHVEQQVSALAQLPSQVLIRQQINTLLSEKAWWQK
FT                   PEILLAHQVGETIMPFGGQVIRWQRYSGSEEAVVENAIAFRRWEATLRVSFYGLYHLFG
FT                   QLSEIRSPVLVKVISLIGDGNALTVKLILTEYLTDDLGDFDVQDK"
FT   gene            163875..164303
FT                   /locus_tag="YP_0150"
FT                   /old_locus_tag="YP0150"
FT   CDS_pept        163875..164303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0150"
FT                   /old_locus_tag="YP0150"
FT                   /product="hypothetical protein"
FT                   /note="similar to Yersinia pestis KIM y3929"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60428"
FT                   /db_xref="InterPro:IPR019684"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CK96"
FT                   /protein_id="AAS60428.1"
FT                   /translation="MTWVILMFKINSYKINSYIAVLAMGLAATRLLVIGLLPSSIFASP
FT                   HLANIERDPFQAVLATSCDSERERLTGWKLHGVVSGGGYQSAWIQRPDATWQRLTLGMR
FT                   LVSEWQVTQISAQWVDFQYENPETPCSGLSVTFSLFQQ"
FT   gene            complement(164306..164695)
FT                   /locus_tag="YP_0151"
FT                   /old_locus_tag="YP0151"
FT   CDS_pept        complement(164306..164695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0151"
FT                   /old_locus_tag="YP0151"
FT                   /product="hypothetical protein"
FT                   /note="similar to Yersinia pestis KIM y3931."
FT                   /db_xref="EnsemblGenomes-Gn:YP_0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60429"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CK94"
FT                   /protein_id="AAS60429.1"
FT                   /translation="MTGPPLRVRGNEALLDEALFGEILLDETLFDKTLFDEVLFDEALF
FT                   DNLLSDKWLLEERLCDGTPMSKRHPINKLINPLERFKCLFLPGKYTKLKFVRLHHQVLN
FT                   CLPAAGIKIVISLLPFNADHHQTIH"
FT   gene            164730..165854
FT                   /gene="gspD1"
FT                   /locus_tag="YP_0152"
FT                   /old_locus_tag="YP0152"
FT   CDS_pept        164730..165854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspD1"
FT                   /locus_tag="YP_0152"
FT                   /old_locus_tag="YP0152"
FT                   /product="putative membrane transport protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0150 and Yersinia
FT                   pestis KIM hofQ. Contains Bacterial general secretion
FT                   pathway protein D (Interpro|IPR001775, (GO:0016020)).
FT                   Contains Filamentous bacteriophage Vg4 protein
FT                   (Interpro|IPR001814, (GO:0005554)). Contains Type III
FT                   secretion system outer membrane G protein
FT                   (Interpro|IPR003522, (GO:0009306), (GO:0015448)). Contains
FT                   Bacterial type II and III secretion system protein
FT                   (Interpro|IPR004846, (GO:0009306)). Contains NolW-like
FT                   (Interpro|IPR005644)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60430"
FT                   /db_xref="GOA:A0A384KY65"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KY65"
FT                   /protein_id="AAS60430.1"
FT                   /translation="MQALADYRQLNLITTTGVGGNLSLRLIEVPWEQALAIILRMGRLK
FT                   AEREGTVMMVFTEQEIQERQQRTKQQAAPEALANLTLALQYANAEQVADSLDPLQGGLL
FT                   SPLGSVVADKRTNTLLIRDTPASLALLKNWLIEMDLPLQQVQLSAHIVTISSEDLQELG
FT                   VRWGMGEGKGNTALRINDFNVNLPLPNSAASVGFHVARIGGRLLELELSALEQENQVDI
FT                   IASPRLITSHQQTASIKQGSDIPYTVSRGKKEAAAIEFKEAVLGMEVTPKILRNGKIIL
FT                   DLKISQNMPGITIKRGESEMLLIDKQEIKTQVTVNDGETIVLGGIFQQKKRQSVNKVPL
FT                   LADIPLLGAMFRQDTQQQSRRELVIFITPKLISA"
FT   gene            166203..166724
FT                   /gene="aroK1"
FT                   /locus_tag="YP_0153"
FT                   /old_locus_tag="YP0153"
FT   CDS_pept        166203..166724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK1"
FT                   /locus_tag="YP_0153"
FT                   /old_locus_tag="YP0153"
FT                   /product="shikimate kinase I"
FT                   /note="similar to Yersinia pestis CO92 aroK and Yersinia
FT                   pestis KIM aroK. Contains Shikimate kinase
FT                   (Interpro|IPR000623, (GO:0008652)). Contains
FT                   ATP/GTP-binding site motif A (P-loop) (Interpro|IPR001687,
FT                   (GO:0005524))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60431"
FT                   /db_xref="GOA:Q8ZJF7"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJF7"
FT                   /protein_id="AAS60431.1"
FT                   /translation="MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFFDSDQEIERRTGA
FT                   DVGWVFDVEGEEGFRDREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLE
FT                   TTIEKQLARTQRDKKRPLLQVDEPPREVLEALAKERNPLYEEIADVTIRTDDQSAKVVA
FT                   NQIINMLESN"
FT   gene            166781..167869
FT                   /gene="aroB"
FT                   /locus_tag="YP_0154"
FT                   /old_locus_tag="YP0154"
FT   CDS_pept        166781..167869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroB"
FT                   /locus_tag="YP_0154"
FT                   /old_locus_tag="YP0154"
FT                   /product="3-dehydroquinate synthase"
FT                   /note="similar to Yersinia pestis CO92 aroB and Yersinia
FT                   pestis KIM aroB. Contains 3-dehydroquinate synthase domain
FT                   (Interpro|IPR002658, (GO:0009073)). Contains
FT                   3-dehydroquinate synthase (Interpro|IPR006265)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60432"
FT                   /db_xref="GOA:Q8ZJF6"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJF6"
FT                   /protein_id="AAS60432.1"
FT                   /translation="MEKITVTLGERSYPITIAAGLFNDPASFKPLKAGDQVMLVTNQTL
FT                   APLYLDSLRAVLEHGGIKVDQVILPDGEQYKSLSVMEQVFSALLEKPHGRDTTLVALGG
FT                   GVVGDLTGFAAACYQRGVRFIQVPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPASV
FT                   VVDLNCLKTLPPRELASGLAEVIKYGIILDAAFFDWLENNIDALLALDMSALAYCIRRC
FT                   CELKADVVAADEREESGARALLNLGHTYGHAIEAEMGYGVWLHGEAVAAGMVMAAQTSR
FT                   RLGQLSVSDVERIKKLLLRAGLPVCGPKEMAPESYLPHMMRDKKVLAGELRLVLPTAIG
FT                   KSEIRGGVAHDMVLASIADCRP"
FT   gene            168123..169112
FT                   /gene="damX"
FT                   /locus_tag="YP_0155"
FT                   /old_locus_tag="YP0155"
FT   CDS_pept        168123..169112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="damX"
FT                   /locus_tag="YP_0155"
FT                   /old_locus_tag="YP0155"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0153"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60433"
FT                   /db_xref="GOA:A0A3N4AZN1"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR032899"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AZN1"
FT                   /protein_id="AAS60433.1"
FT                   /translation="MDDLKLDDDLKPDSSDRRPTRSRKSPTGPKLAVSRQHMMIGIGIL
FT                   VLLLIIIAIGSALKAPTEHEASQQNPNVNAARDINLSDSSSLTSGNNSQPSIANNTSDG
FT                   HDASGVKNTAPPQDISAPPISPTPTEAAIPPSANSTTQRIELPGNMSDALSQTQGQVDT
FT                   LSQNISDAHTSTLPTAAATVAPSKGAKVPATRETITQPVQKQATKQPAVNHKNTATVAV
FT                   PPATSGTPKSGAASSRALSSAPSSHYTLQLSSASRSDTLNAYAKQQNLTDYHVYETKRD
FT                   GKPWYILVSGNYASSAEAKKAITTLPADVQAKKPWVKPVQQVQQDLKK"
FT   gene            169196..170011
FT                   /gene="dam"
FT                   /locus_tag="YP_0156"
FT                   /old_locus_tag="YP0156"
FT   CDS_pept        169196..170011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dam"
FT                   /locus_tag="YP_0156"
FT                   /old_locus_tag="YP0156"
FT                   /product="DNA adenine methylase"
FT                   /note="similar to Yersinia pestis CO92 dam and Yersinia
FT                   pestis KIM dam. Contains N-6 Adenine-specific DNA methylase
FT                   (Interpro|IPR002052, (GO:0008170)). Contains N6
FT                   adenine-specific DNA methyltransferase, D12 class
FT                   (Interpro|IPR002294, (GO:0008170))."
FT                   /db_xref="EnsemblGenomes-Gn:YP_0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60434"
FT                   /db_xref="GOA:A0A2S9PJX3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PJX3"
FT                   /protein_id="AAS60434.1"
FT                   /translation="MKKNRAFLKWAGGKYPLVDDIRRHLPAGDCLIEPFVGAGSVFLNT
FT                   EFESYILADINNDLINLYNIVKLRTDDFVRDARVLFTGDFNHSELFYQLRQEFNASTDA
FT                   YRRALLFLYLNRHCYNGLCRYNLSGEFNVPFGRYKKPYFPEAELYWFAEKSQNAVFVCE
FT                   HYQETLLKAVQGAVVYCDPPYAPLSATANFTAYHTNNFGIADQQNLARLAYQLSTESKV
FT                   PVLISNHDTELTRNWYHQAASLHVVTARRTISRNILGRSKVNELLALYS"
FT   gene            170302..170991
FT                   /gene="rpe"
FT                   /locus_tag="YP_0157"
FT                   /old_locus_tag="YP0157"
FT   CDS_pept        170302..170991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /locus_tag="YP_0157"
FT                   /old_locus_tag="YP0157"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /note="similar to Yersinia pestis CO92 rpe and Yersinia
FT                   pestis KIM rpe. Contains Ribulose-phosphate 3-epimerase
FT                   (Interpro|IPR000056, (GO:0005975))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60435"
FT                   /db_xref="GOA:Q8CZJ6"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZJ6"
FT                   /protein_id="AAS60435.1"
FT                   /translation="MEKRMKKYLIAPSILSADFARLGEDTAKVLAAGADIVHFDVMDNH
FT                   YVPNLTIGPMVCKALRDYGITAPIDVHLMVKPVDRIVPDFAKAGATYITFHPEASEHVD
FT                   RTLQLIKESGCKAGLVFNPATPLSYLDYVMDKLDVILLMSVNPGFGGQSFIPETLNKLR
FT                   QVRKLIDDSGYDIRLEVDGGVKVENIRQIAAAGADMFVAGSAIFNQPDYAAVIDAMRNE
FT                   LAMAANG"
FT   gene            170951..171682
FT                   /gene="gph"
FT                   /locus_tag="YP_0158"
FT                   /old_locus_tag="YP0158"
FT   CDS_pept        170951..171682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gph"
FT                   /locus_tag="YP_0158"
FT                   /old_locus_tag="YP0158"
FT                   /product="phosphoglycolate phosphatase"
FT                   /note="similar to Yersinia pestis KIM gph. Contains
FT                   Haloacid dehalogenase/epoxide hydrolase
FT                   (Interpro|IPR005833, (GO:0008152), (GO:0016787)). Contains
FT                   Haloacid dehalogenase-like hydrolase (Interpro|IPR005834,
FT                   (GO:0008152), (GO:0016787)). Contains 2-phosphoglycolate
FT                   phosphatase, prokaryotic (Interpro|IPR006346). Contains
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3
FT                   (Interpro|IPR006402). Contains HAD-superfamily hydrolase,
FT                   subfamily IA, variant 1 (Interpro|IPR006439)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60436"
FT                   /db_xref="GOA:Q8ZJF3"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJF3"
FT                   /protein_id="AAS60436.1"
FT                   /translation="MPCAMNWRWRLMVKFKAIRGVAFDLDGTLVDSAPGLARAIDMALA
FT                   HQGLPAAGEALVSTWIGNGADVLVERALHWAGREHNAQLVAQTRELFDHYYAKTVEQGS
FT                   QLFPQVKATLAQLAANGLPIGLITNKPTPFVAPLLTSLGISDYFSVIIGGDDVVVKKPH
FT                   PAPLYLLLGKLGLHAREMLFVGDSRNDIMAAQAAGCPCIGLTYGYNYGEAIATSHPDCV
FT                   LAHFADLLPAIGLPSLKDQEV"
FT   gene            171765..172724
FT                   /gene="trpS"
FT                   /locus_tag="YP_0159"
FT                   /old_locus_tag="YP0159"
FT   CDS_pept        171765..172724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="YP_0159"
FT                   /old_locus_tag="YP0159"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /note="similar to Yersinia pestis CO92 trpS and Yersinia
FT                   pestis KIM trpS. Contains Aminoacyl-tRNA synthetase, class
FT                   Ib (Interpro|IPR002305, (GO:0006418)). Contains
FT                   Tryptophanyl-tRNA synthetase, class Ib (Interpro|IPR002306,
FT                   (GO:0006436))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60437"
FT                   /db_xref="GOA:Q8ZJF2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="PDB:3N9I"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJF2"
FT                   /protein_id="AAS60437.1"
FT                   /translation="MTIGNYMGALRQWVQMQDDYDCIYCIVDLHAITARQDPALLRKRT
FT                   LDTLALYLACGIDPKKSTIFVQSHVPEHSQLSWALNCYTYFGELSRMTQFKDKSARYAE
FT                   NINAGLFDYPVLMAADILLYQTNQVPVGEDQKQHLELSRDIASRFNNLYGDIFKIPEPF
FT                   IPKAGARVMSLQDPTKKMSKSDDNRNNVIELLEDPKSVVKKIKRAMTDSDEPALIRYDV
FT                   EKKAGVSNLLDILSGVTGQSIPELEAQFTGQMYGHLKGAVADAVSGMLSELQERYRTYR
FT                   EDEALLQDVMREGAAKARARAQVTLAKVYEAIGFVAQP"
FT   gene            complement(172879..174291)
FT                   /gene="cysG1"
FT                   /locus_tag="YP_0160"
FT                   /old_locus_tag="YP0160"
FT   CDS_pept        complement(172879..174291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysG1"
FT                   /locus_tag="YP_0160"
FT                   /old_locus_tag="YP0160"
FT                   /product="siroheme synthase"
FT                   /note="similar to Yersinia pestis CO92 cysG. Contains
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase (Interpro|IPR000878, (GO:0008152),
FT                   (GO:0008168)). Contains Uroporphiryn-III
FT                   C-methyltransferase (Interpro|IPR003043, (GO:0006779),
FT                   (GO:0008168)). Contains Uroporphyrin-III
FT                   C-methyltransferase, C-terminal (Interpro|IPR006366).
FT                   Contains Siroheme synthase, N-terminal
FT                   (Interpro|IPR006367)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60438"
FT                   /db_xref="GOA:Q74Y23"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR019478"
FT                   /db_xref="InterPro:IPR028281"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037115"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q74Y23"
FT                   /protein_id="AAS60438.1"
FT                   /translation="MDYFPIFCQLQHKACLLVGGGEIAERKARLLLDAGALVTVNACEF
FT                   TPQFHHWADQGQLSLISGEFVPELLADKWLVIAATDQLSVNALVYQSANQQRIFCNVVD
FT                   DPKRTSFIMPSIIDRSPIMIAVSSGGKAPVLARLLREKLEALLPQHLGQLAGNLRQRVK
FT                   QHFTVMTERRRFWEKLLTHDRLAQSLANNDHVQADQHVEQLFSAPLTDRGEVVLVGAGP
FT                   GDAGLLTLKGLQQIQQADVVVYDRLVSDEVMNLVRRDAERIFVGKQSGHHCVPQEQINQ
FT                   ILLQQAQSGKRVVRLKGGDPFIFGRGGEELEELAGYGIPFSVVPGITAASGCSAYSGIP
FT                   LTHRDHAQSVRLVTGHAKKEGQLDWANLAAEKQTLVFYMGLSQAGEIQQQLIQHGMPAT
FT                   TQVALVENGTSRHQRVVSGELSQLALLSQQVSSPSLIIVGSVVSLREKLNWFSSRHHDD
FT                   QPKVTECVAHVG"
FT   gene            complement(174379..175185)
FT                   /gene="nirC"
FT                   /locus_tag="YP_0161"
FT                   /old_locus_tag="YP0161"
FT   CDS_pept        complement(174379..175185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirC"
FT                   /locus_tag="YP_0161"
FT                   /old_locus_tag="YP0161"
FT                   /product="putative nitrite transporter"
FT                   /note="similar to Yersinia pestis CO92 nirC and Yersinia
FT                   pestis KIM nirC. Contains Formate/nitrite transporter
FT                   (Interpro|IPR000292, (GO:0016020))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60439"
FT                   /db_xref="GOA:A0A2U2H294"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR024002"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2U2H294"
FT                   /protein_id="AAS60439.1"
FT                   /translation="MYTDTINKCAANAARIVKLAKESPLGFWIGSAMAGAYVGLGIILI
FT                   FTLGNLIDPALRPLVMGATFGLALTLVIIAGSELFTGHTMFLTFGVKAGTIKSSQMWAV
FT                   LPQTWLGNLLGSVFVALLYYYGGGNLLSVDTSLVHTAALAKTTAPAMTLFFKGVLCNWL
FT                   VCLAIWMAIRVEGAAKFIAIWWCLLAFIASGYEHSVANMTLLALSWFGHHSEAYTLSGI
FT                   GHNLLWVTLGNTLSGAVFMGLGYWYATPRAQRPQPATINAPHSAKS"
FT   gene            complement(175364..175690)
FT                   /gene="nirD"
FT                   /locus_tag="YP_0162"
FT                   /old_locus_tag="YP0162"
FT   CDS_pept        complement(175364..175690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirD"
FT                   /locus_tag="YP_0162"
FT                   /old_locus_tag="YP0162"
FT                   /product="nitrite reductase small subunit"
FT                   /note="similar to Yersinia pestis CO92 nirD and Yersinia
FT                   pestis KIM nirD"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60440"
FT                   /db_xref="GOA:A0A380PIG5"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017881"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A0A380PIG5"
FT                   /protein_id="AAS60440.1"
FT                   /translation="MSQWIPLCPLNDILPGSGVCGLIKQQQVAVFRPYADEQVFAISNI
FT                   DPFAQASVLSRGLIAEHQGELWVASPLKKQHFRLRDGFCLEDEDRSVTHYDVRVRDGMV
FT                   QVNA"
FT   gene            complement(175687..178233)
FT                   /gene="nirB"
FT                   /locus_tag="YP_0163"
FT                   /old_locus_tag="YP0163"
FT   CDS_pept        complement(175687..178233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirB"
FT                   /locus_tag="YP_0163"
FT                   /old_locus_tag="YP0163"
FT                   /product="nitrite reductase"
FT                   /note="similar to Yersinia pestis CO92 nirB and Yersinia
FT                   pestis KIM nirB. Contains Pyridine nucleotide-disulphide
FT                   oxidoreductase, class-II (Interpro|IPR000103, (GO:0006118),
FT                   (GO:0008246)). Contains Serine proteases, subtilase family
FT                   (Interpro|IPR000209, (GO:0006508)). Contains Pyridine
FT                   nucleotide-disulphide oxidoreductase, class I
FT                   (Interpro|IPR001100, (GO:0006118), (GO:0008246)). Contains
FT                   FAD-dependent pyridine nucleotide-disulphide oxidoreductase
FT                   (Interpro|IPR001327, (GO:0006118), (GO:0015036)). Contains
FT                   Nitrite/sulfite reductase ferredoxin-like half domain
FT                   (Interpro|IPR005117). Contains Nitrite and sulfite
FT                   reductase iron-sulfur/siroheme-binding site
FT                   (Interpro|IPR006066, (GO:0006118)). Contains Nitrite and
FT                   sulphite reductase 4Fe-4S domain (Interpro|IPR006067,
FT                   (GO:0006118))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60441"
FT                   /db_xref="GOA:A0A2S9PJY9"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PJY9"
FT                   /protein_id="AAS60441.1"
FT                   /translation="MSKIKIAIIGNGMVGHRFIEDLLDKADKDQFDITVFCEEPRIAYD
FT                   RVHLSSYFSHHTAEELSLVREGFYEKQGVKVLVGERAITINRAEKVIHSNSGRSLYYDK
FT                   LVMATGSYPWIPPIKGSEGQDCFVYRTIEDLNAIEACTRRSKRGAVIGGGLLGLEAAGA
FT                   LKSLGVETHVIEFAPVLMAEQLDPMGGDQLRQKIERMGVRVHTGKNTQEIVHSGQNSRK
FT                   TMLFADGTQLEVDFIVFSTGIRPQDKLANQCGLATARRGGIAINDYCQTSDPDVYAIGE
FT                   CASWQERTFGLVAPGYKMAQVAADHLLGRENAFLGADMSAKLKLLGVDVGGIGDAHGRT
FT                   EGARSYVYLDESKEIYKRLVVSADNKTLLGAVLVGDTTDYGNLLQLALNNITLPENPDS
FT                   LILPAHAGNKPTIGVDSLPDSAQICSCFDVTKGDIIRAIGQGCQTVAALKSATKAGTGC
FT                   GGCIPLVTQVLNAELSKQGIEVNNHLCEHFAYSRQELYHLIRVEGIKTFTELREKYGKG
FT                   YGCEVCKPTVGSLLASCWNEYVLEPQHTPLQDTNDNFLGNIQKDGTYSIIPRSPGGEIT
FT                   PDGLLVVGQIAKEYNLYTKLTGSQRIGMFGAQKDDLPAIWARLIDAGFETGHAYAKALR
FT                   MAKTCVGSTWCRFGVGDSVGFGVALEHRYKGIRAPHKIKFGISGCTRECAEAQGKDVGI
FT                   IATENGWNLYVCGNGGMKPRHADLLAADLDEETLMRYLDRFMMFYIRTADKLQRTSVWL
FT                   ESLEGGIRYLQLVILEDKLGINDQLEAEIARLRDKVACEWKATVENPAAQVRFAHFINS
FT                   SLRDPNVQVVREREQHRPARPDERIPVRVLELEDNA"
FT   gene            178543..179853
FT                   /gene="codA"
FT                   /locus_tag="YP_0164"
FT                   /old_locus_tag="YP0164"
FT   CDS_pept        178543..179853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="codA"
FT                   /locus_tag="YP_0164"
FT                   /old_locus_tag="YP0164"
FT                   /product="cytosine deaminase"
FT                   /note="similar to Yersinia pestis CO92 codA and Yersinia
FT                   pestis KIM codA. Contains Amidohydrolase
FT                   (Interpro|IPR006680)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60442"
FT                   /db_xref="GOA:A0A3N4AYC4"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AYC4"
FT                   /protein_id="AAS60442.1"
FT                   /translation="MEALMAGQSVPNYSLTTVNNVRRIGLAGLWQITIAEGKISLIQPQ
FT                   PEQSLTGQGVLDAQGGLALPPFIEPHIHLDTTQTAGQPSWNQSGTLFEGIERWAERKAR
FT                   LTREDVKQRAWQTLKWQIANGIQHVRTHVDVSDPHLTALSAMLEVKEEVSPWVDMQIVA
FT                   FPQEGILSYPDGAALLEEALRLGADAVGAIPHFEFTREYGVESLHIAFALAQKYQRLVD
FT                   VHCDETDDEQSRFIETVAALALRENMGARVTASHTTAMHSYNGAYTSRLFRLLKLSGIN
FT                   FVANPLVNIHLQGRFDTYPKRRGITRVKEMLAAEINVCFGHDDVFDPWYPLGTANMLQV
FT                   LHMGLHICQLMGYEQINDGLNLITTHSAKTLNLADYGLQPGNRANLIILPAENGFDALR
FT                   RQVPVSYSIRHGVVIAKTQPAESRIYLGQEEIVDFRR"
FT   gene            complement(179938..181122)
FT                   /gene="proP2"
FT                   /locus_tag="YP_0165"
FT                   /old_locus_tag="YP0165"
FT   CDS_pept        complement(179938..181122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proP2"
FT                   /locus_tag="YP_0165"
FT                   /old_locus_tag="YP0165"
FT                   /product="conserved integral membrane protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0163 and Yersinia
FT                   pestis KIM y3947. Contains Tetracycline resistance protein
FT                   TetB (Interpro|IPR001411, (GO:0016021)). Contains Major
FT                   facilitator superfamily (MFS) (Interpro|IPR007114)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60443"
FT                   /db_xref="GOA:Q8ZJE6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR023528"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJE6"
FT                   /protein_id="AAS60443.1"
FT                   /translation="MNNSNRIRLTWISYLSYALTGALVIVTGIVMGNIAEYFNLPIASM
FT                   SNTFTFLNAGILISIFLNAWLMEIIPLKRQLVFGFILMLIAIAGLMVGHNLMIFSISMF
FT                   IFGVVSGITMSIGTFLVTHMYEGRQRGSRLLFTDSFFSMAGMIFPIAAAMLLARHIEWY
FT                   WVYACIGLLYVGIFVLTLCSEFPVLGHKATDQSKPVVKEKWGVGVLFLAIAALCYILGQ
FT                   LGFIQWVPEYATKTFNMNISQAGQLVSNFWISYMIGMWIFSFILRFFDLQRIVTVLAAM
FT                   ATLAMYLFVSTDNPAYLSYYILALGFVSSAIYTTLITLGSLQTKVSSPKLVNFILTCGT
FT                   VGTMLTFVVTGPIVANNGVHAALETANGLYLAVFILCLALGFFTKHRSHGHVTH"
FT   gene            181608..183668
FT                   /gene="cirA1"
FT                   /locus_tag="YP_0166"
FT                   /old_locus_tag="YP0166"
FT   CDS_pept        181608..183668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cirA1"
FT                   /locus_tag="YP_0166"
FT                   /old_locus_tag="YP0166"
FT                   /product="putative membrane receptor protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0164 and Yersinia
FT                   pestis KIM y3948. Contains TonB-dependent receptor protein
FT                   (Interpro|IPR000531, (GO:0016020))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60444"
FT                   /db_xref="GOA:A0A0H2W224"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010100"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W224"
FT                   /protein_id="AAS60444.1"
FT                   /translation="MISGKNKVCKKKLLACAVTSAISAFASNAIASNAIADTTSLAAMN
FT                   RSAINISSTHNSNKKLNDADVITVTAPLYSPLVVVTSPKVPRQPVPASDGTDYLRTIPG
FT                   FSLVRNGGTNGDVVFRGMFGSRLKILTDGAEILGTCPSRMDAPTSYISPESFDLLTVVK
FT                   GPQSVLWGPGVSAGTILFERERPHFDQSGVKGNASVLAGSNGRWDKNLDASLGNEQGYL
FT                   RMMGNQSRAADYKDGNNVRVPSQWDKWNADMALGWTPDTDTLLELSVGKGNGEARYGGR
FT                   GMDGSQFLRESLAARVEKSNIGEVLDKIEAKINYTYVDHIMDNKTLRTPPMMAMSSNLD
FT                   RRMLGGRVMGTWLWQDLKLDAGTDMQTNTHRKNKQGNWDKNARFMNNGVFGELTWAASE
FT                   QNKLISGARLDRHQVTNYTRAGEPTRSATLPAAFMRVEHNLANAPVMLYAGLGHTERFP
FT                   DYWELFSPKFGPAGSTSAFEGVKSEKTTQIDIGGQYSGEQFRGWLSAYIGRVNDFILFK
FT                   YDPKNLRISQADNINATIMGGEMGMEYALTPYWKADASLAYAWGENTRDNRPLPQIPPL
FT                   EARLGLTFEAGDWSSSALWRLVNSQHRVAINEGNVVGKDFSSSAGFGVLSANVAYKVNK
FT                   QVKLSSGIDNLLNKAYSEHLNLAGNSGFGYSVNTPLNEPGRTLWAKLNLTF"
FT   gene            complement(183757..184743)
FT                   /gene="purR2"
FT                   /locus_tag="YP_0167"
FT                   /old_locus_tag="YP0167"
FT   CDS_pept        complement(183757..184743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purR2"
FT                   /locus_tag="YP_0167"
FT                   /old_locus_tag="YP0167"
FT                   /product="LacI-family transcriptional regulator"
FT                   /note="similar to Yersinia pestis CO92 YPO0165 and Yersinia
FT                   pestis KIM y3949. Contains Bacterial regulatory protein
FT                   LacI, HTH motif (Interpro|IPR000843, (GO:0006355)).
FT                   Contains Periplasmic binding protein/LacI transcriptional
FT                   regulator (Interpro|IPR001761)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60445"
FT                   /db_xref="GOA:A0A3N4B0G7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B0G7"
FT                   /protein_id="AAS60445.1"
FT                   /translation="MVTLEDVAVLAGVSRATVSRVVNGDTNVKALTREKVEQAVAVLGY
FT                   TPHPAARALASSQSNTLGLVTTSYRGGFFGALMDFVQTETESQGKQLLVTQGRDNADKE
FT                   WLAIQRLYNLRCDGLILHVRFLSDERLRQLAAANRPFVLLDRLVPDLEARCVTFDHHHA
FT                   SQMATQVLIDAGHRDIACISGSSQRQSSVLRIQGFLDAMQLAGLEPVACLEGVYDLESG
FT                   YLRADEILKQPRLPTAIYCCNEEMAIGALLAINKHGLQVPQDISLICYDSGERAPFVCP
FT                   ALTSVHFPIVEMAQYATQLLIDPLIPAVNFPPAIIMRDSVMPPKTAC"
FT   gene            complement(184992..186305)
FT                   /pseudo
FT                   /locus_tag="YP_0168"
FT                   /old_locus_tag="YP0168"
FT                   /note="similar to Yersinia pestis CO92 YPO0166 and Yersinia
FT                   pestis KIM y3950. This CDS Contains a nonsense mutation at
FT                   codon 193. The sequence has been checked and is believed to
FT                   be correct. Contains Glycoside hydrolase, family 4
FT                   (Interpro|IPR001088, (GO:0005975))"
FT   gene            186791..187390
FT                   /gene="ppiA"
FT                   /locus_tag="YP_0169"
FT                   /old_locus_tag="YP0169"
FT   CDS_pept        186791..187390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiA"
FT                   /locus_tag="YP_0169"
FT                   /old_locus_tag="YP0169"
FT                   /product="peptidyl-prolyl cis-trans isomerase A"
FT                   /note="similar to Yersinia pestis CO92 ppiA and Yersinia
FT                   pestis KIM ppiA. Contains Peptidyl-prolyl cis-trans
FT                   isomerase, cyclophilin type (Interpro|IPR002130,
FT                   (GO:0006457))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60446"
FT                   /db_xref="GOA:Q8CZJ4"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZJ4"
FT                   /protein_id="AAS60446.1"
FT                   /translation="MSASHRKEPLMFKRTLVTFIALCSLSAVAPAALAAGEPHVLLTTS
FT                   AGNIELELNSQKAPISTQNFVDYVNNGYYNNTIFHRVIPGFMIQGGGFTADFKEKTPKT
FT                   PIKNEADNGLRNLRGTISMARTADKDSATSQFFLNVADNAFLDHGQRDFGYAVFGKVVK
FT                   GMDVVEKISQVQTENVGPYQNVPVKPITILSAKVLP"
FT   gene            187716..189257
FT                   /locus_tag="YP_0170"
FT                   /old_locus_tag="YP0170"
FT   CDS_pept        187716..189257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0170"
FT                   /old_locus_tag="YP0170"
FT                   /product="putative ATPase"
FT                   /note="similar to Yersinia pestis CO92 YPO0168 and Yersinia
FT                   pestis KIM y3952. Contains ATP/GTP-binding site motif A
FT                   (P-loop) (Interpro|IPR001687, (GO:0005524))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60447"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WKD4"
FT                   /protein_id="AAS60447.1"
FT                   /translation="MSNTLLIGKALVTEKTQPASRDLVILSALANRHGLITGATGTGKT
FT                   VTLQKMAEQFSRIGVPVFLADVKGDLSGIGAEGVNSEKLQARLAAIDVTDWQPQACPIV
FT                   PWDIFAEKGHPIRATISDLGPLLLGRLLDLNDVQSGVLQLVFKIADDNGLLLLDMKDLR
FT                   AIVQYVGDNAKQFRTQYGNITSASIGAIQRGLLTLEEQGANQFFGEPMLDIHDLMQTDS
FT                   HGQGVINLLAADRLINQPKLYAIFLLWLLAELFEQLPEVGDVEKPKLVFFFDEAHLLFT
FT                   DAPAALVDKVEQVVRLIRSKGVGIYFVTQNPLDIPDKILGQLGNRVQHALRAFTPRDQK
FT                   AVKAAAQTMRPNPAFSAEQVITELGVGEALISFLDEKGRPNVVERAMVIAPQSKMGALD
FT                   AAARNHAINHSPLYGRYEEMIDRESAYEKLSAGGFSTMGRAAEGEPSVPQQPTNQQGSG
FT                   GGLMGGLNDLLFGSSGPRGGKRDGIVQTAAKSMARDLGRQILRGVLGSITGGRKR"
FT   gene            189500..190075
FT                   /gene="pabA"
FT                   /locus_tag="YP_0171"
FT                   /old_locus_tag="YP0171"
FT   CDS_pept        189500..190075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /locus_tag="YP_0171"
FT                   /old_locus_tag="YP0171"
FT                   /product="p-aminobenzoate synthetase, component II"
FT                   /note="similar to Yersinia pestis KIM pabA. Contains
FT                   Glutamine amidotransferase class-I (Interpro|IPR000991,
FT                   (GO:0003824)). Contains Carbamoyl-phosphate synthase,
FT                   GATase domain (Interpro|IPR001317). Contains Anthranilate
FT                   synthase component II/delta crystallin
FT                   (Interpro|IPR006220). Contains Glutamine amidotransferase
FT                   of anthranilate synthase (Interpro|IPR006221)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60448"
FT                   /db_xref="GOA:A0A2U2H276"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2U2H276"
FT                   /protein_id="AAS60448.1"
FT                   /translation="MLLLIDNYDSFTYNLYQYFCELGTEVMVKRNDELQLTDIEQLAPS
FT                   HVVISPGPCTPNEAGISLAVIRHFADKLPILGVCLGHQALGQAFGARVVRARQVMHGKT
FT                   SAICHSGQGVFRGLNQPLTVTRYHSLVIATDSLPGCFELTAWTERGGEMDEIMGIRHRT
FT                   LPLEGVQFHPESILSEQGHQLLDNFLKN"
FT   gene            190196..191425
FT                   /gene="argD"
FT                   /locus_tag="YP_0172"
FT                   /old_locus_tag="YP0172"
FT   CDS_pept        190196..191425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /locus_tag="YP_0172"
FT                   /old_locus_tag="YP0172"
FT                   /product="acetylornithine delta-aminotransferase"
FT                   /note="similar to Yersinia pestis KIM argD. Contains
FT                   Acetylornithine and succinylornithine aminotransferase
FT                   (Interpro|IPR004636, (GO:0006525), (GO:0008483)). Contains
FT                   Aminotransferase class-III (Interpro|IPR005814,
FT                   (GO:0008483))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60449"
FT                   /db_xref="GOA:P59324"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR017652"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59324"
FT                   /protein_id="AAS60449.1"
FT                   /translation="MGSVMTDKLAVNRNTFDQVILPVYAPAQFIPVKGKGSRVWDQQGT
FT                   EYIDFAGGIAVTALGHCHPALVSALHQQGETLWHTSNVFTNEPALRLAQKLIAATFADR
FT                   VFFANSGAEANEAAFKLARHYAIERHSPYKTKIIAFHNAFHGCTLFTVSVGGQPKYSDG
FT                   FGPKPADIIHVPFNDLAAVKAVMDDHTCAVVLEPIQGEGGITSATPEFLQGVRALCDQH
FT                   NALLVFDEVQSGMGRSGKLFSYMHYGVTPDILTTAKALGGGFPISAMLTTEEIASVMTV
FT                   GTHGTTYGGNPLACAVAEAALDVINTPEVLNGIEQRHGLFVQALQSINSKYDVFSDIRG
FT                   MGLLIGAELTAKYRGQAREFLAAAAANGLMILNAGPDVLRLAPSLVIELEDIQQGMARL
FT                   EKAMASVIKG"
FT   gene            complement(191651..193771)
FT                   /locus_tag="YP_0173"
FT                   /old_locus_tag="YP0173"
FT   CDS_pept        complement(191651..193771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0173"
FT                   /old_locus_tag="YP0173"
FT                   /product="putative membrane protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0174 and Yersinia
FT                   pestis KIM y3955"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60450"
FT                   /db_xref="GOA:A0A3N4AZQ2"
FT                   /db_xref="InterPro:IPR010020"
FT                   /db_xref="InterPro:IPR032692"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AZQ2"
FT                   /protein_id="AAS60450.1"
FT                   /translation="MKWQRLIYHPEVNYALRQTLVLCLPAALGFAIGDLRLGLMFSLIP
FT                   ACCNIASLDTPHQHFFRRLIIGGVLFTLSSFLTQQLLLWHIPLPVIMLGLALIVGVSGT
FT                   ISPLNGRLLPAALIAAIFSLSMVGRAPIWQAPLLCAVGTLWYGVFNWLWFRLCKDQPIR
FT                   EPLSQLYHLLADYCDAKYSRLTQHLEPEKAIPPLLDRQQGMMDKVNQLYQQFNLLHNTT
FT                   KKEQKRLLGLFQMALDLQEHITAALNQPEEMQDLIKKTPIEAVTQSNAQIISAQMRAIA
FT                   DDILYHRRTVEHFTAGVPLAELETIAQQNPDNPVAQFCYYHISHITQILSDRRPLYNRD
FT                   LMSSQLSQPFWPALVSYLSFKSSALRDAARIGVTLAVGSYIGVLINLPKPYWILLTIML
FT                   VMQNGYNATRVRIHHRALGTLVGLILAAGLLHLQMTEITTLGIMLLITLLSYLVQRKNY
FT                   GLAVVGRTITAVYILQLLTGEGANFLVPRLLDTLIGCALALGSALWLWPQWQSGLLRKN
FT                   AHQALEAYQTILRLLLTPHPDITQLDYERFNVNKASNTVLSSLNQAMQEPGFNSKYLAD
FT                   MRLWATHSELIVCHINEMTTLIRENPLTEVDSPSTGGHTLMSTKLAASYLQLCEMAIQL
FT                   CQQRLESDNLEDNDSVVQIPDMAPDTQASELERNLRRVLSHLNVMHTVSAMAWQQQPHH
FT                   GIWRSRKLRDNT"
FT   gene            complement(193857..194489)
FT                   /gene="crp"
FT                   /locus_tag="YP_0174"
FT                   /old_locus_tag="YP0174"
FT   CDS_pept        complement(193857..194489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crp"
FT                   /locus_tag="YP_0174"
FT                   /old_locus_tag="YP0174"
FT                   /product="cAMP-regulatory protein"
FT                   /note="similar to Yersinia pestis CO92 crp and Yersinia
FT                   pestis KIM crp. Contains Bacterial regulatory proteins,
FT                   AsnC family (Interpro|IPR000485, (GO:0006355)). Contains
FT                   Cyclic nucleotide-binding domain (Interpro|IPR000595).
FT                   Contains Bacterial regulatory protein, Crp family
FT                   (Interpro|IPR001808, (GO:0006355)). Contains cAMP-dependent
FT                   protein kinase (Interpro|IPR002373, Cellular Component:
FT                   cAMP-dependent protein kinase complex (GO:0005952),
FT                   (GO:0006468), (GO:0008603))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60451"
FT                   /db_xref="GOA:A0A3N4AYD5"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AYD5"
FT                   /protein_id="AAS60451.1"
FT                   /translation="MVLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVK
FT                   GSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFR
FT                   QLIQVNPDILMRLSSQMANRLQITSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDG
FT                   MQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR"
FT   gene            194825..195232
FT                   /locus_tag="YP_0175"
FT                   /old_locus_tag="YP0175"
FT   CDS_pept        194825..195232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0175"
FT                   /old_locus_tag="YP0175"
FT                   /product="putative redox protein, regulator of disulfide
FT                   bond formation"
FT                   /note="similar to Yersinia pestis CO92 YPO0176 and Yersinia
FT                   pestis KIM y3957. Contains OsmC-like protein
FT                   (Interpro|IPR003718, (GO:0006950))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60452"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B1G3"
FT                   /protein_id="AAS60452.1"
FT                   /translation="MQARVKWVEGLTFLGESASGHQVLMDGNSGDKAPSPMEMLLMSAG
FT                   GCSAIDVVSILQKGRNNVRDCEVKLTSERREEAPRLFTQINLHFIVSGKGLTDKVVERA
FT                   VDLSAEKYCSVALMLGKAATITHSFEVREVA"
FT   gene            195304..195735
FT                   /gene="proP3"
FT                   /locus_tag="YP_0176"
FT                   /old_locus_tag="YP0176"
FT   CDS_pept        195304..195735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proP3"
FT                   /locus_tag="YP_0176"
FT                   /old_locus_tag="YP0176"
FT                   /product="Permeases of the major facilitator superfamily"
FT                   /note="similar to Yersinia pestis CO92 YPO0177 and Yersinia
FT                   pestis KIM y3958"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60453"
FT                   /db_xref="GOA:A0A3N4BAY6"
FT                   /db_xref="InterPro:IPR010665"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BAY6"
FT                   /protein_id="AAS60453.1"
FT                   /translation="MKYLILGGYTVVANKNKISVACGAISLFVVASFSLFFSLTHYFNF
FT                   FKMNDEVHFSWAVSLLLSGSPLLFYLSVVSGGYIIGYEKIYNDRVGKILAYIAVLGMVF
FT                   SLFFSFYVDSSLKEAGYLKCERKSFIAPNKYVIDLKLCR"
FT   gene            complement(195913..196818)
FT                   /gene="prk"
FT                   /locus_tag="YP_0177"
FT                   /old_locus_tag="YP0177"
FT   CDS_pept        complement(195913..196818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prk"
FT                   /locus_tag="YP_0177"
FT                   /old_locus_tag="YP0177"
FT                   /product="phosphoribulokinase 1"
FT                   /note="similar to Yersinia pestis CO92 prk and Yersinia
FT                   pestis KIM prkB. Contains Phosphoribulokinase
FT                   (Interpro|IPR006082, (GO:0008974)). Contains
FT                   Phosphoribulokinase/uridine kinase (Interpro|IPR006083,
FT                   (GO:0016301))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60454"
FT                   /db_xref="GOA:Q8CZJ2"
FT                   /db_xref="InterPro:IPR006082"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZJ2"
FT                   /protein_id="AAS60454.1"
FT                   /translation="MPPLQPHGVSANMSTKHPVIAVTGSSGAGTTTTSLAFRKIFQQLD
FT                   IRAAQIEGDSFHRYTRPEMDAAIRKARDQGRHISYFGPEANDFGQLEQSVAEYSKHGTG
FT                   RSRKYLHTYDEAVPYNQIPGTFTPWEPLPEPTDVLFYEGLHGGVVTEHHDVAKHVDLLV
FT                   GVVPIVNLEWIQKLVRDTGERGHSREAVMDSVVRSMDDYINYITPQFSRTHINFQRVPT
FT                   VDTSNPFAAKAIPSLDESFVVIHFRGLDHIDFPYLLAMLQGSFISNINTLVVPGGKMGL
FT                   AMELIMAPLVQQLLEGKQIA"
FT   gene            complement(196931..197167)
FT                   /locus_tag="YP_0178"
FT                   /old_locus_tag="YP0178"
FT   CDS_pept        complement(196931..197167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0178"
FT                   /old_locus_tag="YP0178"
FT                   /product="hypothetical protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0179 and Yersinia
FT                   pestis KIM y3960"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60455"
FT                   /db_xref="InterPro:IPR010648"
FT                   /db_xref="InterPro:IPR036685"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJD4"
FT                   /protein_id="AAS60455.1"
FT                   /translation="MIIPWQQVDSETLDNLLEAFVLREGTDYGEHERSLTEKVADVRRQ
FT                   LVSGEAVLVWSELHETINIMPRGSFRAGAEEQQ"
FT   gene            complement(197164..198144)
FT                   /locus_tag="YP_0179"
FT                   /old_locus_tag="YP0179"
FT   CDS_pept        complement(197164..198144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0179"
FT                   /old_locus_tag="YP0179"
FT                   /product="putative hydrolase of the alpha/beta-hydrolase
FT                   fold"
FT                   /note="similar to Yersinia pestis CO92 YPO0180 and Yersinia
FT                   pestis KIM y3961. Contains Alpha/beta hydrolase fold
FT                   (Interpro|IPR000073). Contains
FT                   Esterase/lipase/thioesterase, active site
FT                   (Interpro|IPR000379, (GO:0003824)). Contains Protein of
FT                   unknown function UPF0017 (Interpro|IPR000952,
FT                   (GO:0005554))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60456"
FT                   /db_xref="GOA:A0A3N4AX04"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000952"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AX04"
FT                   /protein_id="AAS60456.1"
FT                   /translation="MHETFRPLAGASNPHLQTLLPRLVRRHVQLSPYWQRLELPDGDFI
FT                   DLAWSENPELAREKPRVVLFHGLEGNFYSPYAHGLLRAWQAAGWLGVVMHFRGCSGEPN
FT                   RKSRIYHSGETEDANFFLHWLQETYGQVPTAAVGISLGGNMLACYLAKKGKNSGLRAAV
FT                   VVSAPLMLEPCADRMDQGFSRVYQRYLLNQLKLNATRKLLQYPNSLPVNLFQLKKLRRV
FT                   RDFDDAITAKIHGFNDAGDYYRRCSALPLLPQIRVPLLIIHAKDDPFMTAEVIPNIETL
FT                   PDNIDYQLTEHGGHVGFVGGSLKHPQMWLEQRIPAWLSPYLEQQS"
FT   gene            198270..198848
FT                   /gene="rhtB1"
FT                   /locus_tag="YP_0180"
FT                   /old_locus_tag="YP0180"
FT   CDS_pept        198270..198848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhtB1"
FT                   /locus_tag="YP_0180"
FT                   /old_locus_tag="YP0180"
FT                   /product="Putative threonine efflux protein"
FT                   /note="similar to Yersinia pestis KIM y3962. Contains
FT                   Lysine exporter protein (LYSE/YGGA) (Interpro|IPR001123,
FT                   (GO:0016020)). Contains ABC transporter
FT                   (Interpro|IPR003439, (GO:0016020))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60457"
FT                   /db_xref="GOA:Q8CK91"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CK91"
FT                   /protein_id="AAS60457.1"
FT                   /translation="MVGFLWVAAITPGPNNMLLTSTGANFGFMRSIWLMLGIMLGMQSM
FT                   LLLVAFGVGSLILIYPSLHLALKILGSLYLLWLAWKIATSAYEKLDTNVAPAKPLRLYQ
FT                   GWLLQFLNPKAWLMGLGSVASFSMAGAAYNHSILMISLGMFMVNLVAGIIWLGFGTLIG
FT                   RLLGSRRAWFTFNISMGLLTAACVLLIWH"
FT   gene            199051..200109
FT                   /gene="tauA1"
FT                   /locus_tag="YP_0181"
FT                   /old_locus_tag="YP0181"
FT   CDS_pept        199051..200109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauA1"
FT                   /locus_tag="YP_0181"
FT                   /old_locus_tag="YP0181"
FT                   /product="putative taurine-binding periplasmic protein
FT                   precursor"
FT                   /note="similar to Yersinia pestis CO92 tauA and Yersinia
FT                   pestis KIM tauA. Contains Bacterial extracellular
FT                   solute-binding protein, family 3 (Interpro|IPR001638,
FT                   (GO:0030288))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60458"
FT                   /db_xref="GOA:A0A0H2W2I8"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W2I8"
FT                   /protein_id="AAS60458.1"
FT                   /translation="MAITFSSATLAASRRSFLQLRTILLASLLPASLLLATSAQAVDVI
FT                   VAYQTSAEPAKVAQADNSFAKLSGANADWRKFDSGSSVVRALASGDVQIGNIGSSPLAV
FT                   AASQNVPIEVFLLASQLGSSEALVVKKEIKTPQDLIGKRIAVPFISTAHYSLLAALKHW
FT                   GIKPGQVTILNLQPPAIAAWQRGDIDGAYVWAPAVSELAKTGTVLTDSAQVGQWGAPTL
FT                   DVWVVRKDFAKAHPEVVTAFARSALAAQAAYLNNPEQWLQNQAHLAPLSRLSGVPTEQV
FT                   PALVKGNTYLPVAEQITQLGQPVDQAIRDTAEFLKQQGKIPQVASDYRDFVTDRFVKEI
FT                   QATPQSQATPQS"
FT   gene            200118..200885
FT                   /gene="tauB1"
FT                   /locus_tag="YP_0182"
FT                   /old_locus_tag="YP0182"
FT   CDS_pept        200118..200885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauB1"
FT                   /locus_tag="YP_0182"
FT                   /old_locus_tag="YP0182"
FT                   /product="putative taurine transport ATP-binding protein"
FT                   /note="similar to Yersinia pestis CO92 tauB and Yersinia
FT                   pestis KIM tauB. Contains ATP/GTP-binding site motif A
FT                   (P-loop) (Interpro|IPR001687, (GO:0005524)). Contains ABC
FT                   transporter (Interpro|IPR003439, (GO:0016020)). Contains
FT                   AAA ATPase (Interpro|IPR003593, (GO:0000166)). Contains
FT                   ATP/GTP-binding site motif A (P-loop) (Interpro|IPR001687,
FT                   (GO:0005524)). Contains ABC transporter
FT                   (Interpro|IPR003439, (GO:0016020)). Contains AAA ATPase
FT                   (Interpro|IPR003593, (GO:0000166))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60459"
FT                   /db_xref="GOA:Q8ZJD0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015859"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJD0"
FT                   /protein_id="AAS60459.1"
FT                   /translation="MLNVSGLWAEYQGKPALQDVSLQIASGQLVVVLGPSGCGKTTLLN
FT                   LIAGFMTPSAGVITLDNIPVSGPSAERGVVFQNEGLLPWRDVVSNVEFGLQLAGMSKEQ
FT                   RRVTALKMLNRVGLAGFEHHFIWQLSGGMRQRVGIARALAVDPRLLLLDEPFGALDAFT
FT                   REQMQELLLTIWRDTGKQILLITHDIEEAVFLASELLLLSPGPGQVVERLSLNFGQRYA
FT                   EGEPCRAIKSDPEFIARREDVLGKVFQQREVLI"
FT   gene            200882..201736
FT                   /gene="tauC1"
FT                   /locus_tag="YP_0183"
FT                   /old_locus_tag="YP0183"
FT   CDS_pept        200882..201736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauC1"
FT                   /locus_tag="YP_0183"
FT                   /old_locus_tag="YP0183"
FT                   /product="putative taurine transport system permease
FT                   protein"
FT                   /note="similar to Yersinia pestis CO92 tauC and Yersinia
FT                   pestis KIM tauC. Contains Binding-protein-dependent
FT                   transport systems inner membrane component
FT                   (Interpro|IPR000515, (GO:0016020)). Contains
FT                   Sodium:dicarboxylate symporter (Interpro|IPR001991,
FT                   (GO:0016020))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60460"
FT                   /db_xref="GOA:A0A3N4AZR5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AZR5"
FT                   /protein_id="AAS60460.1"
FT                   /translation="MSLHSTLRNQAINLPAADAPKKTPRRLPANQTLWISIATLASVVA
FT                   LWWAVTALQLIGPLFLPAPQQVLHQLWTIASPQGFMDATLWQHLAASLGRIFVALLAAV
FT                   VLGVPTGIAMGLNSNVRGVLDPLIEIYRPVPPLAYLPLMVIWFGIGETSKILLIYLAIF
FT                   APVTLAAVAGVRSVAHVRVRAARALGASRWQVLWFVVLPSALPEILTGIRIGLGVGWST
FT                   LVAAELIAATRGLGFMVQSAGEFLATDVVIAGISVIAIIAFGMELSLRAIQRRLTPWYG
FT                   EQQ"
FT   gene            201715..202581
FT                   /gene="tauD"
FT                   /locus_tag="YP_0184"
FT                   /old_locus_tag="YP0184"
FT   CDS_pept        201715..202581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauD"
FT                   /locus_tag="YP_0184"
FT                   /old_locus_tag="YP0184"
FT                   /product="putative taurine dioxygenase"
FT                   /note="similar to Yersinia pestis CO92 tauD and Yersinia
FT                   pestis KIM tauD. Contains Taurine catabolism dioxygenase
FT                   TauD/TfdA (Interpro|IPR003819, (GO:0006118), (GO:0016491))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60461"
FT                   /db_xref="GOA:Q8CZJ1"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZJ1"
FT                   /protein_id="AAS60461.1"
FT                   /translation="MVWRTTMNERLIVTPLGPHIGALVENINIAHPLGDSQFEQLYHVL
FT                   LKHQVLFFRNQPITPLQQRDLAGRFGDLHIHPVYPHTQECEEIIVLDTADDNPPDNDNW
FT                   HTDVTFIETPPLGAILAAKQLPTTGGDTLWSSGIAAYDALSAPFKQLLAGLQAEHDFTK
FT                   SFPEHKHRTTPEEHQRWLQGKEKNPPLLHPVIRTHPVSGRQALFVNEGFTTRIIGLSDK
FT                   ESEALLGFLFAHTTKPEFQVRWRWQQDDVAIWDNRVTQHYANADYLPQRRVMHRATILG
FT                   DRPVFRP"
FT   gene            complement(202594..203560)
FT                   /pseudo
FT                   /locus_tag="YP_0185"
FT                   /old_locus_tag="YP0185"
FT                   /note="similar to Yersinia pestis CO92 YPO0186 and Yersinia
FT                   pestis KIM rafQ. Note this CDS Contains a possible
FT                   frameshift mutation following codon 34. The sequence has
FT                   been checked and is believed to be correct."
FT   gene            complement(203653..204642)
FT                   /gene="wcaA"
FT                   /locus_tag="YP_0186"
FT                   /old_locus_tag="YP0186"
FT   CDS_pept        complement(203653..204642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wcaA"
FT                   /locus_tag="YP_0186"
FT                   /old_locus_tag="YP0186"
FT                   /product="putative glycosyl transferase"
FT                   /note="similar to Yersinia pestis CO92 YPO0187 and Yersinia
FT                   pestis KIM y3968. Contains Glycosyl transferase, family 2
FT                   (Interpro|IPR001173)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60462"
FT                   /db_xref="GOA:A0A2S9PK03"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PK03"
FT                   /protein_id="AAS60462.1"
FT                   /translation="MNSVDISVIVPVYNCANYLTDLLDSLRSQTGVSLEIIAVNDGSTD
FT                   HSLALLEQVAHIDSRLVIINQQNQGLSEARNVGIAKAKGNWVAFADGDDWLAPHALSTW
FT                   LQQVKQQKLDVLIGNGYQFSSNPERKPVTPLLGQQPWGATLNGQQWIILSVKQKEWPHY
FT                   AWLQLIRRDVISTHQLQFIRDMLHEDILWTTQLALVAQRIGFCATPFYGYRTNPDSITN
FT                   SPSMQALLRRANSYVDIINALVKIAASTKPPVRDALLSHANQESGHLLGLLRKKLPASP
FT                   QRTALAIRFITLGLRPALFRGVTNLHELWRAIRCSFLMGSYARQKRAE"
FT   gene            complement(204777..206699)
FT                   /gene="uup1"
FT                   /locus_tag="YP_0187"
FT                   /old_locus_tag="YP0187"
FT   CDS_pept        complement(204777..206699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uup1"
FT                   /locus_tag="YP_0187"
FT                   /old_locus_tag="YP0187"
FT                   /product="ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /note="Best Blastp hit = gi|16766748|ref|NP_462363.1|
FT                   (NC_003197) putative ATPase component of ABC transporter
FT                   with duplicated ATPase domain [Salmonella typhimurium LT2],
FT                   gi|16422016|gb|AAL22322.1| (AE008858) putative ATPase
FT                   component of ABC transporter [Salmonella typhimurium
FT                   LT2],(len:635 aa);. Contains ATP/GTP-binding site motif A
FT                   (P-loop) (Interpro|IPR001687, (GO:0005524)). Contains
FT                   Spectrin repeat (Interpro|IPR002017). Contains ABC
FT                   transporter (Interpro|IPR003439, (GO:0016020)). Contains
FT                   AAA ATPase (Interpro|IPR003593, (GO:0000166))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60463"
FT                   /db_xref="GOA:A0A0H2W091"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W091"
FT                   /protein_id="AAS60463.1"
FT                   /translation="MIVFSSLQIRRGTRVLLDNATATINPGQKVGLVGKNGCGKSTLLA
FT                   LLKGELSADGGNVTFPNNWALAWVNQETPALDIPAIEYVIDGDREYRQLEAELQAANEK
FT                   NDGHAIATVHGKLDAIHAWTIQSRAASLLHGLGFSQEKLQQPVRSFSGGWRMRLNLAQA
FT                   LVCRSDLLLLDEPTNHLDLDAVIWLEKWLKSYTGTLVLISHDRDFLDPIIDKILHIEQQ
FT                   TLNEYTGNYSSFERQRATKLSQQQSMYQHQQEKVAHLQSYIDRFRAQATKAKQAQSRIK
FT                   MLERMELIAPAHVDNPFHFSFRTPESLPDPLLRMDKVSAGYGENTVLQSIKLNLVPGSR
FT                   IGLLGRNGAGKSTLIKLLAGTLEPQSGEIALSKGIKLGYFAQHQLEFLRADESPLQHMS
FT                   RLAPKESEQQLRDYLGGYGFQGDQVTDPTARFSGGEKARLVLALIIWQRPNLLLLDEPT
FT                   NHLDLDMRQALTEALIDFEGALVVVSHDRHLLRSTTDDLYLVHDGKVEQFDGDLEDYQQ
FT                   WLVDSQRQQSQQDNPAKELSGNSAQQRKDQKRRDAEFRTQTQPLRKQIMTLEKQMDKLS
FT                   TELAAIEAQLADSALYDIARKADLTQCLLQQTQVKSKLEETEMQWLDVQEQLEILTKEF
FT                   SDADI"
FT   gene            206947..207498
FT                   /gene="mdaB1"
FT                   /locus_tag="YP_0188"
FT                   /old_locus_tag="YP0188"
FT   CDS_pept        206947..207498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdaB1"
FT                   /locus_tag="YP_0188"
FT                   /old_locus_tag="YP0188"
FT                   /product="Putative NADPH-quinone reductase (modulator of
FT                   drug activity B)"
FT                   /note="similar to Yersinia pestis CO92 YPO0190 and Yersinia
FT                   pestis KIM y3971. Contains NAD(P)H dehydrogenase (quinone)
FT                   (Interpro|IPR003680, (GO:0006118))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60464"
FT                   /db_xref="GOA:Q8ZJC5"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023947"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJC5"
FT                   /protein_id="AAS60464.1"
FT                   /translation="MMLQPPKVLLLYAHPESQDSVANRVLLQPVQQLEHVTVHDLYAHY
FT                   PDFFIDIHHEQQLLRDHQVIVFQHPLYTYSCPALLKEWLDRVLARGFANGVGGHALTGK
FT                   HWRSVITTGEQEGTYRIGGYNRYPMEDILRPFELTAAMCHMHWINPMIIYWARRQKPET
FT                   LASHAQAYVQWLQSPLTRGL"
FT   gene            207502..209310
FT                   /gene="kefB"
FT                   /locus_tag="YP_0189"
FT                   /old_locus_tag="YP0189"
FT   CDS_pept        207502..209310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefB"
FT                   /locus_tag="YP_0189"
FT                   /old_locus_tag="YP0189"
FT                   /product="putative potassium-efflux system protein"
FT                   /note="similar to Yersinia pestis CO92 kefB and Yersinia
FT                   pestis KIM kefB. Contains TrkA-N (Interpro|IPR003148,
FT                   (GO:0006813)). Contains Potassium efflux system protein
FT                   (Interpro|IPR004771, (GO:0006812), (GO:0016021)). Contains
FT                   TrkA potassium uptake protein (Interpro|IPR006036,
FT                   (GO:0006813), (GO:0008324)). Contains Sodium/hydrogen
FT                   exchanger (Interpro|IPR006153, (GO:0006885), (GO:0016021))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60465"
FT                   /db_xref="GOA:Q8ZJC4"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR020884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJC4"
FT                   /protein_id="AAS60465.1"
FT                   /translation="MEGTGLLTAVLVFLFAAVVAVPIAQRLGIGAVLGYLIAGIAIGPW
FT                   GLGFIRDVDEILHFSELGVVFLMFIIGLELNPAKLWQLRRSIFGVGAGQVVITAAVLGA
FT                   LLYFTQFAWQAAVIGGVGLAMSSTAMALQLMREKGMNRNEGGQLGFSVLLFQDMAVIPA
FT                   LALIPILAGNEGGANDWVKIGLKIAAFAGMLIGGRYLLRPLFRYIVASGVREVFTAAAL
FT                   LVVLGSALFMDALGLSMALGTFIAGILLAESEFQHELEIAIEPFKGLLLGLFFISVGMA
FT                   LDLGVLFTHLLDVLLGVLALVFIKSAILYGLARVFGLRRSVRLQFAGVLSQGGEFAFVL
FT                   FSAAFSQRVLNAEQLALLLVVVTLSMMTTPLLMQVIDRILVRRYNAQEESDEKPFVEDN
FT                   DPQVIIVGFGRFGQVIGRLLMANKMRITVLERDVSAVSMMRKYGYKVYYGDATELELLR
FT                   AAGAEKAKAIVITCNEPEDTMALVHLCQQHFPNLHILARARGRVEAHELLQNGVKDFTR
FT                   ETFSSALELGRKTLLELGMHPHQAYRAQQHFRRLDMRMLRELMPQHHGDVAQISRIKEA
FT                   RRELEDIFQREMLHESRQLDGWDEYE"
FT   gene            209326..209547
FT                   /locus_tag="YP_0190"
FT                   /old_locus_tag="YP0190"
FT   CDS_pept        209326..209547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0190"
FT                   /old_locus_tag="YP0190"
FT                   /product="putative nucleic-acid-binding protein containing
FT                   a Zn-ribbon domain"
FT                   /note="similar to Yersinia pestis CO92 YPO0192 and Yersinia
FT                   pestis KIM y3973"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60466"
FT                   /db_xref="InterPro:IPR012658"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AX14"
FT                   /protein_id="AAS60466.1"
FT                   /translation="MTITLNKTVTRKRFIAGAVCPQCNALDTLALWREDQVEVVECVKC
FT                   GHHQRQTDEQVNKHVRPHEQVIGIFPPE"
FT   gene            209609..210223
FT                   /gene="slyD"
FT                   /locus_tag="YP_0191"
FT                   /old_locus_tag="YP0191"
FT   CDS_pept        209609..210223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slyD"
FT                   /locus_tag="YP_0191"
FT                   /old_locus_tag="YP0191"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /note="similar to Yersinia pestis CO92 slyD and Yersinia
FT                   pestis KIM slyD. Contains Peptidylprolyl isomerase,
FT                   FKBP-type (Interpro|IPR001179). Contains ATP/GTP-binding
FT                   site motif A (P-loop) (Interpro|IPR001687, (GO:0005524))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60467"
FT                   /db_xref="GOA:Q7CFU4"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CFU4"
FT                   /protein_id="AAS60467.1"
FT                   /translation="MPIFVPRVGDIMKVTKDLVVSLAYQVRTEDGVLVDESPVSAPLDY
FT                   LHGHGSLIAGLENALEGHEAGDSFDVRVNADEGYGSYDENLVQRVPKDVFMGVDELEVG
FT                   MRFLADTDQGPVPVEITAVEDEHVVVDGNHMLAGQDLNFHVEVVAVREATEEELQHGHV
FT                   HGEHDHHHEHGDGCCGGHGHDDHEHEHGKGGCGKSGGCGCH"
FT   gene            210208..210408
FT                   /gene="proP4"
FT                   /locus_tag="YP_0192"
FT                   /old_locus_tag="YP0192"
FT   CDS_pept        210208..210408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proP4"
FT                   /locus_tag="YP_0192"
FT                   /old_locus_tag="YP0192"
FT                   /product="Permeases of the major facilitator superfamily"
FT                   /note="no significant database match found"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60468"
FT                   /db_xref="GOA:A0A3N4AX15"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AX15"
FT                   /protein_id="AAS60468.1"
FT                   /translation="MWLSLISDPVSKKPAFIAGFLLCTRSLIFCVIANDLVITAASGAD
FT                   IKINQPRFGGNQWLLKPINGY"
FT   gene            complement(210444..210662)
FT                   /gene="slyX"
FT                   /locus_tag="YP_0193"
FT                   /old_locus_tag="YP0193"
FT   CDS_pept        complement(210444..210662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slyX"
FT                   /locus_tag="YP_0193"
FT                   /old_locus_tag="YP0193"
FT                   /product="phage lysis protein"
FT                   /note="similar to Yersinia pestis KIM slyX; host factor for
FT                   lysis of phiX174 infection"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60469"
FT                   /db_xref="InterPro:IPR007236"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJC1"
FT                   /protein_id="AAS60469.1"
FT                   /translation="MEQSLLEQRLEMLESRLAFQEVTIEELNLIVTEHQMEMTKLREHL
FT                   RLLTDKLRESQSSMLASPSEETPPPHY"
FT   gene            210938..211777
FT                   /gene="fkpA"
FT                   /locus_tag="YP_0194"
FT                   /old_locus_tag="YP0194"
FT   CDS_pept        210938..211777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fkpA"
FT                   /locus_tag="YP_0194"
FT                   /old_locus_tag="YP0194"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /note="similar to Yersinia pestis CO92 fkpA and Yersinia
FT                   pestis KIM fkpA. Contains Domain amino terminal to
FT                   FKBP-type peptidyl-prolyl isomerase (Interpro|IPR000774,
FT                   (GO:0006457)). Contains Peptidylprolyl isomerase, FKBP-type
FT                   (Interpro|IPR001179)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60470"
FT                   /db_xref="GOA:Q8CWG3"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CWG3"
FT                   /protein_id="AAS60470.1"
FT                   /translation="MLGVRVLKPMEKWMKSLFKVTLLATAMTLTLNTSTVFAADATSPV
FT                   VTNSAFKNNDQQSAYALGASLGRYMDNSLKEQEKLGIKLDKDQLIAGVQDAFANKSKLT
FT                   DEEIEKTLQNFEARVKASAQAKMEQDAKENADKGAKYRDTFAKEKGVKKTASGLLYKVE
FT                   NAGTGDAPKDSDTVVVNYKGTLADGTEFDNSYKRGEPLSFRLDGVIPGWTEGLKQIKKG
FT                   GKITLVIPPELAYGKAGVPGIPANSTLIFDVELLDVKAAAKADAQEQQPAVDTKAKK"
FT   gene            212019..212753
FT                   /locus_tag="YP_0195"
FT                   /old_locus_tag="YP0195"
FT   CDS_pept        212019..212753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0195"
FT                   /old_locus_tag="YP0195"
FT                   /product="putative DNA-binding protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0196 and Yersinia
FT                   pestis KIM y3978"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60471"
FT                   /db_xref="GOA:A0A3N4AYF3"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AYF3"
FT                   /protein_id="AAS60471.1"
FT                   /translation="MVSSMSNSLLCSETSELDLLDERPFSQTDHEILKSYEVVVDGLAM
FT                   LIGGHCEIVLHSLEDLKNSAVRIANGEHTGRQIGSPITDLALRMLHDMAGADSSVSKAY
FT                   FTRAKSGVLMKSVTIAIRNRDQRVIGLLCINMNLDVPFSQIIQTFMPPETQEVPSSVNF
FT                   ASSVDDLVAQTLEFTIEEVNADRNVSNNAKNRQVVLNLYEKGIFDIKDAINQVAERLNI
FT                   SKHTVYLYIRQFKSGDLVGHER"
FT   gene            212753..213148
FT                   /gene="dsrE1"
FT                   /locus_tag="YP_0196"
FT                   /old_locus_tag="YP0196"
FT   CDS_pept        212753..213148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsrE1"
FT                   /locus_tag="YP_0196"
FT                   /old_locus_tag="YP0196"
FT                   /product="sulfur transfer complex subunit TusD"
FT                   /note="similar to Yersinia pestis CO92 YPO0197 and Yersinia
FT                   pestis KIM y3979. Contains DsrE-like protein
FT                   (Interpro|IPR003787)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60472"
FT                   /db_xref="GOA:Q8ZJB8"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR017463"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJB8"
FT                   /protein_id="AAS60472.1"
FT                   /translation="MSALKYCLLVTGPAYGTQQASSAYQFAQAVVGAGHHLVSIFFYRE
FT                   GVLNANQLTAPASDEFDLVRAWQQLAAEQAVTLNVCVAAALRRGITDQHEAEQLNLAAA
FT                   NLQPGFTLSGLGALAEATLTCDRMVQF"
FT   gene            213148..213513
FT                   /gene="dsrF"
FT                   /locus_tag="YP_0197"
FT                   /old_locus_tag="YP0197"
FT   CDS_pept        213148..213513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsrF"
FT                   /locus_tag="YP_0197"
FT                   /old_locus_tag="YP0197"
FT                   /product="Uncharacterized protein involved in the oxidation
FT                   of intracellular sulfur"
FT                   /note="similar to Yersinia pestis CO92 YPO0198 and Yersinia
FT                   pestis KIM y3980. Contains DsrE-like protein
FT                   (Interpro|IPR003787)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60473"
FT                   /db_xref="GOA:Q8ZJB7"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR017462"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR037450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJB7"
FT                   /protein_id="AAS60473.1"
FT                   /translation="MARKRIAFIFTQGPHGSSAGREGLDALLATSALSEDIGVFFISDG
FT                   VLQLLPQQQPEKILARNYIATFGVLPLYDVENCYLCERSLQQRGLSKMADWILDVTVLS
FT                   PADLRRELGTYDVVLTF"
FT   gene            213533..213820
FT                   /gene="dsrH"
FT                   /locus_tag="YP_0198"
FT                   /old_locus_tag="YP0198"
FT   CDS_pept        213533..213820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsrH"
FT                   /locus_tag="YP_0198"
FT                   /old_locus_tag="YP0198"
FT                   /product="sulfur transfer complex subunit TusB"
FT                   /note="similar to Yersinia pestis CO92 YPO0199 and Yersinia
FT                   pestis KIM y3981"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60474"
FT                   /db_xref="GOA:Q8ZJB6"
FT                   /db_xref="InterPro:IPR007215"
FT                   /db_xref="InterPro:IPR023526"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJB6"
FT                   /protein_id="AAS60474.1"
FT                   /translation="MLYTVSHSPYHCDLSALLRLATSEDDILLLQDGVIAALKESETLK
FT                   LLLNNPASLFVLEDDVIARGLVGQISDNATLISYTHFVDLTLRHQQQLAW"
FT   gene            213958..214332
FT                   /gene="rpsL"
FT                   /locus_tag="YP_0199"
FT                   /old_locus_tag="YP0199"
FT   CDS_pept        213958..214332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="YP_0199"
FT                   /old_locus_tag="YP0199"
FT                   /product="30S ribosomal protein S12"
FT                   /note="similar to Yersinia pestis CO92 rpsl and Yersinia
FT                   pestis KIM rpsL. Contains Ribosomal protein S12, bacterial
FT                   and chloroplast forms (Interpro|IPR005679, (GO:0015935)).
FT                   Contains Ribosomal protein S12/S23 (Interpro|IPR006032,
FT                   (GO:0006412))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60475"
FT                   /db_xref="GOA:Q8ZJB5"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJB5"
FT                   /protein_id="AAS60475.1"
FT                   /translation="MATINQLVRKPRSMKVAKSNVPALEACPQKRGVCTRVYTTTPKKP
FT                   NSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDC
FT                   SGVKDRKQSRSKYGVKKPKA"
FT   gene            214429..214899
FT                   /gene="rpsG"
FT                   /locus_tag="YP_0200"
FT                   /old_locus_tag="YP0200"
FT   CDS_pept        214429..214899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="YP_0200"
FT                   /old_locus_tag="YP0200"
FT                   /product="30S ribosomal protein S7"
FT                   /note="similar to Yersinia pestis CO92 rpsG and Yersinia
FT                   pestis KIM rpsG. Contains Ribosomal protein S7
FT                   (Interpro|IPR000235, (GO:0006412)). Contains Ribosomal
FT                   protein S7, bacterial and organelle form
FT                   (Interpro|IPR005717, (GO:0015935))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60476"
FT                   /db_xref="GOA:Q8ZJB4"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJB4"
FT                   /protein_id="AAS60476.1"
FT                   /translation="MPRRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAEAIVYT
FT                   ALETLAQRSGKDFLEAFEVALDNVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAMRWI
FT                   VDAARKRGDKSMALRLANELSDAAENKGSAVKKREDVHRMAEANKAFAHYRW"
FT   gene            214993..217101
FT                   /gene="fusA"
FT                   /locus_tag="YP_0201"
FT                   /old_locus_tag="YP0201"
FT   CDS_pept        214993..217101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="YP_0201"
FT                   /old_locus_tag="YP0201"
FT                   /product="elongation factor G"
FT                   /note="similar to Yersinia pestis CO92 fusA and Yersinia
FT                   pestis KIM fusA. Contains Elongation factor G, C-terminal
FT                   (Interpro|IPR000640, (GO:0006414)). Contains Elongation
FT                   factor, GTP-binding (Interpro|IPR000795, (GO:0006414)).
FT                   Contains ATP/GTP-binding site motif A (P-loop)
FT                   (Interpro|IPR001687, (GO:0005524)). Contains Elongation
FT                   factor Tu, domain 2 (Interpro|IPR004161, (GO:0005525)).
FT                   Contains Translation elongation factor G
FT                   (Interpro|IPR004540, (GO:0006414)). Contains Small
FT                   GTP-binding protein domain (Interpro|IPR005225). Contains
FT                   Elongation factor G, domain IV (Interpro|IPR005517,
FT                   (GO:0005525))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60477"
FT                   /db_xref="GOA:Q8ZJB3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJB3"
FT                   /protein_id="AAS60477.1"
FT                   /translation="MARKTPIERYRNIGISAHIDAGKTTTTERILFYTGVNHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTCFWSGMAKQFEPHHVNIIDTPGHVDFTIEVERSMR
FT                   VLDGAVMVYCAVGGVQPQSETVWRQANKYKVPRIAFVNKMDRMGANFLRVVGQLKSRLG
FT                   ANPVPLQLAIGAEEKFTGIIDLVKMKAINWNEADQGVTFEYEEIPADMAELAAEWHQNL
FT                   VESAAEASDELMDKYLGGEELTEEEIKKALRQRVLKSEIILVTCGSAFKNKGVQAMLDA
FT                   VIEYLPAPTDVESINGILDDGKDTPAVRHSDDKEPFSALAFKIATDPFVGNLTFFRVYS
FT                   GIVNSGDTVLNSVKSQRERLGRIVQMHANKREEIKEVHAGDIAAAIGLKDVTTGDTLCD
FT                   PNNPIILERMEFPEPVISVAVEPKTKADQEKMGMALGRLAKEDPSFRVWTDEESGQTII
FT                   AGMGELHLDILVDRMRREFNVEANVGKPQVAYRETIRETVKDVEGKHAKQSGGRGQYGH
FT                   VVIDMSPLPPGGVGYEFVNEIVGGSIPKEFIPAVDKGIQEQLKSGPLAGYPVVDVKVRL
FT                   HYGSYHDVDSSELAFKLAGSIAFKEGFKRAKPVLLEPIMKVEVETPEDYMGDVMGDLNR
FT                   RRGIIEGMEDTATGKTVRVKVPLSEMFGYATDLRSQTQGRASYSMEFLEYAEAPSNVAK
FT                   AVIEARGK"
FT   gene            217174..218358
FT                   /gene="tufA1"
FT                   /locus_tag="YP_0202"
FT                   /old_locus_tag="YP0202"
FT   CDS_pept        217174..218358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tufA1"
FT                   /locus_tag="YP_0202"
FT                   /old_locus_tag="YP0202"
FT                   /product="elongation factor Tu"
FT                   /note="similar to Yersinia pestis CO92 tufA and Yersinia
FT                   pestis KIM tufB. Contains Elongation factor, GTP-binding
FT                   (Interpro|IPR000795, (GO:0006414)). Contains
FT                   ATP/GTP-binding site motif A (P-loop) (Interpro|IPR001687,
FT                   (GO:0005524)). Contains Elongation factor Tu, C-terminal
FT                   (Interpro|IPR004160, (GO:0005525)). Contains Elongation
FT                   factor Tu, domain 2 (Interpro|IPR004161, (GO:0005525)).
FT                   Contains Translation elongation factor Tu
FT                   (Interpro|IPR004541, (GO:0006414)). Contains Small
FT                   GTP-binding protein domain (Interpro|IPR005225). Contains
FT                   Elongation factor, GTP-binding (Interpro|IPR000795,
FT                   (GO:0006414)). Contains Guanine nucleotide binding protein
FT                   (G-protein), alpha subunit (Interpro|IPR001019,
FT                   (GO:0007186)). Contains ATP/GTP-binding site motif A
FT                   (P-loop) (Interpro|IPR001687, (GO:0005524)). Contains
FT                   Elongation factor Tu, C-terminal (Interpro|IPR004160,
FT                   (GO:0005525)). Contains Elongation factor Tu, domain 2
FT                   (Interpro|IPR004161, (GO:0005525)). Contains Translation
FT                   elongation factor Tu (Interpro|IPR004541, (GO:0006414))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60478"
FT                   /db_xref="GOA:Q8ZJB2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJB2"
FT                   /protein_id="AAS60478.1"
FT                   /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSAR
FT                   AFDQIDNAPEEKARGITINTSHVEYDTPARHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLGRQVGVPYIIVFMNKCDMVDDEELLELVEMEVRELLSAYDF
FT                   PGDDLPVVRGSALKALEGEAEWEAKIIELAGYLDSYIPEPERAIDKPFLLPIEDVFSIS
FT                   GRGTVVTGRVERGIVKVGEEVEIVGIKDTVKSTCTGVEMFRKLLDEGRAGENVGVLLRG
FT                   IKREDIERGQVLAKPGSIKPHTTFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNINMIVTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVIA"
FT   gene            218510..219019
FT                   /gene="tnp_3"
FT                   /locus_tag="YP_0203"
FT                   /old_locus_tag="YP0203"
FT   CDS_pept        218510..219019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnp_3"
FT                   /locus_tag="YP_0203"
FT                   /old_locus_tag="YP0203"
FT                   /product="transposase for the IS1541 insertion element"
FT                   /note="similar to Yersinia pestis CO92 tnp and Yersinia
FT                   pestis KIM y3987. Contains Transposase IS200-like
FT                   (Interpro|IPR002686)."
FT                   /db_xref="EnsemblGenomes-Gn:YP_0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60479"
FT                   /db_xref="GOA:A0A0H2W6E9"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W6E9"
FT                   /protein_id="AAS60479.1"
FT                   /translation="MRSGNCKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGS
FT                   PFTGRK"
FT   gene            219207..219401
FT                   /gene="bfd"
FT                   /locus_tag="YP_0204"
FT                   /old_locus_tag="YP0204"
FT   CDS_pept        219207..219401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bfd"
FT                   /locus_tag="YP_0204"
FT                   /old_locus_tag="YP0204"
FT                   /product="putative bacterioferritin-associated ferredoxin"
FT                   /note="similar to Yersinia pestis CO92 bfd"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60480"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AZT4"
FT                   /protein_id="AAS60480.1"
FT                   /translation="MYVCLCNAVSDKVIRKAVRQHQPHTVKQLRQLVPIGSDCGKCIRQ
FT                   AREILIEELANIPEMNDVA"
FT   gene            219480..219953
FT                   /gene="bfr"
FT                   /locus_tag="YP_0205"
FT                   /old_locus_tag="YP0205"
FT   CDS_pept        219480..219953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bfr"
FT                   /locus_tag="YP_0205"
FT                   /old_locus_tag="YP0205"
FT                   /product="bacterioferritin"
FT                   /note="similar to Yersinia pestis CO92 bfr and Yersinia
FT                   pestis KIM bfr. Contains Ferritin (Interpro|IPR001519,
FT                   (GO:0008199)). Contains Bacterioferritin
FT                   (Interpro|IPR002024, (GO:0008199))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60481"
FT                   /db_xref="GOA:A0A2S9PCU3"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PCU3"
FT                   /protein_id="AAS60481.1"
FT                   /translation="MKGDKKIIAHLNKLLGNELVAINQYFLHARMFKNWGLMRLNDKEY
FT                   HESIDEMKHADKYIERILFLEGIPNLQELGKLNIGEDVEEMLKSDLALELSGATDLREG
FT                   IAYADSIHDYVSRDLLKEILVDEEEHIDWLETELSLIDRLGIQSYSQAQLAKD"
FT   gene            220367..220678
FT                   /gene="rpsJ"
FT                   /locus_tag="YP_0206"
FT                   /old_locus_tag="YP0206"
FT   CDS_pept        220367..220678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="YP_0206"
FT                   /old_locus_tag="YP0206"
FT                   /product="30S ribosomal protein S10"
FT                   /note="similar to Yersinia pestis CO92 rpsJ and Yersinia
FT                   pestis KIM rpsJ. Contains Ribosomal protein S10
FT                   (Interpro|IPR001848, (GO:0006412)). Contains Ribosomal
FT                   protein S10, bacterial form (Interpro|IPR005731,
FT                   (GO:0015935))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60482"
FT                   /db_xref="GOA:P67906"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67906"
FT                   /protein_id="AAS60482.1"
FT                   /translation="MQNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTR
FT                   KERFTVLISPHVNKDARDQYEIRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG"
FT   gene            220711..221340
FT                   /gene="rplC"
FT                   /locus_tag="YP_0207"
FT                   /old_locus_tag="YP0207"
FT   CDS_pept        220711..221340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="YP_0207"
FT                   /old_locus_tag="YP0207"
FT                   /product="50S ribosomal protein L3"
FT                   /note="similar to Yersinia pestis CO92 rplC and Yersinia
FT                   pestis KIM rplC. Contains Ribosomal protein L3
FT                   (Interpro|IPR000597, (GO:0006412))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60483"
FT                   /db_xref="GOA:Q8ZJA9"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJA9"
FT                   /protein_id="AAS60483.1"
FT                   /translation="MIGLVGKKVGMTRIFTEDGVSIPVTVIEIEANRVTQVKSLENDGY
FT                   RAVQVTTGAKKANRVTKPEAGHFAKAGVEAGRGLWEFRLPEGQEFTAGQEISVEIFADV
FT                   KKVDVTGTSKGKGFAGTVKRWNFRTQDATHGNSLSHRVPGSIGQNQTPGKVFKGKKMAG
FT                   HMGDERVTVQSLDVVRVDAERNLLLVKGAVPGATGGNLIVKPAVKA"
FT   gene            221357..221962
FT                   /gene="rplD"
FT                   /locus_tag="YP_0208"
FT                   /old_locus_tag="YP0208"
FT   CDS_pept        221357..221962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="YP_0208"
FT                   /old_locus_tag="YP0208"
FT                   /product="50S ribosomal protein L4"
FT                   /note="similar to Yersinia pestis CO92 rplD and Yersinia
FT                   pestis KIM rplD. Contains Ribosomal protein L4/L1e
FT                   (Interpro|IPR002136, (GO:0006412))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60484"
FT                   /db_xref="GOA:P60730"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60730"
FT                   /protein_id="AAS60484.1"
FT                   /translation="MELVMKDAPGALTVSETTFGRDFNEALVHQVVVAYAAGARQGTRA
FT                   QKTRAEVTGSGKKPWRQKGTGRARAGSVKSPIWRSGGVTFAAKPQDHSQKVNKKMYRGA
FT                   LKSILSELVRQDRLIIVEKFSVEAPKTKLLAQKLKDMALEDVLIVTGELDENLFLAARN
FT                   LYKVDVRDVAGIDPVSLIAFDKVVMTADAVKQVEEMLA"
FT   gene            221959..222261
FT                   /gene="rplW"
FT                   /locus_tag="YP_0209"
FT                   /old_locus_tag="YP0209"
FT   CDS_pept        221959..222261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="YP_0209"
FT                   /old_locus_tag="YP0209"
FT                   /product="50S ribosomal protein L23"
FT                   /note="similar to Yersinia pestis CO92 rplW and Yersinia
FT                   pestis KIM rplW. Contains TonB-dependent receptor protein
FT                   (Interpro|IPR000531, (GO:0016020)). Contains Ribosomal L23
FT                   protein (Interpro|IPR001014, (GO:0006412))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60485"
FT                   /db_xref="GOA:P69963"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69963"
FT                   /protein_id="AAS60485.1"
FT                   /translation="MIREERLLKVLRSPHVSEKASAAMEKNNTIVLKVAKDATKAEIKA
FT                   AVQKLFEVEVEDVNTLLVKGKSKRHGQRVGRRSDWKKAYVTLKEGQNLDFIGGAE"
FT   gene            222278..223102
FT                   /gene="rplB"
FT                   /locus_tag="YP_0210"
FT                   /old_locus_tag="YP0210"
FT   CDS_pept        222278..223102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="YP_0210"
FT                   /old_locus_tag="YP0210"
FT                   /product="50S ribosomal protein l2"
FT                   /note="similar to Yersinia pestis CO92 rplB and Yersinia
FT                   pestis KIM rplB. Contains Ribosomal protein L2
FT                   (Interpro|IPR002171, (GO:0006412)). Contains Ribosomal
FT                   protein L2, bacterial and organelle form
FT                   (Interpro|IPR005880, (GO:0016740))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60486"
FT                   /db_xref="GOA:P60436"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60436"
FT                   /protein_id="AAS60486.1"
FT                   /translation="MAIVKCKPTSPGRRHVVKVVNPELHKGKPYAPLLEKLSKSGGRNN
FT                   NGRITTRHIGGGHKQHYRLVDFKRNKDGIPAVVERLEYDPNRSANIALVLYKDGERRYI
FT                   LAPKGLKAGDQIQSGVDAAIKAGNTLPMRNIPVGSTVHNVEMKPGKGGQLARSAGAYVQ
FT                   IVARDGSYVTLRLRSGEMRKVQADCRATLGEVGNAEHMLRVLGKAGASRWRGIRPTVRG
FT                   TAMNPVDHPHGGGEGRNFGKHPVTPWGVQTKGKKTRSNKRTDKFIVRRRSKK"
FT   gene            223117..223395
FT                   /gene="rpsS"
FT                   /locus_tag="YP_0211"
FT                   /old_locus_tag="YP0211"
FT   CDS_pept        223117..223395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="YP_0211"
FT                   /old_locus_tag="YP0211"
FT                   /product="30S ribosomal protein S19"
FT                   /note="similar to Yersinia pestis CO92 rpsS. Contains
FT                   Ribosomal protein S19/S15 (Interpro|IPR002222,
FT                   (GO:0006412)). Contains Ribosomal protein S19, bacterial
FT                   and organelle form (Interpro|IPR005732, (GO:0015935))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60487"
FT                   /db_xref="GOA:Q8ZJA8"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJA8"
FT                   /protein_id="AAS60487.1"
FT                   /translation="MPRSLKKGPFIDLHLLKKVEKAVESGDKKPIRTWSRRSTVFPNMI
FT                   GLTIAVHNGRQHVPVFVSDEMVGHKLGEFAPTRTYRGHAADKKAKKR"
FT   gene            223410..223742
FT                   /gene="rplV"
FT                   /locus_tag="YP_0212"
FT                   /old_locus_tag="YP0212"
FT   CDS_pept        223410..223742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="YP_0212"
FT                   /old_locus_tag="YP0212"
FT                   /product="50S ribosomal protein L22"
FT                   /note="similar to Yersinia pestis CO92 rplV and Yersinia
FT                   pestis KIM rplV. Contains Ribosomal protein L22/L17
FT                   (Interpro|IPR001063, (GO:0006412)). Contains Ribosomal
FT                   protein L22, bacterial and organelle form
FT                   (Interpro|IPR005727, (GO:0015934))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60488"
FT                   /db_xref="GOA:Q8ZJA7"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJA7"
FT                   /protein_id="AAS60488.1"
FT                   /translation="METIAKHRHARSSAQKVRLVADLIRGKKVSQALETLTYTNKKAAG
FT                   LVKKVLESAIANAEHNDGADIDDLKVTKIFVDEGPSMKRIMPRAKGRADRILKRTSHIT
FT                   VVVSDR"
FT   gene            223760..224458
FT                   /gene="rpsC"
FT                   /locus_tag="YP_0213"
FT                   /old_locus_tag="YP0213"
FT   CDS_pept        223760..224458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="YP_0213"
FT                   /old_locus_tag="YP0213"
FT                   /product="30S ribosomal protein S3"
FT                   /note="similar to Yersinia pestis CO92 rpsC and Yersinia
FT                   pestis KIM rpsC. Contains Ribosomal protein S3
FT                   (Interpro|IPR001351, (GO:0006412)). Contains Type 2 KH
FT                   domain (Interpro|IPR004044, (GO:0003676)). Contains KH
FT                   domain (Interpro|IPR004087, (GO:0003676)). Contains
FT                   Bacterial ribosomal protein S3 (Interpro|IPR005704,
FT                   (GO:0015935))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60489"
FT                   /db_xref="GOA:Q8ZJA6"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJA6"
FT                   /protein_id="AAS60489.1"
FT                   /translation="MGQKVHPNGIRLGIVKAWNSTWYANTKEFADNLDSDFKVRQFLTK
FT                   ELAKASVSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIA
FT                   EVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIA
FT                   RTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEPAAQ
FT                   PKKQQRKGRK"
FT   gene            224471..224881
FT                   /gene="rplP"
FT                   /locus_tag="YP_0214"
FT                   /old_locus_tag="YP0214"
FT   CDS_pept        224471..224881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="YP_0214"
FT                   /old_locus_tag="YP0214"
FT                   /product="50S ribosomal protein L16"
FT                   /note="similar to Yersinia pestis CO92 rplP and Yersinia
FT                   pestis KIM rplP. Contains Ribosomal protein L16
FT                   (Interpro|IPR000114, (GO:0006412))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60490"
FT                   /db_xref="GOA:Q8ZJA5"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJA5"
FT                   /protein_id="AAS60490.1"
FT                   /translation="MLQPKRTKFRKMHKGRNRGLAQGTDVSFGEFGLKACGRCRLTARQ
FT                   IEAARRAMTRAIKRQGKVWIRVFPDKPITEKPLEVRMGKGKGNVEYWVALIQPGKVLFE
FT                   MAGVPEETAREAFKLAAAKLPVGTTFVTKTVM"
FT   gene            224881..225072
FT                   /gene="rpmC"
FT                   /locus_tag="YP_0215"
FT                   /old_locus_tag="YP0215"
FT   CDS_pept        224881..225072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="YP_0215"
FT                   /old_locus_tag="YP0215"
FT                   /product="50S ribosomal protein L29"
FT                   /note="similar to Yersinia pestis CO92 rpmC and Yersinia
FT                   pestis KIM rpmC. Contains Ribosomal protein L29
FT                   (Interpro|IPR001854, (GO:0006412))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60491"
FT                   /db_xref="GOA:Q8ZJA4"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJA4"
FT                   /protein_id="AAS60491.1"
FT                   /translation="MKAQELREKSVEELNTELLNLLREQFNLRMQAASGQLQQTHLLKQ
FT                   VRRNVARVKTLLTEKAGA"
FT   gene            225072..225326
FT                   /gene="rpsQ"
FT                   /locus_tag="YP_0216"
FT                   /old_locus_tag="YP0216"
FT   CDS_pept        225072..225326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="YP_0216"
FT                   /old_locus_tag="YP0216"
FT                   /product="30S ribosomal protein S17"
FT                   /note="similar to Yersinia pestis CO92 YPO0219. Contains
FT                   Ribosomal protein S17 (Interpro|IPR000266, (GO:0006412))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60492"
FT                   /db_xref="GOA:Q8ZJA3"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJA3"
FT                   /protein_id="AAS60492.1"
FT                   /translation="MTDQIRTLQGRVVSDKMEKSMVVAIERVVKHPIYGKFIRRTTKLH
FT                   VHDENNECGIGDVVEIRECRPLSKTKSWTLVRVVEKAIL"
FT   gene            225507..225878
FT                   /gene="rplN"
FT                   /locus_tag="YP_0217"
FT                   /old_locus_tag="YP0217"
FT   CDS_pept        225507..225878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="YP_0217"
FT                   /old_locus_tag="YP0217"
FT                   /product="50S ribosomal protein L14"
FT                   /note="similar to Yersinia pestis CO92 rplN and Yersinia
FT                   pestis KIM rplN. Contains Ribosomal protein L14b/L23e
FT                   (Interpro|IPR000218, (GO:0006412)). Contains Ribosomal
FT                   protein L14, bacterial and organelle form
FT                   (Interpro|IPR005745, (GO:0015934))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60493"
FT                   /db_xref="GOA:Q7CFT7"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CFT7"
FT                   /protein_id="AAS60493.1"
FT                   /translation="MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGIGDIIKITIKE
FT                   AIPRGKVKKGDVLKAVVVRTKKGVRRPDGSVIRFDGNACVILNNNSEQPIGTRIFGPVT
FT                   RELRNEKFMKIISLAPEVL"
FT   gene            225889..226203
FT                   /gene="rplX"
FT                   /locus_tag="YP_0218"
FT                   /old_locus_tag="YP0218"
FT   CDS_pept        225889..226203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="YP_0218"
FT                   /old_locus_tag="YP0218"
FT                   /product="50S ribosomal protein L24"
FT                   /note="similar to Yersinia pestis CO92 rplX and Yersinia
FT                   pestis KIM rplX. Contains Ribosomal protein L24
FT                   (Interpro|IPR003256, (GO:0006412)). Contains KOW
FT                   (Interpro|IPR005824). Contains Ribosomal protein L24/L26
FT                   (Interpro|IPR005825, (GO:0006412)). Contains KOW (Kyprides,
FT                   Ouzounis, Woese) motif (Interpro|IPR006646)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60494"
FT                   /db_xref="GOA:Q8ZJA1"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJA1"
FT                   /protein_id="AAS60494.1"
FT                   /translation="MAAKIRRDDEVIVLTGKDKGKRGKVKNVLSSGKVIVEGINLVKKH
FT                   QKPVPALNQPGGIVEKEAAIQVSNLALFNATTGKADRVGFRFEDGKKVRFFKSTSETIK
FT                   "
FT   gene            226218..226757
FT                   /gene="rplE"
FT                   /locus_tag="YP_0219"
FT                   /old_locus_tag="YP0219"
FT   CDS_pept        226218..226757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="YP_0219"
FT                   /old_locus_tag="YP0219"
FT                   /product="50S ribosomal protein L5"
FT                   /note="similar to Yersinia pestis CO92 rplE and Yersinia
FT                   pestis KIM rplE. Contains Ribosomal protein L5
FT                   (Interpro|IPR002132, (GO:0006412)). Contains Mitochondrial
FT                   ribosomal protein L5 (Interpro|IPR003236, (GO:0006412))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60495"
FT                   /db_xref="GOA:Q8ZJA0"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJA0"
FT                   /protein_id="AAS60495.1"
FT                   /translation="MAKLHDYYKDEVVKQLMSQFGYDSVMQVPRVEKITLNMGVGEAIA
FT                   DKKLLDNAAADLAAISGQKPFITKARKSVAGFKIRQGYPIGCKVTLRGERMWEFFERLI
FT                   TIAVPRIRDFRGLSAKSFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTTAKSD
FT                   DEGRALLAAFKFPFRK"
FT   gene            226771..227076
FT                   /gene="rpsN"
FT                   /locus_tag="YP_0220"
FT                   /old_locus_tag="YP0220"
FT   CDS_pept        226771..227076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="YP_0220"
FT                   /old_locus_tag="YP0220"
FT                   /product="30S ribosomal protein S14"
FT                   /note="similar to Yersinia pestis CO92 rpsN and Yersinia
FT                   pestis KIM rpsN. Contains Ribosomal protein S14
FT                   (Interpro|IPR001209, (GO:0006412))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60496"
FT                   /db_xref="GOA:Q8ZJ99"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ99"
FT                   /protein_id="AAS60496.1"
FT                   /translation="MAKQSMKAREVVRVKLANKYRAKREELKAIISGVNSSDEDRWDAV
FT                   LKLQSLPRDSSPSRQRNRCNQTGRPHGFLRKFGLSRIKVRETAMRGEIPGLKKASW"
FT   gene            227110..227502
FT                   /gene="rpsH"
FT                   /locus_tag="YP_0221"
FT                   /old_locus_tag="YP0221"
FT   CDS_pept        227110..227502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="YP_0221"
FT                   /old_locus_tag="YP0221"
FT                   /product="30S ribosomal protein S8"
FT                   /note="similar to Yersinia pestis CO92 rpsH and Yersinia
FT                   pestis KIM rpsH. Contains Ribosomal protein S8
FT                   (Interpro|IPR000630, (GO:0006412)). Contains Prenyl group
FT                   binding site (CAAX box) (Interpro|IPR001230)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60497"
FT                   /db_xref="GOA:Q8ZJ98"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ98"
FT                   /protein_id="AAS60497.1"
FT                   /translation="MSMQDPIADMLTRIRNGQAANKVAVTMPSSKLKVAIANVLKEEGF
FT                   IEDFKIEGDTKPVLELALKYFQGKAVVESIQRISRPGLRIYKKKDELPKVMAGLGIAVI
FT                   STSKGVMTDRAARQAGLGGEIICYVA"
FT   gene            227517..228050
FT                   /gene="rplF"
FT                   /locus_tag="YP_0222"
FT                   /old_locus_tag="YP0222"
FT   CDS_pept        227517..228050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="YP_0222"
FT                   /old_locus_tag="YP0222"
FT                   /product="50S ribosomal protein L6"
FT                   /note="similar to Yersinia pestis CO92 rplF and Yersinia
FT                   pestis KIM rplF. Contains Ribosomal protein L6
FT                   (Interpro|IPR000702, (GO:0006412)). Contains Ribosomal
FT                   protein L6, signature 1 (Interpro|IPR002358, (GO:0006412))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60498"
FT                   /db_xref="GOA:Q7CFT4"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CFT4"
FT                   /protein_id="AAS60498.1"
FT                   /translation="MSRVAKAPVVIPAGVEVKLNGQVISIKGKNGELTRTVHSAVEVKQ
FT                   EENTLTFAPREGAVDGWAQAGTTRALLNSMVIGVTEGFTKKLQLVGVGYRAAVKGNVVN
FT                   LALGFSHPVDHELPAGITAECPTQTEIVLKGADKQVIGQVAADLRAYRRPEPYKGKGVR
FT                   YADEVVRTKEAKKK"
FT   gene            228060..228413
FT                   /gene="rplR"
FT                   /locus_tag="YP_0223"
FT                   /old_locus_tag="YP0223"
FT   CDS_pept        228060..228413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="YP_0223"
FT                   /old_locus_tag="YP0223"
FT                   /product="50S ribosomal protein L18"
FT                   /note="similar to Yersinia pestis CO92 rplR and Yersinia
FT                   pestis KIM rplR. Contains ATP/GTP-binding site motif A
FT                   (P-loop) (Interpro|IPR001687, (GO:0005524)). Contains
FT                   Ribosomal protein L18 (Interpro|IPR004389, (GO:0006412)).
FT                   Contains Ribosomal protein L18P/L5E (Interpro|IPR005484,
FT                   (GO:0006412))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60499"
FT                   /db_xref="GOA:Q8ZJ96"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ96"
FT                   /protein_id="AAS60499.1"
FT                   /translation="MDKKAARIRRATRARRKLKELGATRLVVHRTPRHIYAQVIAPNGS
FT                   EILVAASTVEKAINEQLKYAGNKDAAAAVGKTIAERALEKGITKVSFDRSGFQYHGRVQ
FT                   ALADAAREAGLQF"
FT   gene            228428..228931
FT                   /gene="rpsE"
FT                   /locus_tag="YP_0224"
FT                   /old_locus_tag="YP0224"
FT   CDS_pept        228428..228931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="YP_0224"
FT                   /old_locus_tag="YP0224"
FT                   /product="30S ribosomal protein S5"
FT                   /note="similar to Yersinia pestis CO92 rpsE and Yersinia
FT                   pestis KIM rpsE. Contains Ribosomal protein S5
FT                   (Interpro|IPR000851, (GO:0006412)). Contains Ribosomal
FT                   protein S5, C-terminal domain (Interpro|IPR005324,
FT                   (GO:0006412)). Contains Ribosomal protein S5, bacterial and
FT                   organelle form (Interpro|IPR005712, (GO:0015935))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60500"
FT                   /db_xref="GOA:Q8ZJ95"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ95"
FT                   /protein_id="AAS60500.1"
FT                   /translation="MSHIEKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGR
FT                   VGFGYGKAREVPAAIQKAMEKARRAMINVALNNGTLQHPVKGAHTGSRVFMQPASEGTG
FT                   IIAGGAMRAVLEVAGVHNVLAKAYGSTNPINVVRATIAALEDMKSPEMVAAKRGKSVEE
FT                   ILGK"
FT   gene            228934..229113
FT                   /gene="rpmD"
FT                   /locus_tag="YP_0225"
FT                   /old_locus_tag="YP0225"
FT   CDS_pept        228934..229113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="YP_0225"
FT                   /old_locus_tag="YP0225"
FT                   /product="50S ribosomal protein L30"
FT                   /note="similar to Yersinia pestis CO92 rpmD and Yersinia
FT                   pestis KIM rpmD. Contains Ribosomal protein L30
FT                   (Interpro|IPR000517, (GO:0006412)). Contains Ribosomal
FT                   protein L30, bacterial and organelle form
FT                   (Interpro|IPR005996, (GO:0015934))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60501"
FT                   /db_xref="GOA:Q7CFT2"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CFT2"
FT                   /protein_id="AAS60501.1"
FT                   /translation="MAKTIKVTQTKSSIGRLPKHKATLIGLGLRRIGHTVEREDTPAVR
FT                   GMVNLVSYMVKVEE"
FT   gene            229117..229551
FT                   /gene="rplO"
FT                   /locus_tag="YP_0226"
FT                   /old_locus_tag="YP0226"
FT   CDS_pept        229117..229551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="YP_0226"
FT                   /old_locus_tag="YP0226"
FT                   /product="50S ribosomal protein L15"
FT                   /note="similar to Yersinia pestis CO92 rplO and Yersinia
FT                   pestis KIM rplO. Contains Ribosomal protein L15
FT                   (Interpro|IPR001196, (GO:0006412)). Contains Ribosomal
FT                   protein L15, bacterial form (Interpro|IPR005749,
FT                   (GO:0015934))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60502"
FT                   /db_xref="GOA:Q8ZJ93"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ93"
FT                   /protein_id="AAS60502.1"
FT                   /translation="MRLNTLSPAEGAKHAPKRVGRGIGSGLGKTAGRGHKGQNSRSGGG
FT                   VRRGFEGGQMPLYRRLPKFGFTSRKAMITAEVRLSELALVEGDVIDLNTLKAANVVGIQ
FT                   MEFVKVILSGEVNRAVTLRGLRVTKGARAAIEAAGGKIEE"
FT   gene            229559..230890
FT                   /gene="secY"
FT                   /locus_tag="YP_0227"
FT                   /old_locus_tag="YP0227"
FT   CDS_pept        229559..230890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="YP_0227"
FT                   /old_locus_tag="YP0227"
FT                   /product="preprotein translocase SecY subunit"
FT                   /note="similar to Yersinia pestis CO92 secY and Yersinia
FT                   pestis KIM prlA. Contains C-5 cytosine-specific DNA
FT                   methylase (Interpro|IPR001525, (GO:0006306)). Contains SecY
FT                   protein (Interpro|IPR002208, (GO:0009306), (GO:0016020))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60503"
FT                   /db_xref="GOA:A0A3N4BB31"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BB31"
FT                   /protein_id="AAS60503.1"
FT                   /translation="MAKQPGLDFQSAKGGLGELKRRLLFVIGALIVFRIGSFIPIPGID
FT                   ATVLAKLLEQQRGTIIEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPALAE
FT                   IKKEGEAGRRKISQYTRYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVS
FT                   LVTGTMFLMWLGEQITERGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHFLLLLL
FT                   VAVLVFAVTFFVVFIERGQRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFAS
FT                   SIILFPATIASWFGGGTGWNWLTTISMYLQPGQPLYVLLYASAIIFFCFFYTALVFNPR
FT                   ETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTLIGAMYITFICLIPEFMRDAMKVPF
FT                   YFGGTSLLIVVVVIMDFMAQVQTLMMSSQYESALKKANLKGYNR"
FT   gene            230924..231040
FT                   /gene="rpmJ1"
FT                   /locus_tag="YP_0228"
FT                   /old_locus_tag="YP0228"
FT   CDS_pept        230924..231040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ1"
FT                   /locus_tag="YP_0228"
FT                   /old_locus_tag="YP0228"
FT                   /product="50S ribosomal protein L36"
FT                   /note="similar to Yersinia pestis CO92 YPO0230. Contains
FT                   Ribosomal protein L36 (Interpro|IPR000473, (GO:0006412))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60504"
FT                   /db_xref="GOA:Q8ZJ91"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ91"
FT                   /protein_id="AAS60504.1"
FT                   /translation="MKVRASVKKLCRNCKIVKRNGVVRVICSAEPKHKQRQG"
FT   gene            231188..231544
FT                   /gene="rpsM"
FT                   /locus_tag="YP_0229"
FT                   /old_locus_tag="YP0229"
FT   CDS_pept        231188..231544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="YP_0229"
FT                   /old_locus_tag="YP0229"
FT                   /product="30S ribosomal protein S13"
FT                   /note="similar to Yersinia pestis CO92 rpsM and Yersinia
FT                   pestis KIM rpsM. Contains ATP/GTP-binding site motif A
FT                   (P-loop) (Interpro|IPR001687, (GO:0005524)). Contains
FT                   Ribosomal protein S13 (Interpro|IPR001892, (GO:0006412))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60505"
FT                   /db_xref="GOA:Q8ZJ90"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ90"
FT                   /protein_id="AAS60505.1"
FT                   /translation="MARIAGINIPDQKHTVIALTAIFGIGKTRSQAICVAAGIAEHVKI
FT                   SELSEEQIEKLRDEVAKYVVEGDLRREVTLSIKRLMDLGTYRGLRHRRGLPVRGQRTKT
FT                   NARTRKGPRKPIKK"
FT   gene            231561..231950
FT                   /gene="rpsK"
FT                   /locus_tag="YP_0230"
FT                   /old_locus_tag="YP0230"
FT   CDS_pept        231561..231950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="YP_0230"
FT                   /old_locus_tag="YP0230"
FT                   /product="30S ribosomal protein S11"
FT                   /note="similar to Yersinia pestis CO92 rpsK and Yersinia
FT                   pestis KIM rpsK. Contains Ribosomal protein S11
FT                   (Interpro|IPR001971, (GO:0006412))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60506"
FT                   /db_xref="GOA:Q8ZJ89"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ89"
FT                   /protein_id="AAS60506.1"
FT                   /translation="MAKAPIRARKRVRKTVSDGVAHIHASFNNTIVTITDRQGNALGWA
FT                   TAGGSGFRGSRKSTPFAAQVAAERCAEAVKEYGIKNLEVMVKGPGPGRESTIRALNAAG
FT                   FRITNITDVTPIPHNGCRPPKKRRV"
FT   gene            231981..232601
FT                   /gene="rpsD"
FT                   /locus_tag="YP_0231"
FT                   /old_locus_tag="YP0231"
FT   CDS_pept        231981..232601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="YP_0231"
FT                   /old_locus_tag="YP0231"
FT                   /product="30S ribosomal protein S4"
FT                   /note="similar to Yersinia pestis CO92 rpsD and Yersinia
FT                   pestis KIM rpsD. Contains Ribosomal protein S4
FT                   (Interpro|IPR001912, (GO:0006412)). Contains RNA-binding S4
FT                   (Interpro|IPR002942, (GO:0003723)). Contains Ribosomal
FT                   protein S4, bacterial and organelle form
FT                   (Interpro|IPR005709, (GO:0015935))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60507"
FT                   /db_xref="GOA:Q8ZJ88"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ88"
FT                   /protein_id="AAS60507.1"
FT                   /translation="MARYLGPKLKLSRREGTDLFLKSGVRAIDTKCKIEQPPGQHGARK
FT                   PRLSDYGVQLREKQKVRRIYGVLERQFRNYYKEAARLKGNTGANLLQLLEGRLDNVVYR
FT                   MGFGATRAESRQLVSHKAIMVNGRVVNIASYQVSPNDVVSIREKAKKQSRVKAALELAE
FT                   QREKPTWLEVDAVKMEGVFKRIPERTDLSADINEHLIVELYSK"
FT   gene            232627..233616
FT                   /gene="rpoA"
FT                   /locus_tag="YP_0232"
FT                   /old_locus_tag="YP0232"
FT   CDS_pept        232627..233616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="YP_0232"
FT                   /old_locus_tag="YP0232"
FT                   /product="DNA-directed RNA polymerase alpha chain"
FT                   /note="similar to Yersinia pestis CO92 rpoA and Yersinia
FT                   pestis KIM rpoA. Contains RNA polymerase, alpha chain,
FT                   bacterial and organelle (Interpro|IPR001700, (GO:0006350))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60508"
FT                   /db_xref="GOA:Q8ZJ87"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ87"
FT                   /protein_id="AAS60508.1"
FT                   /translation="MQGSVTEFLKPRLVDIEQVSSTHAKVTLEPLERGFGHTLGNALRR
FT                   ILLSSMPGCAVTEVEIDGVLHEYSTKEGVQEDILEILLNLKGLAVRVQGKDEVILTLNK
FT                   SGIGPVTAADITHDGDVEIVKPQHVICHLTDENASINMRIKVQRGRGYVPASARIHSEE
FT                   DERPIGRLLVDACYSPVERIAYNVEAARVEQRTDLDKLVIEMETNGTIDPEEAIRRAAT
FT                   ILAEQLEAFVDLRDVRQPEVKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDL
FT                   VQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASIADE"
FT   gene            233657..234046
FT                   /gene="rplQ"
FT                   /locus_tag="YP_0233"
FT                   /old_locus_tag="YP0233"
FT   CDS_pept        233657..234046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="YP_0233"
FT                   /old_locus_tag="YP0233"
FT                   /product="50S ribosomal protein L17"
FT                   /note="similar to Yersinia pestis CO92 rplQ and Yersinia
FT                   pestis KIM rplQ. Contains Ribosomal protein L17
FT                   (Interpro|IPR000456, (GO:0006412))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60509"
FT                   /db_xref="GOA:Q7CFS8"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CFS8"
FT                   /protein_id="AAS60509.1"
FT                   /translation="MRHRKSGRQLNRNSSHRQAMFRNMAGSLVRHEIIKTTLPKAKELR
FT                   RVVEPLITLAKTDNVANRRLAFARTRDNEIVAKLFNELGPRFASRAGGYTRILKCGFRA
FT                   GDNAPMAYIELVDRAASQAEVVAAE"
FT   gene            234484..234918
FT                   /gene="soxR1"
FT                   /locus_tag="YP_0234"
FT                   /old_locus_tag="YP0234"
FT   CDS_pept        234484..234918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxR1"
FT                   /locus_tag="YP_0234"
FT                   /old_locus_tag="YP0234"
FT                   /product="MerR-family transcriptional regulator"
FT                   /note="similar to Yersinia pestis CO92 YPO0236 and Yersinia
FT                   pestis KIM y4017. Contains Bacterial regulatory protein,
FT                   MerR family (Interpro|IPR000551, (GO:0006355))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60510"
FT                   /db_xref="GOA:Q8CZI8"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011788"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZI8"
FT                   /protein_id="AAS60510.1"
FT                   /translation="MDNMLKIGQLAKLADVTPDTIRYYEKQGMMDHGERTDGGYRLYTD
FT                   QDLQRLRFIRYAKQLGFTLDTIAELLSIRIDPDHHTCQESKSIVDSRLSDVEGKIRELE
FT                   RMRDSLKRLSEACCGTSHATTYCSILEALEQGATEELIKV"
FT   gene            235006..235206
FT                   /locus_tag="YP_0235"
FT                   /old_locus_tag="YP0235"
FT   CDS_pept        235006..235206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0235"
FT                   /old_locus_tag="YP0235"
FT                   /product="hypothetical protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0237 and Yersinia
FT                   pestis KIM y4018. Contains Domain of unknown function
FT                   (Interpro|IPR005589)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60511"
FT                   /db_xref="GOA:A0A3N4AYJ1"
FT                   /db_xref="InterPro:IPR005589"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AYJ1"
FT                   /protein_id="AAS60511.1"
FT                   /translation="MTTYRHTKGKIKDNALEALLHDPLFRQRIEKNSKGKGSYQRKEKY
FT                   AKGSNWEASGKQSIDFLLLAF"
FT   gene            complement(235316..235738)
FT                   /gene="mscL"
FT                   /locus_tag="YP_0236"
FT                   /old_locus_tag="YP0236"
FT   CDS_pept        complement(235316..235738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="YP_0236"
FT                   /old_locus_tag="YP0236"
FT                   /product="mechanosensitive ion channel"
FT                   /note="similar to Yersinia pestis CO92 mscL and Yersinia
FT                   pestis KIM mscL. Contains Large-conductance
FT                   mechanosensitive channel (Interpro|IPR001185,
FT                   (GO:0016020))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60512"
FT                   /db_xref="GOA:Q8ZJ83"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ83"
FT                   /protein_id="AAS60512.1"
FT                   /translation="MLAMSFMKEFREFAMRGNVVDLAVGVIIGAAFGRIVSSLVADIIM
FT                   PPLGLLLGGVDFKQFHFVLRAAEGTIPAVVMNYGTFIQSIFDFVIVALAIFSAVKLMNK
FT                   LRREKAEEEPATPPAPTTEEILLAEIRDLLKAQHTK"
FT   gene            complement(235868..237244)
FT                   /gene="trkA"
FT                   /locus_tag="YP_0237"
FT                   /old_locus_tag="YP0237"
FT   CDS_pept        complement(235868..237244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA"
FT                   /locus_tag="YP_0237"
FT                   /old_locus_tag="YP0237"
FT                   /product="trk system potassium uptake protein"
FT                   /note="similar to Yersinia pestis CO92 trkA and Yersinia
FT                   pestis KIM trkA. Contains NAD binding site
FT                   (Interpro|IPR000205). Contains TrkA-N (Interpro|IPR003148,
FT                   (GO:0006813)). Contains TrkA potassium uptake protein
FT                   (Interpro|IPR006036, (GO:0006813), (GO:0008324)). Contains
FT                   TrkA-C (Interpro|IPR006037, (GO:0006813), (GO:0008324))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60513"
FT                   /db_xref="GOA:A0A3N4BB44"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BB44"
FT                   /protein_id="AAS60513.1"
FT                   /translation="MKIIILGAGQVGGTLAENLVGENNDITVVDIDSGRLRQLQDKFDL
FT                   RVVQGYGSHPRVLREAGAEDADMLVAVTNSDETNMIACQIAYSLFNTPNRIARIRSTEY
FT                   IREADKLFLPEAVPIDHLISPEQLVIDYIYKLIEYPGALQVVNFAEGKVSIAAVKAYYG
FT                   GPLVGNALSSLREHMPHIDTRVAAIFRQDRPIRPQGSTIIEAGDEVFFVAASQHIRAVM
FT                   SELQRLEKPYKRIMIVGGGNVGAGLALRLEKDYSVKLIERDQQRAAELAEMLHDTIVFY
FT                   GDASDQELLAEEHIEQVDVFIAITNDDEANIMSAMLAKRMGAKKAMVLIQRSAYVDLVQ
FT                   GSVIDIVISPQQATISALLGHVRKADIVSVSSLRRGVAEAIEAIAHGDESTSKVVGRMV
FT                   EDIKLPPGTTIGAIVRGDEVIIANSNSIIKQGDHVIMFITHKKFVPDVERLFQPSPFFL
FT                   "
FT   gene            complement(237300..238607)
FT                   /gene="sun"
FT                   /locus_tag="YP_0238"
FT                   /old_locus_tag="YP0238"
FT   CDS_pept        complement(237300..238607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sun"
FT                   /locus_tag="YP_0238"
FT                   /old_locus_tag="YP0238"
FT                   /product="tRNA and rRNA cytosine-C5-methylases"
FT                   /note="similar to Yersinia pestis CO92 YPO0240 and Yersinia
FT                   pestis KIM sun. Contains SAM (and some other nucleotide)
FT                   binding motif (Interpro|IPR000051, (GO:0008757)). Contains
FT                   Bacterial Sun/eukaryotic nucleolar Nop1/Nop2
FT                   (Interpro|IPR001678). Contains Sun protein
FT                   (Interpro|IPR004573). Contains Antitermination protein NusB
FT                   (Interpro|IPR006027, (GO:0006355)). Contains NusB domain
FT                   (Interpro|IPR006174)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60514"
FT                   /db_xref="GOA:Q8ZJ81"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR023541"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ81"
FT                   /protein_id="AAS60514.1"
FT                   /translation="MSAFLVMKNTYNLRSIAAKAISQVLDQGQSLSAVLPELQKNISDK
FT                   DRALLQELCFGTLRVLPQLEWCIQQLMARPMTGKQRVFHYLIMVGLYQLIYTRIPPHAA
FT                   LAETVEGATVLKRPQLKGLINGVLRQFQRQQVELLERAVNNDSHYLHPSWLLARIKQAY
FT                   PAQWQQILDANNQRPPMWLRVNRLHHSRSEYLELLTQADINAEPHPIYRDAVRLITPCA
FT                   VNHLPGFELGWVTVQDASAQGCVDLLDPQNGEQILDLCAAPGGKTTHILEAAPKAHVLA
FT                   VDIDEQRLSRVKENLQRLQLQAVVRVGDGRAPDTWCGDQQFDRILLDAPCSATGVIRRH
FT                   PDIKWLRRDRDISELAQLQSEIIEAIWPKLKHGGVLVYATCSILPEENQQQIAAFLQRH
FT                   PEAQLTETGTTAAPGKQNLPHPEDGDGFFYAKIIKK"
FT   gene            complement(238683..239630)
FT                   /gene="fmt"
FT                   /locus_tag="YP_0239"
FT                   /old_locus_tag="YP0239"
FT   CDS_pept        complement(238683..239630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="YP_0239"
FT                   /old_locus_tag="YP0239"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="similar to Yersinia pestis CO92 fmt and Yersinia
FT                   pestis KIM fmt. Contains Formyl transferase, N-terminal
FT                   (Interpro|IPR002376, (GO:0009058), (GO:0016742)). Contains
FT                   Formyl transferase, C-terminal (Interpro|IPR005793,
FT                   (GO:0009058), (GO:0016742)). Contains Methionyl-tRNA
FT                   formyltransferase (Interpro|IPR005794, (GO:0006412))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60515"
FT                   /db_xref="GOA:Q8ZJ80"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="PDB:3R8X"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ80"
FT                   /protein_id="AAS60515.1"
FT                   /translation="MSDSLRIIFAGTPDFAARHLGALLSSQHKIVGVFTQPDRPAGRGN
FT                   KLTPSPVKILAEHHGIPVFQPKSLRPEENQHLVADLNADIMVVVAYGLILPAAVLAMPR
FT                   LGCINVHGSLLPRWRGAAPIQRSVWAGDEKTGITIMQMDIGLDTGAMLHKIECAIQPED
FT                   TSATLYDKLAQLGPQGLLITLQQLAAGTALAEVQNETQATYAEKLSKEEAKLDWTLSAT
FT                   QLERCIRAFNPWPVSYFIVDEQPIKVWQAQVLPAGEDAEPGTIIHADKHGIQVATADGV
FT                   LNITQLQPAGKKAMSAADLLNSRREWFIPGSQLV"
FT   gene            complement(239655..240167)
FT                   /gene="def"
FT                   /locus_tag="YP_0240"
FT                   /old_locus_tag="YP0240"
FT   CDS_pept        complement(239655..240167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="YP_0240"
FT                   /old_locus_tag="YP0240"
FT                   /product="polypeptide deformylase"
FT                   /note="similar to Yersinia pestis CO92 def and Yersinia
FT                   pestis KIM def. Contains Formylmethionine deformylase
FT                   (Interpro|IPR000181, (GO:0006412), (GO:0008463))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60516"
FT                   /db_xref="GOA:Q8ZJ79"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ79"
FT                   /protein_id="AAS60516.1"
FT                   /translation="MSVLQVLHYPDERLRKIAAPVKEVNGEIQRIVDDMFETMYAEEGI
FT                   GLAATQVDVHQQIIVIDISENRDQRLVLINPELLEKSGETGIEEGCLSIPEQRALVPRA
FT                   EKVKIRALDRDGKPFELETDGLLAICIQHEMDHLIGKLFVDYLSPLKRQRIRQKLEKMA
FT                   KLNARAN"
FT   gene            240302..241423
FT                   /gene="smf"
FT                   /locus_tag="YP_0241"
FT                   /old_locus_tag="YP0241"
FT   CDS_pept        240302..241423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smf"
FT                   /locus_tag="YP_0241"
FT                   /old_locus_tag="YP0241"
FT                   /product="putative Rossmann fold nucleotide-binding protein
FT                   involved in DNA uptake"
FT                   /note="similar to Yersinia pestis CO92 YPO0243 and Yersinia
FT                   pestis KIM smf1. Contains SMF protein (Interpro|IPR003488,
FT                   (GO:0009294))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60517"
FT                   /db_xref="GOA:A0A3N4BKP2"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BKP2"
FT                   /protein_id="AAS60517.1"
FT                   /translation="MLAAELWLRMTQVKGLGVVKRSALAKRLLASGDIHPGRLAAYGLD
FT                   SQQCHQFAQLSPRYIADTLEWLSDPNHHLLTYGEPGYPPRLVHIAGAPLVLFVSGELDV
FT                   LYRPQIAMVGSRHFSHYGEQWGRYFASELARTGLVITSGLAVGIDGICHQAALNIQGRT
FT                   IAVLGSGLENIYPQRHSRLAKEIEYQGGALVSEFLTTALPIAAHFPRRNRIISGLSDAV
FT                   LVVEATLKSGSLITARYAMDQGRDVFALPGPLGSASSEGTHWLIQQGAYLATSVKDVSE
FT                   QVSGSLQWLSLPEEVIISSPQEQVELPFADVLANVGDEVTPVDVVAERAGQPVQDIASK
FT                   LLELELAGWIAAVPGGYVRIRRAGHVRRSNLLI"
FT   gene            241395..241868
FT                   /locus_tag="YP_0242"
FT                   /old_locus_tag="YP0242"
FT   CDS_pept        241395..241868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0242"
FT                   /old_locus_tag="YP0242"
FT                   /product="hypothetical protein"
FT                   /note="similar to Yersinia pestis KIM smg"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60518"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ77"
FT                   /protein_id="AAS60518.1"
FT                   /translation="MFDVLIYLFETYMHNEPEMLVDQDKITDDLADAGFYREDINNALN
FT                   WLEVLADLQEGQKAPYLYTADPQALRIYTVEECRRLGAACRGFILFLEQIQVLQFDTRE
FT                   MVIDRIMALDSPEIDLEDLKWVVLMVLFNIPGYENAYKQMEELLFEVNDGYLH"
FT   gene            241888..242448
FT                   /gene="topA1"
FT                   /locus_tag="YP_0243"
FT                   /old_locus_tag="YP0243"
FT   CDS_pept        241888..242448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topA1"
FT                   /locus_tag="YP_0243"
FT                   /old_locus_tag="YP0243"
FT                   /product="putative DNA topoisomerase"
FT                   /note="similar to Yersinia pestis KIM y4026. Contains DNA
FT                   topoisomerase I (Interpro|IPR000380, (GO:0006268))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60519"
FT                   /db_xref="GOA:Q8CZI7"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CZI7"
FT                   /protein_id="AAS60519.1"
FT                   /translation="MAYIEGVMTKKVITKDNGSCPECGSALVIRSGGHGPFLGCSHYPD
FT                   CQYIRPLKAQADGHVVKTLEGQPCPECGSDMMLRQGRFGMFIGCSQYPQCDHTEVIDKP
FT                   DETSIDCPQCGQGKLLQRKSRFGKVFHACNRYPDCQFTLNQPPIAGKCGYCHYPLLIEK
FT                   RTARGIKRICASKLCGKAVASES"
FT   gene            242450..243022
FT                   /gene="sUA5A"
FT                   /locus_tag="YP_0244"
FT                   /old_locus_tag="YP0244"
FT   CDS_pept        242450..243022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sUA5A"
FT                   /locus_tag="YP_0244"
FT                   /old_locus_tag="YP0244"
FT                   /product="Putative translation factor (SUA5)"
FT                   /note="similar to Yersinia pestis CO92 YPO0245a and similar
FT                   to Yersinia pestis KIM y4027 (residues 1 to 182 of 182 are
FT                   similar to residues 13 to 194 of 194 from Yersinia pestis
FT                   KIM y4027). Contains Sua5/YciO/YrdC/YwlC protein family
FT                   (Interpro|IPR004388, (GO:0005554)). Contains SUA5/yciO/yrdC
FT                   N-terminal (Interpro|IPR006070)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60520"
FT                   /db_xref="GOA:Q74XX5"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q74XX5"
FT                   /protein_id="AAS60520.1"
FT                   /translation="MNQQENNFVLADIVRALRQEEVIAYPTEAVFGLGCDPDSEKAVNT
FT                   LLALKQRPWQKGLILVAANYAQLEPYINDSMLNEIQRETLFSTWPGPITWVIPARVETP
FT                   QWLTGCFDSLAVRVSNHPLVQQLCAEYGKPLVSTSANLSGHEPCRTEEEVRIQFGPSLP
FT                   VLSGHVGGRLNPSEIRDALTGKRFRQG"
FT   gene            243031..243852
FT                   /gene="aroE1"
FT                   /locus_tag="YP_0245"
FT                   /old_locus_tag="YP0245"
FT   CDS_pept        243031..243852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE1"
FT                   /locus_tag="YP_0245"
FT                   /old_locus_tag="YP0245"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /note="similar to Yersinia pestis CO92 aroE and Yersinia
FT                   pestis KIM aroE. Contains Shikimate/quinate 5-dehydrogenase
FT                   (Interpro|IPR006151, (GO:0016089)). Contains Shikimate
FT                   5-dehydrogenase (Interpro|IPR006152, (GO:0016089))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60521"
FT                   /db_xref="GOA:Q8ZJ74"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ74"
FT                   /protein_id="AAS60521.1"
FT                   /translation="MDQKFAVFGNPISHSKSPRIHTLFSEQTGIEHRYGKVLAPSEAFE
FT                   NTLVSFFADGAQGANITTPFKERAYDQCDELTDRASLAGAVNTIKRLEDGRLLGDNTDG
FT                   IGLLSDLERQNLIRTTDHILLVGAGGAARGVILPLLSYGCTVVVTNRTHTRAQQLAKVF
FT                   NHIGDIDVCEMSELAGQRFDLVINATASGLHGEVPNLPAAILTSQTRCYDMFYQAGTTP
FT                   FLAWAQRLGLADYADGLGMLVGQAAHAFKLWHGVMPEITPVLAQLRSELGK"
FT   gene            complement(243907..244449)
FT                   /gene="paaY"
FT                   /locus_tag="YP_0246"
FT                   /old_locus_tag="YP0246"
FT   CDS_pept        complement(243907..244449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paaY"
FT                   /locus_tag="YP_0246"
FT                   /old_locus_tag="YP0246"
FT                   /product="putative transferase"
FT                   /note="similar to Yersinia pestis KIM y4029. Contains
FT                   Bacterial transferase hexapeptide repeat
FT                   (Interpro|IPR001451)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60522"
FT                   /db_xref="GOA:A0A0H2W242"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W242"
FT                   /protein_id="AAS60522.1"
FT                   /translation="MCDSIRPYLHHSPTLGKRVMIDRSSVIIGNVILGDDVSVWPLVAI
FT                   RGDVNQVIIGARSNIQDGSVLHVTHQSEHNPEGYPLIIGEDVTIGHKAMLHGCTIGNRV
FT                   LVGMGSILLDGTIIEDDVMIGAGSLITPGKRLVSGYLYVGSPAKQIRPLTPLELEGLLY
FT                   SAGNYVRWKDDYLAESK"
FT   gene            245028..246516
FT                   /locus_tag="YP_r4"
FT                   /old_locus_tag="16S_rRNA_2"
FT   rRNA            245028..246516
FT                   /locus_tag="YP_r4"
FT                   /old_locus_tag="16S_rRNA_2"
FT                   /product="16S ribosomal RNA"
FT   gene            246646..246722
FT                   /locus_tag="YP_t2"
FT                   /old_locus_tag="tRNA-Ile_1"
FT   tRNA            246646..246722
FT                   /locus_tag="YP_t2"
FT                   /old_locus_tag="tRNA-Ile_1"
FT                   /product="tRNA-Ile"
FT                   /note="codon recognized: AUC; Cove score 94.77"
FT   gene            246774..246849
FT                   /locus_tag="YP_t3"
FT                   /old_locus_tag="tRNA-Ala_1"
FT   tRNA            246774..246849
FT                   /locus_tag="YP_t3"
FT                   /old_locus_tag="tRNA-Ala_1"
FT                   /product="tRNA-Ala"
FT                   /note="codon recognized: GCA; Cove score 93.97"
FT   gene            247068..249974
FT                   /locus_tag="YP_r5"
FT                   /old_locus_tag="23S_rRNA_2"
FT   rRNA            247068..249974
FT                   /locus_tag="YP_r5"
FT                   /old_locus_tag="23S_rRNA_2"
FT                   /product="23S ribosomal RNA"
FT   gene            250084..250199
FT                   /locus_tag="YP_r6"
FT                   /old_locus_tag="5S_rRNA_2"
FT   rRNA            250084..250199
FT                   /locus_tag="YP_r6"
FT                   /old_locus_tag="5S_rRNA_2"
FT                   /product="5S ribosomal RNA"
FT   gene            250666..250932
FT                   /locus_tag="YP_0247"
FT                   /old_locus_tag="YP0247"
FT   CDS_pept        250666..250932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0247"
FT                   /old_locus_tag="YP0247"
FT                   /product="putative transposase"
FT                   /note="similar to Yersinia pestis KIM y0503. Contains
FT                   Helix-turn-helix, Fis-type (Interpro|IPR002197,
FT                   (GO:0006355)). Contains Transposase, IS3/IS911family
FT                   (Interpro|IPR002514)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60523"
FT                   /db_xref="GOA:A0A384KT65"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KT65"
FT                   /protein_id="AAS60523.1"
FT                   /translation="MKKTRYTEEQIAFALKQAETGTRVEEVCRKMGISEATFYNWKKKF
FT                   GGMGVTELRRLRQLEDENQRLKRLVADLSLDKEMLQDVIRKKF"
FT   gene            250956..251765
FT                   /gene="tra5B"
FT                   /locus_tag="YP_0248"
FT                   /old_locus_tag="YP0248"
FT   CDS_pept        250956..251765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tra5B"
FT                   /locus_tag="YP_0248"
FT                   /old_locus_tag="YP0248"
FT                   /product="putative transposase"
FT                   /note="similar to Yersinia pestis KIM y0504. Contains
FT                   Integrase, catalytic domain (Interpro|IPR001584,
FT                   (GO:0006310))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60524"
FT                   /db_xref="GOA:Q8D1G9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1G9"
FT                   /protein_id="AAS60524.1"
FT                   /translation="MEYLLAAYRIGVRRGCRLMMQSRTVYNYRSHRDDRAITQRIREIA
FT                   ETRIRYGCPRIHILLRREGWLVNHKKTHRIYCLEGLNLRSKRPRWHVTARHRHASPEVT
FT                   ALDQCWSMDFVADNLFNGRRVRALTIVDNFSRECLAIEVGQGLRGDDVVAVMDRLKHSL
FT                   GRIPQRLQTDNGSEFISKSMDRWAYENRVSMDFSGPGKPTDNAFIESFNGSLRDECLNV
FT                   HGFLSLEDAQEKIEQWRQEYNHFRPYSSLNNLTPAEFARSHQKGPDL"
FT   gene            complement(252429..253211)
FT                   /gene="dnaC_3"
FT                   /locus_tag="YP_0249"
FT                   /old_locus_tag="YP0249"
FT   CDS_pept        complement(252429..253211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaC_3"
FT                   /locus_tag="YP_0249"
FT                   /old_locus_tag="YP0249"
FT                   /product="insertion sequence IS100, ATP-binding protein"
FT                   /note="similar to Yersinia pestis CO92 YPO4009 and Yersinia
FT                   pestis KIM y4030. Contains Chaperonin clpA/B
FT                   (Interpro|IPR001270). Contains ATP/GTP-binding site motif A
FT                   (P-loop) (Interpro|IPR001687, (GO:0005524)). Contains
FT                   Bacterial chromosomal replication initiator protein, DnaA
FT                   (Interpro|IPR001957, (GO:0006275)). Contains IstB-like
FT                   ATP-binding protein (Interpro|IPR002611). Contains AAA
FT                   ATPase (Interpro|IPR003593, (GO:0000166))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60525"
FT                   /db_xref="GOA:A0A3N4AY74"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AY74"
FT                   /protein_id="AAS60525.1"
FT                   /translation="MMMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLE
FT                   HLLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNE
FT                   NIVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGV
FT                   MAPRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALT
FT                   SAMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            complement(253208..254230)
FT                   /locus_tag="YP_0250"
FT                   /old_locus_tag="YP0250"
FT   CDS_pept        complement(253208..254230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0250"
FT                   /old_locus_tag="YP0250"
FT                   /product="transposase for insertion sequence IS100"
FT                   /note="similar to Yersinia pestis CO92 YPO4010 and Yersinia
FT                   pestis KIM y4031. Contains Integrase, catalytic domain
FT                   (Interpro|IPR001584, (GO:0006310)). Contains IS21-like
FT                   element transposase, HTH domain (Interpro|IPR007101)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60526"
FT                   /db_xref="GOA:A0A3N4B5E7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B5E7"
FT                   /protein_id="AAS60526.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            254322..254780
FT                   /gene="tnp_4"
FT                   /locus_tag="YP_0251"
FT                   /old_locus_tag="YP0251"
FT   CDS_pept        254322..254780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnp_4"
FT                   /locus_tag="YP_0251"
FT                   /old_locus_tag="YP0251"
FT                   /product="transposase for the IS1541 insertion element"
FT                   /note="similar to Yersinia pestis CO92 tnp (IS1541) and
FT                   Yersinia pestis KIM y3987."
FT                   /db_xref="EnsemblGenomes-Gn:YP_0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60527"
FT                   /db_xref="GOA:A0A384LAH1"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LAH1"
FT                   /protein_id="AAS60527.1"
FT                   /translation="MRDEKSLAHTRWNCKYHIVFAPKYRRQVFYREKRRAIGSILRKLC
FT                   EWKNVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSLMLYEQFGDLKFKYRNRE
FT                   FWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGSPFTGRK"
FT   gene            complement(254970..255176)
FT                   /locus_tag="YP_0252"
FT                   /old_locus_tag="YP0252"
FT   CDS_pept        complement(254970..255176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0252"
FT                   /old_locus_tag="YP0252"
FT                   /product="hypothetical protein"
FT                   /note="similar to Yersinia pestis CO92 YPO3432 and Yersinia
FT                   pestis KIM y0755. Contains Domain of unknown function
FT                   DUF329 (Interpro|IPR005584)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60528"
FT                   /db_xref="GOA:Q8ZBH8"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZBH8"
FT                   /protein_id="AAS60528.1"
FT                   /translation="MESEQIQVNCPTCGKVVIWGEQSPFRPFCCKRCQLIDLGEWADEE
FT                   KRIPSDTELSDSDEWSEEDPLKH"
FT   gene            complement(255362..256114)
FT                   /locus_tag="YP_0253"
FT                   /old_locus_tag="YP0253"
FT   CDS_pept        complement(255362..256114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0253"
FT                   /old_locus_tag="YP0253"
FT                   /product="hypothetical protein"
FT                   /note="similar to Yersinia pestis CO92 YPO3431 and Yersinia
FT                   pestis KIM y0756"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60529"
FT                   /db_xref="GOA:Q8ZBH9"
FT                   /db_xref="InterPro:IPR009777"
FT                   /db_xref="InterPro:IPR027462"
FT                   /db_xref="InterPro:IPR036268"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZBH9"
FT                   /protein_id="AAS60529.1"
FT                   /translation="MSDLTSTILFEHPLNEKMRTWLRMEFLLQQLESHRSLDNIANALT
FT                   FFRTASDLIDVLERGEVRTDLLKELERQQQKLQQWADIPGVDVSLVDSLRNQLKSRAAV
FT                   LMSAPRIGQSLKEDRLISVVRQRLSIPGGCCSFDLPTLHVWLHQPSEQRDQHINKLLAS
FT                   LAPLHQSLTIILDLIRQSCPLRSQISLNGFFQDNAGGADLLRLRLPLDPQLYPQISGHK
FT                   TRYAIRFLALDSENGTVPARLSFELACC"
FT   gene            complement(256111..256731)
FT                   /gene="coaE"
FT                   /locus_tag="YP_0254"
FT                   /old_locus_tag="YP0254"
FT   CDS_pept        complement(256111..256731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="YP_0254"
FT                   /old_locus_tag="YP0254"
FT                   /product="Dephospho-CoA kinase"
FT                   /note="similar to Yersinia pestis CO92 YPO3430 and Yersinia
FT                   pestis KIM y0757. Contains Shikimate kinase
FT                   (Interpro|IPR000623, (GO:0008652)). Contains Uridine kinase
FT                   (Interpro|IPR000764, (GO:0006224)). Contains
FT                   ATP/GTP-binding site motif A (P-loop) (Interpro|IPR001687,
FT                   (GO:0005524)). Contains Dephospho-CoA kinase
FT                   (Interpro|IPR001977, (GO:0005524))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60530"
FT                   /db_xref="GOA:Q8ZBI0"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZBI0"
FT                   /protein_id="AAS60530.1"
FT                   /translation="MTYIVALTGGIGSGKSTVANAFANLGVPLVDADIIARQVVEPGTS
FT                   ALAAIASRYGENILQQDGSLNRAALRQKIFSEQQEKAWLNSLLHPLIQQETQRQLAGID
FT                   QPYALWVVPLLVENGLHHRADRVLVVDVTPDIQLARTMARDGITRQQAENILASQVSRQ
FT                   QRLACADDIIDNSGDPLMIAQHVASLHHRYLKLATAAQQDLHQ"
FT   gene            257026..258069
FT                   /gene="guaC"
FT                   /locus_tag="YP_0256"
FT                   /old_locus_tag="YP0256"
FT   CDS_pept        257026..258069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaC"
FT                   /locus_tag="YP_0256"
FT                   /old_locus_tag="YP0256"
FT                   /product="GMP reductase"
FT                   /note="similar to Yersinia pestis CO92 guaC. Contains IMP
FT                   dehydrogenase/GMP reductase (Interpro|IPR001093,
FT                   (GO:0003824)). Contains FMN/related compound-binding core
FT                   (Interpro|IPR003009). Contains Guanosine monophosphate
FT                   reductase 1 (Interpro|IPR005993, (GO:0009117))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60532"
FT                   /db_xref="GOA:Q8ZBI2"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005993"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZBI2"
FT                   /protein_id="AAS60532.1"
FT                   /translation="MRIEEGLKLGFKDVLIRPKRSTLKSRSEVALERQFTFKHSGWNWS
FT                   GVPIIAANMDTVGTFRMAEVLASFDILTAVHKHYTLEQWAEFVKRSPESVLRHVMVSTG
FT                   TSSADFDKMKQILALSPSLKFICIDVANGYSEHFVSFLQRAREACPDKVICAGNVVTGE
FT                   MVEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGGQIVSDGGC
FT                   SVPGDVAKAFGGGADFVMLGGMLAGHDECEGRVVEENGEKFMLFYGMSSESAMKRHVGG
FT                   VAQYRAAEGKTVKLPLRGSVDNTVRDIMGGLRSACTYVGASHLKELTKRTTFIRVAEQE
FT                   NRVFGTD"
FT   gene            complement(258512..259711)
FT                   /gene="hofC"
FT                   /locus_tag="YP_0257"
FT                   /old_locus_tag="YP0257"
FT   CDS_pept        complement(258512..259711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hofC"
FT                   /locus_tag="YP_0257"
FT                   /old_locus_tag="YP0257"
FT                   /product="putative type II secretion system protein"
FT                   /note="similar to Yersinia pestis CO92 hofC and Yersinia
FT                   pestis KIM hofC. Contains Bacterial type II secretion
FT                   system protein (Interpro|IPR001992, (GO:0016020)). Contains
FT                   Bacterial general secretion pathway protein F
FT                   (Interpro|IPR003004, (GO:0015628))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60533"
FT                   /db_xref="GOA:A0A3N4BA27"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BA27"
FT                   /protein_id="AAS60533.1"
FT                   /translation="MSRHRLFNWTALNKTGELQTGMLLATERNSVYEHIIQHGLQPLGV
FT                   KGGRRLSARYWQGERLVAMTRQLATLLQAGLPLVNSLQLLAKEADDSAWRCLLDEISQQ
FT                   VAQGQSLSEVMEQYPHVFPRLYPPVVAVGELTGNLEQCCTQLVHHQERQQNLHKKVIKA
FT                   LKYPVVVCIVALVVSVIMLVMVLPEFAQIYQSFDTPLPGLTASLLWLSTFLTFYGPYLA
FT                   LIIAIVCIGYFYTLRKKSRWQQWEQTILLSIPLVSTLIRGSCLSQIFQTLAITQQAGLP
FT                   LSAGLDAAARSIHNYNYQQALRCIQKQISQGIPLYTTLNQHPLFPAICQQLIRVGEESG
FT                   SQDVLLEKLACWHQQQTQNLADNVTQMLEPLLMLIIGSIVGVLVIAMYLPIFQLGDVIG
FT                   "
FT   gene            complement(259708..261264)
FT                   /gene="hofB"
FT                   /locus_tag="YP_0258"
FT                   /old_locus_tag="YP0258"
FT   CDS_pept        complement(259708..261264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hofB"
FT                   /locus_tag="YP_0258"
FT                   /old_locus_tag="YP0258"
FT                   /product="putative integral membrane protein"
FT                   /note="similar to Yersinia pestis KIM hofB. Contains
FT                   Bacterial type II secretion system protein E
FT                   (Interpro|IPR001482, (GO:0006810)). Contains
FT                   ATP/GTP-binding site motif A (P-loop) (Interpro|IPR001687,
FT                   (GO:0005524))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60534"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1B8"
FT                   /protein_id="AAS60534.1"
FT                   /translation="MIRPHQMAEFIVSSFETISDELHLLCRRYRAVALTLDGKSLSIAS
FT                   AQTVDEALLTALRFTCGRQVRVEYWPEAKIEQSLYLGSPTKNNLNSSINNGLNSALLSQ
FT                   KGGDPSRVKPHNQQQQTIDDTVFDNESDTPVIQFITQTLSLAIQKRASDIHFEPYQHHY
FT                   RVRLRIDGVLHEFTPPEAEWAARISSCLKVMAKLNIAERRLPQDGQLTLPFGDSHYSMR
FT                   IATLPTQYGEKVVLRILQIQQQTTLEKLGMTDAALKQLTQALSAPQGLILVTGPTGSGK
FT                   TITLYCSLARLNQTQRNICSVEDPIEIPVNGINQTQVNSKIGLDFSRILRAILRQDPDV
FT                   IMVGEIRDNETASIAVNAAQTGHLVLSTLHTNSTAETLIRMAQMGIERHLIASSLKLVI
FT                   AQRLVRRLCLHCRQAASHPFIPPAHIRSGPIQHYLAVGCEHCCTGYYGRTGIYEMLSVT
FT                   PQIQQAILNNASPVKLVQIAQKQEQTALLCSGLALIEKGITTLSEINRVVGFVAETEVT
FT                   S"
FT   gene            complement(261239..261703)
FT                   /gene="ppdD"
FT                   /locus_tag="YP_0259"
FT                   /old_locus_tag="YP0259"
FT   CDS_pept        complement(261239..261703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppdD"
FT                   /locus_tag="YP_0259"
FT                   /old_locus_tag="YP0259"
FT                   /product="putative prepilin peptidase dependent protein D
FT                   precursor"
FT                   /note="similar to Yersinia pestis CO92 ppdD and Yersinia
FT                   pestis KIM ppdD. Contains Fimbrial protein pilin
FT                   (Interpro|IPR001082, (GO:0009289)). Contains Prokaryotic
FT                   N-terminal methylation site (Interpro|IPR001120). Contains
FT                   Bacterial general secretion pathway protein H
FT                   (Interpro|IPR002416, (GO:0015628))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60535"
FT                   /db_xref="GOA:A0A3N4BAC0"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BAC0"
FT                   /protein_id="AAS60535.1"
FT                   /translation="MAKHQGLTLQKGFTLIELMVAVAIIAVLSGIGIPSYQRYIQKAAL
FT                   TDMLQAIVPYKMAVELCALEQSNLDSCNAGSNGIPAGQVSRYINAINIAKGVITLSGQH
FT                   TLTGLTLAISPTRNSNGNLVWARTCTATDSAMTDSCKAVFRFNDKAPSNG"
FT   gene            complement(261906..262853)
FT                   /gene="nadC"
FT                   /locus_tag="YP_0260"
FT                   /old_locus_tag="YP0260"
FT   CDS_pept        complement(261906..262853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="YP_0260"
FT                   /old_locus_tag="YP0260"
FT                   /product="quinolinate phosphoribosyltransferase"
FT                   /note="similar to Yersinia pestis KIM nadC. Contains
FT                   Quinolinate phosphoribosyl transferase (Interpro|IPR002638,
FT                   (GO:0009435)). Contains Nicotinate-nucleotide
FT                   pyrophosphorylase (Interpro|IPR004393, (GO:0019363))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60536"
FT                   /db_xref="GOA:Q8D1B7"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1B7"
FT                   /protein_id="AAS60536.1"
FT                   /translation="MFRRLSIRHFGVYMPPRCYNSNSRRAELLERIQSDIPATVAQALS
FT                   EDLGGEVNADRDLTAQLLPADKQATATIITREDGIFCGQRWLNEVFIQLGAQISIQWLV
FT                   TDGDKLTANQTLCHLTGPARILLTGERTALNFLQTLSGVATEVSRYVVQLAGLKTQLLD
FT                   TRKTLPGLRTALKYAVLCGGGNNHRLGLSDAFLIKENHIIAAGSIKEAVAKAFWIHADV
FT                   PIEVEVESLDELQQALEAGADIVMLDNFTIPMMRDAVKMRDDHAKTQGSAQLEVSGNVT
FT                   LETLRSYAETGIDFISVGALTKHITALDLSMRFQ"
FT   gene            262927..263478
FT                   /gene="ampD1"
FT                   /locus_tag="YP_0261"
FT                   /old_locus_tag="YP0261"
FT   CDS_pept        262927..263478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampD1"
FT                   /locus_tag="YP_0261"
FT                   /old_locus_tag="YP0261"
FT                   /product="putative signaling protein in beta-lactamase
FT                   regulation"
FT                   /note="similar to Yersinia pestis CO92 ampD and Yersinia
FT                   pestis KIM ampD. Contains N-acetylmuramoyl-L-alanine
FT                   amidase, family 2 (Interpro|IPR002502, (GO:0009253))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60537"
FT                   /db_xref="GOA:A0A2S9PBZ5"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PBZ5"
FT                   /protein_id="AAS60537.1"
FT                   /translation="MLLENGWIVGVKQVLSPHFDLRPEGEMPSLLVIHSISLPPSEFGG
FT                   PYIDQLFTGTLNADEHPYFASIVHLRVSAHCLIRRDGEIIQYVPFDKRAWHAGVSVFAG
FT                   RERCNDFSIGIELEGTDVLPFTPVQYQRLTEISAVLFAHYPITVERVAGHSEIAPGRKT
FT                   DPGLAFDWFFYQQNLAKLLV"
FT   gene            263751..264605
FT                   /gene="ampE"
FT                   /locus_tag="YP_0262"
FT                   /old_locus_tag="YP0262"
FT   CDS_pept        263751..264605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampE"
FT                   /locus_tag="YP_0262"
FT                   /old_locus_tag="YP0262"
FT                   /product="putative membrane-bound sensory transducer in
FT                   beta-lactamase regulation"
FT                   /note="similar to Yersinia pestis CO92 ampE and Yersinia
FT                   pestis KIM ampE"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60538"
FT                   /db_xref="GOA:A0A3N4B5T6"
FT                   /db_xref="InterPro:IPR031347"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B5T6"
FT                   /protein_id="AAS60538.1"
FT                   /translation="MTLFTLLLVLAWERLFKLGEHWQLDHRLEVVFARLQRFSLIQTIL
FT                   LTVLWMVLVWGILQLVQNILFGFPLLLLWILICLMCIGAGGIRRHYRAYLKAARQGDIH
FT                   ATDKMAEELALIHGLPIESGEKDRLQSLQNALLWINFRYYLAPIFWLIVCGSYGPVALA
FT                   GYAMLRGYQTWLARHHTPLERAQTGIDGILHWLDWVPVRLVGVAYALLGHGERALPAWL
FT                   ASLGDFHSQQYQVLTRLAQYSLAREPHLDPVQTPRAAVSLARKVTLTIIVVVALLTIYG
FT                   ALV"
FT   gene            complement(265038..266438)
FT                   /gene="aroP1"
FT                   /locus_tag="YP_0263"
FT                   /old_locus_tag="YP0263"
FT   CDS_pept        complement(265038..266438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroP1"
FT                   /locus_tag="YP_0263"
FT                   /old_locus_tag="YP0263"
FT                   /product="aromatic amino acid transport protein"
FT                   /note="similar to Yersinia pestis CO92 aroP and Yersinia
FT                   pestis KIM aroP. Contains Amino acid/polyamine transporter,
FT                   family I (Interpro|IPR002293, (GO:0016020)). Contains Amino
FT                   acid permease (Interpro|IPR004840, (GO:0016020)). Contains
FT                   Domain found in permeases (Interpro|IPR004841,
FT                   (GO:0016020)). Contains Hemopexin repeat
FT                   (Interpro|IPR000585). Contains Amino acid/polyamine
FT                   transporter, family I (Interpro|IPR002293, (GO:0016020)).
FT                   Contains Amino acid permease (Interpro|IPR004840,
FT                   (GO:0016020)). Contains Domain found in permeases
FT                   (Interpro|IPR004841, (GO:0016020))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60539"
FT                   /db_xref="GOA:Q8D1B6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1B6"
FT                   /protein_id="AAS60539.1"
FT                   /translation="MMSDQQEGAELKRGLKNRHIQLIALGGAIGTGLFLGIAQTIKMAG
FT                   PSVLLGYAIGGFIAFLIMRQLGEMVVEEPVAGSFSHFAYKYWGHFAGFASGWNYWVLYV
FT                   LVAMAELTAVGIYVQYWWPEIPTWVSAAVFFLAINAINLANVKVYGEMEFWFAIIKVIA
FT                   IIAMILFGGYLLISGRGGPEATVTNLWAQGGFFPNGIMGLVMAMAVIMFSFGGLELVGI
FT                   TAAEAEDPAKSIPKATNQVIYRILLFYIGSLAILLSLYPWGKVVEGGSPFVLIFDALDS
FT                   NSVATVLNIVVLTAALSVYNSCVYCNSRMLFGLAKQGNGPKILLKVDGRGVPVIAIAVS
FT                   AFATAFCVLINYLLPGRAFELLMALVVSALVINWAMISLAHLKFRAAKNRQGVIPKFKA
FT                   FWYPFGNCLCLLFLTGILVIMFLTPSIRISVILIPVWVVVLAIGYILKNQSQRQNQQLS
FT                   ASSRKVTK"
FT   gene            267226..268062
FT                   /gene="pdhR"
FT                   /locus_tag="YP_0264"
FT                   /old_locus_tag="YP0264"
FT   CDS_pept        267226..268062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhR"
FT                   /locus_tag="YP_0264"
FT                   /old_locus_tag="YP0264"
FT                   /product="pyruvate dehydrogenase complex repressor"
FT                   /note="similar to Yersinia pestis CO92 pdhR and Yersinia
FT                   pestis KIM pdhR. Contains Bacterial regulatory proteins,
FT                   AsnC family (Interpro|IPR000485, (GO:0006355)). Contains
FT                   Bacterial regulatory protein, GntR family
FT                   (Interpro|IPR000524, (GO:0006355)). Contains Bacterial
FT                   regulatory protein, MarR family (Interpro|IPR000835,
FT                   (GO:0006355)). Contains Bacterial regulatory protein, DeoR
FT                   family (Interpro|IPR001034, (GO:0006355))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60540"
FT                   /db_xref="GOA:Q8D1B5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1B5"
FT                   /protein_id="AAS60540.1"
FT                   /translation="MKLVLPIDSAPLAETIHSIRLTPNMAYNKIRQPKLSDVIEQQLEY
FT                   LILEGTLRPGEKLLPERELAKQFDVSRPSLREAIQRLEAKGLLLRRQGGGTFVQTNLWQ
FT                   SFSDPLAELLADHPESQFDLLETRHALEGIAAYYAALRGTDEDLQRIRECHTVIQQAQD
FT                   NGDLDAEADAVMQYQVAVTEAAHNVVLLHLLRCMGPMLEQNVRQNFELLYLRREMLATV
FT                   SSHRARIFEAIVAREPEKAREASHRHLAFIEEILLDLSREHSRRERSLRRLQQRKE"
FT   gene            268258..270921
FT                   /gene="aceE"
FT                   /locus_tag="YP_0265"
FT                   /old_locus_tag="YP0265"
FT   CDS_pept        268258..270921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceE"
FT                   /locus_tag="YP_0265"
FT                   /old_locus_tag="YP0265"
FT                   /product="pyruvate dehydrogenase E1 component"
FT                   /note="similar to Yersinia pestis CO92 aceE and Yersinia
FT                   pestis KIM aceE. Contains Biotin/lipoyl attachment
FT                   (Interpro|IPR000089). Contains Formyl/methionyl peptide
FT                   receptor (Interpro|IPR000826, (GO:0016021)). Contains
FT                   Catalytic domain of components of various dehydrogenase
FT                   complexes (Interpro|IPR001078, (GO:0008152), (GO:0008415)).
FT                   Contains 2-oxo acid dehydrogenase, acyltransferase
FT                   component, lipoyl-binding (Interpro|IPR003016). Contains E3
FT                   binding domain (Interpro|IPR004167, (GO:0008415)). Contains
FT                   2-oxo-acid dehydrogenase E1 component homodimeric type
FT                   (Interpro|IPR004660, (GO:0016491)). Contains Transketolase,
FT                   N terminal (Interpro|IPR005474). Contains Dihydrolipoamide
FT                   acetyltransferase (Interpro|IPR006256)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60541"
FT                   /db_xref="GOA:A0A3N4B5T1"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B5T1"
FT                   /protein_id="AAS60541.1"
FT                   /translation="MSERLNNDVDPIETRDWLQAIESVIREEGVERAQYLIDQVLGEAR
FT                   KGGVSVAAGSANRDYINTIPVEDEPAYPGNLDLERRIRSAIRWNAVMTVLRASKKDLDL
FT                   GGHMASFQSSATFYEVCFNHFFRARNQKDGGDLVYFQGHISPGVYARAFLEGRLTEDQM
FT                   NNFRQEVHGKGLSSYPHPKLMPEFWQFPTVSMGLGPISAIYQAKFLKYLSHRGLKDTSA
FT                   QTVYAFLGDGEMDEPESKGAITIATREKLDNLVFVINCNLQRLDGPVTGNGKIINELEG
FT                   IFSGAGWQVLKVIWGGRWDELLRKDTSGKLIQLMNETLDGDYQTFKSKDGAYVREHFFG
FT                   RFPETAALVKDMTDDEIWSLNRGGHDPKKIFAALKKAQETQGKPTVILAHTIKGYGMGE
FT                   TAEGKNIAHQVKKMNMDGVRHFRDRFNVPVADAEIEKLPYITFEKDSEEYKYLHERRQA
FT                   LEGYLPTRMPKFTEKLEIPALSDFSSLLEEQNKEISTTIAFVRALNVMLKNKSIKDRIV
FT                   PIIADEARTFGMEGLFRQIGIYSPNGQQYTPQDREQVAYYKEDEKGQILQEGINELGAA
FT                   SSWLAAATSYSTNDLPMIPFYIYYSMFGFQRIGDLCWAAGDQQARGFLIGGTSGRTTLN
FT                   GEGLQHEDGHSHIQSLTIPNCISYDPAYAYEVAVIMHDGLERMYGEAQENVYYYLTTLN
FT                   ENYHMPAMPQGAEEGIRKGIYKLETVEGSKGKVQLMSSGAILRHVREAAQILAKDYGVG
FT                   SDVYSVTSFTELARDGQDCERWNMLHPTETPRVPYVAQVMNDAPAVASTDYMKLFAEQI
FT                   RNFIPASEFRVLGTDGFGRSDSRENLRHHFEVDSSYVVVAALGELAKRGDIDTSVVAEA
FT                   ITKFGIDADKVNPRLA"
FT   gene            270935..272464
FT                   /gene="aceF"
FT                   /locus_tag="YP_0266"
FT                   /old_locus_tag="YP0266"
FT   CDS_pept        270935..272464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceF"
FT                   /locus_tag="YP_0266"
FT                   /old_locus_tag="YP0266"
FT                   /product="dihydrolipoamide acetyltransferase component of
FT                   pyruvate dehydrogenase complex"
FT                   /note="similar to Yersinia pestis CO92 aceF and Yersinia
FT                   pestis KIM aceF. Contains Biotin/lipoyl attachment
FT                   (Interpro|IPR000089). Contains Formyl/methionyl peptide
FT                   receptor (Interpro|IPR000826, (GO:0016021)). Contains
FT                   Catalytic domain of components of various dehydrogenase
FT                   complexes (Interpro|IPR001078, (GO:0008152), (GO:0008415)).
FT                   Contains 2-oxo acid dehydrogenase, acyltransferase
FT                   component, lipoyl-binding (Interpro|IPR003016). Contains E3
FT                   binding domain (Interpro|IPR004167, (GO:0008415)). Contains
FT                   2-oxo-acid dehydrogenase E1 component homodimeric type
FT                   (Interpro|IPR004660, (GO:0016491)). Contains Transketolase,
FT                   N terminal (Interpro|IPR005474). Contains Dihydrolipoamide
FT                   acetyltransferase (Interpro|IPR006256)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60542"
FT                   /db_xref="GOA:A0A3N4B5W0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B5W0"
FT                   /protein_id="AAS60542.1"
FT                   /translation="MSIEINVPDIGADEVEVTEIMVKVGDTVEAEQSLITVEGDKASME
FT                   VPSPQAGVVKEIKIAVGDKVATGSLIMVFDATGAAAAPVKAEEKPAAPAQVAAPAASAA
FT                   KNVEVPDIGDDEVEVTEVMVKVGDKVDAEQSLITVEGDKASMEVPAPFAGIVKEIKIST
FT                   GDKVKTGSLIMVFEVEGAAPAPAAAPAAKAESKGEFAENDAYVHATPVIRRLAREFGVN
FT                   LAKVKGTGRKGRILREDIQAYVKDAVKRAEAAPAAAGGGLPGILPWPKVDFSKFGEIEE
FT                   VELGRIQKISGANLSRNWVMIPHVTQFDEADITEVEAFRKQQNIEAEKKKQDLKITPLV
FT                   FLMKAAAKALEEFPRFNSSISEDGQKLTLKKYINIGVAVDTPNGLVVPVFRDVNKKGIV
FT                   ELSRELSVISKKARDGKLTASDMQGGCFTISSLGGIGGTAFTPIVNAPEVAILGVSKSS
FT                   MKPVWNGKEFAPRLMLPLSLSFDHRVIDGAAGARFAAYIATIMADIRRLVM"
FT   gene            272482..272643
FT                   /locus_tag="YP_0267"
FT                   /old_locus_tag="YP0267"
FT   CDS_pept        272482..272643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0267"
FT                   /old_locus_tag="YP0267"
FT                   /product="hypothetical protein"
FT                   /note="no significant database match found"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60543"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W2L9"
FT                   /protein_id="AAS60543.1"
FT                   /translation="MPALLWLLLLLLVILLLLITNREKTLINRLCQAVTLVDKVVETLV
FT                   TRCGFSVY"
FT   gene            272767..274194
FT                   /gene="lpdA"
FT                   /locus_tag="YP_0268"
FT                   /old_locus_tag="YP0268"
FT   CDS_pept        272767..274194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpdA"
FT                   /locus_tag="YP_0268"
FT                   /old_locus_tag="YP0268"
FT                   /product="dihydrolipoamide dehydrogenase component of
FT                   pyruvate dehydrogenase complex"
FT                   /note="similar to Yersinia pestis CO92 lpdA and Yersinia
FT                   pestis KIM lpdA. Contains Pyridine nucleotide-disulphide
FT                   oxidoreductase, class-II (Interpro|IPR000103, (GO:0006118),
FT                   (GO:0008246)). Contains Adrenodoxin reductase
FT                   (Interpro|IPR000759, (GO:0006118)). Contains Mercuric
FT                   reductase (Interpro|IPR000815, (GO:0005505)). Contains
FT                   Pyridine nucleotide-disulphide oxidoreductase, class I
FT                   (Interpro|IPR001100, (GO:0006118), (GO:0008246)). Contains
FT                   FAD-dependent pyridine nucleotide-disulphide oxidoreductase
FT                   (Interpro|IPR001327, (GO:0006118), (GO:0015036)). Contains
FT                   Pyridine nucleotide-disulphide oxidoreductase dimerisation
FT                   domain (Interpro|IPR004099, Cellular Component: cytoplasm
FT                   (GO:0005737), (GO:0006118), (GO:0016491)). Contains
FT                   Dihydrolipoamide dehydrogenase (Interpro|IPR006258)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60544"
FT                   /db_xref="GOA:A0A3N4BA15"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BA15"
FT                   /protein_id="AAS60544.1"
FT                   /translation="MMSTEIKTQVVVLGAGPAGYSAAFRCADLGLETILVERYSTLGGV
FT                   CLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEPKTDIDKVRVWKDKVINQLTGGLAG
FT                   MAKGRKVKVVTGFGKFTGANTLVVDGENGPTTINFDNAIIAAGSRPIQLPFIPHEDSRI
FT                   WDSTDALALRTVPERLLVMGGGIIGLEMGTVYHALGSKIDVVEMLDQVIPAADKDVVKV
FT                   FTKRISKQFNLMLETKVTAVEAKEDGIYVTMEGKKAPAEPQRYDAVLVAIGRVPNGKLL
FT                   DAGQAGVEVDDRGFIHVDKQLRTNVPHIFAIGDIVGQPMLAHKGVHEGHVAAEVIAGMK
FT                   HYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETSTFPWAASGRAIASDCADGMTK
FT                   LIFDKETHRIIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAE
FT                   IYEGSITDLPNPKAKKK"
FT   gene            274386..274895
FT                   /gene="tnp_5"
FT                   /locus_tag="YP_0269"
FT                   /old_locus_tag="YP0269"
FT   CDS_pept        274386..274895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnp_5"
FT                   /locus_tag="YP_0269"
FT                   /old_locus_tag="YP0269"
FT                   /product="transposase for the IS1541 insertion element"
FT                   /note="similar to Yersinia pestis CO92 tnp and Yersinia
FT                   pestis KIM y3987. Contains Transposase IS200-like
FT                   (Interpro|IPR002686)."
FT                   /db_xref="EnsemblGenomes-Gn:YP_0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60545"
FT                   /db_xref="GOA:A0A0H2W6E9"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W6E9"
FT                   /protein_id="AAS60545.1"
FT                   /translation="MRSGNCKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGS
FT                   PFTGRK"
FT   gene            275465..278062
FT                   /gene="acnB"
FT                   /locus_tag="YP_0270"
FT                   /old_locus_tag="YP0270"
FT   CDS_pept        275465..278062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnB"
FT                   /locus_tag="YP_0270"
FT                   /old_locus_tag="YP0270"
FT                   /product="aconitate hydratase 2"
FT                   /note="similar to Yersinia pestis CO92 acnB and Yersinia
FT                   pestis KIM acnB. Contains Aconitate hydratase, N-terminal
FT                   (Interpro|IPR001030). Contains Aconitate hydratase 2
FT                   (Interpro|IPR004406, (GO:0006099))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60546"
FT                   /db_xref="GOA:A0A3N4BAB2"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004406"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015929"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015933"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="InterPro:IPR036288"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BAB2"
FT                   /protein_id="AAS60546.1"
FT                   /translation="MLEEYRKHVAERAAEGIVPKPLDASQMAALVESLKNPPAGEEEFL
FT                   LDLLTNRVPPGVDEAAYVKAGFLAAIAKGEAHSPLITAEKAIELLGTMQGGYNIHPLID
FT                   ALDNEQLAPIAAKALSHTLLMFDNFYDVEDKAKAGNPYAKQIIQSWADAEWYLSRPALA
FT                   EKLTVTVFKVTGETNTDDLSPAPDAWSRPDIPLHALAMLKNAREGIHPDQPGSVGPIKQ
FT                   IEELNKKGFPLAYVGDVVGTGSSRKSATNSVLWFMGDDIPYVPNKRGGGVVLGSKIAPI
FT                   FFNTMEDAGALPIEVDVAKLNMGDVIDIFPYQGEVRRHDTGEVLATFELKTDVLLDEVR
FT                   AGGRIPLIVGRGLTTKARESLGLPVSDVFRVPKPVAKSNKGFSLAQKMVGRACGVAGVR
FT                   PGEYCEPKMTSVGSQDTTGPMTRDELKDLACLGFSADLVMQSFCHTAAYPKPVDVTTHH
FT                   TLPDFIMNRGGVSLRPGDGIIHSWLNRMLLPDTVGTGGDSHTRFPIGISFPAGSGLVAF
FT                   AAATGVMPLDMPESVLVRFKGEMQPGITLRDLVHAIPYYAIQEGLLTVEKKGKKNIFSG
FT                   RILEIEGLPELKVEQAFELADASAERSAAGCTIKLDKAPITEYLQSNVVLLKWMIAEGY
FT                   GDRRTLERRINGMESWLANPSLLEGDADAEYAAVIEIDLAEITQPILCAPNDPDDARLL
FT                   SDVANSKIDEVFIGSCMTNIGHFRAAGKLLDQHKGQLPTRLWVAPPTKMDAAQLTEEGY
FT                   YSVFGKSGARIEIPGCSLCMGNQARVADGATVVSTSTRNFPNRLGTGANVYLASAELAA
FT                   IASLLGRLPTPDEYQTYMAQVDKTAEDTYRYLNFDQLSQYTDKADGVIFQTAV"
FT   gene            278361..278720
FT                   /locus_tag="YP_0271"
FT                   /old_locus_tag="YP0271"
FT   CDS_pept        278361..278720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0271"
FT                   /old_locus_tag="YP0271"
FT                   /product="hypothetical protein"
FT                   /note="similar to Yersinia pestis CO92 YPO3414"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60547"
FT                   /db_xref="InterPro:IPR008249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZBJ5"
FT                   /protein_id="AAS60547.1"
FT                   /translation="MDYEFLRDLTGQVLVKFSMGHEVIGHWLNEEIKGDLVKLDHIETA
FT                   ADGVRGSERQWQLPGHEYTLWLDGEEVMVRANQLDLDGDEMEEGMNYYDEESLCLCGLE
FT                   DFLLVLKGYRAFITQ"
FT   gene            complement(278831..279739)
FT                   /gene="rhaT1"
FT                   /locus_tag="YP_0272"
FT                   /old_locus_tag="YP0272"
FT   CDS_pept        complement(278831..279739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhaT1"
FT                   /locus_tag="YP_0272"
FT                   /old_locus_tag="YP0272"
FT                   /product="putative membrane protein"
FT                   /note="similar to Yersinia pestis CO92 YPO3413 and Yersinia
FT                   pestis KIM y0773. Contains Protein of unknown function DUF6
FT                   (Interpro|IPR000620)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60548"
FT                   /db_xref="GOA:A0A3N4B8K3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B8K3"
FT                   /protein_id="AAS60548.1"
FT                   /translation="MNRLPTLYGIIAILLWSMSVALTRGLAEALGPFGAGSAIYSVSGI
FT                   LVWLVAGKPRVRGQHPAYLYGCGLLFVVYMVAFALAIGMANDRQQTLEIGLINYLWPSL
FT                   TLLLAVPLLKLRARWWLWPGAALALFGVIWVVSGGEGLDVKTLAVNISSNPLAYSLALI
FT                   AAFTWAGYSNLVRLYSQGPGALPLFLIACALCLWLMFFMWTPGKLHFTPRAIFELLLMG
FT                   ANTALAYQCWDRAYQCWDSAMKKGNATLVAALSYFTPLLSILIASVWLNTLPSAAFWPG
FT                   VAMVVAGSLLCWSASRNPLRT"
FT   gene            complement(280177..280971)
FT                   /gene="speD"
FT                   /locus_tag="YP_0273"
FT                   /old_locus_tag="YP0273"
FT   CDS_pept        complement(280177..280971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speD"
FT                   /locus_tag="YP_0273"
FT                   /old_locus_tag="YP0273"
FT                   /product="S-adenosylmethionine decarboxylase proenzyme"
FT                   /note="similar to Yersinia pestis CO92 speD and Yersinia
FT                   pestis KIM speD."
FT                   /db_xref="EnsemblGenomes-Gn:YP_0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60549"
FT                   /db_xref="GOA:Q8ZBJ7"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR009165"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZBJ7"
FT                   /protein_id="AAS60549.1"
FT                   /translation="MSKLKLHGFNNLTKSLSFCIYDICYAKTADDRDGYIAYIDEQYNA
FT                   NRLTEILSETCSIIGANILNIARQDYDPQGASVTILVSEEPVDPRDVDTSEHPGPLPSA
FT                   VVAHLDKSHICVHTYPESHPEAGLCTFRADIEVSTCGVISPLKALNYLIHQLESDIVTM
FT                   DYRVRGFTRDINGVKHFIDHKINSIQNFMSDDMKSLYHMMDVNVYQENIFHTKMMLKDF
FT                   DLKHYLFNAKPEELSAEEKEQITRLLYKEMQEIYYGRNVPEV"
FT   gene            complement(281049..282023)
FT                   /gene="speE"
FT                   /locus_tag="YP_0274"
FT                   /old_locus_tag="YP0274"
FT   CDS_pept        complement(281049..282023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speE"
FT                   /locus_tag="YP_0274"
FT                   /old_locus_tag="YP0274"
FT                   /product="spermidine synthase"
FT                   /note="similar to Yersinia pestis CO92 speE and Yersinia
FT                   pestis KIM speE. Contains SAM (and some other nucleotide)
FT                   binding motif (Interpro|IPR000051, (GO:0008757)). Contains
FT                   Spermine synthase (Interpro|IPR001045, (GO:0003824))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60550"
FT                   /db_xref="GOA:Q8ZBJ8"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZBJ8"
FT                   /protein_id="AAS60550.1"
FT                   /translation="MTVQPQAELAMILPPIFHGCYCEGEAPNMSQKELWYETLHANFGQ
FT                   YFSVENVLFREKTEHQDLVIFENPELGRVMALDGVVQTTERDEFIYHEMMTHVPLLAHG
FT                   QAKKVLIIGGGDGAMLREVSRHKNIEQITMVEIDAGVVEFCRQYLPNHSAGAYDDPRFK
FT                   LVIDDGVNFVNQTTEKFDVIISDCTDPIGPGESLFTSVFYEGCARSLNEGGIFVAQNGV
FT                   CFLQQDEAVNSHNKLSHYFSDVSFYQAAIPTYYGGIMTFAWATQNPALRQLDLATLQNR
FT                   FAQAGLACRYYNPAIHVGSFALPQYLLDALTTIPKVIGVDSSE"
FT   gene            complement(282056..282403)
FT                   /locus_tag="YP_0275"
FT                   /old_locus_tag="YP0275"
FT   CDS_pept        complement(282056..282403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0275"
FT                   /old_locus_tag="YP0275"
FT                   /product="putative exported protein"
FT                   /note="similar to Yersinia pestis CO92 YPO3410 and Yersinia
FT                   pestis KIM y0776"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60551"
FT                   /db_xref="InterPro:IPR019114"
FT                   /db_xref="InterPro:IPR038432"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BUW0"
FT                   /protein_id="AAS60551.1"
FT                   /translation="MKRTTLVMLLLTLCGFSSASFALSESEAEDLADLTAVFVYLKNDC
FT                   GYQELPNNEIKRAIVYFAQQNRWDLHNYDSFNMKALGEDSYRDLRGIALPTPVKCKSLA
FT                   RDSLSLLAYAN"
FT   gene            282546..284321
FT                   /gene="sufI1"
FT                   /locus_tag="YP_0276"
FT                   /old_locus_tag="YP0276"
FT   CDS_pept        282546..284321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufI1"
FT                   /locus_tag="YP_0276"
FT                   /old_locus_tag="YP0276"
FT                   /product="putative exported protein"
FT                   /note="similar to Yersinia pestis CO92 YPO3409 and Yersinia
FT                   pestis KIM y0777. Contains Multicopper oxidase, type 1
FT                   (Interpro|IPR001117, (GO:0005507)). Contains Multicopper
FT                   oxidase, copper-binding (Interpro|IPR002355, (GO:0005507)).
FT                   Contains Twin-arginine translocation pathway signal
FT                   (Interpro|IPR006311)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60552"
FT                   /db_xref="GOA:Q8ZBK0"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZBK0"
FT                   /protein_id="AAS60552.1"
FT                   /translation="MFFMCQRNASTDDLCVNGRRVYQQTVFISIYPCAMQVFTYGQHLP
FT                   MISIYLSSRRETTMHRRDFLKLTAALGAATSLPLWSRAALAADFSPLPIPPLLQPDANG
FT                   KINLNIQTGSVVWLPSTATQTWGYNGNLLGPAIRLQRGKAVTIDITNALPEATTVHWHG
FT                   LEIPGEVDGGPQALIQPGAKRQVTFAVEQPAATCWFHPHTHSKTGHQVAMGLGGLVLID
FT                   DSDSETLPLPKQWGVDDIPVILQDKLLDKHGQVDYQLDVMTAAVGWFGDRMLTNGVPYP
FT                   QQITPRGWVRLRLLNGCNARSLNLALSDGRPMYVIASDGGLLAEPVVVRELPILMGERF
FT                   EVLVDTRDGQSLDLVTLPVTQMGMTLAPFDQPLPVLRIQPSLAIGSQVLPESLVVIPEL
FT                   ADVTGVQERWFQLMMDPKLDMLGMQALVARYGMKAMAGMNMNHGDMGAMDHGNRPDMSQ
FT                   GKMKGMDHGTMNGAPAFNFSHANRINGKAFSMTEPAFDAKQGKYEKWTISGEGDMMLHP
FT                   FHVHGTQFRILTENGKPPAEHRRGWKDIVRVEGARSEILVRFNYLAPASTPYMAHCHLL
FT                   EHEDTGMMLGFTVSA"
FT   gene            284532..285077
FT                   /gene="hpt"
FT                   /locus_tag="YP_0277"
FT                   /old_locus_tag="YP0277"
FT   CDS_pept        284532..285077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="YP_0277"
FT                   /old_locus_tag="YP0277"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /note="similar to Yersinia pestis KIM hpt. Contains
FT                   Phosphoribosyltransferase (Interpro|IPR000836,
FT                   (GO:0009116)). Contains Purine/pyrimidine phosphoribosyl
FT                   transferase (Interpro|IPR002375). Contains Hypoxanthine
FT                   phosphoribosyl transferase (Interpro|IPR005904,
FT                   (GO:0006166))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60553"
FT                   /db_xref="GOA:Q8D1B3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1B3"
FT                   /protein_id="AAS60553.1"
FT                   /translation="MLAVKHTVEVMISEQEVKTRIAELGRQISEHYRDSGSDMVLVGLL
FT                   RGSFMFMADLCRAIDVSHEVDFMTASSYGNGMSTTRDVKILKDLDEDIRGKDVLIVEDI
FT                   IDSGNTLSKVREILQLRGPKSLAICTLLDKPERREVHVPVEWVGFTIPDEFVVGYGIDY
FT                   AQRYRHLPYVGKVVTLDE"
FT   gene            complement(285231..286106)
FT                   /gene="cynT1"
FT                   /locus_tag="YP_0278"
FT                   /old_locus_tag="YP0278"
FT   CDS_pept        complement(285231..286106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cynT1"
FT                   /locus_tag="YP_0278"
FT                   /old_locus_tag="YP0278"
FT                   /product="putative carbonic anhdrase"
FT                   /note="similar to Yersinia pestis KIM y0779. Contains
FT                   Carbonic anhydrase, prokaryotic (Interpro|IPR001765,
FT                   (GO:0015976))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60554"
FT                   /db_xref="GOA:A0A0H2W176"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W176"
FT                   /protein_id="AAS60554.1"
FT                   /translation="MGLLVVLRTHDVFNPPHMRDVTGNIKNQTGTEKILRRQYRVITET
FT                   TVPISKSESLPYIILSQPEHYRLFTLMKEIEKLIANNRTWSNTICKDDPGFFEHLAQSQ
FT                   KPRFLWIGCSDSRVPAEQLTGLKSGELFVHRNVANLVIHTDLNCLSVVQYAIDVLQVEH
FT                   IIICGHLGCGGVEAAIKGEEMGLIDNWLLHIRDLWYKHSSLLGELPQEERSNVLCQINV
FT                   VEQVYNLGHSTIVRSAWKRGQKAMIHGWVYGIENGLLRDLEVSATSLGSLEMVYRKAMA
FT                   ELLQNNKEDH"
FT   gene            286129..287055
FT                   /gene="ccmA1"
FT                   /locus_tag="YP_0279"
FT                   /old_locus_tag="YP0279"
FT   CDS_pept        286129..287055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmA1"
FT                   /locus_tag="YP_0279"
FT                   /old_locus_tag="YP0279"
FT                   /product="putative ABC transporter, ATP-binding protein"
FT                   /note="similar to Yersinia pestis CO92 YPO3406 and Yersinia
FT                   pestis KIM y0780. Contains ATP/GTP-binding site motif A
FT                   (P-loop) (Interpro|IPR001687, (GO:0005524)). Contains ABC
FT                   transporter (Interpro|IPR003439, (GO:0016020)). Contains
FT                   AAA ATPase (Interpro|IPR003593, (GO:0000166))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60555"
FT                   /db_xref="GOA:A0A380PGR8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A380PGR8"
FT                   /protein_id="AAS60555.1"
FT                   /translation="MTYALEITQLTKTYMGGVQALRGIDLHVEAGDFYALLGPNGAGKS
FT                   TTIGIISSLVNKTSGKVQVFGYDIDNDIVNAKRQLGLVPQEFNFNPFETVLQIVITQAG
FT                   YYGVTRRDALARAEKYLSQLDLWSKRDERAIRLSGGMKRRLMIARALMHEPKLLILDEP
FT                   TAGVDIELRRSMWGFLKELNAQGTTIILTTHYLEEAEMLCRNIGIIQNGELVENTTMKQ
FT                   LLSKLESETFIFDLGAKSPLPKLEGYGYRLTDTSTLEVDVKREQGLNSLFSQLNVQGVQ
FT                   VQSMRNKANRLEELFVTLVNGHEGEKA"
FT   gene            287052..287822
FT                   /locus_tag="YP_0280"
FT                   /old_locus_tag="YP0280"
FT   CDS_pept        287052..287822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0280"
FT                   /old_locus_tag="YP0280"
FT                   /product="putative ABC transporter, integral membrane
FT                   protein"
FT                   /note="similar to Yersinia pestis CO92 YPO3405 and Yersinia
FT                   pestis KIM y0781. Contains ABC transporter, family 2
FT                   (Interpro|IPR000412, (GO:0016020))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60556"
FT                   /db_xref="GOA:A0A3N4BJY5"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BJY5"
FT                   /protein_id="AAS60556.1"
FT                   /translation="MTRLYWIALQSIWIKEITRFARIWIQTLVPPVITMSLYFVIFGNL
FT                   IGARIGDMGGFDYMQFIVPGLIMMAVITNAYSNVAASFYGAKFQRSIEELLVAPVPTHI
FT                   VIIGYVGGGVARGICVGILVTIISLFFVPLHVHSWSMIALTLILTAILFSLGGLLNAVF
FT                   AKTFDDISLVPTFVLTPLTYLGGVFYSLSLLPPFWQAVSKLNPIVYMISGFRYGFLGIT
FT                   DVSLAYTIGVLVVFIAVFYAWAWYLIERGTGLRT"
FT   gene            288029..289343
FT                   /pseudo
FT                   /locus_tag="YP_0281"
FT                   /old_locus_tag="YP0281"
FT                   /note="similar to Yersinia pestis CO92 YPO3404 (residue 41
FT                   to 431, and similar to gi|16763569|ref|NP_459184.1|
FT                   putative xylanase/chitin deacetylase [Salmonella
FT                   typhimurium LT2] (409 aa). The sequence has been checked
FT                   and is believed to be correct. Contains Polysaccharide
FT                   deacetylase (Interpro|IPR002509, (GO:0005975),
FT                   (GO:0016810))"
FT   gene            complement(289492..289872)
FT                   /gene="panD"
FT                   /locus_tag="YP_0282"
FT                   /old_locus_tag="YP0282"
FT   CDS_pept        complement(289492..289872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panD"
FT                   /locus_tag="YP_0282"
FT                   /old_locus_tag="YP0282"
FT                   /product="aspartate 1-decarboxylase precursor"
FT                   /note="similar to Yersinia pestis CO92 panD and Yersinia
FT                   pestis KIM panD. Contains Aspartate decarboxylase
FT                   (Interpro|IPR003190, (GO:0006523))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60557"
FT                   /db_xref="GOA:Q8ZBK6"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZBK6"
FT                   /protein_id="AAS60557.1"
FT                   /translation="MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLEAAGILEYEAID
FT                   IYNVDNGQRFSTYAIAAERGSRIISVNGAAARCACVGDKLIICSYVQMSYAAARLHHPK
FT                   VAYFEGENQLQRKAKAVPVQVA"
FT   gene            complement(290283..291137)
FT                   /gene="panC"
FT                   /locus_tag="YP_0283"
FT                   /old_locus_tag="YP0283"
FT   CDS_pept        complement(290283..291137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="YP_0283"
FT                   /old_locus_tag="YP0283"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /note="similar to Yersinia pestis CO92 panC and Yersinia
FT                   pestis KIM panC. Contains Pantoate-beta-alanine ligase
FT                   (Interpro|IPR003721, (GO:0015940))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60558"
FT                   /db_xref="GOA:Q8ZBK7"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="PDB:3Q10"
FT                   /db_xref="PDB:3Q12"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZBK7"
FT                   /protein_id="AAS60558.1"
FT                   /translation="MLIIETLPLLRQQIRRWRQEGKRIALVPTMGNLHEGHMTLVDEAK
FT                   TRADVVVVTIFVNPLQFERPDDLAHYPRTLQEDCEKLTRHGADLVFAPAAADIYPAGLE
FT                   KQTYVDVPALSTILEGASRPGHFRGVSTIVSKLFNLIQPDVACFGEKDYQQLALIRKMV
FT                   ADMGYDINIVGVPTVRAKDGLALSSRNGYLTEEERQIAPQLSKIMWALAEKMALGERQI
FT                   DALLEEAAAQLLRVGFTPDELFIRDAETLQPLTVDSQQAVILMAAWLGKARLIDNQLVD
FT                   LRH"
FT   gene            complement(291225..292022)
FT                   /gene="panB"
FT                   /locus_tag="YP_0284"
FT                   /old_locus_tag="YP0284"
FT   CDS_pept        complement(291225..292022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="YP_0284"
FT                   /old_locus_tag="YP0284"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /note="similar to Yersinia pestis CO92 panB and Yersinia
FT                   pestis KIM panB. Contains Ketopantoate
FT                   hydroxymethyltransferase (Interpro|IPR003700,
FT                   (GO:0015940))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60559"
FT                   /db_xref="GOA:Q8ZBK8"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZBK8"
FT                   /protein_id="AAS60559.1"
FT                   /translation="MKTTTMSQLRQWKQEKRKFATLTAYDASFAQLFAEQGIQVLLVGD
FT                   SLGMTLQGFDSTLPVTVADMAYHTRAVRRGAPHCLLLADMPFMSYATPELAFTHAAELM
FT                   RAGANMVKLEGGSWLCDTIRMLAERAVPVCGHLGLTPQSVNIFGGYKVQGREEVAANQL
FT                   LQDAIALEQAGAQLLVLECVPVELAQRVTEELTIPVIGIGAGNVTDGQILVMHDALGIT
FT                   GGHTPKFSKNFLAHSAGDIRAAIKLYIEEVEGGIYPAEEHTFQ"
FT   gene            complement(292291..292770)
FT                   /gene="folK"
FT                   /locus_tag="YP_0285"
FT                   /old_locus_tag="YP0285"
FT   CDS_pept        complement(292291..292770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="YP_0285"
FT                   /old_locus_tag="YP0285"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /note="similar to Yersinia pestis CO92 folK and Yersinia
FT                   pestis KIM folK. Contains
FT                   7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK
FT                   (Interpro|IPR000550, (GO:0009396))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60560"
FT                   /db_xref="GOA:A0A3N4B8J0"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B8J0"
FT                   /protein_id="AAS60560.1"
FT                   /translation="MIRVYIALGSNLAMPLQQVSAAREALAHLPRSRLVACSPLYRTKP
FT                   LGPQDQPDFLNAVVALDTSLPPEQLLDHTQAIERNQGRVRKEQRWGPRTLDLDIMLYGD
FT                   QVIKTDRLTIPHYGLKAREFMLYPLADIAPDLIFPDGESLSECLKRVDKNGLVLW"
FT   gene            complement(292778..294199)
FT                   /gene="pcnB"
FT                   /locus_tag="YP_0286"
FT                   /old_locus_tag="YP0286"
FT   CDS_pept        complement(292778..294199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcnB"
FT                   /locus_tag="YP_0286"
FT                   /old_locus_tag="YP0286"
FT                   /product="poly(A) polymerase"
FT                   /note="similar to Yersinia pestis CO92 pcnB and Yersinia
FT                   pestis KIM pcnB. Contains Polynucleotide
FT                   adenylyltransferase (Interpro|IPR002646, (GO:0006396))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60561"
FT                   /db_xref="GOA:A0A0H2W1A6"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR010206"
FT                   /db_xref="InterPro:IPR025866"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W1A6"
FT                   /protein_id="AAS60561.1"
FT                   /translation="MPGEDNVARKERRPARAHTGRKGHAVSSSEQRQMAIIPRDQHNIS
FT                   RRDISDNPLKVLYRLNKSGYEAYLVGGGVRDLLLGRKPKDFDITTSATPEQVRKLFRNC
FT                   RLVGRRFRLAHVMFGPEIIEVATFRGHHEQQQAEDSDKNSSQQAQNGMLLRDNIFGSIE
FT                   DDAQRRDFTINSLYYGISDFALRDYTGGLRDLKEGIIRLIGDPETRYREDPVRMLRAVR
FT                   FAAKLDMSISPETAEPIPRLASLLREIPPARLFEESLKLLQSGYGYKTYLKLCEYQLFQ
FT                   PLFPLIARNFTEQHDSPMERILVQVLKNTDHRLHNDQRVNPAFLFAAMLWYPLIEHAQK
FT                   LTQESGLAYYDAFALAMNDVLDEECRSLAIPKRITSLVRDIWLLQLRLSRRQGKRAHKL
FT                   MEHPKFRAAYDLLLLRAEVEKNHELQRLAQWWGEFQEATPTQQKSMLNTLGADPAPRRS
FT                   RPRRPRKPVPRKEGV"
FT   gene            complement(294342..295496)
FT                   /gene="glnS1"
FT                   /locus_tag="YP_0287"
FT                   /old_locus_tag="YP0287"
FT   CDS_pept        complement(294342..295496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnS1"
FT                   /locus_tag="YP_0287"
FT                   /old_locus_tag="YP0287"
FT                   /product="putative glutamyl-tRNA synthetase"
FT                   /note="similar to Yersinia pestis CO92 YPO3398 and Yersinia
FT                   pestis KIM y0789. Contains Glutamyl-tRNA synthetase, class
FT                   Ic (Interpro|IPR000924, (GO:0006424))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60562"
FT                   /db_xref="GOA:Q8ZBL1"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR022380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZBL1"
FT                   /protein_id="AAS60562.1"
FT                   /translation="MLEDTGFQRLFSSQLFDPQPFGSKPSGSQLFGSQPFAAAQLFSAA
FT                   QPRASQFPSAQLPETQQPVVQQAVIQRSANQRATNQPTEYIGRFAPSPSGDLHFGSLIA
FT                   ALGSYLQARAQGGKWLVRIEDIDPPREVPGAASRILAALEHYGLHWDGPVIYQSQRHEA
FT                   YRATLNWLEQQGLSYYCTCTRSRIHQLGGFYDGYCRDRHLPASGAAIRLRQTQPVYAFY
FT                   DKLLGELHAHPALAQEDFIIRRRDGLFAYNLAVVVDDAFQGVTEIVRGADLIEPTVRQI
FT                   ALYQQLQHPVPGYIHLPLALNNQGNKLSKQNHAPPLPNGDPRPILIDALKFLRQPLPEY
FT                   WQDLDLYLLLRYAVEHWTLVSIPLQGAITPQKTQRHSQSKYGEL"
FT   gene            complement(295587..296135)
FT                   /gene="dksA1"
FT                   /locus_tag="YP_0288"
FT                   /old_locus_tag="YP0288"
FT   CDS_pept        complement(295587..296135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dksA1"
FT                   /locus_tag="YP_0288"
FT                   /old_locus_tag="YP0288"
FT                   /product="DnaK suppressor protein"
FT                   /note="similar to Yersinia pestis CO92 dksA and Yersinia
FT                   pestis KIM dksA. Contains Zn-finger, prokaryotic DksA/TraR
FT                   C4 type (Interpro|IPR000962)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60563"
FT                   /db_xref="GOA:Q8D1A8"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1A8"
FT                   /protein_id="AAS60563.1"
FT                   /translation="MPTYLPSVIYSGLIFPPIGDFDSAYECRRSIMQEGQKRKTSSLSI
FT                   LAIAGVEPYQEKPGEEYMNAAQLSHFKLILEAWRNQLRDEVDRTVSHMQDEAANFPDPV
FT                   DRAAQEEEFSLELRNRDRERKLIKKIEKTLKKVEDDDFGFCESCGVEIGIRRLEARPTA
FT                   DLCIDCKTLAEIREKQMAG"
FT   gene            complement(296212..297087)
FT                   /gene="sfsA"
FT                   /locus_tag="YP_0289"
FT                   /old_locus_tag="YP0289"
FT   CDS_pept        complement(296212..297087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="YP_0289"
FT                   /old_locus_tag="YP0289"
FT                   /product="sugar fermentation stimulation protein"
FT                   /note="similar to Yersinia pestis CO92 sfsA and Yersinia
FT                   pestis KIM sfsA. Contains Sugar fermentation stimulation
FT                   protein (Interpro|IPR005224)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60564"
FT                   /db_xref="GOA:P58431"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58431"
FT                   /protein_id="AAS60564.1"
FT                   /translation="MKGNQMPANANLPPFSANLLSVNSDSRSISPNSPPTHAKSLQFNA
FT                   PLLQFTPPLQPATLILRYKRFLADIVTPAGEALTIHCANTGAMTGCATPGDTIWYSTSD
FT                   NPKRKYPQSWELTQTQTGDWICVNTMRANELVNLAIEKNQIAELSGYNFVRKEVKYGEE
FT                   NSRIDLLLQAEDRRDCYIEVKSVTLLQQQCGYFPDAVTLRGQKHLRELQNRVVNGHRAV
FT                   LFFAVLHTGIKQVAPARHIDRRYAELLVQAQQAGVEVICYGFQLSPDGIELNTRLPLLL
FT                   DEMLSSENAE"
FT   gene            complement(297062..297637)
FT                   /gene="ligT"
FT                   /locus_tag="YP_0290"
FT                   /old_locus_tag="YP0290"
FT   CDS_pept        complement(297062..297637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligT"
FT                   /locus_tag="YP_0290"
FT                   /old_locus_tag="YP0290"
FT                   /product="putative 2'-5' RNA ligase"
FT                   /note="similar to Yersinia pestis CO92 ligT and Yersinia
FT                   pestis KIM y0793. Contains 2'_5' RNA ligase
FT                   (Interpro|IPR004175, (GO:0016070))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60565"
FT                   /db_xref="GOA:A0A2S9PMH0"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR014051"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PMH0"
FT                   /protein_id="AAS60565.1"
FT                   /translation="MTNTVDELKRVRRLFFALTLPDAMQQEIVQWRAGHFSPEAGRPVA
FT                   AANLHLTLAFLGEVSATKSQVLQQQAGRIQQAGFSVTLDDIGHWPGSGVIWLGCKNPPR
FT                   GLLQLAQLLRSQAARSGCYQTPLPFHPHVTLLRNATRPVALPAKSGNETFQADHFSLYE
FT                   SVFARGRTRYNIVQSWPLAGSERKPDAC"
FT   gene            297678..300239
FT                   /gene="hrpB"
FT                   /locus_tag="YP_0291"
FT                   /old_locus_tag="YP0291"
FT   CDS_pept        297678..300239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpB"
FT                   /locus_tag="YP_0291"
FT                   /old_locus_tag="YP0291"
FT                   /product="helicase, ATP-dependent"
FT                   /note="similar to Yersinia pestis KIM hrpB. Contains
FT                   DEAD/DEAH box helicase (Interpro|IPR001410, (GO:0008026)).
FT                   Contains Helicase, C-terminal (Interpro|IPR001650,
FT                   (GO:0005524)). Contains ATP/GTP-binding site motif A
FT                   (P-loop) (Interpro|IPR001687, (GO:0005524)). Contains
FT                   Mitochondrial substrate carrier (Interpro|IPR001993,
FT                   (GO:0006810))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60566"
FT                   /db_xref="GOA:Q8D1A7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1A7"
FT                   /protein_id="AAS60566.1"
FT                   /translation="MMLQWLTIKLQWLTIKVERVETNVVVSERKNDVAIAALPVSEVLD
FT                   ELLSALQSSSQVLLHAPTGAGKSTWLPLQILQQSQFLNSGSPGRIIMLEPRRLAAKNVA
FT                   YRLAQQLGELPGQTVGYRMRAESKIGPDTRLEVVTEGILTRMLQQDAELQGVSLVILDE
FT                   FHERSLQADLALALLLDVQQGLRDDLKLLIMSATLDNQRLSALLPSAPAIVSAGRSFPV
FT                   ERSYQPLSSHERLEEGVASRVKRLLNEQPGSLLLFLPGVSEIHRVMERLHGEVASDTDL
FT                   CPLYGALPLSEQQKAIQPAAIGRRKVVLATNIAETSLTIEGIRLVVDSGLERVARFDIK
FT                   NGLTRLVTQRISQASMVQRAGRAGRLEPGICWHLFAKEQAERAAEYSEPEILNSDLCGL
FT                   WLELLSWGCQDAAQLCWLDHPPAAALAVARDLLGRLDAIDDQGQLTATGRTMATLGCEP
FT                   RLAAMLCFGAGHSPDALATAALLAAILEEPPRSGQIDLHDWLSRPQPHWQRRARQLTQR
FT                   LNARGGSVDHALAAQLLALAYPDRIAQQRGQDGRYLLANGMGAAMAQDEALSRSPWLVA
FT                   VGLLQNHSGPDARILLALPVDIEQLVTCLPRQVEERTVVEWDDEKGTLRAWRRWQIGRL
FT                   ILRAQPLAKPDDAALQQALLNWVREQGLQILNWDEPAEQLRTRLQCAARWLPEAPWPAV
FT                   DDDSLQDKLALWLQPSLSGVRDLRGLRQVNIAEALTRLLDWKQRQRLDTELPTHYTVPT
FT                   GSRLPIRYYVDRPPVLAVRLQEVFGEQQSPMLASGRVAVVLELLSPAHRPLQITGDLAA
FT                   FWQGAYREVQKEMKGRYPKHVWPDDPAHTRPTRRTKKYQDK"
FT   gene            300327..302822
FT                   /gene="mrcB"
FT                   /locus_tag="YP_0292"
FT                   /old_locus_tag="YP0292"
FT   CDS_pept        300327..302822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcB"
FT                   /locus_tag="YP_0292"
FT                   /old_locus_tag="YP0292"
FT                   /product="penicillin-binding protein 1B"
FT                   /note="similar to Yersinia pestis CO92 mrcB and Yersinia
FT                   pestis KIM mrcB. Contains Glycosyl transferase, family 51
FT                   (Interpro|IPR001264, (GO:0009274)). Contains
FT                   Penicillin-binding protein, transpeptidase domain
FT                   (Interpro|IPR001460, (GO:0008233), (GO:0008658),
FT                   (GO:0009273))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60567"
FT                   /db_xref="GOA:A0A0H2W2N3"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR011813"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR028166"
FT                   /db_xref="InterPro:IPR032730"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W2N3"
FT                   /protein_id="AAS60567.1"
FT                   /translation="MRVEIGNMSGDDREPIGRKGKKAQPKAAPKRPLRRRRDEDEYEED
FT                   YDEEQNDYDDEEEPMPRKVASRPPRKKRRWLGLLIKLFLIGAVALAIYGVYLDSQIRSR
FT                   IDGKVWQLPAAVYGRMVNLEPGMSYSKKEMIALLEGMQYRQVSRMTRPGEFTVQNDSID
FT                   ILRRPFDFPDGKEGQIRARLLFKNDRLAQIQNLDNQRDFGLFRLDPKLITMLQSPNGEQ
FT                   RLFVPRAGFPDLLVDTLLATEDRHFYEHDGVSPYSIARAVVANLTAGKAVQGGSTLTQQ
FT                   LVKNLFLTNERSLVRKLNEAYMALLMDYRYSKDRILELYLNEVYLGQSGGDQIRGFPLG
FT                   SLYYFGRPVDELSLDQQAMLVGMVKGASLYNPWRNPKLALERRNLVLRLLQNQGIIDAE
FT                   LYTMLSARPLGVQPKGGVITPQPAFMQMVRQELQQKLGNKVNDLSGVKIFTTLDPVSQD
FT                   AAEKAIEDGVPALRAARNMNDLEAAMVVVDRFSGEVRAMVGGSQPQFAGFNRAMQARRL
FT                   VGSLAKPPTYLAALSEPDKYRLNTWLSDQPLSLKLSNGSLWQPKNYDRQFRGQVMLMDA
FT                   LVNSLNIPTVNLGMSVGLDQISATLQRLGIPKSVINPVPAMLLGAIDLTPVEVAQEYQT
FT                   IASGGNRAPLSAVRSVIAEDGTVLYQSFPQAERMVPAQASYLTLYAMQQGVVRGTSRSL
FT                   SAKFGKYNLAAKTGTTNDLRDSWFAGIDGKEVTIAWIGRDNNGPTKLTGASGALTLYRR
FT                   YLENQTPLPLILQPPEGISQMNIDSAGNFVCGEGSGMRVIPVWTENPQALCQGSTPTQD
FT                   PTKPNDDGVADWIKEMFGQ"
FT   gene            303144..303938
FT                   /gene="fhuC"
FT                   /locus_tag="YP_0293"
FT                   /old_locus_tag="YP0293"
FT   CDS_pept        303144..303938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuC"
FT                   /locus_tag="YP_0293"
FT                   /old_locus_tag="YP0293"
FT                   /product="ferrichrome transport ATP-binding protein FhuC"
FT                   /note="similar to Yersinia pestis CO92 fhuC and Yersinia
FT                   pestis KIM fhuC. Contains Disease resistance protein
FT                   (Interpro|IPR000767, (GO:0006952)). Contains
FT                   ATP/GTP-binding site motif A (P-loop) (Interpro|IPR001687,
FT                   (GO:0005524)). Contains ABC transporter
FT                   (Interpro|IPR003439, (GO:0016020)). Contains AAA ATPase
FT                   (Interpro|IPR003593, (GO:0000166))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60568"
FT                   /db_xref="GOA:A0A2S9PMI5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PMI5"
FT                   /protein_id="AAS60568.1"
FT                   /translation="MDLQASHSSTFILRELSFSVPGRTLLQPLSLTFPQGKVCGLIGHN
FT                   GSGKSTLLKMLGRHQPPSSGQVVLNDMPLAQWDSKAFAREVAYLPQQLPAAEGMTVREL
FT                   VAIGRYPWHGALGRFRQEDRQQVEEAIALVDLKPLANRLVDSLSGGERQRAWLAMMVAQ
FT                   NSRCLLLDEPTSALDIAHQVEVLGLIQRLSHERGLTVIAVLHDINMAARYCDHLVALRG
FT                   GEMIAQGPADSLMQSAVLEQIYGIPMGILPHPAGGAPVSFVY"
FT   gene            304115..305026
FT                   /gene="fhuD"
FT                   /locus_tag="YP_0294"
FT                   /old_locus_tag="YP0294"
FT   CDS_pept        304115..305026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuD"
FT                   /locus_tag="YP_0294"
FT                   /old_locus_tag="YP0294"
FT                   /product="ferrichrome-binding periplasmic protein
FT                   precursor"
FT                   /note="similar to Yersinia pestis CO92 fhuD and similar to
FT                   Yersinia pestis KIM fhuD (residues 1 to 292 of 292 are
FT                   similar to residues 71 to 362 of 362 from Yersinia pestis
FT                   KIM fhuD). Contains Periplasmic binding protein
FT                   (Interpro|IPR002491, (GO:0006827))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60569"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LAL9"
FT                   /protein_id="AAS60569.1"
FT                   /translation="MALTLSPLLLSLPSLVAAAPKSDQPLLNIDRVIDIQRDIDTKRVV
FT                   ALEWLPVELLLALGVTPFGVADIHNYRLWVGEPALPADVINVGQRTEPNLELLQQMAPS
FT                   LILLSQGYGPSPEKLAPIAPTMSFAFNEQGSSPLAVGKNSLQTLGQRLGLETAAQQHLA
FT                   DFDHFMLAARARLSGDTQTPLLMFSLLDPRHALIIGNGSLFQDVLSTLNIENAWQGETN
FT                   FWGSAVVGIERLATIKTARAVCFGHGNNEMLQQVARTPLWQSLSFVRENQLRLLPPVWF
FT                   YGATLSAMRFVRLLEQAWGKAP"
FT   gene            305023..307020
FT                   /gene="fhuB"
FT                   /locus_tag="YP_0295"
FT                   /old_locus_tag="YP0295"
FT   CDS_pept        305023..307020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuB"
FT                   /locus_tag="YP_0295"
FT                   /old_locus_tag="YP0295"
FT                   /product="ferrichrome transport system permease protein
FT                   FhuB"
FT                   /note="similar to Yersinia pestis CO92 fhuB. Contains FecCD
FT                   transport family (Interpro|IPR000522, (GO:0016020)).
FT                   Contains Sodium:dicarboxylate symporter
FT                   (Interpro|IPR001991, (GO:0016020))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60570"
FT                   /db_xref="GOA:A0A3N4BA84"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BA84"
FT                   /protein_id="AAS60570.1"
FT                   /translation="MSAISLRQGWRLPAGLLGLLVVIAVSLTFYNLSQLLPSSLWSEAL
FT                   WRPDRDDVRQMLFHYSQLPRLAVALLTGAGLGLVGVLFQQVLRNPLAEPATLGVAAGAQ
FT                   LGLTIATLWMLPGGELTRQLAAMAGGMTVGALVFGVAWGKRLSPVTLILAGLVLGLYCS
FT                   AVSNLLALFNYDQLQGLFLWSSGALNQQDWSTVQFLLPRLLISGILAAFLIRPLTLLGL
FT                   DDGVARNLGLGLSLARLSALGLAIIFSAMLVNAVGVIGFIGLFAPLLAKILGARRLSQR
FT                   LILAPIVGALLLWVTDQGIIWLTQVWREIPTGAATALIGAPLLLWLLPRLHSTTAPNMD
FT                   LGDSVPVERQRLGLWISAGLLLLLGGLIVALMFGRDSQGWRWIVGDELQALLHWRWPRV
FT                   LAALAAGMMLAVAGTLIQKLTGNPMASPEVLGISSGAAFGVVIMLFIVPGNALEWLLPA
FT                   GSLGAAITLLLIMVVAGRGGFSPGRMLLAGIALSTAFTTVITMLLASGDPRMRGLLAWI
FT                   SGSTYSVEGSQALTTGLIAVVLIALAPLCRRWLMILPLGSVTARALGMALAPSRLAILL
FT                   LAATLTAAATLTVGPLSFVGLMAPHMARMLGFRRAIPQLIIAAILGGLLMILADWCGRM
FT                   LLFPNQIPAGLLATFIGAPYFVYLLRKQGR"
FT   gene            complement(307394..308674)
FT                   /gene="hemL"
FT                   /locus_tag="YP_0296"
FT                   /old_locus_tag="YP0296"
FT   CDS_pept        complement(307394..308674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="YP_0296"
FT                   /old_locus_tag="YP0296"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /note="similar to Yersinia pestis CO92 hemL and Yersinia
FT                   pestis KIM hemL. Contains
FT                   Glutamate-1-semialdehyde-2,1-aminomutase
FT                   (Interpro|IPR004639, Cellular Component: cytoplasm
FT                   (GO:0005737), (GO:0006779), (GO:0042286)). Contains
FT                   Aminotransferase class-III (Interpro|IPR005814,
FT                   (GO:0008483))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60571"
FT                   /db_xref="GOA:Q8ZBL9"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="PDB:4E77"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZBL9"
FT                   /protein_id="AAS60571.1"
FT                   /translation="MSKSENLYAQAQQLIPGGVNSPVRAFTGVGGIPLFIERADGAYLF
FT                   DVDGKAYIDYVGSWGPMILGHNHPAIRQAVIEAVERGLSFGAPTEMEVKMAQLVTDLVP
FT                   TMDMVRMVNSGTEATMSAIRLARGYTGRDKIIKFEGCYHGHADCLLVKAGSGALTLGQP
FT                   NSPGVPTDFAKHTLTCTYNDLASVRQAFEQYPQEVACIIVEPVAGNMNCIPPLPEFLPG
FT                   LRALCDEFGALLIIDEVMTGFRVALAGAQDYYHVIPDLTCLGKIIGGGMPVGAFGGRRE
FT                   VMNALAPTGPVYQAGTLSGNPIAMAAGFACLTEISQVGVYETLTELTDSLATGLRHAAK
FT                   EENIPLVVNHVGGMFGLFFTNADTVTCYQDVMNCDVERFKRFFHLMLEEGVYLAPSAFE
FT                   AGFMSLAHSNEDIQKTVNAARRCFAKL"
FT   gene            309055..310491
FT                   /gene="eriC1"
FT                   /locus_tag="YP_0297"
FT                   /old_locus_tag="YP0297"
FT   CDS_pept        309055..310491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eriC1"
FT                   /locus_tag="YP_0297"
FT                   /old_locus_tag="YP0297"
FT                   /product="putative chloride channel protein"
FT                   /note="similar to Yersinia pestis CO92 YPO3388 and Yersinia
FT                   pestis KIM y0800. Contains Eukaryotic thiol (cysteine)
FT                   protease (Interpro|IPR000169, (GO:0006508)). Contains Cl-
FT                   channel, voltage gated (Interpro|IPR001807, (GO:0016020)).
FT                   Contains Sodium:dicarboxylate symporter
FT                   (Interpro|IPR001991, (GO:0016020))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60572"
FT                   /db_xref="GOA:Q8ZBM0"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="InterPro:IPR023861"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZBM0"
FT                   /protein_id="AAS60572.1"
FT                   /translation="MTHSTQQLSPEGVAEGKRGRLIRELVNRDKTPLIILIMAAVVGVV
FT                   TGLLGVAFDRGVDWVQQQRLLALANVADYALLVWPLAFIMSALLAMMGYFLVSRFAPEA
FT                   GGSGIPEIEGAMEEMRPVRWWRVIPVKFIGGLGTLGAGMVLGREGPMVQMGGNSGRMIV
FT                   DIFRLRSPEARHSLLATGAAAGLSAAFNAPLAGILFVIEEMRSQFRYSLVSIKAVFIGV
FT                   ITSTIVYRYFNGERAIIEVGKLSDAPLNTLWLYLLLGIIFGAVGVIFNALIFRTQDMFV
FT                   RFHGGDWRKLVLIGGLLGGMCGLLALLHGNAVGGGFALIPIAAAGNFSIGMLLFIFIAR
FT                   VITTLLCFGSGAPGGIFAPMLALGTILGTAFGLSCAHFFPQYGIEAGTFAIAGMGALFA
FT                   ASVRAPLTGIVLVLEMTDNYQLILPMIVTCLGATLIAQFMGGKPLYSAILARTLAKQEQ
FT                   ARATVIAQEPAVENTPQIGK"
FT   gene            310612..310971
FT                   /gene="iscA1"
FT                   /locus_tag="YP_0298"
FT                   /old_locus_tag="YP0298"
FT   CDS_pept        310612..310971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iscA1"
FT                   /locus_tag="YP_0298"
FT                   /old_locus_tag="YP0298"
FT                   /product="iron-sulfur cluster insertion protein ErpA"
FT                   /note="similar to Yersinia pestis CO92 YPO3387 and Yersinia
FT                   pestis KIM y0801. Contains Protein of unknown function,
FT                   HesB/YadR/YfhF (Interpro|IPR000361, (GO:0005554))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60573"
FT                   /db_xref="GOA:Q0WBQ9"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0WBQ9"
FT                   /protein_id="AAS60573.1"
FT                   /translation="MGVMRMSNETVLPLQFTEAAAKKVKLLISDEENPNLKLRVYITGG
FT                   GCSGFQYGFTFDDQVNDGDMTIEKQGVELVVDPMSLQYLVGGAVDYTEGLEGSRFIVTN
FT                   PNAKSTCGCGSSFSI"
FT   gene            complement(311256..311918)
FT                   /locus_tag="YP_0299"
FT                   /old_locus_tag="YP0299"
FT   CDS_pept        complement(311256..311918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0299"
FT                   /old_locus_tag="YP0299"
FT                   /product="putative membrane protein"
FT                   /note="similar to Yersinia pestis CO92 YPO3386 and Yersinia
FT                   pestis KIM y0803. Contains Domain of unknown function
FT                   UPF0126 (Interpro|IPR005115)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60574"
FT                   /db_xref="GOA:Q8D1A2"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1A2"
FT                   /protein_id="AAS60574.1"
FT                   /translation="MPTNGQHSNPCRGVTLMLVYWLDILGTAVFAISGVLLAGKLRMDP
FT                   FGVLVLGVVTAVGGGTIRDMALANGPVFWVKDPTDLVVAMVTCLATIVLVRQPRRTAKW
FT                   ILPVLDAIGLAVFVGIGVNKAFAADASPLVAICMGVITGVGGGIIRDVLAREIPMILRT
FT                   EIYATACIIGGIVHATAFYTFNMPLQQAMMLGMVITLGIRLAAIRWHLKLPTFEIEH"
FT   gene            complement(311870..312712)
FT                   /gene="fecB1"
FT                   /locus_tag="YP_0300"
FT                   /old_locus_tag="YP0300"
FT   CDS_pept        complement(311870..312712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fecB1"
FT                   /locus_tag="YP_0300"
FT                   /old_locus_tag="YP0300"
FT                   /product="putative priplasmic metal binding protein"
FT                   /note="similar to Yersinia pestis CO92 YPO3385 and Yersinia
FT                   pestis KIM y0804. Contains Periplasmic binding protein
FT                   (Interpro|IPR002491, (GO:0006827))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60575"
FT                   /db_xref="GOA:Q8ZBM3"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR023544"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZBM3"
FT                   /protein_id="AAS60575.1"
FT                   /translation="MMPLGLFPLPRAAAVLLISLLTLPAQAAERVISLSPSTTELAYAA
FT                   GLGDKLVAVSAYSDYPESAKKLEHVASWQGINVERILALKPDLILAWRGGNPQRPLDQL
FT                   AALGIPIFYSDPTHIDQIASDLDKLAQYSPHPEQAHQAAEQFRQHVNTLRDRYARSQPK
FT                   RTFLQFGTQPLFTSSGHTLQSEVVSLCGGENIFADSRVPWPQVSREQVMTRKPQVIVVS
FT                   GTQSQVDNVSAFWLPQLVVPVIALNEDWFNRASPRILLAAQQLCQQMASIPTPVAESH"
FT   gene            complement(312712..313413)
FT                   /gene="mtn"
FT                   /locus_tag="YP_0301"
FT                   /old_locus_tag="YP0301"
FT   CDS_pept        complement(312712..313413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtn"
FT                   /locus_tag="YP_0301"
FT                   /old_locus_tag="YP0301"
FT                   /product="MTA/SAH nucleosidase"
FT                   /note="similar to Yersinia pestis CO92 mtn and Yersinia
FT                   pestis KIM pfs. Contains Purine and other phosphorylases,
FT                   family 1 (Interpro|IPR000845, (GO:0009116)). Contains
FT                   Flavin-containing monooxygenase FMO (Interpro|IPR000960,
FT                   (GO:0006118))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60576"
FT                   /db_xref="GOA:Q7CKD4"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CKD4"
FT                   /protein_id="AAS60576.1"
FT                   /translation="MKVGIIGAMEEEVTLLRDRIENRQTLARAGCEIYTGQLNGIDVAL
FT                   LKSGIGKVAAAMGTTLLLEHCQPDLVINTGSAGGLDSSLKVGDIVVSNEVRYHDADVTA
FT                   FGYEPGQMAGCPAAFVADEDLIALAENCIQQLKLNAVRGLICSGDAFINGAEPLARIRA
FT                   AFPTVAAVEMEAAAIGHVCYLFNTPFVVVRAISDVADQASHLSFEEFLVVAAKQSTLMI
FT                   KAMLTTLAQRG"
FT   gene            313707..315227
FT                   /gene="dgt"
FT                   /locus_tag="YP_0302"
FT                   /old_locus_tag="YP0302"
FT   CDS_pept        313707..315227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgt"
FT                   /locus_tag="YP_0302"
FT                   /old_locus_tag="YP0302"
FT                   /product="deoxyguanosinetriphosphate triphosphohydrolase"
FT                   /note="similar to Yersinia pestis CO92 dgt and Yersinia
FT                   pestis KIM dgt. Contains Metal dependent phosphohydrolase,
FT                   HD region (Interpro|IPR003607, (GO:0003824)). Contains
FT                   Deoxyguanosinetriphosphate triphosphohydrolase
FT                   (Interpro|IPR006261). Contains Metal-dependent
FT                   phosphohydrolase, HD region (Interpro|IPR006674)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60577"
FT                   /db_xref="GOA:Q8ZBM5"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR020779"
FT                   /db_xref="InterPro:IPR023293"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZBM5"
FT                   /protein_id="AAS60577.1"
FT                   /translation="MSGIDFKQKISFQRPFSKPSSAEDEYEITRVFESDRGRIVNSAAI
FT                   RRLQQKTQVFPLERNAAVRSRLTHSLEVQQVGRYIAKEILNRFKQDKKITAYGLDKLLD
FT                   PFESIVEMACLMHDIGNPPFGHFGESAINDWFTKRMDPNGGSGSEPQSTDQCQVDVLKL
FT                   CEGETELNILRSKIRHDLSQFEGNAQAIRLVHSLLKLNLTYAQVGCILKYTKPAYWSAP
FT                   IPASHNYLMKKPGFYLAEENYVKELRRELNMEEFDRFPLTYIMEAADDISYCIADLEDA
FT                   VEKNIFSVEQLYDHMSQEWGAVTPGDLFDKVVGAAFRQLGREQGRRSSEDQFFMYLRVN
FT                   TVGKLVPHAAQRFIENLPAVFSGSFNQALLEDSSAACKLLQIFKRVAVKHVFNHPEVEQ
FT                   LELQGYRVISGLLDIYSPLLAMPETAFTQLVADDRHRKYPIETRLFHKLSIKHRLAYAE
FT                   SAERIRNLPSEQYEIYEYYYRARLIQDYISGMTDLYAYDEYRRLMAAE"
FT   gene            315425..316870
FT                   /gene="gsrA"
FT                   /locus_tag="YP_0303"
FT                   /old_locus_tag="YP0303"
FT   CDS_pept        315425..316870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsrA"
FT                   /locus_tag="YP_0303"
FT                   /old_locus_tag="YP0303"
FT                   /product="global stress requirement protein GsrA"
FT                   /note="similar to Yersinia pestis CO92 gsrA and Yersinia
FT                   pestis KIM htrA. Contains Serine proteases, V8 family
FT                   (Interpro|IPR000126, (GO:0006508), (GO:0008236)). Contains
FT                   Serine protease, trypsin family (Interpro|IPR001254,
FT                   (GO:0006508)). Contains PDZ/DHR/GLGF domain
FT                   (Interpro|IPR001478, (GO:0007242)). Contains HtrA/DegQ
FT                   protease (Interpro|IPR001940, (GO:0006508)). Contains
FT                   Glucose/ribitol dehydrogenase (Interpro|IPR002347,
FT                   (GO:0008152), (GO:0016491))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60578"
FT                   /db_xref="GOA:A0A2S9PMH4"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PMH4"
FT                   /protein_id="AAS60578.1"
FT                   /translation="MKKTTLVLSALALSIGFAMGPVSSVVAAETAASSSQQLPSLAPML
FT                   EKVMPSVVSINVEGSAPVSSAGARGMPPQFQQFFGDNSPFCQDGSPFQGSPMCQGDLGG
FT                   LGQGMPSKREFRSLGSGVIIDAGKGYVVTNNHVVDNANKISVKLSDGRSFDAKVIGKDP
FT                   RTDIALLQLKDAKNLTAIKIANSDQLRVGDYTVAIGNPYGLGETVTSGIVSALGRSGLN
FT                   VENYENFIQTDAAINRGNSGGALINLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNL
FT                   TSQMVEFGQVKRGELGIMGTELNSELAKAMKVDAQKGAFISQVVPKSAAAKAGIKAGDI
FT                   IVSMNGKAINSFAGFRAEIGTLPVGSKMTLGLLRDGKPINVDVVLEQSSHSQVESGNLY
FT                   TGIEGAELSNSDVSGKKGVKVDSVKPGTAAARIGLKKGDIIMGINQQPVQNLGELRKIL
FT                   DAKPPVLALNIQRGDTSLYLLMQ"
FT   gene            complement(317029..319794)
FT                   /gene="barA"
FT                   /locus_tag="YP_0304"
FT                   /old_locus_tag="YP0304"
FT   CDS_pept        complement(317029..319794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="barA"
FT                   /locus_tag="YP_0304"
FT                   /old_locus_tag="YP0304"
FT                   /product="two-component regulatory protein"
FT                   /note="similar to Yersinia pestis CO92 barA and Yersinia
FT                   pestis KIM barA. Contains Response regulator receiver
FT                   (Interpro|IPR001789, (GO:0006355)). Contains Hpt domain
FT                   (Interpro|IPR002570, (GO:0007165)). Contains ATP-binding
FT                   region, ATPase-like (Interpro|IPR003594, (GO:0005524)).
FT                   Contains Histidine kinase, HAMP region (Interpro|IPR003660,
FT                   (GO:0016020)). Contains Histidine kinase A, N-terminal
FT                   (Interpro|IPR003661, (GO:0016020)). Contains Bacterial
FT                   sensor protein, C-terminal (Interpro|IPR004358,
FT                   (GO:0007165)). Contains Histidine kinase
FT                   (Interpro|IPR005467, (GO:0007165), (GO:0016301))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60579"
FT                   /db_xref="GOA:A0A0H2W1B9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR019247"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W1B9"
FT                   /protein_id="AAS60579.1"
FT                   /translation="MTKYSLRARMMILILAPTLLLGLLLSTSFMVNRYNELQNQIVSAG
FT                   TNIIEPLAVASEYGMSFRNRDTVRQLINLLHRRHSNIVRSISVFDVDNKLFVTSNYNYN
FT                   SSQLRLPPGEPVPDSLMLSYRGDSLILRMPIVSESNLSSEQASGQGESDQILGYIAIDL
FT                   DLQSVRLKQYKEIFISTLLLLFCMCVAILFAYRLMRDVTGPIRNMVNTVDRIRRGQLDS
FT                   RVEGHMLGELDILKNGINSMAMSLAAYHEEMQQNIDQATSDLRETLEQMEIQNVELGLA
FT                   KKRAQEASRIKSEFLANMSHELRTPLNGVIGFTRQTLKTSLTPTQTDYLQTIQRSANNL
FT                   LCIINDVLDFSKLEADKLILEHIPFSLRETLDEVIILLAHTAHEKGLELTLHINNDVPD
FT                   QVLGDAMRLQQIVTNLLGNAIKFTEEGNIDILVVVKAIASQQVTLMVEIHDTGIGISES
FT                   QQAQLFQAFRQADASTSRRHGGTGLGLVITERLVKEMGGNISFQSQMSCGSIFRFHLTL
FT                   ELNESIPYRQPDMAHLEGKQLAYIERNSTAARATINILNTTPLQVTHRQSLAQLPEQHY
FT                   DFLLVGVPIPFRNNMAIHQDKLLTALKIADHVILALPSQSQVEAEQLKQIGAKDCLLKP
FT                   ISSIRLIPLLLAEDTHSKVPSEEQPRKQPKLPFRVMAVDDNPANLKLIGTLLEEQIEET
FT                   VLCDSGAMAITYAREHTLDIILMDIQMPEIDGIRASEIIHQIPHHQETPIIAVTAHAVK
FT                   GQQEQLLRLGMADYLAKPIDEARLLQVLSRYQSDNPPLSTASTAESLPLPVPKGAGVID
FT                   WAQAVRQAANKEDLARDLLTMLLEFMPQITARVQAILAGADDGDILNLVHKFHGSCACS
FT                   GVPRLRQLCMTIELQLRQQVNLQDLEPEWLELLDEIENVSEAAKTYLRTE"
FT   gene            319905..320087
FT                   /locus_tag="YP_0305"
FT                   /old_locus_tag="YP0305"
FT   CDS_pept        319905..320087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0305"
FT                   /old_locus_tag="YP0305"
FT                   /product="hypothetical protein"
FT                   /note="similar to Yersinia pestis KIM y0809. Contains
FT                   Prenyl group binding site (CAAX box) (Interpro|IPR001230)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60580"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BA81"
FT                   /protein_id="AAS60580.1"
FT                   /translation="MTVYFLGPFTLGAVLHQGVIVFIPDILPGGRVYLAAGSLFGKPLR
FT                   VKELRRLSLMGCIMR"
FT   gene            320238..322472
FT                   /gene="relA"
FT                   /locus_tag="YP_0306"
FT                   /old_locus_tag="YP0306"
FT   CDS_pept        320238..322472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="relA"
FT                   /locus_tag="YP_0306"
FT                   /old_locus_tag="YP0306"
FT                   /product="GTP pyrophosphokinase"
FT                   /note="similar to Yersinia pestis CO92 relA and Yersinia
FT                   pestis KIM relA. Contains Amino acid-binding ACT
FT                   (Interpro|IPR002912, (GO:0008152), (GO:0016597)). Contains
FT                   TGS domain (Interpro|IPR004095). Contains RelA/SpoT family
FT                   protein (Interpro|IPR004811, (GO:0015969))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60581"
FT                   /db_xref="GOA:A0A3N4B8G7"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B8G7"
FT                   /protein_id="AAS60581.1"
FT                   /translation="MVAVRSAHLNPAGEFALDDWIASLGLANPQSSERLAETWRYCEQQ
FT                   TQNHPDASLLLWRGLEMVEILSTLSMDNDSMRAALLFPLVDANIVDETTLTEQFGKGIT
FT                   YLVHGVRDMDAIRQLKATHNDSMSSEQVDNVRRMLLAMVEDFRCVVIKLAERIAHLREV
FT                   KDAPEDERVLAAKECSNIYAPLANRLGIGQIKWELEDFCFRYLHPDEYKKIAKLLHERR
FT                   IDREQFIDDFVASLHKAMADEGIKADIYGRPKHIYSIWRKMQKKSLAFDELFDVRAVRV
FT                   VVERLQDCYAALGIVHTHFRHLPDEFDDYVANPKPNGYQSIHTVVLGPRGKTLEIQIRT
FT                   RQMHEDAELGVAAHWKYKEGAVAAGRSSYEGRIAWLRKLIAWQEEMADSGEMLDEVRSQ
FT                   VFDDRVYVFTPKGDVIDLPAGSTPLDFAYHIHSDVGHRCIGAKISGRIVPFTYQLQMGD
FT                   QIEIITQKQPNPSRDWLNPNLGYITTSRGRSKIHNWFRKQDRDKNILAGRQMLDDELEH
FT                   LDISLKEAEKLLVPRYNMNSMDEVLAAIGGGDIRLNQMVNFLQGKLNKPTAEEADLEAL
FT                   RHLNNKHQPAPRNASKDSGRIVVEGVGNLMHHIARCCQPIPGDQIIGFITQGRGISIHR
FT                   ADCEQLAELESHAPERIVDAVWGESYSSGYSLVVRVTANDRSGLLRDITTILANEKVNV
FT                   LGVASRSDTKKMVATIDMDIEIYNLQVLGRVLAKLNQLPDVIDARRLHGN"
FT   gene            322674..323516
FT                   /gene="mazG"
FT                   /locus_tag="YP_0308"
FT                   /old_locus_tag="YP0308"
FT   CDS_pept        322674..323516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mazG"
FT                   /locus_tag="YP_0308"
FT                   /old_locus_tag="YP0308"
FT                   /product="putative pyrophosphatase"
FT                   /note="similar to Yersinia pestis CO92 YPO3378 and Yersinia
FT                   pestis KIM mazG. Contains MazG family protein
FT                   (Interpro|IPR004518)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60583"
FT                   /db_xref="GOA:A0A3N4B5P4"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B5P4"
FT                   /protein_id="AAS60583.1"
FT                   /translation="MTQPVTSPDSTAVALQRLLDIMRALRDPEQGCPWDRKQTFDTIAP
FT                   YTLEETYEVLDAIARKDFDDLRDELGDLLFQVVFYAQMGQEQGLFTFDDVCHAISDKLE
FT                   RRHPHVFSDTSQNVTQAAVNREAALAGWESRKAEERAEKALYSALDDIPDALPALMKAH
FT                   KIQKRCASVGFDWNTLGPVLDKVYEEIDEVMFEARQAVVDEDKLGEEIGDLLFATVNLS
FT                   RHLGHKAENALQAANRKFERRFRQVEQIVTASGQTMESATLDEMEAAWQQVKKQETEM"
FT   gene            323728..325365
FT                   /gene="pyrG"
FT                   /locus_tag="YP_0309"
FT                   /old_locus_tag="YP0309"
FT   CDS_pept        323728..325365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="YP_0309"
FT                   /old_locus_tag="YP0309"
FT                   /product="CTP synthase"
FT                   /note="similar to Yersinia pestis CO92 pyrG and Yersinia
FT                   pestis KIM pyrG. Contains Glutamine amidotransferase
FT                   class-I (Interpro|IPR000991, (GO:0003824)). Contains
FT                   Glutamate 5-kinase (Interpro|IPR001057, (GO:0006561)).
FT                   Contains CTP synthase (Interpro|IPR004468, (GO:0006221))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60584"
FT                   /db_xref="GOA:Q8ZBN1"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZBN1"
FT                   /protein_id="AAS60584.1"
FT                   /translation="MTTNYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTIMKLDPYI
FT                   NVDPGTMSPTQHGEVFVTEDGAETDLDLGHYERFIRTKMTRRNNFTTGRIYSEVLRKER
FT                   RGDYLGATIQVIPHITNAIKERIIEGGEGHDVVLVEIGGTVGDIESLPFLEAIRQMAVD
FT                   VGREHTLYMHLTLVPYLAAAGEVKTKPTQHSVKELLSIGIQPDVLICRSDRAVPANERA
FT                   KIALFCNVPEKAVISLKDVDSIYKIPGLLKSQGLDDYICKRFSLTCPEANLAEWEQVLY
FT                   EESNPGGEVTIGMIGKYVELPDAYKSVIEALKHGGLKNRLTVNIKLIDSQDVETRGEEM
FT                   LKELDAILIPGGFGYRGVEGKVLAARYAREHNIPYLGICLGMQVALMEFARNVAGMENA
FT                   NSTEFVPDCKYPVVALITEWRDEDGNVEIRTEESDLGGTMRVGGQQCHLTEGSLVRQMY
FT                   GEPTIVERHRHRYEVNNMLLKQIEAAGLRVAGRSADNKLVEIIELPDHPWFVACQFHPE
FT                   FTSTPRDGHPLFAGFVKAAGDYQKRQVK"
FT   gene            325446..326741
FT                   /gene="eno"
FT                   /locus_tag="YP_0310"
FT                   /old_locus_tag="YP0310"
FT   CDS_pept        325446..326741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="YP_0310"
FT                   /old_locus_tag="YP0310"
FT                   /product="enolase"
FT                   /note="similar to Yersinia pestis CO92 eno and Yersinia
FT                   pestis KIM eno. Contains Enolase (Interpro|IPR000941,
FT                   Cellular Component: phosphopyruvate hydratase complex
FT                   (GO:0000015), (GO:0006096))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60585"
FT                   /db_xref="GOA:Q8ZBN2"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZBN2"
FT                   /protein_id="AAS60585.1"
FT                   /translation="MSKIVKVIGREIIDSRGNPTVEAEVHLEGGFVGLAAAPSGASTGS
FT                   REALELRDGDKSRFLGKGVLKAVAAVNGPIAQAVIGKDAKDQANIDKIMIDLDGTENKS
FT                   QFGANAILAVSLAAAKAAAASKGMPLYEHIAELNGTPGKFSMPLPMMNIINGGEHADNN
FT                   VDIQEFMIQPVGAKTLKEAVRIGSEVFHHLAKVLKAKGLNTAVGDEGGYAPNLGSNAEA
FT                   LAVIAEAVKAAGYELGKDITLAMDCAASEFYKDGKYVLAGEGNKAFTSEEFTHFLEDLT
FT                   KQYPIVSIEDGLDESDWAGFKYQTEVLGDKIQLVGDDLFVTNTKILKEGIEKGVANSIL
FT                   IKFNQIGSLTETLAAIKMAKDAGYTAVISHRSGETEDATIADLAVGTAAGQIKTGSMSR
FT                   SDRVAKYNQLIRIEEALGDRAPFNGLKEVKGQ"
FT   gene            327113..327718
FT                   /gene="sodC"
FT                   /locus_tag="YP_0311"
FT                   /old_locus_tag="YP0311"
FT   CDS_pept        327113..327718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sodC"
FT                   /locus_tag="YP_0311"
FT                   /old_locus_tag="YP0311"
FT                   /product="superoxide dismutase [Cu-Zn] precursor"
FT                   /note="similar to Yersinia pestis CO92 sodC. Contains
FT                   Copper/Zinc superoxide dismutase (Interpro|IPR001424,
FT                   (GO:0006801))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60586"
FT                   /db_xref="GOA:A0A2S9PMF0"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PMF0"
FT                   /protein_id="AAS60586.1"
FT                   /translation="MKLSTLLLPVILYSSATLAANMAGMNDKASMNDKASMNDMASMNG
FT                   KASMTVKINESLPQGNGKALGTVTVTETAYGLLFTPHLTGLAPGIHGFHLHEKPSCAPG
FT                   MKDGKAVPALAAGGHLDPNKTGVHLGPYNDKGHLGDLPGLVVNADGTATYPVLAPRLKS
FT                   LSEVKQHALMIHAGGDNYSDHPMPLGGGGARMACGVIE"
FT   gene            327822..328493
FT                   /gene="nrdG1"
FT                   /locus_tag="YP_0312"
FT                   /old_locus_tag="YP0312"
FT   CDS_pept        327822..328493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdG1"
FT                   /locus_tag="YP_0312"
FT                   /old_locus_tag="YP0312"
FT                   /product="Organic radical activating enzymes"
FT                   /note="similar to Yersinia pestis CO92 YPO3374 and Yersinia
FT                   pestis KIM y0816"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60587"
FT                   /db_xref="GOA:A0A380PGS3"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="InterPro:IPR027609"
FT                   /db_xref="UniProtKB/TrEMBL:A0A380PGS3"
FT                   /protein_id="AAS60587.1"
FT                   /translation="MLYPINEMFQTLQGEGYFTGVPAIFVRLQGCPVGCSWCDTKHTWE
FT                   KEADREVDMQRIMVKTAESDAWGSASEQQLLDLFAQQGYTARHVVITGGEPSIYDLQPL
FT                   TSLLEQAGFSCQIETSGTHEVRCSAQTWVTVSPKVNMRGGLKILSQALQRADEIKHPVG
FT                   RLRDIEALEALLATLDDDKKRIIALQPISQKEDATKLCIETCIAKNWRLSMQTHKYLNI
FT                   A"
FT   gene            complement(328727..329092)
FT                   /locus_tag="YP_0313"
FT                   /old_locus_tag="YP0313"
FT   CDS_pept        complement(328727..329092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0313"
FT                   /old_locus_tag="YP0313"
FT                   /product="sulfite reductase, alpha subunit"
FT                   /note="similar to Yersinia pestis KIM y0817. Contains
FT                   6-pyruvoyl tetrahydropterin synthase and hypothetical
FT                   protein (Interpro|IPR007115)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60588"
FT                   /db_xref="GOA:Q8D199"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D199"
FT                   /protein_id="AAS60588.1"
FT                   /translation="MIMSTTLFKDFQFEAAHRLPHVPEGHKCGRLHGHSFMVRLEVTGE
FT                   VDAHSGWVMDFAALKAVFQPIWERLDHHYLNDIPGLENPTSEVLARWIWQQLKPQLPEL
FT                   SAVMIKETCSAGCVYRG"
FT   gene            329437..331317
FT                   /gene="cysJ"
FT                   /locus_tag="YP_0314"
FT                   /old_locus_tag="YP0314"
FT   CDS_pept        329437..331317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysJ"
FT                   /locus_tag="YP_0314"
FT                   /old_locus_tag="YP0314"
FT                   /product="sulfite reductase [NADPH] flavoprotein
FT                   alpha-component"
FT                   /note="similar to Yersinia pestis CO92 cysJ and Yersinia
FT                   pestis KIM cysJ. Contains Flavodoxin-like domain
FT                   (Interpro|IPR001094, (GO:0006118), (GO:0008246)). Contains
FT                   Flavodoxin (Interpro|IPR001226, (GO:0006118),
FT                   (GO:0009457)). Contains Oxidoreductase FAD/NAD(P)-binding
FT                   (Interpro|IPR001433, (GO:0006118), (GO:0008246)). Contains
FT                   Flavoprotein pyridine nucleotide cytochrome reductase
FT                   (Interpro|IPR001709, (GO:0006118), (GO:0008246)). Contains
FT                   FAD-binding (Interpro|IPR003097, (GO:0006118),
FT                   (GO:0016491))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60589"
FT                   /db_xref="GOA:Q8ZBN6"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010199"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR029758"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZBN6"
FT                   /protein_id="AAS60589.1"
FT                   /translation="MCQPRLKHKGIRTAMTTQAPPTSLLPLSPEQLARLQAAVGEFSPT
FT                   QMAWLSGYFWGMVNQQPGAVASPAVAAPPPVTVTLISASQTGNARRLAEQLRDDLLAAQ
FT                   LSVNLVNAGDYKFKQIAQERLLVVVASTQGEGEPAEEAVALHKFLFSKKAPKLSETAFA
FT                   VFGLGDTSYEHFCQAGKDFDSKLAELGAQRLLDRVDADVEYQVQAQQWRQQVVATLQAK
FT                   VPAQSTAPTQFIAPTQSTTPAAAAITSGGTTTVSPYSKTAPLTAQLSVQQKVTGRNSEK
FT                   DVRHIEIDLGDSGLRYQPGDALGVWFDNDPALVEELLALLWLKGDEPVSIDGQNMPLAQ
FT                   ALLSHLELTQNTTLIVDKYAALSRDETLIALLADKPALQLYAKNTPFVDMVRQAPSDLN
FT                   ADQLVGLLRPLTPRLYSIASSQAETENEVHITVGVVRYDIDGRARSGGASGYLADRLEV
FT                   DGDIRVFIEHNDNFRLPANPETPVIMIGPGTGIAPFRAFMQQREVDGASGKNWLFFGNP
FT                   HFTEDFLYQVEWQRYVKEGVLTRIDLAWSRDQAHKIYVQDKLREQGAELWNWIQQGAHI
FT                   YVCGDANRMAKDVEQVLLDVVALHGAMDAEQADEYLSELRQARRYQRDVY"
FT   gene            331317..333047
FT                   /gene="cysI"
FT                   /locus_tag="YP_0315"
FT                   /old_locus_tag="YP0315"
FT   CDS_pept        331317..333047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysI"
FT                   /locus_tag="YP_0315"
FT                   /old_locus_tag="YP0315"
FT                   /product="sulfite reductase [NADPH] hemoprotein
FT                   beta-component"
FT                   /note="similar to Yersinia pestis CO92 cysI and Yersinia
FT                   pestis KIM cysI. Contains Nitrite/sulfite reductase
FT                   ferredoxin-like half domain (Interpro|IPR005117). Contains
FT                   Nitrite and sulfite reductase iron-sulfur/siroheme-binding
FT                   site (Interpro|IPR006066, (GO:0006118)). Contains Nitrite
FT                   and sulphite reductase 4Fe-4S domain (Interpro|IPR006067,
FT                   (GO:0006118))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60590"
FT                   /db_xref="GOA:Q8ZBN7"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR011786"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZBN7"
FT                   /protein_id="AAS60590.1"
FT                   /translation="MNEKHPGPLVVSGKLSDGERMKSESNFLRGTIAEDLNNGLTGGFS
FT                   GDNFLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMMLRCRLPGGIITPQQWLGIDKFAA
FT                   DNTLYGSIRITNRQTFQFHGILKGNVKPAHQLLNELGLDALATANDVNRNVLCTSNPVE
FT                   SALHQEAYEWAKKISEHLLPRTRAYAEIWLDAEKVATTDEEPILGATYLPRKFKTTVVI
FT                   PPQNDVDLHANDLNFVAVADKGKLIGFNVLVGGGLSIAHGDKNTYPRKASEFGYIPLKH
FT                   TLAIAEAVVTTQRDWGNRTDRKNAKTKYTLERVGVETFKAEVEKRAGVSFSAIKPYQFI
FT                   GRGDRIGWVKGVDKKWHLTLFVENGRLLDYPGRSLKTGVAEIAKIHQGDFRLTANQNLI
FT                   VAGVPEKDKARIEALAREHGLMDDNVTSQRENSMACVSFPTCPLAMAEAERFLPEFVTR
FT                   VEGILQQHGLADEHIVLRVTGCPNGCGRALLAEVGLVGKAVGRYNLHLGGNREGTRIPR
FT                   MYRENITADEILLITDQLVGRWAKERHVDEGFGDFVIRAGVIAPVIDSARDFYDVQEAM
FT                   "
FT   gene            333044..333770
FT                   /pseudo
FT                   /gene="cysH"
FT                   /locus_tag="YP_0316"
FT                   /old_locus_tag="YP0316"
FT                   /note="similar to gi|16766252|ref|NP_461867.1| (NC_003197)
FT                   3'-phosphoadenosine 5'-phosphosulfate (PAPS) reductase
FT                   [Salmonella typhimurium LT2]. Contains a frameshift around
FT                   codon 154. The sequence has been checked and is believed to
FT                   be correct."
FT   gene            complement(334013..334525)
FT                   /locus_tag="YP_0317"
FT                   /old_locus_tag="YP0317"
FT   CDS_pept        complement(334013..334525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0317"
FT                   /old_locus_tag="YP0317"
FT                   /product="hypothetical protein"
FT                   /note="similar to Yersinia pestis KIM y0821. Contains
FT                   Protein of unknown function UPF0150 (Interpro|IPR005357,
FT                   (GO:0005554))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60591"
FT                   /db_xref="GOA:Q8CLN2"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLN2"
FT                   /protein_id="AAS60591.1"
FT                   /translation="MYFKVNDQSVTGMSEGNQRTCNLKYDGDKQLRELTMIYPIFIFKT
FT                   VEGFDGYFPDIDGCFFAGNTFADISKNAEEAFAVHIEALMNEGFPLPSPPKDPHRYIDD
FT                   PRLKEEGGILGFVEIDPAKYESKAVKFNLTMSQNLLTAIDKFIATNRGYKNRSQFLAEL
FT                   AREKIIS"
FT   gene            complement(334595..334795)
FT                   /locus_tag="YP_0318"
FT                   /old_locus_tag="YP0318"
FT   CDS_pept        complement(334595..334795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0318"
FT                   /old_locus_tag="YP0318"
FT                   /product="hypothetical protein"
FT                   /note="no significant database match found"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60592"
FT                   /db_xref="GOA:A0A3N4B5P1"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="PDB:4P78"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B5P1"
FT                   /protein_id="AAS60592.1"
FT                   /translation="MESGELIKRLEDAGWQIRGGRKTNSGSHVTLCKPGVRKIITLPYP
FT                   RKDISKGLLRQAQKIAGIKLS"
FT   gene            334819..335085
FT                   /locus_tag="YP_0319"
FT                   /old_locus_tag="YP0319"
FT   CDS_pept        334819..335085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0319"
FT                   /old_locus_tag="YP0319"
FT                   /product="putative membrane protein"
FT                   /note="similar to Yersinia pestis CO92 YPO3368"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60593"
FT                   /db_xref="GOA:A0A3N4B5N0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B5N0"
FT                   /protein_id="AAS60593.1"
FT                   /translation="MGIIPTSSIESISYRCNTHQFLYVKNTEKGDHNDRPCLEFIGFFI
FT                   HFAQYLAIGNYFLGIANVYRRGNRILALSQVCLLMRPGQYVAK"
FT   gene            335386..336803
FT                   /pseudo
FT                   /gene="cysG2"
FT                   /locus_tag="YP_0320"
FT                   /old_locus_tag="YP0320"
FT                   /note="similar to Yersinia pestis cysG. Note there is a
FT                   frameshift following codon 142. The sequence has been
FT                   checked and is believed to be correct. Contains
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase (Interpro|IPR000878, (GO:0008152),
FT                   (GO:0008168)) . Contains Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase (Interpro|IPR000878,
FT                   (GO:0008152), (GO:0008168)). Contains Uroporphiryn-III
FT                   C-methyltransferase (Interpro|IPR003043, (GO:0006779),
FT                   (GO:0008168)). Contains Uroporphyrin-III
FT                   C-methyltransferase, C-terminal (Interpro|IPR006366).
FT                   Contains Siroheme synthase, N-terminal
FT                   (Interpro|IPR006367). Contains Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase
FT                   (Interpro|IPR000878, (GO:0008152), (GO:0008168)). Contains
FT                   Uroporphiryn-III C-methyltransferase (Interpro|IPR003043)"
FT   gene            336814..337722
FT                   /gene="cysD"
FT                   /locus_tag="YP_0321"
FT                   /old_locus_tag="YP0321"
FT   CDS_pept        336814..337722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysD"
FT                   /locus_tag="YP_0321"
FT                   /old_locus_tag="YP0321"
FT                   /product="sulfate adenylyltransferase subunit 2"
FT                   /note="similar to Yersinia pestis CO92 cysD and Yersinia
FT                   pestis KIM cysD. Contains Phosphoadenosine phosphosulfate
FT                   reductase (Interpro|IPR002500, (GO:0008152), (GO:0016740))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60594"
FT                   /db_xref="GOA:Q8ZBP1"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZBP1"
FT                   /protein_id="AAS60594.1"
FT                   /translation="MDEKRLTHLRQLEAESIHIIREVAAEFGNPVMLYSIGKDSSVMLH
FT                   LARKAFFPGHLPFPLLHVDTGWKFREMYEFRDHTVKEFGCELLVHRNPEGVAMGINPFV
FT                   HGSAKHTDIMKTEGLKQALNKYGFDAAFGGARRDEEKSRAKERIYSFRDRFHRWDPKNQ
FT                   RPELWHNYNGQINKGESIRVFPLSNWTELDIWQYIFLEKIEIVPLYLAKPRPVVERDGM
FT                   LLMVDDDRIDLQPGEVIVQKKVRFRTLGCWPLTGAVESEAETLPAIIEEMLISTTSERQ
FT                   GRMIDRDQSGSMELKKRQGYF"
FT   gene            337734..339251
FT                   /gene="cysN"
FT                   /locus_tag="YP_0322"
FT                   /old_locus_tag="YP0322"
FT   CDS_pept        337734..339251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysN"
FT                   /locus_tag="YP_0322"
FT                   /old_locus_tag="YP0322"
FT                   /product="ATP-sulfurylase, subunit 1"
FT                   /note="similar to Yersinia pestis KIM cysN. Contains
FT                   Elongation factor, GTP-binding (Interpro|IPR000795,
FT                   (GO:0006414)). Contains Heat shock protein Hsp70
FT                   (Interpro|IPR001023). Contains ATP/GTP-binding site motif A
FT                   (P-loop) (Interpro|IPR001687, (GO:0005524)). Contains
FT                   Elongation factor Tu, domain 2 (Interpro|IPR004161,
FT                   (GO:0005525)). Contains Small GTP-binding protein domain
FT                   (Interpro|IPR005225)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60595"
FT                   /db_xref="GOA:Q8ZBP2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR011779"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR041757"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZBP2"
FT                   /protein_id="AAS60595.1"
FT                   /translation="MSTILQNKQTLPSEPIAKNQSALESNSMILQSNSIAQQIADEGGV
FT                   EAYLHAQQHKTMLRFLTCGSVDDGKSTLIGRLLHDTRQIYEDQLSTLHTDSKRIGTQGE
FT                   KLDLALLVDGLQAEREQGITIDVAYRYFSTEKRKFIIADTPGHEQYTRNMATGASTCDL
FT                   AILLIDARKGVLDQTRRHSFIATLLGIRHLVVAVNKMDLVGFQESVFTQFKDDYLSFAE
FT                   QLPTDLDIKFVPLSALDGDNVASPSEKMDWYSGPTLLEILESVDVVNARRQQPLRFPVQ
FT                   YVNRPNLDFRGYAGTLSAGVVWVGQKVKVLPSGVESTVARIVTFDGDLTEANPGEAITL
FT                   VLADEVDISRGDLLVDASETLKAARNALVDVVWMAEQPLVVGQSYDIKVAGKKTRARVE
FT                   NIQYQVEINSLTQRVVENLPLNGIGLVELAFDEPLLLDNYQRNRDTGGMIFIDRLSNVT
FT                   VGAGLVREALASVYQENHDFSTFELELNALVRRHFPHWGARDLLGGK"
FT   gene            339190..339894
FT                   /gene="cysC"
FT                   /locus_tag="YP_0323"
FT                   /old_locus_tag="YP0323"
FT   CDS_pept        339190..339894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysC"
FT                   /locus_tag="YP_0323"
FT                   /old_locus_tag="YP0323"
FT                   /product="adenosine 5'-phosphosulfate kinase"
FT                   /note="similar to Yersinia pestis KIM cysC. Contains
FT                   ATP/GTP-binding site motif A (P-loop) (Interpro|IPR001687,
FT                   (GO:0005524)). Contains Adenylylsulfate kinase
FT                   (Interpro|IPR002891, (GO:0016301), (GO:0016772))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60596"
FT                   /db_xref="GOA:Q8ZBP3"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZBP3"
FT                   /protein_id="AAS60596.1"
FT                   /translation="MPWFAVISHIGVRVICWGVNSVPAHQLDDHNQETRSDDENIVWHP
FT                   HAITRQDREQQHGHQGVVLWFTGLSGSGKSTLAGALEQALFARGVSTYLLDGDNVRHGL
FT                   CRDLGFSDADRRENIRRVGEVAKLMVDAGLVVLTAFISPHRAERKMVQDMLASGQFIEV
FT                   FVDTPLAICEARDPKGLYKKARAGELKNFTGIDSVYESPASPDIHLQGEQLVTNLIEQL
FT                   LDVLRGRAIIKS"
FT   gene            340067..340402
FT                   /locus_tag="YP_0324"
FT                   /old_locus_tag="YP0324"
FT   CDS_pept        340067..340402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0324"
FT                   /old_locus_tag="YP0324"
FT                   /product="putative membrane protein"
FT                   /note="similar to Yersinia pestis CO92 YPO3363 and Yersinia
FT                   pestis KIM y0826."
FT                   /db_xref="EnsemblGenomes-Gn:YP_0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60597"
FT                   /db_xref="GOA:Q8D196"
FT                   /db_xref="InterPro:IPR022721"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D196"
FT                   /protein_id="AAS60597.1"
FT                   /translation="MPTGVSMQNVTQIMNDEQQEEEEPSYSFSGGVTGFVFYWLAFAIP
FT                   FFVYGPNTVFFLLYTWPFFLALMPVSVLIGIALGMLSRGHLLFTIGGTGIAVVCLFWML
FT                   FSLLTGW"
FT   gene            340716..341036
FT                   /locus_tag="YP_0325"
FT                   /old_locus_tag="YP0325"
FT   CDS_pept        340716..341036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0325"
FT                   /old_locus_tag="YP0325"
FT                   /product="Septum formation initiator"
FT                   /note="similar to Yersinia pestis CO92 YPO3362 and Yersinia
FT                   pestis KIM y0827. Contains Septum formation initiator
FT                   (Interpro|IPR007060)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60598"
FT                   /db_xref="GOA:Q8ZBP5"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR023081"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZBP5"
FT                   /protein_id="AAS60598.1"
FT                   /translation="MGKLTLLLLVLLGWLQYSLWLGKNGIHDFVRVKEDVAAQEANNST
FT                   LKARNDQLFAEIDDLNGGQEAIEERARNELGMIKPGESFYRLVPDQSRRNAGTPSTQNN
FT                   AQ"
FT   gene            341040..341765
FT                   /gene="ispD"
FT                   /locus_tag="YP_0326"
FT                   /old_locus_tag="YP0326"
FT   CDS_pept        341040..341765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="YP_0326"
FT                   /old_locus_tag="YP0326"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   synthase"
FT                   /note="similar to Yersinia pestis CO92 ispD and Yersinia
FT                   pestis KIM y0828. Contains
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol synthase
FT                   (Interpro|IPR001228, (GO:0008299), (GO:0008699))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60599"
FT                   /db_xref="GOA:Q8ZBP6"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZBP6"
FT                   /protein_id="AAS60599.1"
FT                   /translation="MSNFAVSLPEVIAVLPAAGIGSRMLVDCPKQYLTVGGKTIIEHAI
FT                   FSLLHHPRIQRVIVVIHPQDTQFSRLSVAQDPRISTVYGGDQRANSVMAGLQLAGQAEW
FT                   VLVHDAARPCLHLDDLSRLLSITECSQVGGILAAPVRDTMKRAEPGIQAIAHTVDRQDL
FT                   WHALTPQLFPLELLKLCLSRALREGVAVTDEASALEHCGYHPILVTGRSDNIKVTRPED
FT                   LALAEFYLTQRQSLNNDSL"
FT   gene            341895..342392
FT                   /gene="ispF"
FT                   /locus_tag="YP_0327"
FT                   /old_locus_tag="YP0327"
FT   CDS_pept        341895..342392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispF"
FT                   /locus_tag="YP_0327"
FT                   /old_locus_tag="YP0327"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /note="similar to Yersinia pestis KIM y0829. Contains YgbB
FT                   (Interpro|IPR003526, (GO:0016114))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60600"
FT                   /db_xref="GOA:Q8ZBP7"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="PDB:3F6M"
FT                   /db_xref="PDB:3FPI"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZBP7"
FT                   /protein_id="AAS60600.1"
FT                   /translation="MHIMRIGHGFDVHKFGENGSGPLIIGGVRIPYEKGLLAHSDGDVA
FT                   LHAATDALLGAAALGDIGKLFPDTDPAFKGADSRGLLREAYRRILAKGYKLGNLDITII
FT                   AQAPKMAPHIPQMRVNLAEDLQCHMDDINVKATTTEQLGFTGRGEGIACEAVVLLVNVE
FT                   QG"
FT   gene            342403..343452
FT                   /locus_tag="YP_0328"
FT                   /old_locus_tag="YP0328"
FT   CDS_pept        342403..343452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0328"
FT                   /old_locus_tag="YP0328"
FT                   /product="hypothetical protein"
FT                   /note="similar to Yersinia pestis CO92 YPO3359 and Yersinia
FT                   pestis KIM y0830. Contains Protein of unknown function
FT                   UPF0024 (Interpro|IPR001656, (GO:0005554))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60601"
FT                   /db_xref="GOA:Q8ZBP8"
FT                   /db_xref="InterPro:IPR001656"
FT                   /db_xref="InterPro:IPR011760"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR020119"
FT                   /db_xref="InterPro:IPR042214"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZBP8"
FT                   /protein_id="AAS60601.1"
FT                   /translation="MDMENLTWLHGKPTASGILKANPEDFVVVEDLGFEPDGEGEHLLV
FT                   RIRKNGCNTQFVADYLARFAKLHPRLVSYAGLKDRHAVTEQWFCLHLPGKEAPDLATFE
FT                   LEGCEVLEAVRHKRKLRIGSLKGNAFTLVLRHITDRQDVEQRLQQIAAQGVPNYFGSQR
FT                   FGRGGNNLVQARLWANNEIRVKERSKRSFYLSASRSAMFNLISSYRLAQQLSTTVLEGD
FT                   ALQLSGRGSWFVAQADELAALQQRVTAGELNITAPLPGDSELGTHGEALAFEQACLAEQ
FT                   TELLSLIKRERVEGSRRAVLLKPQNMISNWWDDVTLELSFWLPAGSFATSVVREIMNQD
FT                   RADDTDIIE"
FT   gene            343430..344194
FT                   /gene="surE"
FT                   /locus_tag="YP_0329"
FT                   /old_locus_tag="YP0329"
FT   CDS_pept        343430..344194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surE"
FT                   /locus_tag="YP_0329"
FT                   /old_locus_tag="YP0329"
FT                   /product="stationary-phase survival protein"
FT                   /note="similar to Yersinia pestis CO92 surE and Yersinia
FT                   pestis KIM surE. Contains Survival protein SurE
FT                   (Interpro|IPR002828)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60602"
FT                   /db_xref="GOA:Q8ZBP9"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZBP9"
FT                   /protein_id="AAS60602.1"
FT                   /translation="MIRILLSNDDGISAPGIQTLASALRGFAQVQIVAPDRNRSGASNA
FT                   LTLDSALRITTLSNGDIAVQQGTPTDCVYLGVNALMRPRPDIVVSGINAGPNLGDDVIY
FT                   SGTVAAAMEGRHLGYPALAVSLNGHQHYDTAAAVTCRLLRALQRKPLRTGKILNINVPD
FT                   LPLAEIKGIRVTRCGSRHPAEQVFCQQDPRGQDLYWIGPPGEKYDAGPDTDFAAVEQGY
FT                   VSITPLQVDLTAYMAQEVVESWLANTEVDGEW"
FT   gene            344188..344814
FT                   /gene="pcm"
FT                   /locus_tag="YP_0330"
FT                   /old_locus_tag="YP0330"
FT   CDS_pept        344188..344814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcm"
FT                   /locus_tag="YP_0330"
FT                   /old_locus_tag="YP0330"
FT                   /product="protein-L-isoaspartate O-methyltransferase"
FT                   /note="similar to Yersinia pestis CO92 pcm and Yersinia
FT                   pestis KIM pcm. Contains SAM (and some other nucleotide)
FT                   binding motif (Interpro|IPR000051, (GO:0008757)). Contains
FT                   Protein-L-isoaspartate(D-aspartate) O-methyltransferase
FT                   (Interpro|IPR000682, (GO:0006464))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60603"
FT                   /db_xref="GOA:Q8ZBQ0"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZBQ0"
FT                   /protein_id="AAS60603.1"
FT                   /translation="MVNKRMQTLLMQLRQQGIHDERLLQAIEAVPRERFVDEALAHKAY
FT                   ENTALPIGAGQTISQPYMVARMTELLQLTPTSRVLEIGTGSGYQTAILAHLVDHVCSVE
FT                   RIKGLQWQAKRRLKQLDLHNVSTRHGDGWLGWQSRGPFDAIIVTAAPPEIPDALLEQLD
FT                   EGGILVLPVGEQFQTLKYVQRRNNEYHIETVEAVRFVPLVKGELA"
FT   gene            344918..345919
FT                   /gene="nlpD2"
FT                   /locus_tag="YP_0331"
FT                   /old_locus_tag="YP0331"
FT   CDS_pept        344918..345919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nlpD2"
FT                   /locus_tag="YP_0331"
FT                   /old_locus_tag="YP0331"
FT                   /product="lipoprotein"
FT                   /note="similar to Yersinia pestis CO92 nlpD and Yersinia
FT                   pestis KIM nlpD. Contains Peptidoglycan-binding LysM
FT                   (Interpro|IPR002482, (GO:0016998)). Contains Peptidase
FT                   M23/M37 (Interpro|IPR002886, (GO:0006508))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60604"
FT                   /db_xref="GOA:A0A3N4BUR3"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BUR3"
FT                   /protein_id="AAS60604.1"
FT                   /translation="MSTGSPMIRLRRVAACTVVSLWLVGCTNDNSTSAPISSVGGDRSG
FT                   TMLSKANTDSSGGRIVYNRSYDNIPKGSYSGNTYTVKRGDTLFYIAWITGNDFRDLAAK
FT                   NNIAEPYSLNVGQSIQLGNGSGGGMLAATDATSSGIAQPPSNIQNTTTIQNTTTTVDSQ
FT                   STSAYSGNSGKQNVGKMLPSSGAVVATTAPVTAPSSSVSEPASNGGPVSGWRWPTDGKT
FT                   IDSFSASEGGNKGIDIAGSRGQPILATASGRVVYAGNALRGYGNLIIIKHNDDYLSAYA
FT                   HNDTMLVREQQEVKAGQKIATMGSTGTSSVRLHFEIRYKGKSVNPLRYLPQR"
FT   gene            345974..346972
FT                   /gene="rpoS"
FT                   /locus_tag="YP_0332"
FT                   /old_locus_tag="YP0332"
FT   CDS_pept        345974..346972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoS"
FT                   /locus_tag="YP_0332"
FT                   /old_locus_tag="YP0332"
FT                   /product="RNA polymerase sigma factor RpoS"
FT                   /note="similar to Yersinia pestis CO92 rpoS and Yersinia
FT                   pestis KIM rpoS. Contains Sigma-70 factor family
FT                   (Interpro|IPR000943, (GO:0016987))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60605"
FT                   /db_xref="GOA:A0A384KIP6"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012761"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KIP6"
FT                   /protein_id="AAS60605.1"
FT                   /translation="MSQSTLKVNELHEDADFDENSTETEIFDEKALVDDEPTESELADD
FT                   ELLAQGVTQRVLDATQLYLGEIGYSPLLTAEEEVYFARRALRGDVSSRRRMIESNLRLV
FT                   VKIARRYSNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMNQ
FT                   TRTIRLPIHIVKELNVYLRTARELSHKLDHEPSAEEIAEQLDKPVDDVSRMLRLNERIT
FT                   SVDTPLGGDSEKALLDILSDENENGPEDTTQDDDMKQSIVKWLFELNAKQREVLARRFG
FT                   LLGYEAATLEDVGREIGLTRERVRQIQVEGLRRLREILQTQGLSIEALFRE"
FT   gene            complement(347332..349887)
FT                   /gene="mutS"
FT                   /locus_tag="YP_0333"
FT                   /old_locus_tag="YP0333"
FT   CDS_pept        complement(347332..349887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS"
FT                   /locus_tag="YP_0333"
FT                   /old_locus_tag="YP0333"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /note="similar to Yersinia pestis CO92 mutS and Yersinia
FT                   pestis KIM mutS. Contains DNA mismatch repair protein MutS,
FT                   C-terminal (Interpro|IPR000432, (GO:0006298)). Contains
FT                   RNA-binding region RNP-1 (RNA recognition motif)
FT                   (Interpro|IPR000504, (GO:0003676)). Contains
FT                   ATP/GTP-binding site motif A (P-loop) (Interpro|IPR001687,
FT                   (GO:0005524)). Contains DNA mismatch repair protein MutS,
FT                   N-terminal (Interpro|IPR002863, (GO:0006298)). Contains
FT                   MutS 1 protein (Interpro|IPR005748, (GO:0045005))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60606"
FT                   /db_xref="GOA:Q8ZBQ3"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZBQ3"
FT                   /protein_id="AAS60606.1"
FT                   /translation="MKNNDKLDSHTPMMQQYLRLKAQHPEILLFYRMGDFYELFYSDAK
FT                   RASQLLDISLTKRGASAGEPIPMAGVPYHSIENYLAKLVQLGESAAICEQIGDPATSKG
FT                   PVERKVVRIVTPGTISDEALLQERQDNLLAAIWQDAKGFGYATLDISSGRFRVAEPADL
FT                   ETMAAELQRTNPAELLYPENFEPMSLIEHRHGLRRRPLWEFELDTAKQQLNLQFGTRDL
FT                   IGFGVEQAHLALRAAGCLLQYVKDTQRTSLPHIRGLTMERQQDGIIMDAATRRNLELTQ
FT                   NLSGGSENTLAAILDCSVTPMGSRMLKRWLHMPIRDIRVLTDRQQAIGGLQDIAAELQT
FT                   PLRQVGDLERILARLALRTARPRDLARMRHAFQQLPEIHRLLQPIDVPHVQNLLSQVGQ
FT                   FDELQDLLERAIVETPPVLVRDGGVIASGYNAELDEWRALADGATDYLDRLEIREREKL
FT                   GLDTLKVGFNGVHGYYIQVSRGQSHLVPIHYVRRQTLKNAERYIIPELKEYEDKVLTSK
FT                   GKALAIEKGLYEEIFDLLLPHLPELQLSANALAELDVLANLAERAETLNYSCPTLSDKP
FT                   GIKIMGGRHPVVEQVLKEPFISNPLTLSPQRRMLIITGPNMGGKSTYMRQTALIVLLAH
FT                   LGSYVPADQATIGPIDRIFTRVGAADDLASGRSTFMVEMTETANILHNATEQSLVLMDE
FT                   IGRGTSTYDGLSLAWACAENLASRIKAMTLFATHYFELTTLPEKMEGVVNVHLDALEHG
FT                   ETIAFMHSVQEGAASKSYGLAVAALAGVPRDVIKRARQKLKELESLSNNAAASTIDGSQ
FT                   MTLLNEEIPPAVEALEALDPDSLSPRQALEWIYRLKNMV"
FT   gene            complement(350662..351117)
FT                   /gene="rpiB1"
FT                   /locus_tag="YP_0334"
FT                   /old_locus_tag="YP0334"
FT   CDS_pept        complement(350662..351117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiB1"
FT                   /locus_tag="YP_0334"
FT                   /old_locus_tag="YP0334"
FT                   /product="ribose 5-phosphate isomerase B"
FT                   /note="similar to Yersinia pestis CO92 rpiB and Yersinia
FT                   pestis KIM rpiB. Contains Ribose/galactose isomerase
FT                   (Interpro|IPR003500, (GO:0005975))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60607"
FT                   /db_xref="GOA:A0A3N4B9T6"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B9T6"
FT                   /protein_id="AAS60607.1"
FT                   /translation="MLSIAIGCDDAAIEMKNQIVIFLQSKNITVVDYSCDQHQEPTMYP
FT                   DIAIQVALAIKAGKHERGILICGTGIGMSISANKVFGVRAAQCHDTFSAQRARKSNNAQ
FT                   IICLGARVIGPELAKTLIEAWLDAEFDGGGSTEKVERIRYYEQSLHD"
FT   gene            351567..352715
FT                   /gene="tdh2"
FT                   /locus_tag="YP_0335"
FT                   /old_locus_tag="YP0335"
FT   CDS_pept        351567..352715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdh2"
FT                   /locus_tag="YP_0335"
FT                   /old_locus_tag="YP0335"
FT                   /product="putative Zinc-binding dehydrogenase"
FT                   /note="similar to Yersinia pestis CO92 YPO3352 and Yersinia
FT                   pestis KIM y0838. Contains NAD binding site
FT                   (Interpro|IPR000205). Contains Zinc-containing alcohol
FT                   dehydrogenase superfamily (Interpro|IPR002085,
FT                   (GO:0008270)). Contains Zinc-containing alcohol
FT                   dehydrogenase (Interpro|IPR002328, (GO:0008270))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60608"
FT                   /db_xref="GOA:Q8D195"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D195"
FT                   /protein_id="AAS60608.1"
FT                   /translation="MCDKKPLKESSMSHENLKGAQMAEGIPETMRAVVAYGPRDYRFER
FT                   VPVPTIDAKEILVKVEGCGICAGDTKAFEGAPSFWGDDKQPAYIKAPMIPGHEFIGHVV
FT                   GLGADVEGFELGDRVTSEQIVPCWGCRFCNHGQYWMCEKHDLYGFQSNVNGAMAEYLKF
FT                   TKEAINYHVPDHLPLEKAILIEPYACAFHAVQRAKIKLGDVVVLAGSGTLGLGMIGAIK
FT                   KSGAAKLIVLDLSDDRLALAKKFGADLVLNPSRDDVNTLIKEMTGGYGCDIYIDATGAQ
FT                   KAVEQGLTLLRKLGTFVEFSVFKDPVTVDWSIISDRKELDVLGSHLGPYCFPLVIEGIS
FT                   NGDLPTEGVVTHILPLEKYAEGIELVKRGVDSLKVVLNPNLT"
FT   gene            352779..353549
FT                   /gene="fabG1"
FT                   /locus_tag="YP_0336"
FT                   /old_locus_tag="YP0336"
FT   CDS_pept        352779..353549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG1"
FT                   /locus_tag="YP_0336"
FT                   /old_locus_tag="YP0336"
FT                   /product="putative dehydrogenase"
FT                   /note="similar to Yersinia pestis CO92 YPO3351 and Yersinia
FT                   pestis KIM y0839. Contains Short-chain
FT                   dehydrogenase/reductase SDR (Interpro|IPR002198,
FT                   (GO:0008152), (GO:0016491)). Contains Glucose/ribitol
FT                   dehydrogenase (Interpro|IPR002347, (GO:0008152),
FT                   (GO:0016491))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60609"
FT                   /db_xref="GOA:A0A2S9PME3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PME3"
FT                   /protein_id="AAS60609.1"
FT                   /translation="MPNDYKWFDTAFSLSGKVAAITGGATGIGHAIAELYLAKGARVVL
FT                   MDCADNVAEIAEQLDRDNAVGLHCDVSDSQSVRQAVAQAIGAFGQLDILVNSAGIAALD
FT                   PAEKVREQDWDRTIDINLKGVFLMCQEVGKHFIQHGHGKIVNLASQAGVVALPNHLAYC
FT                   ASKFGVIGITKVLALEWGPLDIQVNAISPTVVLTALGQKAWSGQLAEDMKLKIPARRFA
FT                   YPAEVAACALFLASDAANMITGENLVIDGGYTIQ"
FT   gene            353549..354637
FT                   /gene="dAK1_1"
FT                   /locus_tag="YP_0337"
FT                   /old_locus_tag="YP0337"
FT   CDS_pept        353549..354637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dAK1_1"
FT                   /locus_tag="YP_0337"
FT                   /old_locus_tag="YP0337"
FT                   /product="putative dihydroxyacetone kinase"
FT                   /note="similar to Yersinia pestis CO92 dhaK and Yersinia
FT                   pestis KIM y0840. Contains Dak kinase domain
FT                   (Interpro|IPR004006, (GO:0006071))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60610"
FT                   /db_xref="GOA:Q8D194"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D194"
FT                   /protein_id="AAS60610.1"
FT                   /translation="MLSLRALNYRGIQLTHPLFLFIFHFNEIAMNRIINDPDQVVEEAI
FT                   KGYLAAYPHFFAKTAHEKVLKYPEIPLQGKVGVVTGGGSGHEPAFLGYIGKNMLDAVAV
FT                   GEIFSSPAAGAFLEAFKVADGGAGVACLYGNYAGDNMNVKMAAKKAEAMGIRVRTVVAN
FT                   DDVASAPPSEREKRRGVAGEIFMWKVGAAAASQGYALDNVIEVAQKAIDHCRSIGVGLT
FT                   SCTIPAVGKPNFSIEDGMMEVGIGHHGEPGIRVESLQNAHQMAKTMVDLVVADRPFSQG
FT                   DEVAVLISGLGATPTIELYIYYAEVAKLLEAQGITIYRPYIGNYFTSLDMMGVTLTLMK
FT                   LDDELKSLIDVPTHSLGLTQLE"
FT   gene            354644..355318
FT                   /gene="dAK1_2"
FT                   /locus_tag="YP_0338"
FT                   /old_locus_tag="YP0338"
FT   CDS_pept        354644..355318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dAK1_2"
FT                   /locus_tag="YP_0338"
FT                   /old_locus_tag="YP0338"
FT                   /product="Dihydroxyacetone kinase"
FT                   /note="similar to Yersinia pestis CO92 YPO3349 and Yersinia
FT                   pestis KIM y0842. Contains Dak phosphatase domain
FT                   (Interpro|IPR004007, (GO:0006071))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60611"
FT                   /db_xref="GOA:A0A380PH29"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012737"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:A0A380PH29"
FT                   /protein_id="AAS60611.1"
FT                   /translation="MKALLITDGSIKDKCITDGTPIIEEMANTILANREYLSEIDGAIG
FT                   DGDHGINMAKGFNLCAENIKGKNLTLAEALDALSDALMEGIGGSMGPLYGSIFMGMAES
FT                   IRGCDKMDAVAFGAMLKGGLADLQEVTDARVGDKCIMDTLIPASAAFELAQQQQQSFVE
FT                   SLHRMKHAASMGRDSTLDLVAKIGRASRLGERSRGVLDAGATSCCLILTQLADSVERRL
FT                   VP"
FT   gene            complement(355439..356398)
FT                   /gene="deoR5"
FT                   /locus_tag="YP_0339"
FT                   /old_locus_tag="YP0339"
FT   CDS_pept        complement(355439..356398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoR5"
FT                   /locus_tag="YP_0339"
FT                   /old_locus_tag="YP0339"
FT                   /product="transcriptional regulatory protein"
FT                   /note="similar to Yersinia pestis CO92 YPO3348 and similar
FT                   Yersinia pestis KIM y0843 . Contains Bacterial regulatory
FT                   proteins, AsnC family (Interpro|IPR000485, (GO:0006355)).
FT                   Contains Bacterial regulatory protein, GntR family
FT                   (Interpro|IPR000524, (GO:0006355)). Contains Bacterial
FT                   regulatory protein, Crp family (Interpro|IPR001808,
FT                   (GO:0006355)). Contains Rhodopsin-like GPCR superfamily
FT                   (Interpro|IPR000276, (GO:0016021)). Contains Bacterial
FT                   regulatory protein, Crp family (Interpro|IPR001808,
FT                   (GO:0006355))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60612"
FT                   /db_xref="GOA:A0A3N4B8D1"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B8D1"
FT                   /protein_id="AAS60612.1"
FT                   /translation="MIPQDNELLTEIAVSYYQDEMTQEEIAHKFGISRIKVGRLLKRAK
FT                   TEGIVEINVRYHPVFSTRLEQQLIEHFGLKRALIALDYQDEDEQRRQVAALVSAYLATN
FT                   LKDNTVLAVGQGRNVAAIADHVSVVPERHCKFICGIGGTHRPGDAINADHISRRLAKKF
FT                   GGTSETLYAPAYVENRALKEAFMQNGTIKETLDRARKADMALVGIGDMNENSYMVELGW
FT                   FTPQEIVDASLHQGVTGEIAGYDFFDAQGQPANTVMNDRVIGISTQELRQIPCVIAIAA
FT                   ENTKALALLGALRTGAIDILATSASNARTILKMIQHQS"
FT   gene            complement(356965..358254)
FT                   /gene="arsB"
FT                   /locus_tag="YP_0340"
FT                   /old_locus_tag="YP0340"
FT   CDS_pept        complement(356965..358254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsB"
FT                   /locus_tag="YP_0340"
FT                   /old_locus_tag="YP0340"
FT                   /product="arsenical pump membrane protein"
FT                   /note="similar to Yersinia pestis CO92 arsB and Yersinia
FT                   pestis KIM arsB. Contains Arsenical pump membrane protein
FT                   (Interpro|IPR000802, (GO:0016021))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60613"
FT                   /db_xref="GOA:A0A3N4B5L5"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B5L5"
FT                   /protein_id="AAS60613.1"
FT                   /translation="MLLAGAIFILTIVLVIWQPKGLGIGWSAMLGAGLALLTGVVHVSD
FT                   IPVVWQIVWNATATFIAIIIISLLLDESGFFEWAALHVARWGNGHGRRLFTYIILLGAA
FT                   VAALFANDGAALILTPIVIAMLLALGFGRGATLAFVMAAGFIADTASLPLIVSNLVNIV
FT                   SADFFNLGFTEYAAVMVPVNLVAVIATLAMLHLFFRKDIPAVYDLSLLKAPQAAIRDMN
FT                   TFKTGWLVLALLLIGFFALEPLGVPVSLVAAVGALILLAVAKKGHAINTGKVLRGAPWQ
FT                   IVIFSLGMYLVVYGLRNAGLTHYISALLNRLGEQGLWASTLGTGFLTAFLSSIMNNLPT
FT                   VLVGALSIEGSTATGLIKEAMIYANVIGSDLGPKITLIGSLATLLWLHVLSQKNMTITW
FT                   GYYFRVGIIMTLPVLLVTLSALALRLSVSM"
FT   gene            complement(358339..358680)
FT                   /gene="arsR1"
FT                   /locus_tag="YP_0341"
FT                   /old_locus_tag="YP0341"
FT   CDS_pept        complement(358339..358680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsR1"
FT                   /locus_tag="YP_0341"
FT                   /old_locus_tag="YP0341"
FT                   /product="arsenical resistance operon repressor"
FT                   /note="similar to Yersinia pestis CO92 arsR and Yersinia
FT                   pestis KIM arsR. Contains Cytochrome c heme-binding site
FT                   (Interpro|IPR000345, (GO:0006118)). Contains Bacterial
FT                   regulatory protein, ArsR family (Interpro|IPR001845,
FT                   (GO:0006355))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60614"
FT                   /db_xref="GOA:A0A3N4B5L0"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B5L0"
FT                   /protein_id="AAS60614.1"
FT                   /translation="MTTLTPLQLFKNLSDETRLNIILLLKASGELCVCELCHRLNEAQP
FT                   KISRHLAMLRESGLLLDRRAGKWVHYRLSPHIPAWAAAIIEQTYLSQRDEITLLAQGNV
FT                   TPDSKMLCN"
FT   gene            complement(358927..359205)
FT                   /locus_tag="YP_0342"
FT                   /old_locus_tag="YP0342"
FT   CDS_pept        complement(358927..359205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0342"
FT                   /old_locus_tag="YP0342"
FT                   /product="hypothetical protein"
FT                   /note="similar to Yersinia pestis CO92 YPO3345"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60615"
FT                   /db_xref="GOA:A0A3N4BUQ3"
FT                   /db_xref="InterPro:IPR006793"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BUQ3"
FT                   /protein_id="AAS60615.1"
FT                   /translation="MRTIPMTAKNQRKEEVMSILEDHCNVLKKQFPGSLPPVHNWPKTR
FT                   DVADKAQLDIYTARLVLMKLVDEKRARMSETKVMNSLRWFIAHPAEK"
FT   gene            complement(359401..359607)
FT                   /locus_tag="YP_0343"
FT                   /old_locus_tag="YP0343"
FT   CDS_pept        complement(359401..359607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0343"
FT                   /old_locus_tag="YP0343"
FT                   /product="hypothetical protein"
FT                   /note="similar to Yersinia pestis CO92 YPO3344 and Yersinia
FT                   pestis KIM y0846."
FT                   /db_xref="EnsemblGenomes-Gn:YP_0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60616"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B5L7"
FT                   /protein_id="AAS60616.1"
FT                   /translation="MMLIHAKAKQPKLNDNKSLKHEQTTKIAYVNRVKKPTSAETRLHS
FT                   LTHYFKKIKNKFIEMKLMTLQLK"
FT   gene            complement(360028..360798)
FT                   /gene="artI1"
FT                   /locus_tag="YP_0344"
FT                   /old_locus_tag="YP0344"
FT   CDS_pept        complement(360028..360798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="artI1"
FT                   /locus_tag="YP_0344"
FT                   /old_locus_tag="YP0344"
FT                   /product="putative extracellular solute-binding protein"
FT                   /note="similar to Yersinia pestis CO92 YPO3343 and Yersinia
FT                   pestis KIM y0847. Contains Solute-binding protein/glutamate
FT                   receptor (Interpro|IPR001311, (GO:0006810)). Contains
FT                   Bacterial extracellular solute-binding protein, family 3
FT                   (Interpro|IPR001638, (GO:0030288))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60617"
FT                   /db_xref="GOA:Q0WBV2"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR037298"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WBV2"
FT                   /protein_id="AAS60617.1"
FT                   /translation="MQMKKLSLGIMVLALISSQHVLAKNWQEIKQSGELRIGVPGDYAP
FT                   LAFHDKQGQLIGYDVDMANAFGEDLKLKVNFVSTSWPTLSDDLAADKFDIAMGGVTATP
FT                   GREAQFALSHAVVKNGKIALTHCQKVNKFPTLDAIDRQNVKVIVNPGGTNQSFVDANIK
FT                   QAQIIRTKDNVANLQGIRNKSADIMFTDLIEGDYYQSKEPGVFCVATPEVLAGTGSYKV
FT                   YMMAKDNQPLLEEVNQWLAGKTKTLLAQKWNISE"
FT   gene            complement(360863..362242)
FT                   /gene="mauG"
FT                   /locus_tag="YP_0345"
FT                   /old_locus_tag="YP0345"
FT   CDS_pept        complement(360863..362242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mauG"
FT                   /locus_tag="YP_0345"
FT                   /old_locus_tag="YP0345"
FT                   /product="putative cytochrome C peroxidase"
FT                   /note="similar to Yersinia pestis CO92 YPO3342 and Yersinia
FT                   pestis KIM y0848. Contains Cytochrome c heme-binding site
FT                   (Interpro|IPR000345, (GO:0006118)). Contains Di-haem
FT                   cytochrome c peroxidase (Interpro|IPR004852, (GO:0006118))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60618"
FT                   /db_xref="GOA:A0A2S9PMC7"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR025992"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PMC7"
FT                   /protein_id="AAS60618.1"
FT                   /translation="MIRRGLIGGGILVIAGYLGIAGYLYMTDNTRNNTFISEAKTPNQQ
FT                   VSNILYQKGCDYCHTANASLPFYAAIPGPKQLMDYDIRQGNQHFSLEPTLLALKENRAV
FT                   PEADLAKIESAIARDQMPPQRFNALHWSSSINAEERNQILDWVKIQRTTYFPSNSHSEM
FT                   QHLALQPIPDALLVDNQKVALGSRLFHDPRLSGDNSISCASCHLLNKGGVDNLATSTGV
FT                   DGQKGGINAPTVFNAVFNVEQFWDGRAVDLQQQAGGPPLNPVEMASTSWEDIIAKLQQD
FT                   PQLTQDFAQVYPQGYSEDTITDAIAEFEKTLTTPNSPFDHYLKGETQALTTSQQKGLAL
FT                   FQQNKCDTCHVGKNIGGQSYEFLGLKSDYFADRQKEQTTDDLGRFNVTNDPRDMHRFKT
FT                   PSLRNIALTAPYFHDAQAKDLHQAVELMLKYQVGTQLPEQDINDIVAFLESLTGEYIPH
FT                   S"
FT   gene            complement(362479..362784)
FT                   /locus_tag="YP_0346"
FT                   /old_locus_tag="YP0346"
FT   CDS_pept        complement(362479..362784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0346"
FT                   /old_locus_tag="YP0346"
FT                   /product="hypothetical protein"
FT                   /note="similar to Yersinia pestis KIM y0849"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60619"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLM9"
FT                   /protein_id="AAS60619.1"
FT                   /translation="MEHINTWLLIKPNGGCPLMTYTLALSGGQTGNSIHHVQINAETLL
FT                   TVVRNTSIYVQIHHGLIFMSRYHPTADKIEFFIPPAPSVRLIPSASFFFNTIKQKA"
FT   gene            362804..364999
FT                   /gene="cirA2"
FT                   /locus_tag="YP_0347"
FT                   /old_locus_tag="YP0347"
FT   CDS_pept        362804..364999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cirA2"
FT                   /locus_tag="YP_0347"
FT                   /old_locus_tag="YP0347"
FT                   /product="putative outer membrane receptor"
FT                   /note="similar to Yersinia pestis KIM y0850. Contains
FT                   TonB-dependent receptor protein (Interpro|IPR000531,
FT                   (GO:0016020))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60620"
FT                   /db_xref="GOA:Q8D192"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D192"
FT                   /protein_id="AAS60620.1"
FT                   /translation="MIIDIICFYIYAYIITIALRYKKTNINLLEAYKMSNKTIAFALVV
FT                   ASSAPVIAADNDNIMVVTASGYEQKIREAAASISVISQNELRQRNYNDLAQALSDVEGV
FT                   DVNSSTGKTGGLDISIRGMPSAYTLILVDGIRQNGTSDVTPNGFGAMNTSFMPPLSAIE
FT                   RIEVIRGPMSTLYGSDAIGGVVNIITKKITKAWASSATLEHTFQENTAFGDSSKFSFYS
FT                   SGPAVEDQLGLSLRGTIFRRDASRVESSNTGVELSRRGPNPVKADNYNLGGKLFWQLNT
FT                   QSTLWLDGDIANQKYDNSANQLGTIGARGGYEDTLRYQRRKITLGNDNRLDFGTWNSSL
FT                   SYNQTENIGRLITNASVPQGSGLAGEKRLLKNTNIILDSKLVAPLGDNHMVTLGGQYWN
FT                   AIMKDGIVLANNGDEFAQDAWSLFSEDEWRLLDSLALTYGARYEYQTTFGGHISPRAYL
FT                   VWDAQDNWTVKGGVSTGYKTPTLAQLHNGISGVTGQGTITTIGNPKLEPESSVNTEVGV
FT                   YYENETGFGANVTLFHNRFRNKINSVSIDNTTSTYTNVGKAITQGIEVASTIPLWSDDW
FT                   MLGINYTFTDSEQKDGNNKGARLTNTPKNMVNARLNWNINEQLSTWLKAEYRSKTARFT
FT                   QNYANLSAANKVVYNNLGSEFKPFSVLNLGVAYKVTKDVTLNGAVNNLLDKDFTRTHIF
FT                   AVGNGTTTAGDYFTSSQSTAGYVVPGRNYWVSVNVNF"
FT   gene            365432..366619
FT                   /locus_tag="YP_0348"
FT                   /old_locus_tag="YP0348"
FT   CDS_pept        365432..366619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0348"
FT                   /old_locus_tag="YP0348"
FT                   /product="hypothetical protein"
FT                   /note="similar to Yersinia pestis CO92 YPO3339 and Yersinia
FT                   pestis KIM y0851"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60621"
FT                   /db_xref="InterPro:IPR012927"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BA41"
FT                   /protein_id="AAS60621.1"
FT                   /translation="MHIDHYSLPVYDKNNSDNTLKETELFKEVPYLSARLGEQAYEYSG
FT                   GDISNYHLSIQYIMDVLADQAKGKVDLSHFSSEETLSSHVSLEKNEHNYHCFNQHASTV
FT                   YHINNNDFGRTLVDLFEQMNNSGENVRALKIDSSQHSMAARLYIKDTEQGQRFVVNFYD
FT                   PNITDKTVRCEVDDALKLNDYSLRNFISNQTYLSSYVDAEISSIIVCDQADIHDQHKVK
FT                   ENRALTPLSQSSPLPLSVARLDLLLTDNFAAGIQTMAEEVKNLSESERNTFFNQLLQPR
FT                   AENDLSGLQCAFNYQCFDALEAYSALLVLAPPEQRTDLLTGKSENGWSSLAQAMSSGNS
FT                   DMVSVCFYLLQWLPLDDMNAFVWKLLASLPLEDANTLMCPLEEPLPLDNMSTRVE"
FT   gene            complement(367013..367798)
FT                   /gene="map"
FT                   /locus_tag="YP_0350"
FT                   /old_locus_tag="YP0350"
FT   CDS_pept        complement(367013..367798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="YP_0350"
FT                   /old_locus_tag="YP0350"
FT                   /product="methionine aminopeptidase"
FT                   /note="similar to Yersinia pestis CO92 map and Yersinia
FT                   pestis KIM map. Contains Metallopeptidase family M24
FT                   (Interpro|IPR000994, (GO:0006508), (GO:0008235)). Contains
FT                   Methionine aminopeptidase (Interpro|IPR001714,
FT                   (GO:0006508)). Contains Methionine aminopeptidase,
FT                   subfamily 1 (Interpro|IPR002467, (GO:0006508))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60623"
FT                   /db_xref="GOA:A0A3N4B7G7"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B7G7"
FT                   /protein_id="AAS60623.1"
FT                   /translation="MTEVKIHSPAEIEMARAAGQAAAKVLEMIKPYVLAGITTDEIDRL
FT                   CHDYIVNELKVIPANIGYHGYTRTVCTSVNHVVCHGIPSDKKLKNGDIVNIDVAIIKEG
FT                   WYGDTSRMYFVGEPSVRAKRLVDITYQSMVAGIKAVRPGATLGDIGASIQQLAEGAGFS
FT                   VVREYCGHGVGQEYHTAPQVLHYGIAQTGMLLKPGMIFTIEPMINAGKAATSVLSDGWT
FT                   VVTKDRSLSAQWEHTIAVTESGYDLLTPWPEGTGEYEAI"
FT   gene            complement(367795..368100)
FT                   /locus_tag="YP_0351"
FT                   /old_locus_tag="YP0351"
FT   CDS_pept        complement(367795..368100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0351"
FT                   /old_locus_tag="YP0351"
FT                   /product="hypothetical protein"
FT                   /note="similar to Yersinia pestis CO92 YPO3336 and Yersinia
FT                   pestis KIM y0853."
FT                   /db_xref="EnsemblGenomes-Gn:YP_0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60624"
FT                   /db_xref="InterPro:IPR021831"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B8C2"
FT                   /protein_id="AAS60624.1"
FT                   /translation="MILIYGNIRYIYVSYRCCMGIVKISDLMHENLRIASHAMSRSINS
FT                   QAEHWLKIGMLAELYPQLSHHELARALVQVELQGGADIAKMIYPDALTLNNGEKAQ"
FT   gene            complement(368229..369872)
FT                   /gene="fumA"
FT                   /locus_tag="YP_0352"
FT                   /old_locus_tag="YP0352"
FT   CDS_pept        complement(368229..369872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fumA"
FT                   /locus_tag="YP_0352"
FT                   /old_locus_tag="YP0352"
FT                   /product="fumarate hydratase, class I"
FT                   /note="similar to Yersinia pestis CO92 fumA and Yersinia
FT                   pestis KIM fumA. Contains Fumarate lyase
FT                   (Interpro|IPR000362, (GO:0003824)). Contains Fe-S type
FT                   hydro-lyases tartrate/fumarate alpha region
FT                   (Interpro|IPR004646, (GO:0016829)). Contains Fe-S type
FT                   hydro-lyases tartrate/fumarate beta region
FT                   (Interpro|IPR004647, (GO:0016829))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60625"
FT                   /db_xref="GOA:A0A2S9PMB7"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR011167"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PMB7"
FT                   /protein_id="AAS60625.1"
FT                   /translation="MSNKPFHYQDPFPLKEDDTEYYLVSDKHVSVAQFEGHDILKVEPE
FT                   ALTLLAQQAFHDASFLLRPAHQKQVAAILDDPEASENDKYVALQFLRNSEISAKGILPT
FT                   CQDTGTAIIMGKKGQRVWTGGNDAEALSRGVYNTFIEDNLRYSQNAALDMYKEVNTGTN
FT                   LPAQIDLYSTEGEEYKFLFVTKGGGSANKTYLYQETKALLTPGRLKAFLVEKMRTLGTA
FT                   ACPPYHIAFVIGGTSAESTLKTVKLASTKYYDGLPTEGNEHGQAFRDTALEQELLEAAQ
FT                   DLGLGAQFGGKYFAHDVRVVRLPRHGASCPVGMGVSCSADRNIKGKINRKGIWLEKLEQ
FT                   NPGKYIPEHLRHSTEGQVVKIDLNRPMPEILKELSQYPVSTRLSLSGTIIVGRDIAHAK
FT                   LKERLDNGEGLPQYIKDHPIYYAGPAKTPEGYASGSLGPTTAGRMDSYVDLLQSHGGSM
FT                   IMLAKGNRSQQVTDACHKHGGFYLGSIGGPAAVLAQNSIKSLECVEYPELGMEAIWKIE
FT                   VEDFPAFILVDDKGNDFFQQIQAAKCNRCG"
FT   gene            complement(370270..371766)
FT                   /gene="sgbK"
FT                   /locus_tag="YP_0353"
FT                   /old_locus_tag="YP0353"
FT   CDS_pept        complement(370270..371766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sgbK"
FT                   /locus_tag="YP_0353"
FT                   /old_locus_tag="YP0353"
FT                   /product="putative L-xylulose kinase"
FT                   /note="similar to Yersinia pestis CO92 sgbK and Yersinia
FT                   pestis KIM lyxK. Contains Carbohydrate kinase, FGGY
FT                   (Interpro|IPR000577, (GO:0005975))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60626"
FT                   /db_xref="GOA:A0A380PGD4"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A0A380PGD4"
FT                   /protein_id="AAS60626.1"
FT                   /translation="MSHYFLGIDLGGTVTKAGIYTADGSEIAVTEQALPVLSPQAGFCE
FT                   RDMEALWIATCQVIRQTLNKACALSEYHIAAENIGGISFSAHGKGLYLVDKQGLPVRNG
FT                   IVSSDSRAQKLVNRWQQEGKDHAAYERSLQQLWPSHPAALLRWLKENEPENYQRSGYVL
FT                   MVHDYIRYRLTGEFTIEETNISGSNLYNQYNGSFDPQLMAIFAIEEVMEKTAPIIGSAD
FT                   LAGHVSEDAANACGLKAGTPVFGGMFDVVGAALTSGLHDSRQLSAVAGTWSIATRIFEA
FT                   ITPSEYPYVWGKYCIPGTYFVHEGSPTSASNLAWFVKQFLPELPNSYQTLNQWAALGYE
FT                   KSEDILFFPWLYGSNHSANLSGGLLGLSGHHNIEDIVYAIYQGVVFSHLLHQDKILALD
FT                   DTIDCIRFTGGPTHSAIWMQMFCDASNLPLEIVDIQQSGCRAAALCAAVGSHYYHGFEE
FT                   AIRACPPPITRLLPNAEKHQRLRARFDKFKQVAEALSTVM"
FT   gene            complement(371777..372658)
FT                   /gene="sgbU"
FT                   /locus_tag="YP_0354"
FT                   /old_locus_tag="YP0354"
FT   CDS_pept        complement(371777..372658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sgbU"
FT                   /locus_tag="YP_0354"
FT                   /old_locus_tag="YP0354"
FT                   /product="putative hexulose-6-phosphate isomerase"
FT                   /note="similar to Yersinia pestis CO92 sgbU and Yersinia
FT                   pestis KIM sgbU. Contains Putative hexulose-6-phosphate
FT                   isomerase (Interpro|IPR004560, (GO:0005975), (GO:0016861))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60627"
FT                   /db_xref="GOA:A0A3N4BUP5"
FT                   /db_xref="InterPro:IPR004560"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BUP5"
FT                   /protein_id="AAS60627.1"
FT                   /translation="MRIHPLGIYEKALPAGTSWVEKLAVAKSCGFDFVEMSVDESDERL
FT                   ARLDWSREERMAVISAIQQTGVRIPTLCLSAHRRYPFGSRDATTREQAHTVMLQAIRLA
FT                   QDLGIRTIQLAGYDVYYEPQDSETIARFEAGIAWAVKQAAAAQVMCAVEIMDTQFMNSI
FT                   SKWKALDNKIGSPWFTVYPDIGNLTAWGNEVNSELAKGIDRIAAIHLKDTFAVTADSPG
FT                   QFRDVPFGEGCVDFVNLFKTLRRLNYRGTFLIEMWTEKAAEPLLEIIHARHWIEDKMRL
FT                   AGWDNESGQLTR"
FT   gene            complement(372864..373901)
FT                   /gene="araH1"
FT                   /locus_tag="YP_0355"
FT                   /old_locus_tag="YP0355"
FT   CDS_pept        complement(372864..373901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araH1"
FT                   /locus_tag="YP_0355"
FT                   /old_locus_tag="YP0355"
FT                   /product="putative sugar ABC transporter, permeaseprotein"
FT                   /note="similar to Yersinia pestis CO92 YPO3332 and Yersinia
FT                   pestis KIM y0857. Contains ATP/GTP-binding site motif A
FT                   (P-loop) (Interpro|IPR001687, (GO:0005524)). Contains
FT                   Bacterial inner-membrane translocator (Interpro|IPR001851,
FT                   (GO:0016020)). Contains Sodium:dicarboxylate symporter
FT                   (Interpro|IPR001991, (GO:0016020))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60628"
FT                   /db_xref="GOA:A0A0H2W1G4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W1G4"
FT                   /protein_id="AAS60628.1"
FT                   /translation="MKKNRFLPIDGTISGLLGIFCLATLAFSLAMPGRFFTENTFLSIA
FT                   FQLPELGLLTFAMFVPMLSGGLNLSIIGTANLTSLFMAWLLIQYVPADASTTTQLMWLL
FT                   LALMGAALIAVVIGTLTGLMIARIGAHPILVTLGSMTIISSIGVYLTKGAALSGMPPIV
FT                   RSMGSEVVMGVPIPMIIFIVASLLLALFLGKTRLGKTIYMCGSNINATWFSGIRTDRVM
FT                   MAIYTMSSLLCVLAGLIMMSRFNSARMGYGDSYLLLTVLAIVLGGTNPFGGVGKVSHVF
FT                   CALLVLQVIATGLSLLGVSLHVNLAVWGITLIFALAFKFFKEKWKAKRAMRQNRLNYLK
FT                   KCHAK"
FT   gene            complement(373914..374903)
FT                   /gene="araH2"
FT                   /locus_tag="YP_0356"
FT                   /old_locus_tag="YP0356"
FT   CDS_pept        complement(373914..374903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araH2"
FT                   /locus_tag="YP_0356"
FT                   /old_locus_tag="YP0356"
FT                   /product="putative sugar ABC transporter, permease protein"
FT                   /note="similar to Yersinia pestis CO92 YPO3331 and Yersinia
FT                   pestis KIM y0858. Contains Bacterial inner-membrane
FT                   translocator (Interpro|IPR001851, (GO:0016020)). Contains
FT                   Sodium:dicarboxylate symporter (Interpro|IPR001991,
FT                   (GO:0016020))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60629"
FT                   /db_xref="GOA:A0A0H2W1B7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W1B7"
FT                   /protein_id="AAS60629.1"
FT                   /translation="MANFGRLKPQSVEGWLAWVIVLMLALFSLLSREFLSIQNVLDLAE
FT                   SYAVTGIFALGLFVVLVTGGIDISFAAVASVVQYVVASLLLNDVIASPVLCLVIAVAIG
FT                   VLLGFVNAVLIYYLNIVSIIITISMQSLLFGMLMWLTNGHSIYDLPNWWVDQRSILPFT
FT                   VNGESYQIGLPLVIMLAIALLTWILLNKTHIGRQLYAVGGSPESARRIGIRVSLIYLFA
FT                   YGYLGAAAAIGGMLQTYRMSEVVPSALVGGELDVLAAAVLGGASLSSGRGSVIGTLMGV
FT                   FLIGILKNGLNLIGVSSYFVNIVIGMVIVAAICVTHYKKRKETDVGFV"
FT   gene            complement(374896..376410)
FT                   /gene="mglA1"
FT                   /locus_tag="YP_0357"
FT                   /old_locus_tag="YP0357"
FT   CDS_pept        complement(374896..376410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mglA1"
FT                   /locus_tag="YP_0357"
FT                   /old_locus_tag="YP0357"
FT                   /product="putative sugar ABC transporter, ATP-binding
FT                   protein"
FT                   /note="similar to Yersinia pestis CO92 YPO3330. Contains
FT                   ATP/GTP-binding site motif A (P-loop) (Interpro|IPR001687,
FT                   (GO:0005524)). Contains ABC transporter
FT                   (Interpro|IPR003439, (GO:0016020)). Contains AAA ATPase
FT                   (Interpro|IPR003593, (GO:0000166))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60630"
FT                   /db_xref="GOA:A0A2S9PMC8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PMC8"
FT                   /protein_id="AAS60630.1"
FT                   /translation="MTHISDVDRDVPLITLKALSKSFGGHQALKNITLTLNKGEVHCLA
FT                   GANGCGKSTLIKTISGVYAPDDGSEIIIDEKSYHRLTPDRARALGVQVIYQDLSLFPNL
FT                   TVAENIAFEYNLKGYFGWFNKQKIKQKACQILHELAFSLDPDALVQHLPIAQRQQVAIC
FT                   RALVADARLVIMDEPTASLTRTEVNQLLRTVNYLRDKHITVVFVSHRLDEVKEISDRIT
FT                   VIRDGEKVGTWPATELSTGRITELMTGLTLTHEQKLPNAELGKVVLQLENLSRKGQFDD
FT                   ISFSLHRGEVLGLCGLLGSGRTELALSLFGITHPDSGKITIDGNPVCIKDNTRAIELGI
FT                   GYVSEDRLTLGAVLQQSIADNMVLSILQRIRTPLYLVDDAKQNALVQEWVKDLDIKITD
FT                   ADNALSTLSGGNQQKVVLAKWILTKPKVLILDSPTVGVDIGAKDSIYKLIHRLSGVGIS
FT                   VLLLSDEIPEAYYNCDRILHMQQGRIVNELIPNQMTEQQLAEVING"
FT   gene            complement(376559..377662)
FT                   /gene="rbsB1"
FT                   /locus_tag="YP_0358"
FT                   /old_locus_tag="YP0358"
FT   CDS_pept        complement(376559..377662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsB1"
FT                   /locus_tag="YP_0358"
FT                   /old_locus_tag="YP0358"
FT                   /product="putative sugar ABC transporter, periplasmic
FT                   protein"
FT                   /note="similar to Yersinia pestis CO92 YPO3328 and Yersinia
FT                   pestis KIM y0861. Contains Periplasmic binding protein/LacI
FT                   transcriptional regulator (Interpro|IPR001761)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60631"
FT                   /db_xref="GOA:A0A3N4BA32"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR030159"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BA32"
FT                   /protein_id="AAS60631.1"
FT                   /translation="MHQKIAIQQKQANLLYINIIKPALPIALSEDVMMRKLILPCLITT
FT                   LLASHAAWSADSNTPQKANKPFTLGVVVKVGGIPWFNVMEQGIKAEGQALGVNAWQVGP
FT                   TTADPAEQVRAIEDLIAKKVDVIGVVPNDAKVLEPVLKRAQEAGIKVITHESPGQINAD
FT                   WDFELLDTQSMGANHMKDMAQCMGEEGKYAMFVGSLTVPLVNEWADAAIAYQKANYPKM
FT                   VLVEDRFGVAESVDDSMRTANDLLSKHKDLKGIMSFGSQGPIGAGRAIDKRKKNDTTCV
FT                   FGTFTPGQGIKLLEKGAIDGGYISNPMVAGKVFVQVATAMMNGEPIKDGVKLGDMGEIK
FT                   TQGNTILSDNPEKLDIENTKRLVKLGL"
FT   gene            complement(377724..378533)
FT                   /gene="glpR2"
FT                   /locus_tag="YP_0359"
FT                   /old_locus_tag="YP0359"
FT   CDS_pept        complement(377724..378533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpR2"
FT                   /locus_tag="YP_0359"
FT                   /old_locus_tag="YP0359"
FT                   /product="putative deoR-family regulatory protein"
FT                   /note="similar to Yersinia pestis CO92 YPO3327 and Yersinia
FT                   pestis KIM y0862. Contains Bacterial regulatory protein,
FT                   DeoR family (Interpro|IPR001034, (GO:0006355))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60632"
FT                   /db_xref="GOA:A0A0H2W2S3"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W2S3"
FT                   /protein_id="AAS60632.1"
FT                   /translation="MLQAERHKIICTHVQQQGSALVTELSVLCQVSQETIRRDLTVLQK
FT                   KQKLIRSFGGAVALDSPEIPVIDIKEIHDGLNVIDRAESFRKRTEEHPDTKMKIAKAAL
FT                   QFIRPGDCILLDNSSSCWFLARQIPDIEITVVTNSVKIIQALACRDKVRIIGIGGEYSA
FT                   RHDDFHGPVAENAIRNFQINTFFFSCQGINQDSGVRDGNDINAKLKQVMLQVSGQKILL
FT                   ADSSKFDQYAFCKICTLDEVDILITNRLSSQNYRSDNPKLNIIESDK"
FT   gene            379161..379931
FT                   /gene="araD1"
FT                   /locus_tag="YP_0360"
FT                   /old_locus_tag="YP0360"
FT   CDS_pept        379161..379931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araD1"
FT                   /locus_tag="YP_0360"
FT                   /old_locus_tag="YP0360"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /note="similar to Yersinia pestis KIM araD. Contains Class
FT                   II aldolase/adducin, N-terminal (Interpro|IPR001303)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60633"
FT                   /db_xref="GOA:A0A1U8QYT9"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR004661"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1U8QYT9"
FT                   /protein_id="AAS60633.1"
FT                   /translation="MTSFEYRMMFFIIACPSEYYFMRCTMLEQLKQQVFEANLALPKYK
FT                   LVTFTWGNVSGIDREHGLVVIKPSGVEYDVMSVNDMVVVDLATGKVVEGDKKPSSDTDT
FT                   HLVLYRAFAEIGGIVHTHSRHATIWAQAGKSLSALGTTHADYFYGPIPCTRLMTEAEIT
FT                   GDYEHETGKVIVETFAEQGLRAADIPAVLVNGHGPFAWGSNAANAVHNAVVLEEIAYMN
FT                   LFTHQLTPGVGDMQQTLLDKHYLRKHGAAAYYGQ"
FT   gene            380373..382844
FT                   /gene="dmsA1"
FT                   /locus_tag="YP_0361"
FT                   /old_locus_tag="YP0361"
FT   CDS_pept        380373..382844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dmsA1"
FT                   /locus_tag="YP_0361"
FT                   /old_locus_tag="YP0361"
FT                   /product="anaerobic dimethyl sulfoxide reductase subunit A"
FT                   /note="similar to Yersinia pestis KIM dmsA. Contains
FT                   Twin-arginine translocation pathway signal
FT                   (Interpro|IPR006311). Contains Prokaryotic molybdopterin
FT                   oxidoreductase (Interpro|IPR006655, (GO:0006118)). Contains
FT                   Molybdopterin oxidoreductase (Interpro|IPR006656). Contains
FT                   Molydopterin dinucleotide binding domain
FT                   (Interpro|IPR006657). Contains Molybdopterin oxidoreductase
FT                   Fe4S4 domain (Interpro|IPR006963). Contains Twin-arginine
FT                   translocation pathway signal (Interpro|IPR006311). Contains
FT                   Prokaryotic molybdopterin oxidoreductase
FT                   (Interpro|IPR006655, (GO:0006118)). Contains Molybdopterin
FT                   oxidoreductase (Interpro|IPR006656). Contains Molydopterin
FT                   dinucleotide binding domain (Interpro|IPR006657). Contains
FT                   Molybdopterin oxidoreductase Fe4S4 domain
FT                   (Interpro|IPR006963)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60634"
FT                   /db_xref="GOA:A0A1U8QW44"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR011888"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1U8QW44"
FT                   /protein_id="AAS60634.1"
FT                   /translation="MQLSGNLMKETNESRLLTTGVTRRKLVQTTLVGGLAMATGAFSLP
FT                   FSRTARAVQSALNPTSANDGKVIWSACTVNCGSRCPLRMHVADGEIKYVETDNTGDDDF
FT                   EGLHQVRACLRGRSMRRRVYNPDRLKYPMKRIGARGEGKFKRISWEEAFETIAGSMQNI
FT                   IKEYGNEAIYLNYGTGTIGGTMTRSWPPGATLLARLMNCCGGYLNQYGDYSTAQIAAGL
FT                   NYTYGGWADGNSPSDIENSKLVVLFGNNPAETRMSGGGVTYYLEQAREKSNAKMIVIDP
FT                   RYTDTAAGREDEWIPLRPGTDAALASALAYVMITENLVDQPFLDQYCVGYDEKTLPEGA
FT                   PENSHYKAYILGQGADKTAKTPQWAAAITGIPAAKIITLGREIGSVKPAYISQGWGPQR
FT                   HSNGENTSRAIAMLAILTGNVGINGGNSGAREGSYSLPFVRMPTFENPVKTSISMFLWT
FT                   DAIERGPEMTATRDGVQGKDKLDVPIKFIWNYASNCLVNQHSEINRTHDILQDDKKCEM
FT                   IVVIDNHMTSSAEYADIILPDCTASEQMDFCLDASSGNMAYVIFADQVIKPRFECKNIY
FT                   DITSGLARHMGVEQKFTEGRTQEEWMRHLYQQSQAAIPELPSFEDFRAQGMFKKRDPAG
FT                   HHVAYHDFRTDPVANPLSTPSGKIEIYSAALAEIAATWELQKDDVIDPLPVYAAGFESH
FT                   VDPLIEQYPLQLTGFHYKARTHSTYGNVDVLKASCLQEMWINPMDAERRGISNGDMVRI
FT                   FNGRGEVQINAKVTPRMMPGVVALGEGAWYSPDAKRIDRAGSINVLTTQRPSPLAKGNP
FT                   SHTNLVQVAKA"
FT   gene            382856..383473
FT                   /gene="dmsB1"
FT                   /locus_tag="YP_0362"
FT                   /old_locus_tag="YP0362"
FT   CDS_pept        382856..383473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dmsB1"
FT                   /locus_tag="YP_0362"
FT                   /old_locus_tag="YP0362"
FT                   /product="anaerobic dimethyl sulfoxide reductase chain B"
FT                   /note="similar to Yersinia pestis CO92 dmsB and Yersinia
FT                   pestis KIM dmsB. Contains Cytochrome c heme-binding site
FT                   (Interpro|IPR000345, (GO:0006118)). Contains 7Fe ferredoxin
FT                   (Interpro|IPR000813, (GO:0006118), (GO:0009497)). Contains
FT                   3Fe-4S ferredoxin (Interpro|IPR001080, (GO:0006118),
FT                   (GO:0009497)). Contains 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain (Interpro|IPR001450, (GO:0006118),
FT                   (GO:0009497)). Contains 7Fe ferredoxin (Interpro|IPR000813,
FT                   (GO:0006118), (GO:0009497)). Contains 3Fe-4S ferredoxin
FT                   (Interpro|IPR001080, (GO:0006118), (GO:0009497)). Contains
FT                   4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   (Interpro|IPR001450, (GO:0006118), (GO:0009497))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60635"
FT                   /db_xref="InterPro:IPR014297"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B5I5"
FT                   /protein_id="AAS60635.1"
FT                   /translation="MTTQYGFYIDSSRCTGCKTCELACKDFKNLSPDVSFRRIYEYAGG
FT                   DWQQDNGTWHQNVFAYYLSIACNHCSDPACTKVCPSGAMHKRDDGFVVVNEDICIGCRY
FT                   CHMACPYGAPQYDAEKGHMTKCDGCYERVAVGKKPICVDSCPLRALDMAPIDELREKYG
FT                   DLAEIAPLPAAHFTLPNIVLKPNANSRPVRDTTGHLANPKEV"
FT   gene            383412..384335
FT                   /gene="dmsC1"
FT                   /locus_tag="YP_0363"
FT                   /old_locus_tag="YP0363"
FT   CDS_pept        383412..384335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dmsC1"
FT                   /locus_tag="YP_0363"
FT                   /old_locus_tag="YP0363"
FT                   /product="anaerobic dimethyl sulfoxide reductase subunit C"
FT                   /note="similar to Yersinia pestis KIM dmsC. Contains
FT                   Ribosomal protein S2 (Interpro|IPR001865, (GO:0006412)).
FT                   Contains DMSO reductase anchor subunit (DmsC)
FT                   (Interpro|IPR007059)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60636"
FT                   /db_xref="GOA:Q8D190"
FT                   /db_xref="InterPro:IPR007059"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D190"
FT                   /protein_id="AAS60636.1"
FT                   /translation="MPTAARSEIPPVIWQTRRRYNMGSGWHEWPLMVFTVLGQCVVGGF
FT                   IVLGLALIFGGLSRGQQQRVHRSMFVLWVLMALAFIASTLHLGSPMRAFNSLNRIGESA
FT                   LSNEIAAGSLFFAVAGFYWLLAVLDKMPAALGKIWLVVAMVLGVIFVYAMCRVYSINTV
FT                   PTWDSIYTPLGFVLTTLIGGPLLGYLLLQLADVNGRAMLQLPMISVLALIISVASVIMQ
FT                   AASLPLIYSSVQQASALIPDYGSLMVWRLVLLVLGLGCWICPLIRGRRPMTLVMVLGTL
FT                   LVIAGELIGRGVFYGLHMTVGMAVGG"
FT   gene            384481..385191
FT                   /gene="torD1"
FT                   /locus_tag="YP_0364"
FT                   /old_locus_tag="YP0364"
FT   CDS_pept        384481..385191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="torD1"
FT                   /locus_tag="YP_0364"
FT                   /old_locus_tag="YP0364"
FT                   /product="putative component of anaerobic dehydrogenases"
FT                   /note="similar to Yersinia pestis CO92 YPO3322 and Yersinia
FT                   pestis KIM y0867"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60637"
FT                   /db_xref="GOA:A0A3N4B5I8"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR026269"
FT                   /db_xref="InterPro:IPR028611"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B5I8"
FT                   /protein_id="AAS60637.1"
FT                   /translation="MIKTDMTYQDIVYKDTVYQDSVYQKIGLTGRVLGALFYCEPDSAE
FT                   CRDIVVQLRNGTWAAEWPYGGADELMPIATLLAAAQSDQYQSIAHQSAAAPLAETLEEA
FT                   WQRLFIGPYALPAPPWGSVYLDKDMVLFGDSTLKLRNWMQQRHVEVTLKQQEPEDHFGL
FT                   LMMMAAWLAEHQPVDLPVLLADHLLPWSYRYLALLQSDAGHPFYQGLAQLTTLTLAHWQ
FT                   HELQVTPAGVELYR"
FT   gene            complement(385448..386011)
FT                   /gene="cybB1"
FT                   /locus_tag="YP_0365"
FT                   /old_locus_tag="YP0365"
FT   CDS_pept        complement(385448..386011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cybB1"
FT                   /locus_tag="YP_0365"
FT                   /old_locus_tag="YP0365"
FT                   /product="putative cytochrome B561"
FT                   /note="similar to Yersinia pestis CO92 cybB and Yersinia
FT                   pestis KIM cybB. Contains Nickel-dependent hydrogenase
FT                   b-type cytochrome subunit (Interpro|IPR000516,
FT                   (GO:0016020), (GO:0016491))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60638"
FT                   /db_xref="GOA:Q9X6B2"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9X6B2"
FT                   /protein_id="AAS60638.1"
FT                   /translation="MKGDGYISGKHMHKKYSCLQIGIHWLVLLLVIIAWSSIELRGFAP
FT                   RSYQPWMKMIHFSCGIAILVLMMTRILIQLRYPTPPIVPKPSPMIVGLAHVGHWVIYLL
FT                   FIALPIIGIAILYCRGSSWIAFGLIMPHAEQANFDLADTLKAYHLLLANMSYFVIGLHA
FT                   LAALLHHYVLKDNTLLRMMPKKRG"
FT   gene            complement(386126..386509)
FT                   /gene="cybC"
FT                   /locus_tag="YP_0366"
FT                   /old_locus_tag="YP0366"
FT   CDS_pept        complement(386126..386509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cybC"
FT                   /locus_tag="YP_0366"
FT                   /old_locus_tag="YP0366"
FT                   /product="putative cytochrome B562"
FT                   /note="similar to Yersinia pestis CO92 cybC"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60639"
FT                   /db_xref="GOA:Q9X6B1"
FT                   /db_xref="InterPro:IPR009155"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9X6B1"
FT                   /protein_id="AAS60639.1"
FT                   /translation="MRKIPIIAGVFSLLITSCTFAASLQDDMNILIANLGIVSSSTDTK
FT                   VITSSLEKMRNAALDAQKAIPPKLEGKAEDSPEIKDYRHGFDLLIEQIDKTKQWAEEGN
FT                   IQEVKKSVGEVINIRNTYHSRYR"
FT   gene            complement(386586..388841)
FT                   /gene="katG"
FT                   /locus_tag="YP_0367"
FT                   /old_locus_tag="YP0367"
FT   CDS_pept        complement(386586..388841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="katG"
FT                   /locus_tag="YP_0367"
FT                   /old_locus_tag="YP0367"
FT                   /product="catalase"
FT                   /note="similar to Yersinia pestis KIM katG. Contains
FT                   Bacterial haem catalase/peroxidase (Interpro|IPR000763,
FT                   (GO:0006979)). Contains Haem peroxidase
FT                   (Interpro|IPR002016, (GO:0006804)). Contains
FT                   Calcium-binding EF-hand (Interpro|IPR002048, (GO:0005509)).
FT                   Contains Plant ascorbate peroxidase (Interpro|IPR002207,
FT                   (GO:0006804)); hydroperoxidase HPI(I)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60640"
FT                   /db_xref="GOA:Q9X6B0"
FT                   /db_xref="InterPro:IPR000763"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019793"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9X6B0"
FT                   /protein_id="AAS60640.1"
FT                   /translation="MLKNSCLLVKGDLYMLKKILPVLITLAIVHNTPTAWAAEAPKTDS
FT                   FYLPKSLDLSPLRLHNIESNPYGKDFNYAQQFKTLDLEAVKKDIKTVLTTSQDWWPADY
FT                   GNYGPFFIRMAWHGAGTYRIYDGRGGADGGQQRFEPLNSWPDNANLDKARRLLWPIKKK
FT                   YGAKISWGDLMVLTGNVALESMGFKTLGFAGGREDDWQSDLVYWGAGNKMLSDNRDKNG
FT                   KLPKPLAATQMGLIYVNPEGPNGKPDPVAAAKDIREAFARMAMNDEETVALIAGGHTFG
FT                   KAHGAASPEKCLGAAPGEAGLEQQGLGWANKCGSGNGKDTITSGLEGAWTTDPTHFTMQ
FT                   YLSNLYKHEWVLTKSPAGAWQWKPKNAANVVPDATDPTKFHPLMMFTTDIALKVDPEYK
FT                   KITTRFLENPEEFKMAFARAWFKLTHRDMGPAARYLGDEVPKETFIWQDPLPAANYKMI
FT                   DSADISELKDKILKTGLSDTKLIKTAWASASTFRGTDFRGGDNGARIRLAPQKDWPVND
FT                   PAELHSVLAALMEVQNNFNKDRSDGKKVSLSDLIVLGGNAAIEDAAKKAGYSISIPFTP
FT                   GRTDASQEETDVSSFAVLEPTADGFRNYYDAKRNTLSPIASLIDRANKLELTVPEMTVL
FT                   IGGLRVLDVNSGGSKAGVLTNTPGQLNNNFFVNLLDMSTKWTKSPKAEGYFDGYDRKTG
FT                   KLKWTASSVDLVFGSNPELRAVAEVYASDDAKEKFVHDFTKVWEKVMNLDRFDIKNN"
FT   gene            389320..390276
FT                   /gene="rbsB2"
FT                   /locus_tag="YP_0368"
FT                   /old_locus_tag="YP0368"
FT   CDS_pept        389320..390276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsB2"
FT                   /locus_tag="YP_0368"
FT                   /old_locus_tag="YP0368"
FT                   /product="putative sugar ABC transporter, periplasmic
FT                   protein"
FT                   /note="similar to Yersinia pestis CO92 YPO3318 and similar
FT                   to Yersinia pestis KIM y0871. Contains Periplasmic binding
FT                   protein/LacI transcriptional regulator
FT                   (Interpro|IPR001761)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60641"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W1H3"
FT                   /protein_id="AAS60641.1"
FT                   /translation="MRRKIMKNTLLKSCLTAALISMAGVAGAASNGLIAIITPSHDNPF
FT                   FKAEAEGAKAKATELGYTTLVASHDDDVNKQNQLIETAIARKAKAIILDNAGSDATIGP
FT                   LKKAKAAGIPAFLIDREINETGIAVSQIVSNNYQGAQLGAEKFVTLMGGKGKYIELLGR
FT                   ESDTNAHVRSQGYHDVIDEHSDMKMVAQQTANWSQTEAFNRMESILQANPDITGVISGN
FT                   DTMALGAEAALKAAGRNDVVVVGFDGSDYVRDSIINNGNIKATVLQPGWAQAQMAVVQA
FT                   DQYLKTGKTGLEEKQLMDCVLIDENNAKNLNVFALKD"
FT   gene            390369..390986
FT                   /locus_tag="YP_0369"
FT                   /old_locus_tag="YP0369"
FT   CDS_pept        390369..390986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0369"
FT                   /old_locus_tag="YP0369"
FT                   /product="putative lipoprotein"
FT                   /note="similar to Yersinia pestis CO92 YPO3317 and Yersinia
FT                   pestis KIM y0872"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60642"
FT                   /db_xref="InterPro:IPR014582"
FT                   /db_xref="InterPro:IPR036215"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B7E5"
FT                   /protein_id="AAS60642.1"
FT                   /translation="MRFRAISKAGALLMISAVLVACTVVDLDENGKPILPVDPNAVVSD
FT                   YNQTPDKVAATIWAKNVMPFANSNAISWQEVKQQQSQPAVGKNNQSRFVRFTGKVVAVE
FT                   TEGREGLIRLAIDGDEQVLQLGPIVKGNAIRDASTFIRFDDFKNQVQYAQLAKALSLRA
FT                   LQEVAKPDASWIGQQVEVLAAVTLTPTSLSNGVPLSLNKESH"
FT   gene            390986..392509
FT                   /gene="mglA2"
FT                   /locus_tag="YP_0370"
FT                   /old_locus_tag="YP0370"
FT   CDS_pept        390986..392509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mglA2"
FT                   /locus_tag="YP_0370"
FT                   /old_locus_tag="YP0370"
FT                   /product="putative sugar ABC transporter, ATP-binding
FT                   protein"
FT                   /note="similar to Yersinia pestis CO92 YPO3316 and Yersinia
FT                   pestis KIM y0873. Contains ATP/GTP-binding site motif A
FT                   (P-loop) (Interpro|IPR001687, (GO:0005524)). Contains
FT                   ATP-dependent serine protease, Lon family
FT                   (Interpro|IPR001984, (GO:0006508)). Contains ABC
FT                   transporter (Interpro|IPR003439, (GO:0016020)). Contains
FT                   AAA ATPase (Interpro|IPR003593, (GO:0000166))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60643"
FT                   /db_xref="GOA:A0A380PGL4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A380PGL4"
FT                   /protein_id="AAS60643.1"
FT                   /translation="MNHRPDIVMRAEDISMRFPGTLALDSVNYTVYRGKVNVIIGENGA
FT                   GKSTLMKILAGVQQQTSGQIYLNGQKVSIANTREAAALGIGMVHQELNLSENLNVAENI
FT                   FLGREIQHGLKPINQAAQERVTEQLMVRLDQVISPQEKVSNLKVGQQQLIEIAKALAEQ
FT                   ADILILDEPTSALSKTEVDVLFRVIRELTRQGVSIVYISHRLEELMAIGDYITILRDGR
FT                   FQAEAAVKDIDVPWIVREMLGSDPVSSFLRPGRTFGEPMMEVEDVTLINESGNTVVNHV
FT                   SLHVRAGEIVGIYGLMGAGRTELFECLLGTQQNYLGTVRLNGTVMNAKTSTAERIRFGM
FT                   SLVPEDRKKAGIFPASSVACNLTISSLWRRLKHRFAIWQESEVQVVAATIGELSIKVSS
FT                   PDVEIQALSGGNQQKVVIGRSLLTRPNILLLDEPTRGIDVGAKADVFEMMVKLSEQGIG
FT                   ILFSTSDLKEIMAVSDRILVMSNGKLTANLSRQSASESALVTASAQGFE"
FT   gene            392506..393651
FT                   /gene="araH3"
FT                   /locus_tag="YP_0371"
FT                   /old_locus_tag="YP0371"
FT   CDS_pept        392506..393651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araH3"
FT                   /locus_tag="YP_0371"
FT                   /old_locus_tag="YP0371"
FT                   /product="putative sugar ABC transporter, permease protein"
FT                   /note="similar to Yersinia pestis CO92 YPO3315 and Yersinia
FT                   pestis KIM rbsC. Contains Bacterial inner-membrane
FT                   translocator (Interpro|IPR001851, (GO:0016020))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60644"
FT                   /db_xref="GOA:A0A3N4B5H3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B5H3"
FT                   /protein_id="AAS60644.1"
FT                   /translation="MMKATTGTALASHLPGGASWSRENMLLLLLKMRTFIALFLILGFF
FT                   SIMVPGFLATGSLIIMVKHIAINAFLALGITFVIITAGIDLSIGATLGLCGMIAGWMIT
FT                   QGIVLPMFGIAIFPSVWVVVPVVLVIGALIGAVNGWIITRYNVAPFICTLGTMYVVRGA
FT                   SMLISGGETFPGLQGNPQLGNTGFDLLGSGTLLGLPIAIWIMFILALVIAYVARRLPFG
FT                   RHVYAIGDNERAAELSGVKVRQVKVWVYTLSGFCAAIAGIIVSAQLVASHPANGSGFEM
FT                   NAIAAVVLGGTSLAGGRGTILGTLIGAFVIGILADGLVMMGISEFWQMVIKGIVIIVAV
FT                   IIDQMQNRMQHKAAIVSQKVTAIPSDVTSQAGIISQTVKSE"
FT   gene            393897..394727
FT                   /gene="tktA1"
FT                   /locus_tag="YP_0372"
FT                   /old_locus_tag="YP0372"
FT   CDS_pept        393897..394727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tktA1"
FT                   /locus_tag="YP_0372"
FT                   /old_locus_tag="YP0372"
FT                   /product="putative N-terminal region of transketolase"
FT                   /note="similar to Yersinia pestis CO92 YPO3314. Contains
FT                   Transketolase, N terminal (Interpro|IPR005474)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60645"
FT                   /db_xref="GOA:A0A2S9PM95"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PM95"
FT                   /protein_id="AAS60645.1"
FT                   /translation="MNPYSLSIDELVRKARAIRRRIVLLNANSPAGGHTGADLSQVEIL
FT                   TALYFRILNCAPERLTDPERDIYVQSKGHAVGGYYCCLAEARYFPEEWLATYQRADSHL
FT                   PGHPVKHKTPGIELNTGALGHGLPVAVGIALAAKRANSKRRVFVLTGDGELAEGSNWEA
FT                   ALVAAHYQLDNLVIINDKNKLQLAGTTKSIMNTDPLADKWRAFGLQVTECRGNDMQSVV
FT                   ETLETLPQNGKPNVVIANTEKGAGISFIQGRVEWHHRVPKGAEIDLALEELNDE"
FT   gene            394720..395664
FT                   /gene="tktA2"
FT                   /locus_tag="YP_0373"
FT                   /old_locus_tag="YP0373"
FT   CDS_pept        394720..395664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tktA2"
FT                   /locus_tag="YP_0373"
FT                   /old_locus_tag="YP0373"
FT                   /product="C-terminal region of transketolase"
FT                   /note="similar to Yersinia pestis CO92 YPO3313. Contains
FT                   Transketolase, central region (Interpro|IPR005475).
FT                   Contains Transketolase, C terminal (Interpro|IPR005476)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60646"
FT                   /db_xref="GOA:A0A2S9PM93"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PM93"
FT                   /protein_id="AAS60646.1"
FT                   /translation="MSNAEHLASVMVEQFIKAVDNGVDLVPVVADSTSTAKIGPFITRF
FT                   PDRVVNVGIAEQAMVGMAVGLSMGGKIAVTCNAAPFLISRANEQLKIDVCYNNSNVKLF
FT                   GLNSGASYGPLASTHHCIDDIAILRGFGNIEIYAPADPQECRQIIDYALAHQGPVYIRL
FT                   DGKALPPLHDEHYRFAPGQIDVLQEGRDIALVAMGSTVHEAVSAAAILADNNISAAVVN
FT                   VSSIRPCDTQQLFAILQQSQRVITIEEHNINGGVGSLVAEVLAEAGSGTPLVRLGIPDG
FT                   GYAIAADRAEMRAYHGFDAAGIVARALRFCRGE"
FT   gene            395667..397154
FT                   /gene="glpK2"
FT                   /locus_tag="YP_0374"
FT                   /old_locus_tag="YP0374"
FT   CDS_pept        395667..397154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK2"
FT                   /locus_tag="YP_0374"
FT                   /old_locus_tag="YP0374"
FT                   /product="glycerol kinase"
FT                   /note="similar to Yersinia pestis CO92 YPO3312 and Yersinia
FT                   pestis KIM glpK. Contains Carbohydrate kinase, FGGY
FT                   (Interpro|IPR000577, (GO:0005975)). Contains Glycerol
FT                   kinase (Interpro|IPR005999, (GO:0006072)). Contains
FT                   Carbohydrate kinase, FGGY (Interpro|IPR000577,
FT                   (GO:0005975)). Contains ATP/GTP-binding site motif A
FT                   (P-loop) (Interpro|IPR001687, (GO:0005524))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60647"
FT                   /db_xref="GOA:A0A2S9PMC3"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="InterPro:IPR042016"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PMC3"
FT                   /protein_id="AAS60647.1"
FT                   /translation="MSTPIILAIDEGTTNAKAIAVDRAGRVLAKASVPLQLEHPQPGWA
FT                   EQDPLAIWLAVSQAVEGCLNQLAGAQVAGIAISNQRESVLIWERETGTPLTPVVSWQCR
FT                   RSEAFCLALRQLPAAAMVAERTGLQIDPLFPAAKIHGMLAQIPHGAERAAHGELCVGTL
FT                   DCWLTWQFSEGQSFSTDFSNAARTQLFNIHSGQWDPDLLALFGIPSLCLPAVLPSASIH
FT                   GHTARTGILGLEQGVPIVAHIGDSHAALYGQGGDQAGEIKATYGTGSSLMMTLKQASAP
FT                   SHGLSTTIAWHDGELRYALEGNITHTGSGVAWVSRMLGISDLSRLTDMAESQSGNQGVY
FT                   FVPALSGLGAPYWDSQARGLFCGLTDATTPAVLARAALESVAYQIADVFFAMENAAHHR
FT                   LERLRVDGGATSNRWLMQFQADLLQRTLIRNHTAEVSALGAAYLGGKTLGWWQDSQQLA
FT                   ALPREVEYIEPRIHSAEMQDNYSLWQTAIARARFQPK"
FT   gene            397175..398599
FT                   /locus_tag="YP_0375"
FT                   /old_locus_tag="YP0375"
FT   CDS_pept        397175..398599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0375"
FT                   /old_locus_tag="YP0375"
FT                   /product="hypothetical protein"
FT                   /note="similar to Yersinia pestis CO92 YPO3311 and Yersinia
FT                   pestis KIM y0877"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60648"
FT                   /db_xref="GOA:A0A3N4B5K9"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR015888"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B5K9"
FT                   /protein_id="AAS60648.1"
FT                   /translation="MSAIPRKLIFAVIIGNRGFFPSYLVSDARRDAQALFDRLGINIIM
FT                   LNEEQTPLGGVENWHDAKVCAELFRQHSEEIHGVVVILPNFGDEKSVSDAIRLSGLKVP
FT                   VLVQAEEDALDKMGLATRRDSFCGKISLCNNLRQYGIPFTLTKQHVCSLNSEIFSRDVE
FT                   QFVQLCRVVHAMKRVRVGAIGARPTNFNTVRYSEKLLENLGITVETLDLSEVFFRVANL
FT                   SDNDIRVGEKLALLKANGDTSTIPQDKLHKMAKLFVVISEWIIANDIDTTAMQCWTSLQ
FT                   QNLGINVCSIMSVMSGQLMPSACEVDVMGALSMYALASCSLAPASIADWNNNFGAERDK
FT                   CVLFHCGNFASESLESSTMGTADIIGTTVGCENTCGAVHGRMKSGPLTYFRLSSDDFTG
FT                   QVRAYVGEGRSVSDELNTVGCRAVVEVPQLESLLTHICNNGFEHHVAMNHSATAQVLQE
FT                   AFSKYLGVDCYWHGKP"
FT   gene            complement(398821..399765)
FT                   /gene="deoR1"
FT                   /locus_tag="YP_0376"
FT                   /old_locus_tag="YP0376"
FT   CDS_pept        complement(398821..399765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoR1"
FT                   /locus_tag="YP_0376"
FT                   /old_locus_tag="YP0376"
FT                   /product="putative transcriptional regulatory protein"
FT                   /note="similar to Yersinia pestis CO92 YPO3310 and Yersinia
FT                   pestis KIM y0878. Contains Bacterial regulatory proteins,
FT                   AsnC family (Interpro|IPR000485, (GO:0006355)). Contains
FT                   Bacterial regulatory protein, GntR family
FT                   (Interpro|IPR000524, (GO:0006355)). Contains Bacterial
FT                   regulatory protein, Crp family (Interpro|IPR001808,
FT                   (GO:0006355)). Contains Rhodopsin-like GPCR superfamily
FT                   (Interpro|IPR000276, (GO:0016021)). Contains Bacterial
FT                   regulatory protein, Crp family (Interpro|IPR001808,
FT                   (GO:0006355))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60649"
FT                   /db_xref="GOA:A0A3N4BJQ6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BJQ6"
FT                   /protein_id="AAS60649.1"
FT                   /translation="MSRQDEQRLLVKIATLYYTEGMKQSEIADSLHLSQSFVSRAITRC
FT                   VKEGVVKISVIQPANMFIGIESRIQKHYGIDQAIVVDITDDASPAQIKQAIGSAAAHYM
FT                   QTSIRPNDMVGISSWSSTIRAMVDNLHPLNIKTSGVIQLLGGVGPNGNVQATLLTQSLA
FT                   NILNCPAYLLPAQSIERSTEDRARLISSGEVADVVNKFAEVDLALVGIGVLEPSQLLKN
FT                   SGNYYHEEMLKLLAERGAVGDLCLHYFDAAGNAVLSDEEDPVIGMSLPQLRACPRVVAL
FT                   AGGIEKSAAIRGALTGNYIDVLITDRLTAETLL"
FT   gene            complement(400013..401353)
FT                   /gene="proP5"
FT                   /locus_tag="YP_0377"
FT                   /old_locus_tag="YP0377"
FT   CDS_pept        complement(400013..401353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proP5"
FT                   /locus_tag="YP_0377"
FT                   /old_locus_tag="YP0377"
FT                   /product="putative membrane protein"
FT                   /note="similar to Yersinia pestis CO92 YPO3309 and Yersinia
FT                   pestis KIM y0879. Contains Sodium:dicarboxylate symporter
FT                   (Interpro|IPR001991, (GO:0016020)). Contains General
FT                   substrate transporter (Interpro|IPR005828, (GO:0016020)).
FT                   Contains Major facilitator superfamily (MFS)
FT                   (Interpro|IPR007114)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60650"
FT                   /db_xref="GOA:A0A3N4BA12"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BA12"
FT                   /protein_id="AAS60650.1"
FT                   /translation="MKKIFNTFFPLYSATVLMLLGSGLLTTYISLRLTAINVSALLIGA
FT                   IIAANYIGLVIGGKVGHFLIARVGHIRAYVACAGIITAAVLSHGLTEYIPAWVVLRLII
FT                   GLCMMCQFMVLESWLNDQAASNQRGTVFGFYMAATYAGLALGQVVLMFQPALGLITLMV
FT                   IALFFALCLVPVALTTRSNAQQMSPAPMELKFFVSSIPKILASTLVIGMIVGSFYGLAP
FT                   VYSSLQSLSTQETGLFMALSIFAGLVAQFPLSWLSDRYNRTQLIRINALLLALTALPLA
FT                   LIPHISFRFLLSLGFVVSLLQFTLYPLVVALANDLIEPERRVSLAACLLMSFGVGASIG
FT                   PLVVGALMAPLGGNILYAFFSLCGLGLIALSRTVKQDQDEFVNDAPVPHIAIPDCLVSS
FT                   PLSSALNPSFDEQMIQNVMPPPEQPATINTPADSLSDPDTTPSPHSQ"
FT   gene            401541..402158
FT                   /gene="cinA"
FT                   /locus_tag="YP_0378"
FT                   /old_locus_tag="YP0378"
FT   CDS_pept        401541..402158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cinA"
FT                   /locus_tag="YP_0378"
FT                   /old_locus_tag="YP0378"
FT                   /product="Uncharacterized protein (competence-and
FT                   mitomycin-induced)"
FT                   /note="similar to Yersinia pestis KIM y0880. Contains
FT                   Competence-damaged protein (Interpro|IPR003396)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60651"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D188"
FT                   /protein_id="AAS60651.1"
FT                   /translation="MYGKVLIFITCCETFRITECGCYRRLKKCYYRQQEIYLEWGATMS
FT                   EGQLRQLSIAVGHKLKEHGAWVTCAESCTGGWVAKALTDIAGSSAYFDRGFVTYSNAAK
FT                   QDLLGVSETTLARYGAVSEAVVREMALGALKQANADFAVSISGIAGPDGGSADKPVGTV
FT                   WFGFISREGPISARKKHFSGDRDSVRLQAAVFALQTLFDDFL"
FT   gene            402273..403343
FT                   /gene="recA"
FT                   /locus_tag="YP_0379"
FT                   /old_locus_tag="YP0379"
FT   CDS_pept        402273..403343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recA"
FT                   /locus_tag="YP_0379"
FT                   /old_locus_tag="YP0379"
FT                   /product="RecA protein"
FT                   /note="similar to Yersinia pestis CO92 recA and Yersinia
FT                   pestis KIM recA. Contains RecA bacterial DNA recombination
FT                   protein (Interpro|IPR001553, (GO:0008094)). Contains
FT                   ATP/GTP-binding site motif A (P-loop) (Interpro|IPR001687,
FT                   (GO:0005524)). Contains AAA ATPase (Interpro|IPR003593,
FT                   (GO:0000166))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60652"
FT                   /db_xref="GOA:P37858"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37858"
FT                   /protein_id="AAS60652.1"
FT                   /translation="MAIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGS
FT                   LSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIY
FT                   AKKLGVDIDNLLCSQPDTGEQALEICDALTRSGAVDVIIVDSVAALTPKAEIEGEIGDS
FT                   HMGLAARMMSQAMRKLAGNLKNANTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASV
FT                   RLDIRRIGAVKDGDVVVGSETRVKVVKNKIAAPFKQAEFQILYGEGININGELVDLGVK
FT                   HKLIEKAGAWYSYNGDKIGQGKANASNYLKENPAIAAELDKKLREMLLNGGNGEQPVAA
FT                   ATAEFADGADETNEEF"
FT   gene            403481..404044
FT                   /gene="recX"
FT                   /locus_tag="YP_0380"
FT                   /old_locus_tag="YP0380"
FT   CDS_pept        403481..404044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recX"
FT                   /locus_tag="YP_0380"
FT                   /old_locus_tag="YP0380"
FT                   /product="putative regulatory protein"
FT                   /note="similar to Yersinia pestis CO92 recX and Yersinia
FT                   pestis KIM oraA. Contains Regulatory protein RecX
FT                   (Interpro|IPR003783, (GO:0006282))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60653"
FT                   /db_xref="GOA:P37867"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37867"
FT                   /protein_id="AAS60653.1"
FT                   /translation="MNDQLSRAMRLLSQRDHSESELRRKLAAPPFSAKGNWGKRSGAKS
FT                   SDVVESNLVESNPVESNLAESNAIEESDPQVIEQVIDYCYQHNWLDDSRFAASYINSRS
FT                   RKGYGVQRIRSELMQKGVDKERILAAFENSEIDWCQLAKEVAQRKFSETLPVEWKEKAK
FT                   VQRYLLYRGFFQEEIQSIYTDSVE"
FT   gene            404184..406811
FT                   /gene="alaS"
FT                   /locus_tag="YP_0381"
FT                   /old_locus_tag="YP0381"
FT   CDS_pept        404184..406811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alaS"
FT                   /locus_tag="YP_0381"
FT                   /old_locus_tag="YP0381"
FT                   /product="alanyl-tRNA synthetase"
FT                   /note="similar to Yersinia pestis CO92 alaS and Yersinia
FT                   pestis KIM alaS. Contains Alanyl-tRNA synthetase, class IIc
FT                   (Interpro|IPR002318, (GO:0006419)). Contains
FT                   Phosphoesterase, DHHA1 (Interpro|IPR003156, (GO:0003676)).
FT                   Contains Alanyl-transfer RNA synthetase
FT                   (Interpro|IPR006193, (GO:0006419))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60654"
FT                   /db_xref="GOA:Q8ZBT8"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZBT8"
FT                   /protein_id="AAS60654.1"
FT                   /translation="MSKSTAEIRQAFLDFFHSKGHQVVSSSTLVPNNDPTLLFTNAGMN
FT                   QFKDVFLGLDKRAYSRATTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFK
FT                   HDAINFAWELLTSEQWFNLPKEKLWVTVYETDDEAYNIWANEVGVPHERIIRIGDNKGG
FT                   AFASDNFWQMGDTGPCGPCSEIFFDHGDHIWGGPPGSAEEDGDRYIEIWNIVFMQFNRQ
FT                   SDGTMLPLPKPSVDTGMGLERIAAVLQHVNSNYEIDLFRDLIAAVADVTGATDLSSKSL
FT                   RVIADHIRSCAFLISDGVIPSNENRGYVLRRIIRRAIRHGNMLGAKETFFYKLVAPLIA
FT                   VMGPAAAELKQQQAMVEQVLKTEEEQFARTLERGLALLDDELSKLTGDTLDGETAFRLY
FT                   DTYGFPVDLTADVCRERNLKVDEAGFEQAMEAQRRRARESSGFGADYNSLIRVDSASQF
FT                   SGYDHVQQHATVTALFRNGEAVDEIHAGEEAVVVLNRTPFYGESGGQVGDKGELKNATA
FT                   TFSVTDTQKYGQAIGHVGILTTGTLRVNHSVEALVDVVRRNRIRLNHSATHLLHAALRN
FT                   VLGEHVAQKGSLVNDKYLRFDFSHFEAMKPEQIRLVEDLVNEQIRRNMPVQTEVMELDA
FT                   AKEKGAMALFGEKYDDQVRVLTMGDFSTELCGGTHASRTGDIGLFRILTESGTAAGIRR
FT                   IEAVTGEGAIALLHQQSDLLQDVAHLVKGDIHNLADKVRAVLDRSKMLERELQQLKDQQ
FT                   AAQESASLSSSAKLINGVKLLVSQLDNVEPKMLRTMVDDLKNQLGSAIIVLATTADDKV
FT                   SLIVGVTKDLTGKVKAGELIADIAQQVGGKGGGRPDMAQAGGTDVQALPAALASVEAWV
FT                   ASRM"
FT   gene            407061..407246
FT                   /gene="csrA"
FT                   /locus_tag="YP_0382"
FT                   /old_locus_tag="YP0382"
FT   CDS_pept        407061..407246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csrA"
FT                   /locus_tag="YP_0382"
FT                   /old_locus_tag="YP0382"
FT                   /product="carbon storage regulator"
FT                   /note="similar to Yersinia pestis CO92 csrA and Yersinia
FT                   pestis KIM csrA. Contains Carbon storage regulator
FT                   (Interpro|IPR003751, (GO:0016071))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60655"
FT                   /db_xref="GOA:P63876"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63876"
FT                   /protein_id="AAS60655.1"
FT                   /translation="MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHRE
FT                   EIYQRIQAEKSQPTTY"
FT   gene            407609..407701
FT                   /locus_tag="YP_t4"
FT                   /old_locus_tag="tRNA-Ser_1"
FT   tRNA            407609..407701
FT                   /locus_tag="YP_t4"
FT                   /old_locus_tag="tRNA-Ser_1"
FT                   /product="tRNA-Ser"
FT                   /note="codon recognized: AGC; Cove score 73.90"
FT   gene            407710..407786
FT                   /locus_tag="YP_t5"
FT                   /old_locus_tag="tRNA-Arg_1"
FT   tRNA            407710..407786
FT                   /locus_tag="YP_t5"
FT                   /old_locus_tag="tRNA-Arg_1"
FT                   /product="tRNA-Arg"
FT                   /note="codon recognized: CGA; Cove score 85.08"
FT   gene            407866..407942
FT                   /locus_tag="YP_t6"
FT                   /old_locus_tag="tRNA-Arg_2"
FT   tRNA            407866..407942
FT                   /locus_tag="YP_t6"
FT                   /old_locus_tag="tRNA-Arg_2"
FT                   /product="tRNA-Arg"
FT                   /note="codon recognized: CGA; Cove score 80.38"
FT   gene            408365..408931
FT                   /locus_tag="YP_0383"
FT                   /old_locus_tag="YP0383"
FT   CDS_pept        408365..408931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0383"
FT                   /old_locus_tag="YP0383"
FT                   /product="putative hydrolase"
FT                   /note="similar to Yersinia pestis CO92 YPO3303 and Yersinia
FT                   pestis KIM y0885. Contains Haloacid dehalogenase/epoxide
FT                   hydrolase (Interpro|IPR005833, (GO:0008152), (GO:0016787)).
FT                   Contains Haloacid dehalogenase-like hydrolase
FT                   (Interpro|IPR005834, (GO:0008152), (GO:0016787)). Contains
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3
FT                   (Interpro|IPR006402)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60656"
FT                   /db_xref="GOA:A0A0H2W1D5"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W1D5"
FT                   /protein_id="AAS60656.1"
FT                   /translation="MYDLYEGLIFDMDGTLLDTESTHRQAWRQVLAPYGMHFDEQAMVA
FT                   LNGAPTWKIAGVIIAHNQSDLDPHFLAAQKTSLVNTMLLDNVKPLPLIDVVKSYYGRLP
FT                   MAVGTGSEHSMAEMLLRHVGLRDYFDAIVGADDVTKHKPEPETFLRCAELLGVRPDKCI
FT                   VFEDADFGVEAAKRANMAIVDVRLL"
FT   gene            408928..409356
FT                   /locus_tag="YP_0384"
FT                   /old_locus_tag="YP0384"
FT   CDS_pept        408928..409356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0384"
FT                   /old_locus_tag="YP0384"
FT                   /product="putative membrane protein"
FT                   /note="similar to Yersinia pestis CO92 YPO3302 and Yersinia
FT                   pestis KIM y0886."
FT                   /db_xref="EnsemblGenomes-Gn:YP_0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60657"
FT                   /db_xref="GOA:A0A3N4B5J9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B5J9"
FT                   /protein_id="AAS60657.1"
FT                   /translation="MSNTLAIASLFGSSFLSATLLPGNSEILLVTLLTAGSAPAAILVL
FT                   SATVGNTLGGLTNVVIGRLLPELKPQRGMGVALGWLQRFGPAALLLSWLPIVGDLMCVL
FT                   AGWLRMPWGFVAFFLFLGKALRYIVLTMITLQGIAWWQ"
FT   gene            409400..410998
FT                   /gene="gshA"
FT                   /locus_tag="YP_0385"
FT                   /old_locus_tag="YP0385"
FT   CDS_pept        409400..410998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshA"
FT                   /locus_tag="YP_0385"
FT                   /old_locus_tag="YP0385"
FT                   /product="gamma-glutamate-cysteine ligase"
FT                   /note="similar to Yersinia pestis KIM gshA. Contains
FT                   RNA-binding region RNP-1 (RNA recognition motif)
FT                   (Interpro|IPR000504, (GO:0003676)). Contains
FT                   Glutamate--cysteine ligase (Interpro|IPR006334)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60658"
FT                   /db_xref="GOA:Q8ZBU2"
FT                   /db_xref="InterPro:IPR006334"
FT                   /db_xref="InterPro:IPR007370"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZBU2"
FT                   /protein_id="AAS60658.1"
FT                   /translation="MLMSYGFQEREVDLIPDVSHALTWLEAHPKALKGIRRGIERETLR
FT                   VTADGHLASTGHPESLGAALTHQWITTDFAEALLEFITPVDGDIDHLLTFLRDIHRYTA
FT                   RKLGDERMWPLSMPCFIEAEQDIELAKYGSSNIGRFKTLYREGLKNRYGALMQTISGVH
FT                   YNFSLPLEFWQAWAGVTDEQSGKEEISAGYFRLIRNYYRFGWVIPYLFGASPAICSSFL
FT                   QGRETALPFERNGKGMCYLPYATSLRLSDLGYTNKSQSNLGITFNDLHTYVDALKRAIQ
FT                   TPSEEYVALGLKDGDRHLQLNTNVLQIENELYAPIRPKRVTRAGESPSDALLRGGIEYI
FT                   EVRSLDINPFSPIGVDAVQARFLDLFLIWCVLADAPEMSSDELLCTRKNWDRVILEGRK
FT                   PGQTIGIGCSDSRQPLETVGKALFADLRRVAEVLDGSESASYQQVCDELVASFDDPELT
FT                   FSARILKVMQEKGSGGVGLELAEHYREMLQNEPLELLTEEQLSAERDASRQRQHELELK
FT                   DKLSFEEYLALHGGQ"
FT   gene            411166..411681
FT                   /gene="luxS"
FT                   /locus_tag="YP_0386"
FT                   /old_locus_tag="YP0386"
FT   CDS_pept        411166..411681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="luxS"
FT                   /locus_tag="YP_0386"
FT                   /old_locus_tag="YP0386"
FT                   /product="autoinducer-2 production protein"
FT                   /note="similar to Yersinia pestis CO92 luxS and Yersinia
FT                   pestis KIM y0888. Contains LuxS protein
FT                   (Interpro|IPR003815, (GO:0009372))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60659"
FT                   /db_xref="GOA:Q8ZBU3"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZBU3"
FT                   /protein_id="AAS60659.1"
FT                   /translation="MPLLDSFTVDHTIMKAPAVRVAKTMKTPHGDEITVFDLRFCVPNK
FT                   EVMPEKGIHTLEHLFAGFMRDHLNGDGVEIIDISPMGCRTGFYMSLIGTPDEQRVADAW
FT                   KAAMADVLKVTDQRKIPELNEYQCGTYHMHSLEEAQSIAKDILDRDVRINHNEELALPK
FT                   EKLTELHI"
FT   gene            complement(411770..413053)
FT                   /locus_tag="YP_0387"
FT                   /old_locus_tag="YP0387"
FT   CDS_pept        complement(411770..413053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0387"
FT                   /old_locus_tag="YP0387"
FT                   /product="putative membrane protein"
FT                   /note="similar to Yersinia pestis CO92 YPO3298 and Yersinia
FT                   pestis KIM y0890. Contains CBS domain (Interpro|IPR000644).
FT                   Contains Protein of unknown function DUF21
FT                   (Interpro|IPR002550). Contains Transporter associated
FT                   domain (Interpro|IPR005170)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60660"
FT                   /db_xref="GOA:A0A3N4B7C4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B7C4"
FT                   /protein_id="AAS60660.1"
FT                   /translation="MLEHVSTSSLIIILVIMIIVSAYFSASETGMMTLNRYRMRHLSKQ
FT                   GNRAARRVEKLLNRPDRLISLVLIGNNLVNILASALATIVGIRLYGDAGVAIATGVLTF
FT                   VILIFAEVLPKTIAALYPERVAFPSSMLLAPLQKIMLPLVWLLNTITRGLMHLCGIRGN
FT                   VHSSDAMSKDELRTIVSESQSKISRRNQDMLISVLDLEKVTVSDIMVPRNEVVGIDIND
FT                   DWKSIMRQLTHSPHGRIVLYRQSLDDAIGMLRVREAYRLMTEKKEFNKENLLRAADEIY
FT                   FIPEGTPLNVQLVKFQRNKKKVGMIVDEYGDIQGLVTVEDILEEIVGDFTTSMSPTLAE
FT                   EVNPQSDGSVLIDGSASVREVNKAFNWSLPVDARTINGMLLEELEEIPQAHIHVRLGNY
FT                   QIEVLDVQENMIKRVKITPMTSAEHSTL"
FT   gene            complement(413122..414015)
FT                   /gene="ccmC1"
FT                   /locus_tag="YP_0388"
FT                   /old_locus_tag="YP0388"
FT   CDS_pept        complement(413122..414015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmC1"
FT                   /locus_tag="YP_0388"
FT                   /old_locus_tag="YP0388"
FT                   /product="putative membrane protein"
FT                   /note="similar to Yersinia pestis CO92 YPO3297 and Yersinia
FT                   pestis KIM y0891."
FT                   /db_xref="EnsemblGenomes-Gn:YP_0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60661"
FT                   /db_xref="GOA:Q0WBZ5"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WBZ5"
FT                   /protein_id="AAS60661.1"
FT                   /translation="MQTISALTSENGWRGTLSTLYWLSNSLSRCSYNAMPVFSILALLA
FT                   YSLSLGLIIPSLVRKNSAYRRLALVSAVVALVCHAIALKNQIFDVGVGQNLTLLNIGSI
FT                   VGLMICTIMTIVASQGRGWFLLPIVYSFAMINLALASLLPGEFITHLEASPEIFIHIGL
FT                   ALFAYATLIIAALYALQLAWLDYQLKHKKLTFNADMPPLMSIERKMFHITQIGVVLLTL
FT                   TLCTGLLYMDNLFSKENVHKAVLSIMAWFVYIVLLWGHYHEGWRGRRVIWFSFAGAFLL
FT                   TLAYFGSRLVQEIMVR"
FT   gene            414079..415440
FT                   /gene="ffh"
FT                   /locus_tag="YP_0389"
FT                   /old_locus_tag="YP0389"
FT   CDS_pept        414079..415440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ffh"
FT                   /locus_tag="YP_0389"
FT                   /old_locus_tag="YP0389"
FT                   /product="signal recognition particle protein"
FT                   /note="similar to Yersinia pestis CO92 ffh and Yersinia
FT                   pestis KIM ffh. Contains GTP-binding signal recognition
FT                   particle (SRP54) G-domain (Interpro|IPR000897,
FT                   (GO:0006605)). Contains ATP/GTP-binding site motif A
FT                   (P-loop) (Interpro|IPR001687, (GO:0005524)). Contains AAA
FT                   ATPase (Interpro|IPR003593, (GO:0000166)). Contains Signal
FT                   peptide binding (SRP54) M-domain (Interpro|IPR004125,
FT                   (GO:0008249)). Contains Signal recognition particle protein
FT                   (Interpro|IPR004780, (GO:0008548))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60662"
FT                   /db_xref="GOA:A0A3N4B5F5"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B5F5"
FT                   /protein_id="AAS60662.1"
FT                   /translation="MFENLTDRLSRTLRNISGRGRLTEENIKETLREVRMALLEADVAL
FT                   PVVRDFINRVKERAVGHEVNKSLTPGQEFVKIVKNELISAMGEVNNELNLAAQPPAVVL
FT                   MAGLQGAGKTTSVAKLGKFLKEKQKKKVLVVSADVYRPAAIKQLETLAQGVGIDFFPSD
FT                   AQEKPIDIVNRALQQAKLKFYDVLIVDTAGRLHVDEAMMDEIKQVHAAIKPVETLFVVD
FT                   AMTGQDAANTAKAFNEALPLTGVVLTKVDGDARGGAALSIRHITGKPIKFLGVGEKSDA
FT                   LEPFHPDRIASRILGMGDVLSLIEDIESKVDRAQAEKLATKLKKGDGFDLNDFLDQLKQ
FT                   MRNMGGMASMLSKMPGAGQLPENVKSQMDDKVTVRMEAIINSMTLKERAKPEIIKGSRK
FT                   RRIATGSGVQVQDVNRLLKQFDEMQRMMKKMKNGGLAKMMRGMKGMMPPGFPGR"
FT   gene            415668..415916
FT                   /gene="rpsP"
FT                   /locus_tag="YP_0391"
FT                   /old_locus_tag="YP0391"
FT   CDS_pept        415668..415916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="YP_0391"
FT                   /old_locus_tag="YP0391"
FT                   /product="30S ribosomal protein S16"
FT                   /note="similar to Yersinia pestis CO92 rpsP and Yersinia
FT                   pestis KIM rpsP. Contains Ribosomal protein S16
FT                   (Interpro|IPR000307, (GO:0006412))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60664"
FT                   /db_xref="GOA:Q8ZBU7"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZBU7"
FT                   /protein_id="AAS60664.1"
FT                   /translation="MVTIRLARGGAKKRPFYQVVVTDSRNARDGRFIERVGFFNPIASG
FT                   QAEALRLDLDRIEHWIGLGATVSDRVSVLIKDAKKAA"
FT   gene            415926..416486
FT                   /gene="rimM"
FT                   /locus_tag="YP_0392"
FT                   /old_locus_tag="YP0392"
FT   CDS_pept        415926..416486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="YP_0392"
FT                   /old_locus_tag="YP0392"
FT                   /product="16S rRNA processing protein"
FT                   /note="similar to Yersinia pestis CO92 rimM and Yersinia
FT                   pestis KIM y0895. Contains RimM protein
FT                   (Interpro|IPR002676, (GO:0007046))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60665"
FT                   /db_xref="GOA:Q8ZBU8"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZBU8"
FT                   /protein_id="AAS60665.1"
FT                   /translation="MVVIMSKQLNPAVPDQPIVLGKMGSTYGIRGWLRVFSSTENAESI
FT                   FDYQPWFIQQAGKWQHVELEDWKRHSQDLIIKVKGVDDREAANLLTNCEIIVDSTQLPA
FT                   LEEDDYYWKDLMGCQVVTTTGYELGKIIDMMETGSNDVMVVKANLKDAFGMKERLVPFL
FT                   HGQVIKKVDLTAQRVEVDWDPGF"
FT   gene            416468..417265
FT                   /gene="trmD"
FT                   /locus_tag="YP_0393"
FT                   /old_locus_tag="YP0393"
FT   CDS_pept        416468..417265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="YP_0393"
FT                   /old_locus_tag="YP0393"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /note="similar to Yersinia pestis CO92 trmD and Yersinia
FT                   pestis KIM trmD. Contains tRNA
FT                   (guanine-N1-)-methyltransferase (Interpro|IPR002649,
FT                   (GO:0008175))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60666"
FT                   /db_xref="GOA:Q8ZBU9"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZBU9"
FT                   /protein_id="AAS60666.1"
FT                   /translation="MGSWFLTSELNGDSEWNKTMWIGVISLFPEMFRAITDYGVTGRAV
FT                   KNGLLSVQCWSPRDFTYDRHRTVDDRPYGGGPGMLMMVQPLREAIHAAKAAAGEGAKVI
FT                   YLSPQGRKLDQQGVCELAMNQKMILVCGRYEGVDERVIKTEIDEEWSIGDYVLSGGELP
FT                   AMTLIDSVSRFIPGVLGHHASAEEDSFVDGLLDCPHYTRPEVLEGMEVPPVLLSGNHAE
FT                   IRRWRLKQSLGRTWLRRPELLESLALTDEQMVLLAEFQREHKP"
FT   gene            417346..417693
FT                   /gene="rplS"
FT                   /locus_tag="YP_0394"
FT                   /old_locus_tag="YP0394"
FT   CDS_pept        417346..417693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="YP_0394"
FT                   /old_locus_tag="YP0394"
FT                   /product="50S ribosomal protein L19"
FT                   /note="similar to Yersinia pestis CO92 rplS and Yersinia
FT                   pestis KIM rplS. Contains Ribosomal protein L19
FT                   (Interpro|IPR001857, (GO:0006412))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60667"
FT                   /db_xref="GOA:Q8ZBV0"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZBV0"
FT                   /protein_id="AAS60667.1"
FT                   /translation="MSNIIKQIEQEQMKQDVPAFRPGDSVEVKVWVVEGSKKRLQAFEG
FT                   VVIAIRNRGLHSAFTVRKISNGEGVERVFQTHSPVIDSITVKRRGAVRQAKLYYLRERT
FT                   GKSARIKERLG"
FT   gene            complement(417955..418767)
FT                   /locus_tag="YP_0395"
FT                   /old_locus_tag="YP0395"
FT   CDS_pept        complement(417955..418767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0395"
FT                   /old_locus_tag="YP0395"
FT                   /product="Putative salt-induced outer membrane protein"
FT                   /note="similar to Yersinia pestis KIM y0899"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60668"
FT                   /db_xref="InterPro:IPR007433"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D187"
FT                   /protein_id="AAS60668.1"
FT                   /translation="MRAASQTSFFHHRSIMFSLRHTKALPFYISTLTLSLFSASALADA
FT                   TLFTALDDPSSAKKSFDGSVDAGYTAQSGNTTNSSLAANSTLTWFQPNTAYSLWGAARN
FT                   TSANNQRSSERYQLGGRTRYNLTDRHYIFGQASWLTDRYNGFDSRSVLTTGYGRQVMTT
FT                   PLHNLRVEFGPGVRHDEFYGGGRATKALAYGGANYTYQLTDNTVFSEGVSALANEETTL
FT                   NSETALNVAINKSFALRLAYIATYNTKPPTSAPKNTDTTTSITLVYGL"
FT   gene            complement(419045..420390)
FT                   /pseudo
FT                   /gene="dcuB"
FT                   /locus_tag="YP_0396"
FT                   /old_locus_tag="YP0396"
FT                   /note="similar to gi|16767551|ref|NP_463166.1| (NC_003197)
FT                   Dcu family, anaerobic C4-dicarboxylate transporter
FT                   [Salmonella typhimurium LT2](len:446 aa). This CDS Contains
FT                   a frameshift after codons 341. The sequence has been
FT                   checked and is believed to be correct."
FT   gene            complement(420819..421592)
FT                   /gene="lytT"
FT                   /locus_tag="YP_0397"
FT                   /old_locus_tag="YP0397"
FT   CDS_pept        complement(420819..421592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lytT"
FT                   /locus_tag="YP_0397"
FT                   /old_locus_tag="YP0397"
FT                   /product="two-component system response regulator"
FT                   /note="similar to Yersinia pestis CO92 YPO3287 and Yersinia
FT                   pestis KIM y0902. Contains Response regulator receiver
FT                   (Interpro|IPR001789, (GO:0006355))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60669"
FT                   /db_xref="GOA:Q8ZBV2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZBV2"
FT                   /protein_id="AAS60669.1"
FT                   /translation="MVPCSLRGHDKIEKICGGCMLRVIIVDDEQPAREDLRERLNEEHG
FT                   IEIVAECSNALEAIPAIQRLQPDVVFLDIQMPRINGLELASMLNPESMPHIVFVTAYDE
FT                   YAIRAFEEHAFDYLLKPLDHQRLAKTLTRLSRDLIVKNNLHKVIEPILRHIPCSGHNRI
FT                   FLLKIEEVEYLSSELSGVHVVGTVQSGYTQLSLKTLEEKTPFIRCHRQYMVNTEQLGEI
FT                   QLMDNGAAEVITRSGKHIPVSRRYLKSLKEKLGIA"
FT   gene            421761..422837
FT                   /gene="aroF"
FT                   /locus_tag="YP_0398"
FT                   /old_locus_tag="YP0398"
FT   CDS_pept        421761..422837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroF"
FT                   /locus_tag="YP_0398"
FT                   /old_locus_tag="YP0398"
FT                   /product="3-deoxy-D-arabinoheptulosonate-7-phosphate
FT                   synthase"
FT                   /note="similar to Yersinia pestis KIM aroF. Contains DAHP
FT                   synthetase I/KDSA superfamily (Interpro|IPR006218,
FT                   (GO:0009058), (GO:0016228)). Contains
FT                   Phospho-2-dehydro-3-deoxyheptonate aldolase, subtype 1
FT                   (Interpro|IPR006219, (GO:0009073))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60670"
FT                   /db_xref="GOA:Q8D184"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D184"
FT                   /protein_id="AAS60670.1"
FT                   /translation="MIMQKDSLNNVHISAEQILITPEELKNQFPLSENDQYSIERARKT
FT                   IADIIQGRDPRLLVVCGPCSIHDVDAALDYARRLKKLSVELDDSLYIVMRVYFEKPRTT
FT                   VGWKGLINDPAMDGSFDVEAGLHIARRLLLDLVGMGLPLATEALDPNSPQYLGDLFSWS
FT                   AIGARTTESQTHREMASGLSMPVGFKNGTDGSLGTAINAMRAAAMPHRFMGINQSGQVC
FT                   LLQTQGNPHGHVILRGGKTPNYSAQDVAQCEKQMQDAGLIPSLMIDCSHGNSNKDYRRQ
FT                   VAVAESVVEQIKAGNRSITGVMLESHIHEGNQSSEQPRADMRYGVSVTDACINWESTET
FT                   LLRGMRQELLAALTARTA"
FT   gene            422850..423971
FT                   /gene="tyrA"
FT                   /locus_tag="YP_0399"
FT                   /old_locus_tag="YP0399"
FT   CDS_pept        422850..423971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrA"
FT                   /locus_tag="YP_0399"
FT                   /old_locus_tag="YP0399"
FT                   /product="T-protein"
FT                   /note="includes: chorismate mutase and prephenate
FT                   dehydrogenase; similar to Yersinia pestis CO92 tyrA and
FT                   Yersinia pestis KIM tyrA. Contains Chorismate mutase
FT                   (Interpro|IPR002701, (GO:0009073)). Contains Prephenate
FT                   dehydrogenase (Interpro|IPR003099, (GO:0006571))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60671"
FT                   /db_xref="GOA:A0A3N4B7B3"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008244"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011277"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B7B3"
FT                   /protein_id="AAS60671.1"
FT                   /translation="MVAELTALRDQIDEVDKALLDLLAKRLHLVAEVGEVKSRYGLPIY
FT                   VPDREAAMLASRRQEAGALGVPPDLIEDVLRRVMRESYTSENDKGFKTLCPELRPVVII
FT                   GGQGQMGRLFSRMLNLSGYQVRTLEQEDWSQAESILADAGMVIVSVPIHITEEVINRLP
FT                   KLPADCILLDLASVKNKPLQAMLAAHEGPVLGLHPMFGPDVGSLAKQVVVYCDGRDPQA
FT                   YQWLLEQLQVWGARLHRISAVEHDQNMAFIQALRHFATFAYGLHLAEENVQLEQLLALS
FT                   SPIYRLELAMVGRLFAQDPQLYADIIMSSEDNLALIKRYYKRFGEALTLLEHHDKQAFV
FT                   QSFEKVEHWFGDYAERFLVESRSLLRQANDNRQ"
FT   gene            complement(424076..425233)
FT                   /gene="pheA1"
FT                   /locus_tag="YP_0400"
FT                   /old_locus_tag="YP0400"
FT   CDS_pept        complement(424076..425233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheA1"
FT                   /locus_tag="YP_0400"
FT                   /old_locus_tag="YP0400"
FT                   /product="Prephenate dehydratase"
FT                   /note="Best Blastp hit = gi|266771|sp|Q02286|PHEA_ERWHE
FT                   P-protein [Includes: Chorismate mutase (CM); Prephenate
FT                   dehydratase (PDT)], gi|281791|pir||S26053 chorismate mutase
FT                   (EC 5.4.99.5) / prephenate dehydratase (EC 4.2.1.51) pheA
FT                   [similarity] - Erwinia herbicola, gi|43344|emb|CAA42949.1|
FT                   (X60420) prephenate dehydratase; chorismate mutase [Pantoea
FT                   agglomerans],(len:387 aa);. Contains Prephenate dehydratase
FT                   (Interpro|IPR001086, (GO:0009094)). Contains Chorismate
FT                   mutase (Interpro|IPR002701, (GO:0009073))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60672"
FT                   /db_xref="GOA:A0A0H2W1J1"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR010952"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W1J1"
FT                   /protein_id="AAS60672.1"
FT                   /translation="MTDNPLLVLRERISALDLKLLALLAERRELAVDVAKAKQLHHRPI
FT                   RDKERERDLLDALIDAAKPYNLDGFYVTRLFQLIIEDSVLTQQALLQHQLNQTALLSAR
FT                   IAFLGPKGSYSHLAARQYAARHFEQLIECGCLKFQDIFTQVETGQADYAVLPIENTSSG
FT                   SINDVYDLLQHTSLSIVGEITNPIEHCVLIATETDLNKIETVYSHPQPFQQCSQFINRF
FT                   PHWKIEYCESTAAAMEKVAGMKSPTAAALGSEAGGALYNLQVLEHNLANQQQNITRFIV
FT                   LARKPIDVSEQIPAKTTLIMATGQQSGALVEALLVLREHGIIMTKLESRPINGNPWEEM
FT                   FYIDVQANIRSEAMQKALADLTPITRSLKVLGCYPSENVVPVEPR"
FT   gene            complement(425505..426287)
FT                   /gene="dnaC_4"
FT                   /locus_tag="YP_0401"
FT                   /old_locus_tag="YP0401"
FT   CDS_pept        complement(425505..426287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaC_4"
FT                   /locus_tag="YP_0401"
FT                   /old_locus_tag="YP0401"
FT                   /product="insertion sequence IS100, ATP-binding protein"
FT                   /note="similar to Yersinia pestis CO92 YPO4009 and Yersinia
FT                   pestis KIM y4030. Contains Chaperonin clpA/B
FT                   (Interpro|IPR001270). Contains ATP/GTP-binding site motif A
FT                   (P-loop) (Interpro|IPR001687, (GO:0005524)). Contains
FT                   Bacterial chromosomal replication initiator protein, DnaA
FT                   (Interpro|IPR001957, (GO:0006275)). Contains IstB-like
FT                   ATP-binding protein (Interpro|IPR002611). Contains AAA
FT                   ATPase (Interpro|IPR003593, (GO:0000166))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60673"
FT                   /db_xref="GOA:A0A3N4AY74"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AY74"
FT                   /protein_id="AAS60673.1"
FT                   /translation="MMMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLE
FT                   HLLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNE
FT                   NIVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGV
FT                   MAPRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALT
FT                   SAMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            complement(426284..427306)
FT                   /locus_tag="YP_0402"
FT                   /old_locus_tag="YP0402"
FT   CDS_pept        complement(426284..427306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0402"
FT                   /old_locus_tag="YP0402"
FT                   /product="transposase for insertion sequence IS100"
FT                   /note="similar to Yersinia pestis CO92 YPO4010 and Yersinia
FT                   pestis KIM y4031. Contains Integrase, catalytic domain
FT                   (Interpro|IPR001584, (GO:0006310)). Contains IS21-like
FT                   element transposase, HTH domain (Interpro|IPR007101)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60674"
FT                   /db_xref="GOA:A0A3N4B5E7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B5E7"
FT                   /protein_id="AAS60674.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            427359..428351
FT                   /pseudo
FT                   /locus_tag="YP_0403"
FT                   /old_locus_tag="YP0403"
FT                   /note="similar to Yersinia pestis KIM y0507. The putative
FT                   start codon of this CDS locates in the IS100 element, so it
FT                   might be a pseudogene. Contains
FT                   Esterase/lipase/thioesterase, active site
FT                   (Interpro|IPR000379, (GO:0003824))"
FT   gene            complement(428425..430080)
FT                   /gene="putP1"
FT                   /locus_tag="YP_0404"
FT                   /old_locus_tag="YP0404"
FT   CDS_pept        complement(428425..430080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="putP1"
FT                   /locus_tag="YP_0404"
FT                   /old_locus_tag="YP0404"
FT                   /product="putative transmembrane transport protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0251 and Yersinia
FT                   pestis KIM y0508. Contains Na+/solute symporter
FT                   (Interpro|IPR001734, (GO:0016020))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60675"
FT                   /db_xref="GOA:Q8ZJ73"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR014083"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ73"
FT                   /protein_id="AAS60675.1"
FT                   /translation="MKIRHWSALSLFVLPALAQAEALTGEVHRQPLNIQAIVMFLLFVG
FT                   GTLYITYWASKRTRSRQDYYTAGGRITGFQNGLAIAGDYMSAASFLGISALVYASGYDG
FT                   LIYSIGFLIGWPIILFLIAERLRNLGRYTFADVASYRLQQRPIRTLSACGSLVVVALYL
FT                   IAQMVGAGKLIQLLFGLNYHVAVVLVGILMVLYVLFGGMLATTWVQIIKAVMLLSGATF
FT                   MAIMVMKSVNFNFNTLFSEAVKVHPKGLSIMSPGGLVSDPISALSLGLALMFGTAGLPH
FT                   ILMRFFTVSDAKEARKSVFYATGFIGYFYILTFIIGFGAILLVGPNQTFKDAAGALLGG
FT                   NNMAAVHLANAVGGSFFLGFISAVAFATILAVVAGLTLAGASAVSHDLYASVIKKGKAN
FT                   ERDELRVSKITVIILGIVAIGLGILFENQNIAFMVGLAFSIAASCNFPIIIISMYWDKL
FT                   TTRGAMIGGWLGLSTAVILMILGPTIWVTILGHEKPIYPYEYPALFSMIAAFVGTWFFS
FT                   ITDNSETGKQERLLFKSQFVRSQTGLGASKGGAH"
FT   gene            complement(430077..430388)
FT                   /locus_tag="YP_0405"
FT                   /old_locus_tag="YP0405"
FT   CDS_pept        complement(430077..430388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0405"
FT                   /old_locus_tag="YP0405"
FT                   /product="putative membrane protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0252 and Yersinia
FT                   pestis KIM y0509"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60676"
FT                   /db_xref="GOA:A0A3N4AX67"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AX67"
FT                   /protein_id="AAS60676.1"
FT                   /translation="MNDSIYQEIEDNPRFQELVKKRSRFAWLLSLITLTMYVAFIFLIA
FT                   FEPQWLGTPIYTGSSVTRGIPVGVGLIVTSFILTGIYVIRANGEFDRLTAEIIREVKQ"
FT   gene            complement(430445..432409)
FT                   /gene="acs"
FT                   /locus_tag="YP_0406"
FT                   /old_locus_tag="YP0406"
FT   CDS_pept        complement(430445..432409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acs"
FT                   /locus_tag="YP_0406"
FT                   /old_locus_tag="YP0406"
FT                   /product="acetyl-coenzyme A synthetase"
FT                   /note="similar to Yersinia pestis CO92 acs and Yersinia
FT                   pestis KIM acs. Contains AMP-dependent synthetase and
FT                   ligase (Interpro|IPR000873, (GO:0008152))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60677"
FT                   /db_xref="GOA:Q8D1G8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8D1G8"
FT                   /protein_id="AAS60677.1"
FT                   /translation="MTMSQIHKHPIPAAIAEHALITPEKYQHYYQQSVQNPDEFWGEQG
FT                   KIIDWIKPYKTVKNTSFDPGHVSIRWFEDGTLNLAANCLDRHLAERGDQTAIIWEGDDP
FT                   NQSKTVTYKQLHHDVCQFANVLKSLGVKKGDVVAIYMPMVPEAAVAMLACARIGAVHSV
FT                   IFGGFSPDAVAGRIIDSHSKLVITADEGIRAGRAIPLKKNVDEALKNPAITSIKNVVVF
FT                   QRTGNASYWEDGRDVWWHDLIKEASADCPPEEMNAEDPLFILYTSGSTGKPKGVVHTTG
FT                   GYLVYAALTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGPLACGAITLMFEGVPNYPG
FT                   VNRLSQVVDKHKVNILYTAPTAIRALMAEGDKAIEGTKRDSLRIMGSVGEPINPEAWEW
FT                   YYNKIGNSKCPIVDTWWQTETGGFMITPLPGATELKAGSATRPFFGVQPALVDNLGNPQ
FT                   EGVAEGNLVITDSWPGQARTLFGDHERFEQTYFSTFKGMYFSGDGARRDEDGYYWITGR
FT                   VDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGVPHNIKGQAIYAYITLNHGEEPTPE
FT                   LYTEVRNWVRKEIGPLATPDILHWTDSLPKTRSGKIMRRILRKIATGDTSNLGDTSTLA
FT                   DPSVVEKLLEEKQSMQTPS"
FT   gene            433307..434575
FT                   /gene="gltP"
FT                   /locus_tag="YP_0407"
FT                   /old_locus_tag="YP0407"
FT   CDS_pept        433307..434575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltP"
FT                   /locus_tag="YP_0407"
FT                   /old_locus_tag="YP0407"
FT                   /product="proton glutamate symport protein"
FT                   /note="similar to Yersinia pestis CO92 gltP and Yersinia
FT                   pestis KIM gltP. Contains Sodium:dicarboxylate symporter
FT                   (Interpro|IPR001991, (GO:0016020))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60678"
FT                   /db_xref="GOA:A0A0H2W2V6"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR034703"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W2V6"
FT                   /protein_id="AAS60678.1"
FT                   /translation="MLGILVGAVLHNQIESREWLVSNILSPAGDIFIRLIKMIVVPIVI
FT                   STLIVGIAGVGDAKKLGRIGLKTIIYFEVITTIAIIIGITLANVFQPGVGIDMSALTVV
FT                   DISQYEKTTEQVQSGSHSLVSTILSLIPANVFASMAKGDMLPIIFFSVLFGLGLSSLPK
FT                   ETKEPLLNVFKAVSESMFKVTHMIMRYAPIGVFGLISVTVANFGFASLIPLAKLVILVY
FT                   AAILFFALVILGTVARLCKLRIWILIRILKDELILAYSTASSETVLPRIIEKMEAYGAP
FT                   KAITSFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIELSIGQEIILVLTLMVTSKGIAG
FT                   VPGVSFVVLLATLGSVGIPLEGLAFIAGVDRILDMARTALNVVGNALAVLVIAKWENQF
FT                   DDKKAKAYEKTLFAVEQTPANQS"
FT   gene            complement(434753..435385)
FT                   /gene="citB1"
FT                   /locus_tag="YP_0408"
FT                   /old_locus_tag="YP0408"
FT   CDS_pept        complement(434753..435385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citB1"
FT                   /locus_tag="YP_0408"
FT                   /old_locus_tag="YP0408"
FT                   /product="putative two-component response regulator"
FT                   /note="similar to Yersinia pestis CO92 YPO0255 and Yersinia
FT                   pestis KIM y0512. Contains Bacterial regulatory protein,
FT                   LuxR family (Interpro|IPR000792, (GO:0006355)). Contains
FT                   Response regulator receiver (Interpro|IPR001789,
FT                   (GO:0006355))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60679"
FT                   /db_xref="GOA:A0A3N4AX86"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AX86"
FT                   /protein_id="AAS60679.1"
FT                   /translation="MNTKLLIVDDHELIIHGIKNMLAAYPRYLIVGQADNGLEVYNLCR
FT                   QTEPDMVILDLGLPGMDGLDVIIQLLRRWPALKILTLTARNEEHYASRTFNSGALGYVL
FT                   KKSPQQILMAAIQTVAIGKRYIDPALDASMVIKLTQGSDNTPPVLTPRERQILKLITEG
FT                   SCNRVIAAQLSISQKTVETHRLNMMKKLDVHKVAELIHWSYRLGLNV"
FT   gene            complement(435398..438187)
FT                   /gene="baeS1"
FT                   /locus_tag="YP_0409"
FT                   /old_locus_tag="YP0409"
FT   CDS_pept        complement(435398..438187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="baeS1"
FT                   /locus_tag="YP_0409"
FT                   /old_locus_tag="YP0409"
FT                   /product="two-component sensor/regulator"
FT                   /note="similar to Yersinia pestis CO92 YPO0256 and Yersinia
FT                   pestis KIM y0513. Contains Response regulator receiver
FT                   (Interpro|IPR001789, (GO:0006355)). Contains ATP-binding
FT                   region, ATPase-like (Interpro|IPR003594, (GO:0005524)).
FT                   Contains Histidine kinase, HAMP region (Interpro|IPR003660,
FT                   (GO:0016020)). Contains Histidine kinase A, N-terminal
FT                   (Interpro|IPR003661, (GO:0016020)). Contains Bacterial
FT                   sensor protein, C-terminal (Interpro|IPR004358,
FT                   (GO:0007165)). Contains Histidine kinase
FT                   (Interpro|IPR005467, (GO:0007165), (GO:0016301))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60680"
FT                   /db_xref="GOA:Q8D1G7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1G7"
FT                   /protein_id="AAS60680.1"
FT                   /translation="MTLLMGVTLTVIWLILIATTAFFSYENTRQILINELTHMASMRAD
FT                   LSNHQFEGAERDAASLISRRESLQSTSPLPEISIKHYDSYYIPFNLDSCNINQHKNDLW
FT                   IIQAYGTAGQTYYLDSFIIKQKEGIVLFPPQKSSSDYLNQRRKDLLLLPKFPTHNNIYW
FT                   GAPTYTPQGGWHVSVAVCDKVGTLAGFALKLNDLIAYNHPVEQRDINLLLDKNGELLPI
FT                   SQQATSSNQLHEILNQLKNSKLHDGWQQTPDYLVLRTQLKGPGWQQLVIYPRMGFAWEA
FT                   LKPALYQLPFALAILLLLTSVLSLLLRYYLAIPLWNFINIIGATGPQAMEPRLPINRID
FT                   ELGHIARAYNNLLDTLNEQYDTLEMKVKERTLALAEAKRAAEQANRRKSDHLTTISHEI
FT                   RTPLNGALGAVELLQNTPLDAGQMRLAETAHQCSLSLLAIINNLLDFSRIESGQMTLSL
FT                   EKTALLPLLDQAMLTIHSQALSKSLALSTFISANIPLELELDTLRLRQILVNLLGNAVK
FT                   FTPQGRIQLRVRRQNQTLCFTVEDTGCGIDVQHQQTIFQPFMQTSDHEQGTGLGLAIAD
FT                   NLAKMMGGHLTVFSEPGQGSCFSLCLPFNAITPPMPFHGELFAPQRLHAQLSAWGMTCQ
FT                   PELANQPSRHFVDNALCYLPGRLYAKLKQYLQGAETEALKSLPLQPWQMHILLVDDSET
FT                   NRDITGMMLQQLGHQVTRADSGTTALAIGRQHRFDLVLMDIRMPVLDGLATTARWRHDP
FT                   ANIDSHCMITALSANASPDEQIKTSQAGMNHYLSKPVTLGQLAEMLDLTAQFQLERGVD
FT                   LSPQLSEPQPLLDLADSALSLKLYQSLQVLIQQAKDAIENLPVLSHTLHTIKGCAGQAG
FT                   LIELQDAVIQLEHALDTHETLTQQEIIQLDEIIHVLLQPPTTCESTFIISQGQSLMVK"
FT   gene            438389..439960
FT                   /gene="gspD2"
FT                   /locus_tag="YP_0410"
FT                   /old_locus_tag="YP0410"
FT   CDS_pept        438389..439960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspD2"
FT                   /locus_tag="YP_0410"
FT                   /old_locus_tag="YP0410"
FT                   /product="putative type III secretion protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0257 and Yersinia
FT                   pestis KIM y0514. Contains Bacterial general secretion
FT                   pathway protein D (Interpro|IPR001775, (GO:0016020)).
FT                   Contains Type III secretion system outer membrane G protein
FT                   (Interpro|IPR003522, (GO:0009306), (GO:0015448)). Contains
FT                   Bacterial type II secretion system protein D
FT                   (Interpro|IPR004845, (GO:0008565)). Contains Bacterial type
FT                   II and III secretion system protein (Interpro|IPR004846,
FT                   (GO:0009306)). Contains NolW-like (Interpro|IPR005644)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60681"
FT                   /db_xref="GOA:A0A3N4AYK6"
FT                   /db_xref="InterPro:IPR003522"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AYK6"
FT                   /protein_id="AAS60681.1"
FT                   /translation="MIVGLRQKPYLNLRNYKWMSLIYIMRKITGLILLFFATLLPYGKF
FT                   SYVKAIPWQGEPFFIYSRGMTVSELLKDLGMNYGIPVVISSEINEHFTGKIRDKTPEKI
FT                   LSELAGRYNITWYYDGETLYFYPVQSIKREFISPDGLAANTLVKYLQRGDVLAGKNCAI
FT                   KAIPHLDTLEVKGVPICIERVKSVSKMLSEQVRHQNQNKETVKVFPLKYASAADSDYQY
FT                   RDQNVRLPGLVSVLRELNQGNNLPLAGGNQPDGNQASSPVFSADPRQNAVIIRDRQANM
FT                   PIYRSLITQLDQRPIQIEISVTIIDVDAGDISQLGVDWSASASIGGTGVSFNSTFAKNN
FT                   AEGFSTVIGDTGNFMVRLNALQKNSRARILSQPSVVTLNNIQAVLDKNVTFYTKLQGEK
FT                   VAKLESVTSGSLLRVTPRMIETEGVQEVLLNLNIQDGQQQASTNSNEPLPEIRNSDIST
FT                   QATLQVGQSLLLGGFIQDTQIESQNKIPLLGDIPLLGGLFRSTDKQSHSVVRLFLIKAV
FT                   PVNAGE"
FT   gene            439947..441176
FT                   /locus_tag="YP_0411"
FT                   /old_locus_tag="YP0411"
FT   CDS_pept        439947..441176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0411"
FT                   /old_locus_tag="YP0411"
FT                   /product="putative type-III secretion protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0258 and Yersinia
FT                   pestis KIM y0515."
FT                   /db_xref="EnsemblGenomes-Gn:YP_0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60682"
FT                   /db_xref="GOA:A0A0H2W0L4"
FT                   /db_xref="InterPro:IPR012843"
FT                   /db_xref="InterPro:IPR032034"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W0L4"
FT                   /protein_id="AAS60682.1"
FT                   /translation="MQGNNMTTVFKLRLLNGDLNGLELILPEGEFTLGEQGCDVLLPLS
FT                   DGNIVTLCVNEYQVMIQVAEEVWINGAQHDLHTPLPLLQSIEIAGLVFVLGEQTDILSG
FT                   IKVTHRARFPLLVWLAIAICVPLSLLFVFLFWLTTQPETLRASIPADVPTQLAERLREP
FT                   ALQGIKGTWLADGSVTLSGHCASSSMMEPLQHFLLRNHIAFRNQLVCDDRLIASVSDLL
FT                   HQHGYHDIEVRIGDEPGNIVIYGAVQMGDQWLTVQDTLAAVSGLKGWLVVNAHSGQIQQ
FT                   LVERLRAAGLLGFLSMTESNKELAISGVLSSEQQQQLKETLAALSQQQPGFPSVRYQNI
FT                   PASDRTDQFLPAKVVSYGGNTQSAFVRLANGGRLQQGSVLANGYKVVFIGEQGLTLLKA
FT                   NNLVHIPMDF"
FT   gene            441195..441416
FT                   /locus_tag="YP_0412"
FT                   /old_locus_tag="YP0412"
FT   CDS_pept        441195..441416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0412"
FT                   /old_locus_tag="YP0412"
FT                   /product="putative type III secretion apparatus"
FT                   /note="similar to Yersinia pestis CO92 YPO0259 and Yersinia
FT                   pestis KIM y0516"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60683"
FT                   /db_xref="GOA:A0A3N4BB58"
FT                   /db_xref="InterPro:IPR012671"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BB58"
FT                   /protein_id="AAS60683.1"
FT                   /translation="MQHITVLEEDIKHDPTAIKQRKEILARGRRLITCQLSLLQTPENY
FT                   QSLNNMMLALQRAEEIIEILTLRYGNKE"
FT   gene            441523..442230
FT                   /gene="araC1"
FT                   /locus_tag="YP_0413"
FT                   /old_locus_tag="YP0413"
FT   CDS_pept        441523..442230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araC1"
FT                   /locus_tag="YP_0413"
FT                   /old_locus_tag="YP0413"
FT                   /product="putative AraC-family regulatory protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0260 and Yersinia
FT                   pestis KIM y0517. . Contains Helix-turn-helix, AraC type
FT                   (Interpro|IPR000005, (GO:0006355))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60684"
FT                   /db_xref="GOA:A0A0H2W1K1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W1K1"
FT                   /protein_id="AAS60684.1"
FT                   /translation="MKSIQFILFRQEGVLRSDGERYVIPAGKLVIADEQASASAFANSA
FT                   ITSILCYPIDLFPIYQDLARRTLPLNKGHLPHAVNDKYKVLPANVEIIQAAEELINIER
FT                   VASLRFLYLYCLGIDNVYFSKLLDSIVGTNNELLEFFEKNRLNPWSVSRYANELGISTR
FT                   KLNFLFYEKFGMSAKQWLLDQRLKKGCELLLSTRLRVADIAMECGFSNHAHFSDSFRRR
FT                   FQQCPSHMRSLIE"
FT   gene            442240..442455
FT                   /locus_tag="YP_0414"
FT                   /old_locus_tag="YP0414"
FT   CDS_pept        442240..442455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0414"
FT                   /old_locus_tag="YP0414"
FT                   /product="putative type III secretion apparatus"
FT                   /note="similar to Yersinia pestis CO92 YPO0260a"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60685"
FT                   /db_xref="GOA:A0A3N4AX88"
FT                   /db_xref="InterPro:IPR011841"
FT                   /db_xref="InterPro:IPR021123"
FT                   /db_xref="InterPro:IPR037203"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AX88"
FT                   /protein_id="AAS60685.1"
FT                   /translation="MQISSPMGQLTNDIQQARQAYQNQMAAVNINDPEQMLTSQFTMNQ
FT                   YSAFLDFKSIEMKMINDIRNRILSRI"
FT   gene            442452..442700
FT                   /locus_tag="YP_0415"
FT                   /old_locus_tag="YP0415"
FT   CDS_pept        442452..442700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0415"
FT                   /old_locus_tag="YP0415"
FT                   /product="putative type III secretion apparatus"
FT                   /note="similar to Yersinia pestis CO92 YPO0261 and Yersinia
FT                   pestis KIM y0519"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60686"
FT                   /db_xref="InterPro:IPR010437"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AX77"
FT                   /protein_id="AAS60686.1"
FT                   /translation="MSLLSADCRQLVVEAALAGVNHSLLAEAHDIVNALPLLIPDPQVR
FT                   LVCEAMLRFGLGDKVQARALLATSGEEDAQILLGLLQ"
FT   gene            442798..443049
FT                   /locus_tag="YP_0416"
FT                   /old_locus_tag="YP0416"
FT   CDS_pept        442798..443049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0416"
FT                   /old_locus_tag="YP0416"
FT                   /product="putative type III secretion apparatus"
FT                   /note="similar to Yersinia pestis CO92 YPO0262"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60687"
FT                   /db_xref="GOA:A0A3N4BKV6"
FT                   /db_xref="InterPro:IPR012670"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BKV6"
FT                   /protein_id="AAS60687.1"
FT                   /translation="MNMSSAQAVAGLFQATEPPVGNTQQVAKFTQLMAQPASTELMMTP
FT                   ESLLMQQAEWMHASLAIDLTAKVAGVMGQNINKLVNMQ"
FT   gene            443046..443777
FT                   /gene="fliF1"
FT                   /locus_tag="YP_0417"
FT                   /old_locus_tag="YP0417"
FT   CDS_pept        443046..443777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliF1"
FT                   /locus_tag="YP_0417"
FT                   /old_locus_tag="YP0417"
FT                   /product="type III secretion system apparatus lipoprotein"
FT                   /note="similar to Yersinia pestis CO92 YPO0263. Contains
FT                   Type III secretion system outer membrane K protein
FT                   (Interpro|IPR003282, (GO:0009306), (GO:0015448)). Contains
FT                   Secretory protein YscJ/FliF (Interpro|IPR006182)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60688"
FT                   /db_xref="GOA:A0A3N4AX85"
FT                   /db_xref="InterPro:IPR003282"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AX85"
FT                   /protein_id="AAS60688.1"
FT                   /translation="MKSLRQMLAIVLMTLSLSGCDMELYSGLSEGEANQMLALLMLHQI
FT                   NAEKQIEKSGMVGLTVDKRQFINAVELLRQNGFPRQRFITVDELFPANQLVTSPTQEQA
FT                   KMVFLKEQQLENMLSHMDGVIHADVTVAMPMSVDGKNPLPHTASVFIKYSPEVNLQSYQ
FT                   SQIKGLVRDAVPGIDYAKISVVMQPANYRFSASEAEQQQGPQTTVQWLLRHVGMVQNMV
FT                   GVAFISLIVLMFVGWFYYRRR"
FT   gene            443949..444545
FT                   /locus_tag="YP_0418"
FT                   /old_locus_tag="YP0418"
FT   CDS_pept        443949..444545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0418"
FT                   /old_locus_tag="YP0418"
FT                   /product="hypothetical protein"
FT                   /note="similar to Yersinia pestis KIM y0523"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60689"
FT                   /db_xref="InterPro:IPR025292"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLR0"
FT                   /protein_id="AAS60689.1"
FT                   /translation="MMAFSPSIDVQYLHQLAWRPAQFAHPLWLAAVGVNPENYGYGRSR
FT                   ALDSALNGMLIQRRKFPQQRLPAVLNPRQQRQIAQRQRLPALCLALGVVSLQCDDYLRL
FT                   RRYRQVLSPLLNDDDIQQIIGMGYRGQWQASLSPQQLPDVALRLGQSLACQVRSNNIIW
FT                   QAVSILLPPNPRALCLSRSMQAQTEAWLSRLERLL"
FT   gene            444629..445189
FT                   /locus_tag="YP_0419"
FT                   /old_locus_tag="YP0419"
FT   CDS_pept        444629..445189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0419"
FT                   /old_locus_tag="YP0419"
FT                   /product="putative type III secretion system component"
FT                   /note="similar to Yersinia pestis KIM y0524"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60690"
FT                   /db_xref="InterPro:IPR012842"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1G4"
FT                   /protein_id="AAS60690.1"
FT                   /translation="MHSQDLLAQANAQAAEILQAAEQARVLLLDQAAEQADALISQARE
FT                   QMETALLAQHVRWLVGAEQLESLLITQVRHRILAAITTVVTTWSGEQPMSQILIQRLGD
FT                   QAEKMAQQGELTLRVHPQHLPAVTTALGERLRCVGDTEMAADQAQLSSPMLQLTLSLHH
FT                   HLSQLVLWLQQSPDLFDEENVYE"
FT   gene            445176..447230
FT                   /gene="flhA1"
FT                   /locus_tag="YP_0420"
FT                   /old_locus_tag="YP0420"
FT   CDS_pept        445176..447230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhA1"
FT                   /locus_tag="YP_0420"
FT                   /old_locus_tag="YP0420"
FT                   /product="putative type III secretion system component"
FT                   /note="similar to Yersinia pestis KIM y0525. Contains
FT                   Bacterial type III secretion FHIPEP (Interpro|IPR001712,
FT                   (GO:0016020)). Contains Type III secretion protein HrcV
FT                   (Interpro|IPR006302)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60691"
FT                   /db_xref="GOA:Q8D1G3"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006302"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1G3"
FT                   /protein_id="AAS60691.1"
FT                   /translation="MFMSKSALVRGLTMITARQDIFLAVMLLVAVFMMILPLPTTMVDL
FT                   LIAINLAFSVILLMISIYLRDPLEFSVFPSLLLITTLYRLALTISTTRLVLLQHDAGEI
FT                   VEAFGQFVVGGNLAVGMIIFTIITVVQFIVITKGSERVAEVSARFSLDGMPGKQMSIDG
FT                   DMRAGAIDSVEAKRLRERVQKESRLFGAMDGAMKFVKGDAIAGIIVILINIIGGITIGV
FT                   MQHKMSAEEAMNTYAVLSIGDGLCAQIPSLLISITAGIIVTRVPGSNKQSLANELAVQV
FT                   GRQPDALWLAAAILTVFALLPGFPFLIFITLAAAVAAPAFLLYRKNRRISQDGRANGGS
FT                   EEGGATGQRMTPGAVPLMLHCASNLHHPHLGRDIDGLRWRWFEHLGVPLPEVEIRCDPT
FT                   LAENTLSVQVYQERVLEVVLPPDSLLLTRPCSSLVTNNQVLGAKMGSFDWLDAKQAMQA
FT                   RTLGIPYVEGHQRIITCLTRVFERYTAEFIGVQETRYLMDAMEGRYGELVKELQRQIPV
FT                   GKVAEILQRLVEENISIRDLRTIFGALVVWAPKEKDIVMLTEYVRIALRRHLCRRFSHN
FT                   KTWISVLRLGDGVEHLIRDSIRQTSSGTYSALEERQSLLILNKIKNAFAENQDAVLLTT
FT                   LDVRRFVRKIIERDLFVLPVLSWQELGDEMNLKVAGTIELIGDELDETA"
FT   gene            447214..448554
FT                   /gene="fliI1"
FT                   /locus_tag="YP_0421"
FT                   /old_locus_tag="YP0421"
FT   CDS_pept        447214..448554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliI1"
FT                   /locus_tag="YP_0421"
FT                   /old_locus_tag="YP0421"
FT                   /product="putative type III secretion system ATP synthase"
FT                   /note="similar to Yersinia pestis CO92 YPO0267 and Yersinia
FT                   pestis KIM fliI. Contains H+-transporting two-sector
FT                   ATPase, alpha/beta subunit, central region
FT                   (Interpro|IPR000194, (GO:0006818)). Contains Disease
FT                   resistance protein (Interpro|IPR000767, (GO:0006952)).
FT                   Contains ATP/GTP-binding site motif A (P-loop)
FT                   (Interpro|IPR001687, (GO:0005524)). Contains AAA ATPase
FT                   (Interpro|IPR003593, (GO:0000166)). Contains
FT                   H+-transporting two-sector ATPase, alpha/beta subunit,
FT                   N-terminal (Interpro|IPR004100, (GO:0016469)). Contains
FT                   ATPase FliI/YscN (Interpro|IPR005714, Cellular Component:
FT                   cytoplasm (GO:0005737), (GO:0015031), (GO:0016887)).
FT                   Contains H+-transporting two-sector ATPase, alpha/beta
FT                   subunit, central region (Interpro|IPR000194, (GO:0006818)).
FT                   Contains Disease resistance protein (Interpro|IPR000767,
FT                   (GO:0006952)). Contains ATP/GTP-binding site motif A
FT                   (P-loop) (Interpro|IPR001687, (GO:0005524)). Contains AAA
FT                   ATPase (Interpro|IPR003593, (GO:0000166)). Contains ATPase
FT                   FliI/YscN (Interpro|IPR005714, Cellular Component:
FT                   cytoplasm (GO:0005737), (GO:0015031), (GO:0016887)).
FT                   Contains Eukaryotic thiol (cysteine) protease
FT                   (Interpro|IPR000169, (GO:0006508)). Contains
FT                   H+-transporting two-sector ATPase, alpha/beta subunit,
FT                   central region (Interpro|IPR000194, (GO:0006818)). Contains
FT                   ATP/GTP-binding site motif A (P-loop) (Interpro|IPR001687,
FT                   (GO:0005524)). Contains AAA ATPase (Interpro|IPR003593,
FT                   (GO:0000166)). Contains ATPase FliI/YscN
FT                   (Interpro|IPR005714, Cellular Component: cytoplasm
FT                   (GO:0005737), (GO:0015031), (GO:0016887))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60692"
FT                   /db_xref="GOA:A0A0H2W0M2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W0M2"
FT                   /protein_id="AAS60692.1"
FT                   /translation="MMKLPDIARLTPRLQQQLTRPSAPPEGLRYRGPIVEIGPTLLRAS
FT                   LPNVAQGELCRIEPQGMLAEVVSIEQEMALLSPFASSDGLRCGQWVTPLGHMHRVQVGA
FT                   DLAGRILDGLGAPIDGGPPLTGQWRELDCPPPSPLTRQPVEQMLTTGIRAIDGILSCGE
FT                   GQRIGIFAAAGVGKSTLLSMLCADSAADVMVLALIGERGREVREFLEQVLTPEARARTV
FT                   VVVATSDRPALERLKGLSTATTVAEYFRERGLKVLLLADSLTRYARAAREIGLAAGEPP
FT                   AAGSFPPSVFANLPRLLERTGNSDRGSITAFYTVLVEGDDMNEPVADEVRSLLDGHIVL
FT                   SRRLAGAGHYPAIDIAASVSRIMPQIVSAGQLAMAQKLRRMLACYQEIELLVQIGEYQA
FT                   GEDLQADEALQRYPAICAFLQQDHSLTRDPDTAHLDTTLEHLAQVVG"
FT   gene            448551..448952
FT                   /gene="sbcC"
FT                   /locus_tag="YP_0422"
FT                   /old_locus_tag="YP0422"
FT   CDS_pept        448551..448952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcC"
FT                   /locus_tag="YP_0422"
FT                   /old_locus_tag="YP0422"
FT                   /product="type III secretion system apparatus protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0268 and Yersinia
FT                   pestis KIM y0527."
FT                   /db_xref="EnsemblGenomes-Gn:YP_0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60693"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B1P4"
FT                   /protein_id="AAS60693.1"
FT                   /translation="MNHSQQRTLQRLLALRQRQERRLRQQLGQLRREQQQQEQQLENGR
FT                   RRHQQLCQQLQQLAQWCGMLTPREADEQKVLRQAVYQAERQAKKQLNAWVAQGRQQVSA
FT                   IERQQARLRRNQREQEKLRMLTEDESNRY"
FT   gene            448933..449331
FT                   /locus_tag="YP_0423"
FT                   /old_locus_tag="YP0423"
FT   CDS_pept        448933..449331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0423"
FT                   /old_locus_tag="YP0423"
FT                   /product="hypothetical protein"
FT                   /note="similar to Yersinia pestis KIM y0528"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60694"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BB64"
FT                   /protein_id="AAS60694.1"
FT                   /translation="MSRIDIEGALPPLREQGYSKERSTHWDHERQRQQFARCFSSPLPR
FT                   IQNIACTVAGYDDNGLMETHYRIVSGPLCGTKVSVSMTAHGLRIVLSNTESKLIERLQR
FT                   IQNRWQRQLHQLGFPCLLEVTCADESDA"
FT   gene            449309..450271
FT                   /gene="fliN1"
FT                   /locus_tag="YP_0424"
FT                   /old_locus_tag="YP0424"
FT   CDS_pept        449309..450271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliN1"
FT                   /locus_tag="YP_0424"
FT                   /old_locus_tag="YP0424"
FT                   /product="type III secretion system apparatus protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0269 and Yersinia
FT                   pestis KIM y0529. Contains Flagellar motor switch FliN
FT                   protein (Interpro|IPR001172, (GO:0001539), (GO:0003774),
FT                   (GO:0009425)). Contains Surface presentation of antigens
FT                   (SPOA) protein (Interpro|IPR001543)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60695"
FT                   /db_xref="GOA:A0A3N4B0U4"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR013385"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B0U4"
FT                   /protein_id="AAS60695.1"
FT                   /translation="MLTNLTPELRALSTLIGSGRQTAGVSVALTEIDGEGVYLPLHYGG
FT                   QECGLWLSQSCWQHWLNTTLATDNPQLLAAELVIAMANWAVTPLLALFTDLVVLAESPQ
FT                   KRSLPKQWAVTVAFELEGQPIIGVLQDWPQAALADTLSHWPCEAVTAPDLLWQSGLVAG
FT                   WCHLSLRQLQQLRPGEGLRLSMAAELDKEACWLWHHASPQIYIKLEGGNRMTIQQINEA
FT                   SDPLACGSRAESPPLAAVQLEDLPQTLVMEIGRLTLPLGEIKQLAVGQTLACQTHCYGE
FT                   VNICLNGQSVGRGSLLRCDEKLVVRIAQWGLQNGENIME"
FT   gene            450443..451048
FT                   /gene="fliP1"
FT                   /locus_tag="YP_0425"
FT                   /old_locus_tag="YP0425"
FT   CDS_pept        450443..451048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliP1"
FT                   /locus_tag="YP_0425"
FT                   /old_locus_tag="YP0425"
FT                   /product="putative type III secretion apparatus protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0270 and Yersinia
FT                   pestis KIM y0530. Contains Yop virulence translocation
FT                   protein R (Interpro|IPR005773, (GO:0015031), (GO:0016021)).
FT                   Contains Flagellar transport protein FliP
FT                   (Interpro|IPR005837, (GO:0016020)). Contains Type III
FT                   secretion system inner membrane P protein
FT                   (Interpro|IPR005838, (GO:0016020))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60696"
FT                   /db_xref="GOA:A0A0H2W2D7"
FT                   /db_xref="InterPro:IPR005773"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W2D7"
FT                   /protein_id="AAS60696.1"
FT                   /translation="MLSVLPLLVVMGTAFLKLSVVFSLLRNALGVQQVPPNIAIYGLAL
FT                   VLTIFIMAPVGLDVQARLQNEELSNDIGALAHQIDQNALVPYRDFLQRNTDIEQVTFFN
FT                   DIVQNKWPERYRDSVKPDSLLILMPAFTLSQLNEAFKIGLLLFLPFVAIDLIVSNILLA
FT                   MGMMMVSPMTLSLPFKLLVFVLVDGWSLVLGQLVGSYL"
FT   gene            451045..451338
FT                   /gene="fliQ1"
FT                   /locus_tag="YP_0426"
FT                   /old_locus_tag="YP0426"
FT   CDS_pept        451045..451338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliQ1"
FT                   /locus_tag="YP_0426"
FT                   /old_locus_tag="YP0426"
FT                   /product="putative type III secretion apparatus protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0271. Contains
FT                   Bacterial export protein FliQ, family 3
FT                   (Interpro|IPR002191, (GO:0016020)). Contains Type III
FT                   secretion protein HrpO (Interpro|IPR006306)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60697"
FT                   /db_xref="GOA:A0A3N4AX93"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006306"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AX93"
FT                   /protein_id="AAS60697.1"
FT                   /translation="MNNHMSSYHENAIIVHLATELLWLVLLLSLPVVVVASTVGLVISL
FT                   VQALTQIQDQTLQFLIKLLAVSATLLMTYHWMGATLLNYTQQSFLQITSMRP"
FT   gene            451340..452134
FT                   /gene="fliR1"
FT                   /locus_tag="YP_0427"
FT                   /old_locus_tag="YP0427"
FT   CDS_pept        451340..452134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliR1"
FT                   /locus_tag="YP_0427"
FT                   /old_locus_tag="YP0427"
FT                   /product="putative type III secretion apparatus protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0272 and Yersinia
FT                   pestis KIM y0532. Contains Bacterial export protein, family
FT                   1 (Interpro|IPR002010, (GO:0016020)). Contains Type III
FT                   secretion protein SpaR/YscT (Interpro|IPR006304)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60698"
FT                   /db_xref="GOA:A0A3N4AX87"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006304"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AX87"
FT                   /protein_id="AAS60698.1"
FT                   /translation="MTDVLPGLTALALAMMRPYGILLILPLFTARSLGSSLLRNGLIVA
FT                   IALPVTPLFLSAPIITNSSPVTWIGVLCTELLIGVVMGFVAALPFWAMNMAGFLIDTLR
FT                   GATMSTLFNPGMGVESSLFGVLFTQILTVLFLISGGFNQVLAALYGSYDSLPIGQGIQP
FT                   AADLLLFLQTEWQMMFELCLCFALPALLVMVLADLSLGLINRSARQLNVFFLAMPIKSA
FT                   LALFLLLISLPYGLHHYLSRMSDTEQKIGTLIPLIKGGNDVH"
FT   gene            452121..453191
FT                   /gene="flhB1"
FT                   /locus_tag="YP_0428"
FT                   /old_locus_tag="YP0428"
FT   CDS_pept        452121..453191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhB1"
FT                   /locus_tag="YP_0428"
FT                   /old_locus_tag="YP0428"
FT                   /product="putative type III secretion system component"
FT                   /note="similar to Yersinia pestis KIM y0533. Contains
FT                   Phosphoglucose isomerase (PGI) (Interpro|IPR001672,
FT                   (GO:0006096)). Contains Type III secretion exporter
FT                   (Interpro|IPR006135, (GO:0016020)). Contains Type III
FT                   secretion protein HrpY/HrcU (Interpro|IPR006307)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60699"
FT                   /db_xref="GOA:Q8D1F9"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006307"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1F9"
FT                   /protein_id="AAS60699.1"
FT                   /translation="MMSTEKNEKPTPKRLKEAKEKGQVVKSVEITSGVQLVALVIYFLL
FT                   TGYSLVEQAKALIRSSIIQLQQPLTLALARIGAECMTVLMHIVVVLGGALIVVTIIAGI
FT                   AQVGPLLATKAVSFKGERINPIQNAKQLFSLRSVFELMKSLLKVGVLTLIFGYLLMQYA
FT                   PSFGYLTHCGSRCALPVFSTLMGWLLGSLIACYLVFSLMDYAFQRYTIMKQLKMSHDEV
FT                   KREYKDSNGDPHIKQKRRQLQHEVQSGSFATNVRRSTAVVRNPTHFAVCLIYHPEETPL
FT                   PIVIEKGHDEQAALIVSLAEQSGIPVVENIALARALHRDVACGDTIPEQFFEPVAALLR
FT                   MALELDYQPSSDDPPR"
FT   gene            453574..454788
FT                   /locus_tag="YP_0429"
FT                   /old_locus_tag="YP0429"
FT   CDS_pept        453574..454788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0429"
FT                   /old_locus_tag="YP0429"
FT                   /product="putative integral membrane protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0274 and Yersinia
FT                   pestis KIM y0534. Contains Delayed-early response
FT                   protein/equilibrative nucleoside transporter
FT                   (Interpro|IPR002259, (GO:0016020))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60700"
FT                   /db_xref="GOA:A0A3N4AX96"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AX96"
FT                   /protein_id="AAS60700.1"
FT                   /translation="MSWPEFKSQYLVRFWAPLPAVIAAGILATYYFGLTGTFWAVTGEF
FT                   TRWGGHIMQLFGAQPQEWGYFKVIGLEGTPLDRIDGMMIIGMFAGCIAAALWANNIKLR
FT                   KPQHTIRIAQALVGGIIAGFGARLAMGCNLAAFFTGIPQFSLHAWFFALATAAGSYFGA
FT                   KFTLLPLFRIPIKLQKVTAASPLTQHPARAARRFRLGMVVLVLALGWSLIELFRQPKLG
FT                   IAMLCGIGFGLLIERAQICFTSAFRDLWITGRTHMAKAIILGMAVSTLGIFSYVQLGVE
FT                   PKILWAGPNAVIGGLLFGFGIVLAGGCETGWMYRAVEGQIHYWWVGLGNIIGATLLAYY
FT                   WDDFAPALATNYDKVNLLETFGPMGGLLVTYLMLALAFAAMLWWEKRFFRKQKATTSAL
FT                   IKESL"
FT   gene            454785..455054
FT                   /gene="sirA1"
FT                   /locus_tag="YP_0430"
FT                   /old_locus_tag="YP0430"
FT   CDS_pept        454785..455054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sirA1"
FT                   /locus_tag="YP_0430"
FT                   /old_locus_tag="YP0430"
FT                   /product="putative redox protein, regulator of disulfide
FT                   bond formation"
FT                   /note="similar to Yersinia pestis CO92 YPO0275 and Yersinia
FT                   pestis KIM y0535. Contains Protein of unknown function
FT                   UPF0033 (Interpro|IPR001455, (GO:0005554))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60701"
FT                   /db_xref="GOA:A0A3N4AX99"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AX99"
FT                   /protein_id="AAS60701.1"
FT                   /translation="MSHSPSVETPQLAAPIVPDYRLDMVGEPCPYPAVATLEAMPQLKP
FT                   GEILEVISDCPQSINNIPLDARNYGYTVLDIQQDGPTIRYLIQR"
FT   gene            complement(455132..456118)
FT                   /gene="lysR2"
FT                   /locus_tag="YP_0431"
FT                   /old_locus_tag="YP0431"
FT   CDS_pept        complement(455132..456118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysR2"
FT                   /locus_tag="YP_0431"
FT                   /old_locus_tag="YP0431"
FT                   /product="putative LysR-family transcriptional regulator"
FT                   /note="similar to Yersinia pestis CO92 YPO0276 and Yersinia
FT                   pestis KIM y0536. Contains Bacterial regulatory protein
FT                   LysR, HTH motif (Interpro|IPR000847, (GO:0006355)).
FT                   Contains LysR substrate binding domain
FT                   (Interpro|IPR005119)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60702"
FT                   /db_xref="GOA:A0A3N4AZZ3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AZZ3"
FT                   /protein_id="AAS60702.1"
FT                   /translation="MMSIDENTFAFSAKINNHAIYKHLENFIKIVECNSLSIAAHKLNI
FT                   TPSSTSRSLAQLEEKLGVVLLKRTTRSIVLTDAGDYLFHQARQLLLDLDETLVNTHSFY
FT                   NHPQGQLKITCSIAFGVCHLMHLFSQYKETNSDVCLSVDLNDQLVNLNEEHFDIALRIT
FT                   SIPPPNFAIRRICTINWVYCGSKEYLMKRGVPATIEDLEQHDCLVNPNVSDAWLYKSTE
FT                   GESVPLKIKNTVQANSSLGLLHAALHHQGIVCLPTYMLGDYITSGKLVPILLDYNAKDK
FT                   EYGLYALYYPSKYNDPKIRSFIDFMLDELSMDVPWDKWRADYQISLS"
FT   gene            456285..457571
FT                   /gene="sdaC1"
FT                   /locus_tag="YP_0432"
FT                   /old_locus_tag="YP0432"
FT   CDS_pept        456285..457571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdaC1"
FT                   /locus_tag="YP_0432"
FT                   /old_locus_tag="YP0432"
FT                   /product="putative transmembrane transport protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0277 and Yersinia
FT                   pestis KIM y0537. Contains Aromatic amino acid permease
FT                   (Interpro|IPR002091, (GO:0016020)). Contains Amino
FT                   acid/polyamine transporter, family II (Interpro|IPR002422,
FT                   (GO:0016020))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60703"
FT                   /db_xref="GOA:A0A3N4AYM6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AYM6"
FT                   /protein_id="AAS60703.1"
FT                   /translation="MSEISSSKSELKKLYKSVPFTQYDVGWVILCIGMAIGSGIVFMPV
FT                   QVGIKGIWVFIAAVIISYPAIYLLQNLYLRTLSESDNCTDYTSVITQYLGKNWGVGLGI
FT                   AYFLMLLHGMFSYSLAVTFDSASYIKTFGLTEGLLSDSIWYGLIILTVLVAIAAQGEKI
FT                   LFKVSGPMVCVKFGIIVVLGVVMVPYWDFNNISAFPELFSFLRDVLLTLPFTLFSILFV
FT                   QILSPMNIAYRKVESDKRIATYRAIRANRVAYIILAVAVLFFAFSFTFSISHEQAVSAF
FT                   EQNISALAIAAQVIPGSIVRIMTALLNIFAILTAFLGIYLGFQEAIKGIVVNIISRFIP
FT                   EENINQKVLHIGVCVGVILTLWLWVSTRFSILFFLQLGGPLFGVVSCLIPCYLVYKVPV
FT                   LHKLKGPTIWFISFFGILLCLSPFFKFFE"
FT   gene            457617..458798
FT                   /gene="metC2"
FT                   /locus_tag="YP_0433"
FT                   /old_locus_tag="YP0433"
FT   CDS_pept        457617..458798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metC2"
FT                   /locus_tag="YP_0433"
FT                   /old_locus_tag="YP0433"
FT                   /product="cystathionine beta-lyase"
FT                   /note="similar to Yersinia pestis CO92 metC and Yersinia
FT                   pestis KIM metC. Contains Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent enzymes (Interpro|IPR000277,
FT                   (GO:0006520)). Contains Cystathionine beta-lyase, bacterial
FT                   (Interpro|IPR006233). Contains Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent enzymes (Interpro|IPR000277,
FT                   (GO:0006520)). Contains Cystathionine beta-lyase, bacterial
FT                   (Interpro|IPR006233)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60704"
FT                   /db_xref="GOA:A0A3N4B1Q3"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006233"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B1Q3"
FT                   /protein_id="AAS60704.1"
FT                   /translation="MNKKDISSFGISTQITQLGRNPQEQTGFVNTPIYRGSTVIFNTVD
FT                   DIVNNRAVFNYGTAGTPTIANLESAWTALAGAAGTVISPSGLGVIALALLTTLKAGDHL
FT                   LMPDSVYKPTRLLCAGLIARMGVETTYYDPLIGAEIETLMKPNTSTLFLESPGSQSFEI
FT                   QDIPMMTAITKRRGIATIIDNTWASPLFFAAHKHGCDLSLEAGTKYLGGHSDLLMGLVS
FT                   ANEQWWPKLRETYDSMAMLPGAEDCFLALRGLRTLHLRIKEAEKRGLEMAQWLKERPEV
FT                   LRVLHPAFPDCPGHEFWKRDFTGSSGLFSIVLKPEFTQKGLAEMLDNMSIFAMGFSWGG
FT                   YESLVIPFDCSEYRTVTKWNPGGLTIRLQIGLEDMEDLKEDLAQGFIRLASNS"
FT   gene            complement(458939..459739)
FT                   /gene="hmuV"
FT                   /locus_tag="YP_0434"
FT                   /old_locus_tag="YP0434"
FT   CDS_pept        complement(458939..459739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuV"
FT                   /locus_tag="YP_0434"
FT                   /old_locus_tag="YP0434"
FT                   /product="hemin transport system ATP-binding protein"
FT                   /note="similar to Yersinia pestis CO92 hmuV and Yersinia
FT                   pestis KIM hmuV. Contains Uridine kinase
FT                   (Interpro|IPR000764, (GO:0006224)). Contains
FT                   ATP/GTP-binding site motif A (P-loop) (Interpro|IPR001687,
FT                   (GO:0005524)). Contains ABC transporter
FT                   (Interpro|IPR003439, (GO:0016020)). Contains AAA ATPase
FT                   (Interpro|IPR003593, (GO:0000166))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60705"
FT                   /db_xref="GOA:Q56993"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015863"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:4G1U"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q56993"
FT                   /protein_id="AAS60705.1"
FT                   /translation="MVDMAVTPVALLEASHLHYHVQQQALINDVSLHIASGEMVAIIGP
FT                   NGAGKSTLLRLLTGYLSPSHGECHLLGQNLNSWQPKALARTRAVMRQYSELAFPFSVSE
FT                   VIQMGRAPYGGSQDRQALQQVMAQTDCLALAQRDYRVLSGGEQQRVQLARVLAQLWQPQ
FT                   PTPRWLFLDEPTSALDLYHQQHTLRLLRQLTRQEPLAVCCVLHDLNLAALYADRIMLLA
FT                   QGKLVACGTPEEVLNAETLTQWYQADLGVSRHPESALPQIYLRQ"
FT   gene            complement(459732..460736)
FT                   /gene="hmuU"
FT                   /locus_tag="YP_0435"
FT                   /old_locus_tag="YP0435"
FT   CDS_pept        complement(459732..460736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuU"
FT                   /locus_tag="YP_0435"
FT                   /old_locus_tag="YP0435"
FT                   /product="hemin transport system permease protein HmuU"
FT                   /note="similar to Yersinia pestis CO92 hmuU and Yersinia
FT                   pestis KIM hmuU. Contains FecCD transport family
FT                   (Interpro|IPR000522, (GO:0016020))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60706"
FT                   /db_xref="GOA:Q56992"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="PDB:4G1U"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q56992"
FT                   /protein_id="AAS60706.1"
FT                   /translation="MNGRVQPRLMLGFLLILLVILALGSANMGALSLSFRTLWNTSTND
FT                   AMWHIWLNIRLPRVLLAVVVGCALAVSGTIMQGLFRNPLADPGLLGISSGAALCVGLII
FT                   VMPFSLPPLLALYSHMVGAFIGSLAISTIIFTLSRWGHGNLARLLLAGIAINALCGAAV
FT                   GVLTYISDDQQLRQFSLWSMGSLGQAQWSTLLVASSLILPTCILGLLQARQLNLLQLGD
FT                   EEAHYLGVNVRQAKLRLLLLSAILIGAAVAVSGVIGFIGLVVPHLIRMRIGADHRWLLP
FT                   GAALGGACLLLTADTLARTLVAPAEMPVGLLTSLLGGPYFLWLILRQREQRSG"
FT   gene            complement(460733..461572)
FT                   /gene="hmuT"
FT                   /locus_tag="YP_0436"
FT                   /old_locus_tag="YP0436"
FT   CDS_pept        complement(460733..461572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuT"
FT                   /locus_tag="YP_0436"
FT                   /old_locus_tag="YP0436"
FT                   /product="hemin-binding periplasmic protein"
FT                   /note="similar to Yersinia pestis CO92 hmuT and Yersinia
FT                   pestis KIM hmuT. Contains Periplasmic binding protein
FT                   (Interpro|IPR002491, (GO:0006827))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60707"
FT                   /db_xref="GOA:Q56991"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="PDB:3MD9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q56991"
FT                   /protein_id="AAS60707.1"
FT                   /translation="MRLRLLSLPFILSLCAPLLPLNTLAAERIVTIGGDVTEIAYALGA
FT                   GDEIVARDSTSQQPQAAQKLPDVGYMRTLNAEGILAMKPTMLLVSELAQPSLVLTQIAS
FT                   SGVNVVTVPGQTTPESVAMKINAVATALHQTEKGQKLIEDYQQRLAAVNKTPLPVKVLF
FT                   VMSHGGLTPMAAGQNTAADAMIRAAGGSNAMQGFSRYRPLSQEGVIASAPDLLLITTDG
FT                   VKALGSSENIWKLPGMALTPAGKHKRLLVVDDMALLGFGLETPQVLAQLREKMEQMQ"
FT   gene            complement(461569..462606)
FT                   /gene="hmuS"
FT                   /locus_tag="YP_0437"
FT                   /old_locus_tag="YP0437"
FT   CDS_pept        complement(461569..462606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuS"
FT                   /locus_tag="YP_0437"
FT                   /old_locus_tag="YP0437"
FT                   /product="hemin transport protein"
FT                   /note="similar to Yersinia pestis CO92 hmuS and Yersinia
FT                   pestis KIM hmuS"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60708"
FT                   /db_xref="GOA:Q56990"
FT                   /db_xref="InterPro:IPR007845"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q56990"
FT                   /protein_id="AAS60708.1"
FT                   /translation="MNASLYQQYVQAKAEHPGKYARDLATLMGISEAELTHSRVGHDAK
FT                   RLQSDARALLAALESVGEVKAITRNTYAVHEQVGRYENQHLNGHAGLILNPRALDLRLF
FT                   LNQWASAFTLTEETRHGVRHSIQFFDHQGDALHKVYVTEQTDMSAWEALLAQFIIPENP
FT                   ALQLEPLSTPEAVEPTADDATVDSEWRAMTDVHQFFQLLKRNNLTRQQAFRAVGDDLAY
FT                   QVDNNSLTQLLHIAQQDQNEIMIFVGNRGCVQIFTGLIEKVTPHNEWINVFNQRFTLHL
FT                   IETAIAESWITRKPTKDGFVTSLELFAADGTQLAQLYGQRTEGQPEQNQWREQIARLIN
FT                   KDIAA"
FT   gene            complement(462725..464755)
FT                   /gene="hmuR"
FT                   /locus_tag="YP_0438"
FT                   /old_locus_tag="YP0438"
FT   CDS_pept        complement(462725..464755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuR"
FT                   /locus_tag="YP_0438"
FT                   /old_locus_tag="YP0438"
FT                   /product="hemin receptor precursor"
FT                   /note="similar to Yersinia pestis CO92 hmuR and Yersinia
FT                   pestis KIM hmuR. Contains TonB-dependent receptor protein
FT                   (Interpro|IPR000531, (GO:0016020))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60709"
FT                   /db_xref="GOA:Q56989"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR010949"
FT                   /db_xref="InterPro:IPR011276"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q56989"
FT                   /protein_id="AAS60709.1"
FT                   /translation="MLRSTSDRFRWSSLSLAIACTLPLATQAADTTTTQTSSKKHSTDT
FT                   MVVTATGNERSSFEAPMMVTVIEGNAPTSQTAATAADMLRQVPGLTVTGSGRTNGQDVV
FT                   MRGYGKQGVLTLVDGVRQGTDTGHLNSTFLDPALVKRIEIVRGPAALLYGSGALGGVIA
FT                   YETVDAADMLQPGQNSGYRVYSSAATGDHSFGLGASAFGRTDDLDGILSFGTRDIGNIR
FT                   QSNGFNAPNDETISNVLAKGTWQIDSIQSLSANLRYYNNSAIEPKNPQTSAPSSTNVMT
FT                   NRSTIQRDAQLRYNIKPLDQEWLNATAQVYYSEVEINARPQGSAEEGREQTTEGVKLEN
FT                   RTRLFIESPASHLLTYGTETYKQEQTPGGATESFPQAKIRFSSGWLQDEITLRDLPVSI
FT                   LAGTRYDNYSGSSDGYADVDADKWSSRGAISITPTDWLMLFGSYAQAFRAPTMGEMYND
FT                   SKHFAIPIRPGLTLTNYWVPNPNLKPETNETQEYGFGLRFSDLLMAEDDLQFKVSYFDT
FT                   KAKDYISTRVDMQAMTTTSVNIDQAKIWGWDASMSYKTALFNWDLAYNRTRGKNQNTDE
FT                   WLDTINPDTVTSIVDVPVANSGFSVGWIGTFANRSSRVSSSTPQAGYGVNDFYVSYKGQ
FT                   EAFKGMTTTMLLGNVFEKEYYTPQGIPQDGRNVKFFVSYQW"
FT   gene            complement(464885..465076)
FT                   /locus_tag="YP_0439"
FT                   /old_locus_tag="YP0439"
FT   CDS_pept        complement(464885..465076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0439"
FT                   /old_locus_tag="YP0439"
FT                   /product="putative hemin uptake protein hemp"
FT                   /note="Best Blastp hit = gi|399882|sp|P31516|HEMP_YEREN
FT                   HEMIN UPTAKE PROTEIN HEMP, gi|282050|pir||S28041 hemP
FT                   protein - Yersinia enterocolitica, gi|49122|emb|CAA48249.1|
FT                   (X68147) hemP [Yersinia enterocolitica],(len:81 aa)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60710"
FT                   /db_xref="InterPro:IPR019600"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W1H6"
FT                   /protein_id="AAS60710.1"
FT                   /translation="MDKQLNKVPMLNDEPAAEYSVARKPLSIASEQLLGEHGVAFIVHQ
FT                   GECYQLRQTKSGKLILTK"
FT   gene            complement(465162..465812)
FT                   /locus_tag="YP_0440"
FT                   /old_locus_tag="YP0440"
FT   CDS_pept        complement(465162..465812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0440"
FT                   /old_locus_tag="YP0440"
FT                   /product="putative nucleoside-diphosphate-sugar epimerases"
FT                   /note="similar to Yersinia pestis CO92 YPO0284 and Yersinia
FT                   pestis KIM y0545"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60711"
FT                   /db_xref="GOA:A0A2S9PHS2"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PHS2"
FT                   /protein_id="AAS60711.1"
FT                   /translation="MRPWLIFGAGRGVGAHLLALANQHADSASNPRPVTLLIRNQQQAE
FT                   ELRNKGLTVVCGDACDPASVREACQLAGEDAAIISTLGNNNANYQGNRLIIDTAEQLGL
FT                   KRMLLVTSIGCGDSWPTLSPAARAAFGQAVREKSLAESWLQTSNLIYTLIRPGGLLDQP
FT                   ATGNAIRLQTEAHGMVTRADVAHHISQMIEDPATYYQAYALIEPGLARKVKMN"
FT   gene            complement(465846..466409)
FT                   /locus_tag="YP_0441"
FT                   /old_locus_tag="YP0441"
FT   CDS_pept        complement(465846..466409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0441"
FT                   /old_locus_tag="YP0441"
FT                   /product="Putative heme iron utilization protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0285 and Yersinia
FT                   pestis KIM y0546."
FT                   /db_xref="EnsemblGenomes-Gn:YP_0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60712"
FT                   /db_xref="InterPro:IPR010413"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W0N6"
FT                   /protein_id="AAS60712.1"
FT                   /translation="MNTSSSINTSSSMNTSSSMNRSPLAEFLATQPDGTLEQIAQDYQV
FT                   SVLDVVRALPERVLVGAEHFDRIWDSMTEWGDVTTLVHTADVILEHKGPLPSGTHRHGY
FT                   FNLRSKQGLSGHIRAQNCQAIALLERPFMGMATASVQFFNQQGEVMFKVYVGRDEHRQL
FT                   RADGLAAFHQLAQQLLIEDPTLVK"
FT   gene            complement(466406..469678)
FT                   /pseudo
FT                   /locus_tag="YP_0442"
FT                   /old_locus_tag="YP0442"
FT                   /note="similar to Yersinia pestis CO92 YPO0286 (putative
FT                   coproporphyrinogen III oxidase) and Yersinia pestis KIM
FT                   y0547; disrupted by IS100 element"
FT   gene            complement(467438..468217)
FT                   /gene="dnaC_5"
FT                   /locus_tag="YP_0443"
FT                   /old_locus_tag="YP0443"
FT   CDS_pept        complement(467438..468217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaC_5"
FT                   /locus_tag="YP_0443"
FT                   /old_locus_tag="YP0443"
FT                   /product="insertion sequence IS100, ATP-binding protein"
FT                   /note="similar to Yersinia pestis CO92 YPO4009 and Yersinia
FT                   pestis KIM y4030. Contains Chaperonin clpA/B
FT                   (Interpro|IPR001270). Contains ATP/GTP-binding site motif A
FT                   (P-loop) (Interpro|IPR001687, (GO:0005524)). Contains
FT                   Bacterial chromosomal replication initiator protein, DnaA
FT                   (Interpro|IPR001957, (GO:0006275)). Contains IstB-like
FT                   ATP-binding protein (Interpro|IPR002611). Contains AAA
FT                   ATPase (Interpro|IPR003593, (GO:0000166))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60713"
FT                   /db_xref="GOA:A0A384L599"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L599"
FT                   /protein_id="AAS60713.2"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            complement(468217..469239)
FT                   /locus_tag="YP_0444"
FT                   /old_locus_tag="YP0444"
FT   CDS_pept        complement(468217..469239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0444"
FT                   /old_locus_tag="YP0444"
FT                   /product="transposase for insertion sequence IS100"
FT                   /note="similar to Yersinia pestis CO92 YPO4010 and Yersinia
FT                   pestis KIM y4031. Contains Integrase, catalytic domain
FT                   (Interpro|IPR001584, (GO:0006310)). Contains IS21-like
FT                   element transposase, HTH domain (Interpro|IPR007101)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60714"
FT                   /db_xref="GOA:A0A3N4B5E7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B5E7"
FT                   /protein_id="AAS60714.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            complement(470019..470819)
FT                   /gene="metF2"
FT                   /locus_tag="YP_0445"
FT                   /old_locus_tag="YP0445"
FT   CDS_pept        complement(470019..470819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metF2"
FT                   /locus_tag="YP_0445"
FT                   /old_locus_tag="YP0445"
FT                   /product="putative methylenetetrahydrofolate reductase"
FT                   /note="similar to Yersinia pestis CO92 YPO0287 and Yersinia
FT                   pestis KIM y0548. Contains Methylenetetrahydrofolate
FT                   reductase (Interpro|IPR003171, (GO:0006555))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60715"
FT                   /db_xref="GOA:A0A2S9PHP6"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PHP6"
FT                   /protein_id="AAS60715.1"
FT                   /translation="MERKLSFEMNSAKNEKEMENIFKLIEFTDTLDPIYYTVNTEIGSS
FT                   VWSDTYRTVIELREKTDVPLIPHITINNKKEREIMQIIEKYINVGICEFFVIRGDKHVY
FT                   DQDNPINYGVELIELIRRSHKHIGIKTSLYPDFHKETTEVKEEIDWNERKYQLGVNEFI
FT                   SQLTLNTNALDFLSHWVDKERPFTPSIMPLGNFSFIEKFTSSNSIDYPLWIKKFANSKS
FT                   NSNEDKENIGIEIIRFLCREYLNQRERLHVFTLNKVDVMKKIFQ"
FT   gene            complement(471134..471622)
FT                   /locus_tag="YP_0446"
FT                   /old_locus_tag="YP0446"
FT   CDS_pept        complement(471134..471622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0446"
FT                   /old_locus_tag="YP0446"
FT                   /product="putative exported protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0288 and Yersinia
FT                   pestis KIM y0549"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60716"
FT                   /db_xref="InterPro:IPR011233"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B1R5"
FT                   /protein_id="AAS60716.1"
FT                   /translation="MLLSTKQFRHYTLALLLASGKPVDADDIYDKLSCSGPTLTRALKE
FT                   LRETYNAEIRYSKSTHSYQLTEKGTLTPKVLRHIKDAIASHMIIKSHEELVASHVILDK
FT                   EKKRSISLSLRMSVIRKIDRVVNQLEITRSEAVEILVNTYISELMLSVSQPPKGKKSV"
FT   gene            complement(472019..472978)
FT                   /gene="citE1"
FT                   /locus_tag="YP_0447"
FT                   /old_locus_tag="YP0447"
FT   CDS_pept        complement(472019..472978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citE1"
FT                   /locus_tag="YP_0447"
FT                   /old_locus_tag="YP0447"
FT                   /product="putative ATP/GTP-binding protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0289 and Yersinia
FT                   pestis KIM y0550. Contains ATP/GTP-binding site motif A
FT                   (P-loop) (Interpro|IPR001687, (GO:0005524))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60717"
FT                   /db_xref="GOA:A0A3N4BB90"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039480"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BB90"
FT                   /protein_id="AAS60717.1"
FT                   /translation="MKSTPSAYALGATLYMPATRTDIADIIIHNKISGLRSLVICLEDA
FT                   VSEDDVPLAISQLSTLLGTLAVEKKRDGSAHWPLIFVRPRHEAMGLALITRFNLSAING
FT                   FVLPKFTQASITTWWEIMKETHLCMMPTLETEDVFDVAKMSTLARELENHPSRQRIVAL
FT                   RIGGNDLMSVISMRRSRKLTLYDGPMGYVIKMLVSVFCPKNFALTAPVCEQIDNPQLLE
FT                   TELALDIAHGLVGKTAIHPSQIEVIQRALMVDTHDHADALRILNSTQAVFKSQGAMCEP
FT                   STHKRWAAAILERAQYYGIMPDFTAMAVRDAPRKHQSG"
FT   gene            complement(472978..474057)
FT                   /locus_tag="YP_0448"
FT                   /old_locus_tag="YP0448"
FT   CDS_pept        complement(472978..474057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0448"
FT                   /old_locus_tag="YP0448"
FT                   /product="hypothetical protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0290 and Yersinia
FT                   pestis KIM y0551"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60718"
FT                   /db_xref="GOA:A0A3N4B0W0"
FT                   /db_xref="InterPro:IPR011215"
FT                   /db_xref="InterPro:IPR028157"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B0W0"
FT                   /protein_id="AAS60718.1"
FT                   /translation="MHDITPFSGSYLPDDIQFLLKPIQIEMTPVEVKEKLIQSGARHYS
FT                   DMLSQEPAPTEHHLTLFARALDQGATRMAREVVMLAKALINRFGDTPIVLASLVRAGVP
FT                   LGVMLHHTLRALGKTSFHYGISIIRDRGIDEVALSYIEQKHGTEGLVFVDGWTGKGAIT
FT                   GELTRSLQGRPGYPELPRLVVLADPCGCSWLSATDDDWLIPFGIMGAPVSGLVSRSLWS
FT                   EKGLHGCVHCEHLQEFECSQLLVNTVADCRQQLDLSQIPAAEWDYQQNAALRIQSHQVV
FT                   KKMAEQFEINSVNRIKPGIAEATRAVLRRVPDHVLVRHIDDPDVSLLVYLAKQKKIAIK
FT                   EVGNELGQYRAITIIKKVI"
FT   gene            complement(474050..474868)
FT                   /locus_tag="YP_0449"
FT                   /old_locus_tag="YP0449"
FT   CDS_pept        complement(474050..474868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0449"
FT                   /old_locus_tag="YP0449"
FT                   /product="hypothetical protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0291 and Yersinia
FT                   pestis KIM y0552."
FT                   /db_xref="EnsemblGenomes-Gn:YP_0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60719"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR024197"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W1M9"
FT                   /protein_id="AAS60719.1"
FT                   /translation="MLMNKPVFLCDLDDTLFQTRRKMVDELDLPPFRVGALDRSLTPRS
FT                   FMTEEQSMLVDWLLEHAEFIPVTARGTEEISRVNIPFSSWAITTHGAVILTPDRQPDAG
FT                   WQDTVLTNLQPYRDRLIAMESRINDMMAERGLNAWCRINYEYGDTPVYFVMKHRDSTQI
FT                   AELYAFNDQLESLFSTDGFYIHRNSNNIAWLPVCIEKGLATTYLLDKLRHEHGAFPVLG
FT                   FGDSLSDFSFMRHCHWFGMPAKSQFSQALTSHLFDNTTFNKNNVNGDNDA"
FT   gene            complement(474855..475991)
FT                   /locus_tag="YP_0450"
FT                   /old_locus_tag="YP0450"
FT   CDS_pept        complement(474855..475991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0450"
FT                   /old_locus_tag="YP0450"
FT                   /product="hypothetical protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0292 and Yersinia
FT                   pestis KIM y0553"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60720"
FT                   /db_xref="GOA:A0A3N4AXB2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR011214"
FT                   /db_xref="InterPro:IPR022537"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR041688"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AXB2"
FT                   /protein_id="AAS60720.1"
FT                   /translation="MMTTQPPVYRRELSGGTLTVIPNSSNIPLDSLFDIAERRNPKRAF
FT                   LFVSKVLGRHIPVSPATMRNVYRQLAERFPADLPGPVLFIGMAETAVGLAAGVFQELRG
FT                   TVAEPVFLTSTRHPVDGDLLCEFKENHSHATDHLLYLPSDPVLRARLQRARSVVLIDDE
FT                   ATTGNTFINLLQALRDANLNGLEKVVAVTLTDWSGSALTERCPLPVTTVSLITGEWNWS
FT                   PIPDAPVPVMPACNVTARGKVAITDKQNWGRLGMDETRADIGHKVHVLAGEKVLVLGTS
FT                   EFVWQPFLLAERLEHAGANVKFSSITRSPIAQGHAINSIIAFSDNYGLGIPNFLYNVAH
FT                   QHFDRIIVCVETPAESIDPTLIEQLRTVAPCVEVIAYE"
FT   gene            complement(476003..477064)
FT                   /locus_tag="YP_0451"
FT                   /old_locus_tag="YP0451"
FT   CDS_pept        complement(476003..477064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0451"
FT                   /old_locus_tag="YP0451"
FT                   /product="hypothetical protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0293 and Yersinia
FT                   pestis KIM y0554"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60721"
FT                   /db_xref="GOA:A0A3N4BKZ9"
FT                   /db_xref="InterPro:IPR011226"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BKZ9"
FT                   /protein_id="AAS60721.1"
FT                   /translation="MKKNIWFMGGLSSQRDIISGVKNTSELHGNAIQVFASHHQHRYEI
FT                   LEKADVAFIEPSDLDTKMAFIRHIVKAFDIEAIHTGRSCLWFEQHRAAIEGLGVKLTTG
FT                   AQCPATFTLADNKVEYAAYMAQKGLPVVPSIQIASPDELREWLANPPFDTEKLCIKPVT
FT                   GIYGMGFWKLDQSISAMDCFDRTDNRVVHPDLYLAALERTEKMQPMVLMPYLPGPESSV
FT                   DMLVEKGKVIAAVARRKEGSVQHLHQSGAAFELAKSSAELMQADGLVNVQTRCDHHGQP
FT                   LLLEINLRPSGGIDYTRHSGVNLPGLFALRQLDLMSQDEVSSQAVAHFKPVSVRAMTDA
FT                   LPFPAELQNLTHF"
FT   gene            477307..477933
FT                   /gene="terZ"
FT                   /locus_tag="YP_0452"
FT                   /old_locus_tag="YP0452"
FT   CDS_pept        477307..477933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="terZ"
FT                   /locus_tag="YP_0452"
FT                   /old_locus_tag="YP0452"
FT                   /product="tellurium resistance protein"
FT                   /note="similar to Yersinia pestis CO92 terZ and Yersinia
FT                   pestis KIM terZ. Contains Bacterial stress protein
FT                   (Interpro|IPR003325, (GO:0006950))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60722"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1F8"
FT                   /protein_id="AAS60722.1"
FT                   /translation="MFNNFILKGNVMISLSKNQTISLAKESSALSRVQFGLGWDPVKKK
FT                   KSFLGGLFGGGSASDSIDLDASCVMLSQAGKPVDTVSFRHLTSKCRSVQHTGDNLTGEG
FT                   DGDDEVINVDLSRLPAEVEYLAFTVNSFRGQTFNEVENAFCRVVDQTGKELARYVLTEQ
FT                   GSHTGIVISSLRRNNGQWDFTAHGRACRGRTIEDMMSEIIETVVR"
FT   gene            477942..479117
FT                   /gene="terA"
FT                   /locus_tag="YP_0453"
FT                   /old_locus_tag="YP0453"
FT   CDS_pept        477942..479117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="terA"
FT                   /locus_tag="YP_0453"
FT                   /old_locus_tag="YP0453"
FT                   /product="putative tellurite resistance protein"
FT                   /note="similar to Yersinia pestis CO92 terA and Yersinia
FT                   pestis KIM terA. Contains Bacterial stress protein
FT                   (Interpro|IPR003325, (GO:0006950))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60723"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="InterPro:IPR017115"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W303"
FT                   /protein_id="AAS60723.1"
FT                   /translation="MPGGNAPVASQTLTVRVLSGASVDVSAFRLYASGKVRGDTDMVFY
FT                   GQPVTDDSTIRLSGQGVNTAFSVNLQAINHDVQKIAFTATCDGNQTLSQLGNLSIQVEL
FT                   NGSVLMKGDVETQGRQEAALILGELYRRNTEWKFRFVAQGFNGGLKPLAEHFGVVVEDE
FT                   PAAPTPVPTPVSTPAPTAPPVAKPINLSKVSLTKEKPVISLTKRDDFGEIRVNLNWHRG
FT                   GGAPAKGFLQGIFNSNKGIDLDLGAFVALNDGSRGVIQALGNNFGSYHSEPYVQLQGDD
FT                   RTGDVSDGEWMHINGREWKHVKEVLIFAFIYEGVPSWGSTDGIVTINVPGQAPIETQMN
FT                   EGNDRKNMCAVARLVNESGNIKVERINRYFSGHKEMDEAFGWGFRWKAGSK"
FT   gene            479150..479605
FT                   /gene="terB"
FT                   /locus_tag="YP_0454"
FT                   /old_locus_tag="YP0454"
FT   CDS_pept        479150..479605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="terB"
FT                   /locus_tag="YP_0454"
FT                   /old_locus_tag="YP0454"
FT                   /product="tellurite resistance protein"
FT                   /note="similar to Yersinia pestis CO92 terB and Yersinia
FT                   pestis KIM terB"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60724"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B013"
FT                   /protein_id="AAS60724.1"
FT                   /translation="MSFFNKVKNAISAGRTELTNQVGRFKNRKFMEGTVAVCAHISMAS
FT                   NGAGPEEKQKMIMFIKQSPELSVFDTNEVIEFFNKLVTSYEFDADIGKGEAMKYIMALK
FT                   SQPEAAQLALRVGIAVAKSDGVFDEMEEAAAREICVTLGFVPADFQL"
FT   gene            479627..480664
FT                   /gene="terC1"
FT                   /locus_tag="YP_0455"
FT                   /old_locus_tag="YP0455"
FT   CDS_pept        479627..480664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="terC1"
FT                   /locus_tag="YP_0455"
FT                   /old_locus_tag="YP0455"
FT                   /product="tellurium resistance protein"
FT                   /note="similar to Yersinia pestis CO92 terC. Contains
FT                   Integral membrane protein TerC family (Interpro|IPR005496)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60725"
FT                   /db_xref="GOA:A0A3N4AYP4"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AYP4"
FT                   /protein_id="AAS60725.1"
FT                   /translation="MESTHIGFPIETVAVFILLSVGAICIDLFMHRHDKPISLKSAALW
FT                   SLFWVAIAFVFAGFLYLHHGAEAASLFVTGYALEKVLSIDNLFVMMAIFSWFAVPDRLR
FT                   YRVLYWGIIGAIVFRGIFVAIGTGLLMLGPWVEVVFAIVVAWTAVMMLRKGDDDDAIED
FT                   YSQHIAYRLVKRFFPIWPKLRGNAFILSQKEVDAELAKPENADVQVGRKGGVARYATPL
FT                   MLCLAVVELSDVMFAFDSVPAVIAVSREPLIVYSAMMFAILGLRTLYFVLEALKQYLVH
FT                   LEKAVIVLLFFIAAKLGLNASDHFFNHGYDISANVSLFVVIGVLAIGIVASFLFPEKDS
FT                   KEGQH"
FT   gene            480722..481306
FT                   /gene="terD"
FT                   /locus_tag="YP_0456"
FT                   /old_locus_tag="YP0456"
FT   CDS_pept        480722..481306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="terD"
FT                   /locus_tag="YP_0456"
FT                   /old_locus_tag="YP0456"
FT                   /product="putative tellurium resistance protein"
FT                   /note="similar to Yersinia pestis KIM terD. Contains
FT                   Bacterial stress protein (Interpro|IPR003325,
FT                   (GO:0006950))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60726"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1F5"
FT                   /protein_id="AAS60726.1"
FT                   /translation="MKMGVSLSKGGNVSLSKEAPTMTNVLIGLGWDARSTDGQDFDLDA
FT                   SAFLLTANGKVRNDADFIFYNNLKSSDGSVMHTGDNRTGEGEGDDESLKIKLPLIPADV
FT                   DKIVFVVTIHDAQARRQSFGQVANAFIRLVNDDNGVEIARYDLSEDASTETAMLFGELY
FT                   RHNAEWKFRAVGQGYAGGLSSVCAQYGINAS"
FT   gene            481490..482065
FT                   /gene="terE"
FT                   /locus_tag="YP_0457"
FT                   /old_locus_tag="YP0457"
FT   CDS_pept        481490..482065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="terE"
FT                   /locus_tag="YP_0457"
FT                   /old_locus_tag="YP0457"
FT                   /product="tellurium resistance protein"
FT                   /note="similar to Yersinia pestis CO92 terE and Yersinia
FT                   pestis KIM terE. Contains Bacterial stress protein
FT                   (Interpro|IPR003325, (GO:0006950))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60727"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BB99"
FT                   /protein_id="AAS60727.1"
FT                   /translation="MAVSLVKGGNVSLTKEAPTMNIAVVGLGWDARVTDGSEFDLDASV
FT                   FMVGENGKVLSDQHFIFFNNKVSPCGSVVHQGDNRTGAGDGDDEQIKIDLKKVPADVKK
FT                   IIFSVTIYDAEARKQNFGMVSNSFMRVVNEDNSAEIARFDLSEDASTETAMIFGELYRN
FT                   NDEWKFKAVGQGFAGGLSALASQHGVSV"
FT   gene            482778..483416
FT                   /locus_tag="YP_0458"
FT                   /old_locus_tag="YP0458"
FT   CDS_pept        482778..483416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0458"
FT                   /old_locus_tag="YP0458"
FT                   /product="putative exported protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0301 and Yersinia
FT                   pestis KIM y0561"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60728"
FT                   /db_xref="InterPro:IPR010546"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B0X4"
FT                   /protein_id="AAS60728.1"
FT                   /translation="MKKPLTQIAILSSLVVSISAASAAVPTAELKVVGTMTVPSCTVVS
FT                   PDAGIYDIGKLSSSLVKPGTTVTVLAQINKTWTVNCDANTYLNFTPVDNRVGSSSDGSA
FT                   AAFGLGKINDTGKIGYYTVQMRNATVDGKKSGVFTASSASFSQADTSYLNRGQRTGWAA
FT                   GANTQNSGKVFVADLLVTPVLAGTNTMNGAITEDAKIDGSLTMNFAFGI"
FT   gene            483667..486045
FT                   /gene="fimD1"
FT                   /locus_tag="YP_0459"
FT                   /old_locus_tag="YP0459"
FT   CDS_pept        483667..486045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fimD1"
FT                   /locus_tag="YP_0459"
FT                   /old_locus_tag="YP0459"
FT                   /product="putative outer membrane fimbrial usher protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0302 and Yersinia
FT                   pestis KIM y0562. Contains Fimbrial biogenesis outer
FT                   membrane usher protein (Interpro|IPR000015, (GO:0016020)).
FT                   Contains Short-chain dehydrogenase/reductase SDR
FT                   (Interpro|IPR002198, (GO:0008152), (GO:0016491))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60729"
FT                   /db_xref="GOA:A0A0H2W1P0"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W1P0"
FT                   /protein_id="AAS60729.1"
FT                   /translation="MVARCINLQCIAFLFSFFPTLAFPVTEEGEVVFDIETLERLGYSA
FT                   ELAKFFSGQDRFLPGQHDVTIIINASKTYRIAATFDSEGKLCMDKALLMALKLRNTESD
FT                   GSCENMEARWPGMVVKLFPGQFRVEITLPQEAFDPEMEGSEYQQGGHALLLNYNIFGQR
FT                   VESNNSRFNLVQGQFEPGINFKNWVLINRGSYSYNQGVSQYYNQETSALRAVESLKSVV
FT                   QLGEFGLVGNTFSGLPVTGIQLYSDNAQRDDTQLIVPIEGIANTNATIEIRQRGRVIYR
FT                   TIVAPGPFSLSNISNFSSGVNTDVSIIEEDGTQQNFTVTSALDINAEQQASIYQLAVGR
FT                   YRDMFTGEDRPSPLLLSGEMSFNPAATFYMTSAGLLSSGYQNIRVQNLYSGWDQAWFSA
FT                   AASYANTKDAGQGYQFSVQNQMTINGNFGVSWSSVYGSANYWLPDDALSSSNNLNDLMF
FT                   GKLKNATSVAVSWVHPRWGAFSYALSNNMYYQASGRTYHIFSISEQFGRATTILSSQLS
FT                   SQGQNSLYVGINMPLGNGTLSGRVQRNNGNVALGSTYQGRWGDNKDYSVGISGDNRQRR
FT                   INGSMNIRTAYSQLTGGVSQATNNSRSAYLSSRGSVAYVNNTFATSSSSVGDTFAVVNI
FT                   PNQPGLRVSSPSSGIAITDYAGIALLPLVRPYTASKVQISTQTLPLNIRLNNTSADLLM
FT                   TRGSVATHHFETTETRQLLLTIRGSDGEMLPIGANVLDEKGNFLGTIIGDGNFMLENKA
FT                   IGVTLRVKANNRDECRVNYREPEKFDPDVLYEVADAVCQ"
FT   gene            486117..486860
FT                   /gene="fimC1"
FT                   /locus_tag="YP_0460"
FT                   /old_locus_tag="YP0460"
FT   CDS_pept        486117..486860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fimC1"
FT                   /locus_tag="YP_0460"
FT                   /old_locus_tag="YP0460"
FT                   /product="putative fimbrial chaperone"
FT                   /note="similar to Yersinia pestis CO92 YPO0303 and Yersinia
FT                   pestis KIM y0563. Contains Bacterial pili assembly
FT                   chaperone (Interpro|IPR001829, (GO:0030288))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60730"
FT                   /db_xref="GOA:A0A3N4AXC2"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AXC2"
FT                   /protein_id="AAS60730.1"
FT                   /translation="MQNFPTHHRDIGATIIYVNSVNRFNIFFVFTLLILLSSWSAVSYA
FT                   SFKLESTTVILQESEARTSFTIDNISSNPILLVTKLTDLDGKSFSKQILISPPVTRINA
FT                   GQSQQVNFVLKKGSVLNNEVLLKASFEGVEQVPGNAAVMPIRQEIGFLIQPSAVPQIRM
FT                   PWQTLVFSISGNNLVIKNPGKHVVRLGPQIILVPSNEVVALGNPYIMPETSKLFPITSS
FT                   PTAVKVTPLSRYGFVQTEVTLPVTR"
FT   gene            486868..487125
FT                   /gene="proP6"
FT                   /locus_tag="YP_0461"
FT                   /old_locus_tag="YP0461"
FT   CDS_pept        486868..487125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proP6"
FT                   /locus_tag="YP_0461"
FT                   /old_locus_tag="YP0461"
FT                   /product="putative membrane protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0304 and Yersinia
FT                   pestis KIM y0564."
FT                   /db_xref="EnsemblGenomes-Gn:YP_0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60731"
FT                   /db_xref="GOA:A0A3N4BL04"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BL04"
FT                   /protein_id="AAS60731.1"
FT                   /translation="MMWGDHLYTEGGIFFPVVEIDMPQEFAGSARAIGYLIGYLPSLFG
FT                   YRLYGYFLDTYLGIQGVNYVFYIMAAFSAGRFICAAVWAK"
FT   gene            488237..489637
FT                   /locus_tag="YP_0462"
FT                   /old_locus_tag="YP0462"
FT   CDS_pept        488237..489637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0462"
FT                   /old_locus_tag="YP0462"
FT                   /product="hypothetical protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0306 and Yersinia
FT                   pestis KIM y0565. Contains Cytochrome c heme-binding site
FT                   (Interpro|IPR000345, (GO:0006118)). Contains Zn-finger,
FT                   C2H2 type (Interpro|IPR007087)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60732"
FT                   /db_xref="GOA:A0A3N4AXB9"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AXB9"
FT                   /protein_id="AAS60732.1"
FT                   /translation="MSVIDHLERPLIPRRYPPNELIIMEDNMMHTENNSPSGLIPLPDW
FT                   YPVAFSHLDAMEYASVTRLWHHEPVLRDLVDELDKRNPGLITFTHCPHCHSADICPGTR
FT                   PEEYRCRTCHRCSSPYTHTPFFDLHHARHSRLYAVLVTLWGTWQVEDAAWLSDCKSKQI
FT                   WKQYCHRLKPILALIGGRAVTHTPRYLRGFTPGQQGLHCPACASTQLVYSETMPVGNPE
FT                   VHCQVCQTDFVMYPDIPKGIDPFAVNTPQYDIPLPRWFSRLFSHASQAQYQHLREVWQR
FT                   EPVLREAVDRLDAQNPEQGAVYACPYCQNKHISPRKTASSIEGYYCPACDNPFTATTGT
FT                   VFTRMRQEHFWRLYAVLVMLWTQWRPTQIFELCQLRSVHPFLTYHKRLAPLLAEFDGAP
FT                   ITPYPRNLLGFTPGQQGVCCVYCQSTKLITEGITVMPLDNPYICCLDCGQRFMLRVWRK
FT                   QVKSNEKK"
FT   gene            490646..492703
FT                   /gene="glcD1"
FT                   /locus_tag="YP_0464"
FT                   /old_locus_tag="YP0464"
FT   CDS_pept        490646..492703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcD1"
FT                   /locus_tag="YP_0464"
FT                   /old_locus_tag="YP0464"
FT                   /product="putative oxidoreductase"
FT                   /note="similar to Yersinia pestis CO92 YPO0308 and Yersinia
FT                   pestis KIM y0566. Contains Carbohydrate binding domain,
FT                   family V/XII (Interpro|IPR003610, (GO:0030246)). Contains
FT                   Fibronectin, type III (Interpro|IPR003961). Contains FAD
FT                   linked oxidase, N-terminal (Interpro|IPR006094,
FT                   (GO:0008246))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60734"
FT                   /db_xref="GOA:A0A2S9PHR6"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PHR6"
FT                   /protein_id="AAS60734.1"
FT                   /translation="MKIIDKNVSTYETLQKGFNLRWPPNVEQGAETIYICTTPDEVFAA
FT                   TNTALAAGNRITVRSGGHCYEGFVSNKLSTERLSIIDLGEMSGLDYDEDKTITSLWDAN
FT                   KNTYRFKSLTGNQNWNGYVSLYKRSGRTIPGGSCYSVGVGGHISGGGYGLLSRLHGLTV
FT                   DWVTGVDILVPVGNAHRLAFRHVRADSVSEVDRELLMACCGAGGGNFGIIIAYYFDDLP
FT                   KAPQKAYWIPLTYPWSSLKATFPAFLKAYWQWFADNDVNATSTKEGVGNGGLFTLLKLN
FT                   HIDASDNVVLAIQYTGPNGQVGGANDIPLNDFIEKMNAAAGMTPTIYDDFILPNIPPFK
FT                   HLYPGRKIGRTVDESASMDWLHVTQMINGSGSNQRGKYKSDYQIKQFSDEMCHALLTHL
FT                   TTATADKRFNQSLVQIDSYGGAINSRGIGATAVSQRNSLLKAQYQTYWTNEADDQTHLT
FT                   WIRNIYAAVHNGKPAPPEFEGCYINYPDIDMKYTDSGEEDPNWLNLYYGWDTQLIKRLI
FT                   ALKARIDPNNIFHHELSIPLVTELPKAPVNLHSTGQTTTSISLMWGSSIGALPVASYAI
FT                   YRDGHEVKLLNGTQTSAEDAGLQPNTEYRYFVAAGDEHGNLSVPSNVLTVSTQGTHPAW
FT                   VLNGSYAVGDVVSNLGKLWRCIQSHVAYDPLWAPGTNGGITLWAGYTAGR"
FT   gene            complement(493047..496856)
FT                   /locus_tag="YP_0465"
FT                   /old_locus_tag="YP0465"
FT   CDS_pept        complement(493047..496856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0465"
FT                   /old_locus_tag="YP0465"
FT                   /product="putative exported protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0309 and Yersinia
FT                   pestis KIM y0567. Contains Autotransporter beta-domain
FT                   (Interpro|IPR005546). Contains Outer membrane
FT                   autotransporter barrel (Interpro|IPR006315)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60735"
FT                   /db_xref="GOA:A0A0H2W1J8"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W1J8"
FT                   /protein_id="AAS60735.1"
FT                   /translation="MHIQFREPISTSPAQPDAGRQHLFSRVPAAVMNPITLAIIVAFST
FT                   LVLPQTAWAACNSSGVGTYVCEGENNTAISLFGTDIAVETRPGFGITEHEITDSALSLT
FT                   GSGTISYLDTNSSALDTDSRYSLYIKNDTLITEQSASINVQSNGSISSGVYIDNQSSDD
FT                   STIRVDLSGILSSSLSGAPALSIFSSAGNDSTIILNTHAISGVTGIQSDNNSQNGATIT
FT                   HVDVTGDINVENSGVSIRNAANGGTSIINFNSKSINTEYNSFYIQNTNYVGGVITDINI
FT                   DGDISSANSQAARIYNYTNGGLASLRFRANNVTGSTGLYIDNSSQNGAVTDIILTGDLT
FT                   ATSGSALQANAYSDEGNIETAIKLNNVYSLYDALNISDYTRSGNILHDLDISGTITAEN
FT                   GTGIKVMGAAGEGSSTMLINVNNITSSSQSLDINNYNFLGSAFSAITATGHLTAEWGQG
FT                   AMLQTHSSLGDATTLIHFNDITAMSSGISLINEANQGTSTADITVTGQINVSHGEGITL
FT                   NALTTDGRTLVNVDVNNIASEYDAIRLYNYNYNDNYATGVDDGTGADNGTSTIDLITRG
FT                   ALVSQQGYGINIETNTADTYVTVGGLVHGGNGTAIGIHRLDNIQTSATLELQSGYALEG
FT                   VTQALVFTGSYAEINDAALDLANSHLVLGGAGDAAFDLTRIDNREEAILDGDPNRITGF
FT                   GTLTKTNNSIWTLTGANMADGDANAFLSANIAGGILVLDNATLGLTPDAGALTGATVNR
FT                   LSAADIAADPTRVATETGALTLAEGGALSSLGDSVLSGNLISAGGILLSNHYTGGNGAA
FT                   TDDRLTVTGTYFGENNGSGEGAWLALDTVLGDDDSATDRLVINGDATGTTSVRVNNAGG
FT                   LGDKTLNGINLITVDGLAQDDTFLLAGDYVTTDGYQAVVAGAYAYTLQADGEAATAGRN
FT                   WYLSSELMLTEGVRYQVGVPLYEQYPQVLAALNTLPTLQQRVGNRYGAPGALADLNFDD
FT                   NQWAWGRIEGSHQVTDPARSTSGSQREIDVWKLQTGIDVPLYQSQGGSLLTGGVNFTYG
FT                   KAKADIHSFFGDGRINSAGYGLGTSLTWYGNNGVYVDGQLQTMWFDSDLSSRTAGHAVA
FT                   SGNNGRGYTSAIEAGKGYTLSHGLSLTPQMQVTYSRVDFDTFRDPFDSEVSLQEGDSLR
FT                   GRLGVSLNKETTWSAKDGTTRRSHIYSHLDLHNEFLNGSKVQVSGVEFATRDERQSVGL
FT                   GAGGTYEWQNGRYAVYGNVNLLGATRNISDNYAVGGTIGARVSW"
FT   gene            497646..498212
FT                   /gene="ubiC"
FT                   /locus_tag="YP_0466"
FT                   /old_locus_tag="YP0466"
FT   CDS_pept        497646..498212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiC"
FT                   /locus_tag="YP_0466"
FT                   /old_locus_tag="YP0466"
FT                   /product="putative chorismate--pyruvate lyase"
FT                   /note="similar to Yersinia pestis CO92 ubiC and Yersinia
FT                   pestis KIM ubiC."
FT                   /db_xref="EnsemblGenomes-Gn:YP_0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60736"
FT                   /db_xref="GOA:Q8ZJ20"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ20"
FT                   /protein_id="AAS60736.1"
FT                   /translation="MRGWLFYPRQGAFRMFIGDASILKPIQWCATEHPELPADIADWLM
FT                   ELGSMTRRFEQHCQRVHVEPQRECFITRDALGEEAEHLPVSQRYWLREIVLFGDNVPWL
FT                   LGRTVIPEETLSGPDRALVDLGTLPLGRYLFSGDALTRDYIHVGRQDNLWARRSLLRLS
FT                   GNPLLLTEVFLPASPLYTHCDSIPK"
FT   gene            498378..499244
FT                   /gene="ubiA"
FT                   /locus_tag="YP_0467"
FT                   /old_locus_tag="YP0467"
FT   CDS_pept        498378..499244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /locus_tag="YP_0467"
FT                   /old_locus_tag="YP0467"
FT                   /product="4-hydroxybenzoate octaprenyltransferase"
FT                   /note="similar to Yersinia pestis CO92 ubiA and Yersinia
FT                   pestis KIM ubiA. Contains UbiA prenyltransferase
FT                   (Interpro|IPR000537). Contains 4-hydroxybenzoate polyprenyl
FT                   transferase, proteobacterial (Interpro|IPR006370)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60737"
FT                   /db_xref="GOA:Q7CKP5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CKP5"
FT                   /protein_id="AAS60737.1"
FT                   /translation="MKGSTVHTKWQAYCRLMRIDKPIGSLLLLWPTLWALWLAGRGIPE
FT                   AKILVVFVLGVFFMRAAGCVVNDYADRHIDGFVKRTASRPLPSGTISEKESKILFVVLI
FT                   LLSFGLVLTLNSMTIWLSLAALALAWIYPFMKRVTHLPQVVLGAAFGWSIPMGFAAVSE
FT                   SLPLVCWLLLLANICWTVAYDTQYAMVDRDDDLRIGVKSTAILFGQHDKLIIGLLQLAT
FT                   LLLMVAIGWLMNLGGAFYWSILLAGALFTHQQKMIAQREREPCFRAFLNNNYVGLVLFL
FT                   GILISYW"
FT   gene            complement(499425..502031)
FT                   /gene="plsB"
FT                   /locus_tag="YP_0468"
FT                   /old_locus_tag="YP0468"
FT   CDS_pept        complement(499425..502031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsB"
FT                   /locus_tag="YP_0468"
FT                   /old_locus_tag="YP0468"
FT                   /product="glycerol-3-phosphate acyltransferase"
FT                   /note="similar to Yersinia pestis KIM plsB. Contains
FT                   Phospholipid/glycerol acyltransferase (Interpro|IPR002123,
FT                   (GO:0008152), (GO:0008415))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60738"
FT                   /db_xref="GOA:Q8ZJ18"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="InterPro:IPR028354"
FT                   /db_xref="InterPro:IPR041728"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ18"
FT                   /protein_id="AAS60738.1"
FT                   /translation="MVYLPLSYVNRDFCHFLLSHLHRSQNQFLVSLRRIANKRLQVVMS
FT                   GWRKIYYKLLNLPLKLLVKSKVIPADPVSELGLDPSRPILYVLPYNSKADLLTLRAQCL
FT                   AQDLPDPLIPLEIDGVQLPSHVFIENGPRVFRYYVPKQESVKLFHDYLDLHRNNPALDI
FT                   QMLPVSVMFGRSPGREGHGTPHLRVLNGVQKFFAVLWLGRDSFVRFSTTVSLRRMASEH
FT                   GTDKTIAHKLARVARMHFSRQRLAAVGPSLPARQDLFKKLLASKAIEKAVADEARSKKI
FT                   SHEKAQQNAITLMEEIAANFSYEAVRLSDRVLSWTWNRLYQGINVHNAERVRQLAQDGH
FT                   EIVYVPCHRSHMDYLLLSYVLYHQGLVPPHIAAGINLNFWPAGPIFRRLGAFFIRRTFK
FT                   GNKLYSTVFREYLGELFTRGYSVEYFVEGGRSRTGRLLEPKTGTLSMTIQAMLRGGTRP
FT                   ITLVPIYIGYEHVMEVGTYAKELRGAIKEKENLLQMLRGLRKLRNLGQGYVNFGEPLPL
FT                   TTYLNTHVPQWRDAIDPIEAQRPSWLTPAVNDLANQIMVRINNAAAANAMNLCSTALLA
FT                   SRQRSLTREQLLEQLDCYLQLMRNAPYAKDTTVPDKTPEELLNHALNMNKFEVEKDTIG
FT                   DIIILPREQAVLMTYYRNNIQHLLILPSLIASMVMYHRRITRTELLHKISMIYPMLKAE
FT                   LFLHYSKEQLPETLDTLIDELARQQLICDKGSELVLNPARIRPLQLLAAGVRETLQRYA
FT                   ITLSLLSATPSINRGALEKESRIMAQRLSVLHGINAPEFFDKAVFSTLVATLREEGYIS
FT                   DSGDAIQEHTLEVYNMLSALMTPEVKLTIESVSMPAETSNQPEAPETPEPEGKTES"
FT   gene            502030..502401
FT                   /gene="dgkA"
FT                   /locus_tag="YP_0469"
FT                   /old_locus_tag="YP0469"
FT   CDS_pept        502030..502401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgkA"
FT                   /locus_tag="YP_0469"
FT                   /old_locus_tag="YP0469"
FT                   /product="diacylglycerol kinase"
FT                   /note="similar to Yersinia pestis CO92 dgkA and Yersinia
FT                   pestis KIM dgkA. Contains Prokaryotic diacylglycerol kinase
FT                   (Interpro|IPR000829, (GO:0016020))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60739"
FT                   /db_xref="GOA:A0A2S9PJL9"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033718"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PJL9"
FT                   /protein_id="AAS60739.1"
FT                   /translation="MANQSTGLTRIYKAAGYTVKGLTAAWNNEAAFRQESVAAVIAIIL
FT                   AFWLDVGAIARILLICSVVLVLIVEVINSAIEAVVDRIGSEFHALSGRAKDMGSAAVFL
FT                   TILMALFVWITVLWQHVAR"
FT   gene            502526..503134
FT                   /gene="lexA1"
FT                   /locus_tag="YP_0470"
FT                   /old_locus_tag="YP0470"
FT   CDS_pept        502526..503134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lexA1"
FT                   /locus_tag="YP_0470"
FT                   /old_locus_tag="YP0470"
FT                   /product="LexA repressor"
FT                   /note="similar to Yersinia pestis CO92 lexA and Yersinia
FT                   pestis KIM lexA. Contains Peptidase family S24
FT                   (Interpro|IPR006197, (GO:0006508), (GO:0008236)). Contains
FT                   Peptidase S24, C-terminal (Interpro|IPR006198,
FT                   (GO:0006508), (GO:0008236)). Contains LexA DNA-binding
FT                   region (Interpro|IPR006199, (GO:0006508), (GO:0008992)).
FT                   Contains LexA repressor (Interpro|IPR006200, (GO:0006508),
FT                   (GO:0008992))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60740"
FT                   /db_xref="GOA:Q8ZJ16"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ16"
FT                   /protein_id="AAS60740.1"
FT                   /translation="MKALTTRQQEVYDLVRDHLAQTGMPPTRAEIAQRLGFRSPNAAEE
FT                   HLKALARKGVIEIVSGASRGIRLLMEEEEGLPLIGRVAAGEPLLAQQHIEGHYKVDPSL
FT                   FKPGADFLLRVNGMSMRDIGILDGDLLAVHKTQDVRNGQVVVARIDDEVTVKRLKKQGN
FT                   IVHLLPENSEFQPIVVDLREQSFTIEGLAVGVIRNGDWI"
FT   gene            complement(503308..503826)
FT                   /gene="fur1"
FT                   /locus_tag="YP_0471"
FT                   /old_locus_tag="YP0471"
FT   CDS_pept        complement(503308..503826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fur1"
FT                   /locus_tag="YP_0471"
FT                   /old_locus_tag="YP0471"
FT                   /product="putative regulator"
FT                   /note="similar to Yersinia pestis KIM y0573. Contains
FT                   Ferric-uptake regulator (Interpro|IPR002481, (GO:0006355))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60741"
FT                   /db_xref="GOA:Q8D1F3"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1F3"
FT                   /protein_id="AAS60741.1"
FT                   /translation="MNMMNPINQEKLLAQAESLCQQRNVRLTPQRLEVLRLMAQQPGAI
FT                   SAYDLLDLLRVAEPQAKPPTVYRALDFLLEQGFIHRVESANSYVLCHHFEEPTHTSALF
FT                   ICDRCKIVTERPTVGIEEALAQLAKQSGFTLRHSVVEAHGLCTECGVVEACESHDDCEH
FT                   DHSIVVKKK"
FT   gene            504072..505109
FT                   /locus_tag="YP_0472"
FT                   /old_locus_tag="YP0472"
FT   CDS_pept        504072..505109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0472"
FT                   /old_locus_tag="YP0472"
FT                   /product="putative TIM-barrel enzymes"
FT                   /note="similar to Yersinia pestis CO92 YPO0316 and Yersinia
FT                   pestis KIM y0574. Contains Protein of unknown function
FT                   UPF0034 (Interpro|IPR001269, (GO:0005554)). Contains
FT                   TIM-barrel protein yjbN family (Interpro|IPR004653,
FT                   (GO:0005554)); possibly dehydrogenases, nifR3 family"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60742"
FT                   /db_xref="GOA:Q8ZJ14"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ14"
FT                   /protein_id="AAS60742.1"
FT                   /translation="MHEAQTFSSTPATKPQYPLQRFSVAPMLDWTDRHCRYFHRLLTKQ
FT                   ALLYTEMVTTGAIIHGKADYLAYSEQDHPVALQLGGSDPQALAHCAKLAEQRGYNEINL
FT                   NVGCPSDRVQNGRFGACLMGEADLVADCIKAMRDAVAIPVTVKTRIGIDQLDSYEFLCE
FT                   FVQTVAERGECEIFTIHARKAWLSGLSPKENREVPPLDYERVYQLKRDFPALTIAINGG
FT                   VKTLAEAKEHLKHLDGVMMGREAYQNPGILTQVDRELFDPNAPVVDSVKAIEALYPYIE
FT                   QELSQGAYLGHITRHILGIFQGIPGARQWRRHLSENAHKPGAGVSVVEEALALVSPSYY
FT                   ESVGG"
FT   gene            505625..505843
FT                   /gene="malF1"
FT                   /locus_tag="YP_0473"
FT                   /old_locus_tag="YP0473"
FT   CDS_pept        505625..505843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malF1"
FT                   /locus_tag="YP_0473"
FT                   /old_locus_tag="YP0473"
FT                   /product="putative exported protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0318 and Yersinia
FT                   pestis KIM y0575"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60743"
FT                   /db_xref="GOA:A0A3N4AXD3"
FT                   /db_xref="InterPro:IPR014318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AXD3"
FT                   /protein_id="AAS60743.1"
FT                   /translation="MLEIFFVIGFFMVLMVTGISLLGILAALLVAAVFMMLGGLFVMMI
FT                   KLLPWLILAVVVAWIWRSMQKPVIRRY"
FT   gene            complement(506188..507240)
FT                   /gene="qor1"
FT                   /locus_tag="YP_0474"
FT                   /old_locus_tag="YP0474"
FT   CDS_pept        complement(506188..507240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qor1"
FT                   /locus_tag="YP_0474"
FT                   /old_locus_tag="YP0474"
FT                   /product="quinone oxidoreductase"
FT                   /note="similar to Yersinia pestis CO92 qor and Yersinia
FT                   pestis KIM qor. Contains Zinc-containing alcohol
FT                   dehydrogenase superfamily (Interpro|IPR002085,
FT                   (GO:0008270)). Contains Ribosomal protein L5
FT                   (Interpro|IPR002132, (GO:0006412)). Contains Quinone
FT                   oxidoreductase/zeta-crystallin (Interpro|IPR002364,
FT                   (GO:0008270))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60744"
FT                   /db_xref="GOA:Q8D1F2"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1F2"
FT                   /protein_id="AAS60744.1"
FT                   /translation="MSQVSEQSALVTSSKKAIPRGTDMAKHIQFTTTGGPDVLQYLEFT
FT                   PSDPAPHEVQVENKAIGINYIDTYVRSGLYPPAHLPSGLGTEAAGIVSKVGAAVSSVKV
FT                   GDRVVYAQSALGAYSEVHNVPADKIALLPEQISFEQAAASFLKGLTAYYLLRQTHEIKP
FT                   GEVFLFHAAAGGVGLIACQWAKALGAKLIGTVGSDEKAQLAKAAGAWATINYRTENIAQ
FT                   RVAELTEGEKVGVVYDSVGKSTWEASLDSLKRRGLLVSFGNASGPVTGVNLGILNQKGG
FT                   IYVTRPSLNVYVANRQELESASQQLFSMITSGAINVDVAQAQQFPLRDAQRAHETLEGR
FT                   QTTGSSLLIP"
FT   gene            507503..508909
FT                   /gene="dnaB"
FT                   /locus_tag="YP_0475"
FT                   /old_locus_tag="YP0475"
FT   CDS_pept        507503..508909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="YP_0475"
FT                   /old_locus_tag="YP0475"
FT                   /product="replicative DNA helicase"
FT                   /note="similar to Yersinia pestis CO92 dnaB and Yersinia
FT                   pestis KIM dnaB. Contains DnaB helicase
FT                   (Interpro|IPR001198, (GO:0006260)). Contains
FT                   ATP/GTP-binding site motif A (P-loop) (Interpro|IPR001687,
FT                   (GO:0005524)). Contains AAA ATPase (Interpro|IPR003593,
FT                   (GO:0000166))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60745"
FT                   /db_xref="GOA:A0A2S9PJM3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PJM3"
FT                   /protein_id="AAS60745.1"
FT                   /translation="MAAKKPTNKMTEPRDRQMEGLKLPPHSLEAEQSVLGGLMLDNERW
FT                   DNVSERVASKDFFSRPHRRIFTEMQRLLENSKPIDLITLSESLEQKGDLDSVGGFAYLA
FT                   ELSKNTPSAANIGAYADIVRERAVVREMISVANEIADAGYDPQGRSSEDLLDLAESKVF
FT                   QIAESRASKDEGPKSVDRILEDTVARIEQLYQRPHDGVTGVSTGFTDLDKKTAGLQKSD
FT                   LIIVAARPSMGKTTFAMNLCENAAMMQDKPVLIFSLEMPGDQIMMRMLASLSHVDQTRI
FT                   RTGQLDDEDWARISSTMGILMEKRNMYIDDSSGLTPTEVRSRARRIFREHGGLSLIMID
FT                   YLQLMRVPSLSDNRTLEIAEISRSLKALAKELQVPVVALSQLNRSLEQRADKRPVNSDL
FT                   RESGSIEQDADLIMFIYRDEVYHENSDEKGIAQIILGKQRNGPIGSVRLKFNGQWSRFD
FT                   NYAGPQYDDE"
FT   gene            509006..510085
FT                   /gene="alr"
FT                   /locus_tag="YP_0476"
FT                   /old_locus_tag="YP0476"
FT   CDS_pept        509006..510085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="YP_0476"
FT                   /old_locus_tag="YP0476"
FT                   /product="alanine racemase (biosynthetic)"
FT                   /note="similar to Yersinia pestis CO92 alr and Yersinia
FT                   pestis KIM alr. Contains Alanine racemase
FT                   (Interpro|IPR000821, (GO:0006522), (GO:0008784)). Contains
FT                   Protein of unknown function UPF0001 (Interpro|IPR001608)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60746"
FT                   /db_xref="GOA:Q8ZJ10"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ10"
FT                   /protein_id="AAS60746.1"
FT                   /translation="MKAATAVIDRHALRHNLQQIRRLAPQSRLVAVVKANAYGHGLLAA
FT                   AHTLQDADCYGVARISEALMLRAGGIVKPILLLEGFFDAEDLPVLVANHIETAVHSLEQ
FT                   LVALEAATLSAPINVWMKLDTGMHRLGVRPDQAEAFYQRLSACRNVIQPVNIMSHFSRA
FT                   DEPEVAATQQQLACFDAFAAGKPGKQSIAASGGILRWPQAHRDWVRPGIVLYGVSPFDA
FT                   PYGRDFGLLPAMTLKSSLIAVREHKAGESVGYGGTWVSERDTRLGVIAIGYGDGYPRSA
FT                   PSGTPVWLNGREVSIVGRVSMDMISIDLGPESTDKVGDEALMWGAELPVERVAACTGIS
FT                   AYELITNLTSRVAMEYLGE"
FT   gene            510271..511464
FT                   /gene="tyrB"
FT                   /locus_tag="YP_0477"
FT                   /old_locus_tag="YP0477"
FT   CDS_pept        510271..511464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrB"
FT                   /locus_tag="YP_0477"
FT                   /old_locus_tag="YP0477"
FT                   /product="aromatic-amino-acid aminotransferase"
FT                   /note="similar to Yersinia pestis CO92 tyrB and Yersinia
FT                   pestis KIM tyrB. Contains Aspartate/other aminotransferase
FT                   (Interpro|IPR000796, (GO:0006520), (GO:0008483)). Contains
FT                   Aminotransferase, class-I (Interpro|IPR004838,
FT                   (GO:0009058)). Contains Aminotransferase, class I and II
FT                   (Interpro|IPR004839, (GO:0009058))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60747"
FT                   /db_xref="GOA:A0A380PJK5"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A380PJK5"
FT                   /protein_id="AAS60747.1"
FT                   /translation="MFQNVDAYAGDPILSLMESFKADNRAHKVNLSIGLYYNEQGEIPQ
FT                   MQAVDAAEAQLSTQPHGTPVYLPMEGLQSYRTAIQQLLFGHDHPMLVQQRVATIQTVGG
FT                   SGALKVGADFLNHYFPDSQVWVSDPTWENHVAIFSGAGFKVNTYPYFDNDKLAVKFDPM
FT                   LATLQQLPARSIVLLHPCCHNPTGSDLTNAQWDRLIDVVKERELIPFLDIAYQGFGAGL
FT                   NEDAYAIRAMAAVGLPCLISNSFSKIFSLYNERVGGLSVVCESDEAAGRVLGQLKATVR
FT                   RNYSSPPNFGAQVVSKVLNDTVLRAQWQAEVEQMRLRILDMRHTLVEALKASLPERNFD
FT                   YLLQQRGMFSYTGFSEAQVESLREEFGVYLIASGRMCMAGVNHQNVEQVAVAFAAVQ"
FT   gene            511991..512350
FT                   /gene="mmcQ"
FT                   /locus_tag="YP_0478"
FT                   /old_locus_tag="YP0478"
FT   CDS_pept        511991..512350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmcQ"
FT                   /locus_tag="YP_0478"
FT                   /old_locus_tag="YP0478"
FT                   /product="YjbR"
FT                   /note="similar to Yersinia pestis CO92 YPO0323"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60748"
FT                   /db_xref="GOA:A0A3N4BBC3"
FT                   /db_xref="InterPro:IPR007351"
FT                   /db_xref="InterPro:IPR038056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BBC3"
FT                   /protein_id="AAS60748.1"
FT                   /translation="MNHSALLEYCLSKPGAEQCEHEQWQTNQIKVADVMFAMVGNIGGR
FT                   PSISLKSSPKLAERLREQHPEIVPSEHLNKTHWNTVFLDGKLPNSQFYTLIDHSYQLVL
FT                   QGLPEQRRQDLSSHL"
FT   gene            complement(512443..515286)
FT                   /gene="uvrA1"
FT                   /locus_tag="YP_0479"
FT                   /old_locus_tag="YP0479"
FT   CDS_pept        complement(512443..515286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA1"
FT                   /locus_tag="YP_0479"
FT                   /old_locus_tag="YP0479"
FT                   /product="excinuclease ABC subunit A"
FT                   /note="similar to Yersinia pestis CO92 uvrA and Yersinia
FT                   pestis KIM uvrA. Contains ATP/GTP-binding site motif A
FT                   (P-loop) (Interpro|IPR001687, (GO:0005524)). Contains ABC
FT                   transporter (Interpro|IPR003439, (GO:0016020)). Contains
FT                   Excinuclease ABC, A subunit (Interpro|IPR004602,
FT                   (GO:0009380), (GO:0009381))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60749"
FT                   /db_xref="GOA:Q8ZJ07"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ07"
FT                   /protein_id="AAS60749.1"
FT                   /translation="MDNIEVRGARTHNLKNINLIIPRDKLIVVTGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLSLMEKPDVDHIEGLSPAISIEQKSTSHNPRSTVGTITEI
FT                   HDYLRLLFARVGEPRCPDHDVPLAAQTVSQMVDNVISQPEGRRLMLLAPVVKDRKGEHT
FT                   KILENLAAQGYIRARIDGEVCDLSDPPKLELQKKHTIEVVVDRFKVREDLAQRLAESFE
FT                   TALALSGGTAVVADMDDPHVEELLFSANFACPICGYSMRELEPRLFSFNNPAGACPTCD
FT                   GLGVQQFFDPDRVLQNPELSLAGGAIRGWDRRNFYYFQMLRSLAEHYKFDIEAPFNSLD
FT                   SAVQQAVLYGSGKDTIEFKYINDRGDTTVRRHPFEGVLHNMERRYKETESSAVREELAK
FT                   FISNRSCASCSGTRLRREARYVFVENTTLPEISELSIGHALSFFQNMKLSGQRAQIAEK
FT                   ILKEIGDRLKFLVNVGLNYLSLSRSAETLSGGEAQRIRLASQIGAGLVGVMYVLDEPSI
FT                   GLHQRDNERLLETLIHLRNLGNTVIVVEHDEDAIRAADHVIDIGPGAGVHGGEVVAEGT
FT                   VDDIMAAPASLTGQFLSGKRSIAIPEKRVSADPSKVLKLIGATGNNLKDVTLTLPVGLF
FT                   SCITGVSGSGKSTLINDTLYSIAQRQLNGATITEPAPYREIQGLEHFDKVIDIDQSPIG
FT                   RTPRSNPATYTGIFTPIRELFAGVPESRTRGYTPGRFSFNVKGGRCEACQGDGVIKVEM
FT                   HFLPDIYVPCDHCKGKRYNRETLEVKYKGKSIHEVLAMTIEEAREFFDAVPALARKLQT
FT                   LIDVGLSYICLGQSATTLSGGEAQRVKLSRELSKRGTGQTLYILDEPTTGLHFADIQQL
FT                   LAVLHQLRDQGNTIVVIEHNLDVIKTADWIVDLGPEGGSGGGEILVSGTPETVAECAAS
FT                   HTARFLKPMLQRKPQTV"
FT   gene            515744..516292
FT                   /gene="ssb"
FT                   /locus_tag="YP_0480"
FT                   /old_locus_tag="YP0480"
FT   CDS_pept        515744..516292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="YP_0480"
FT                   /old_locus_tag="YP0480"
FT                   /product="single-strand binding protein"
FT                   /note="similar to Yersinia pestis CO92 ssb and Yersinia
FT                   pestis KIM ssb. Contains Single-strand binding protein
FT                   (Interpro|IPR000424)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60750"
FT                   /db_xref="GOA:Q8ZJ06"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ06"
FT                   /protein_id="AAS60750.1"
FT                   /translation="MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKQ
FT                   TGEQKEKTEWHRVVLFGKLAEVAGEYLRKGSQVYIEGALQTRKWQDQSGQERYTTEVVV
FT                   NVGGTMQMLGGRQGGGAPAGGGAAPQDGGAQGGWGQPQQPQGGNQFSGGQASRPAQPAP
FT                   AAPQGGNEPPMDFDDDIPF"
FT   gene            complement(516539..516856)
FT                   /locus_tag="YP_0481"
FT                   /old_locus_tag="YP0481"
FT   CDS_pept        complement(516539..516856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0481"
FT                   /old_locus_tag="YP0481"
FT                   /product="hypothetical protein"
FT                   /note="similar to Yersinia pestis KIM y0583"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60751"
FT                   /db_xref="GOA:Q0WJY2"
FT                   /db_xref="InterPro:IPR008000"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013448"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0WJY2"
FT                   /protein_id="AAS60751.1"
FT                   /translation="MMIRKAFVMAVNPDAHAEYQRRHTPIWPELESVLKAHGAHHYSIF
FT                   LDETRNLLFGVVEIESEERWNAVAQTAECQRWWQHMADVMPSHPDNSPVSQALREVFYL
FT                   E"
FT   gene            complement(516867..518015)
FT                   /gene="eutG"
FT                   /locus_tag="YP_0482"
FT                   /old_locus_tag="YP0482"
FT   CDS_pept        complement(516867..518015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutG"
FT                   /locus_tag="YP_0482"
FT                   /old_locus_tag="YP0482"
FT                   /product="putative alcohol dehydrogenase"
FT                   /note="similar to Yersinia pestis CO92 YPO0327 and Yersinia
FT                   pestis KIM y0584. Contains Iron-containing alcohol
FT                   dehydrogenase (Interpro|IPR001670, (GO:0016491))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60752"
FT                   /db_xref="GOA:A0A3N4AXD8"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR013460"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AXD8"
FT                   /protein_id="AAS60752.1"
FT                   /translation="MSFMLALPKISLHGTGAIGDMVKLLSDKQWGKALIVTDGQLVELG
FT                   LLDSLFAAMAQYQLPYGLFGEVFPNPTEELVQAGFAAFTQHQCDYLIAFGGGSPIDTAK
FT                   AIKILTANPGPSTAYSGVGKVKQTGVPLIAINTTAGTAAELTSNAVIIDSQRQVKEVII
FT                   DTNLIPDIAVDDPSVMLNIPASVTAATGMDALTHAVEAYVSLGAHTLTDHSALESIRLI
FT                   SQWLPLAVADGKNLQAREMMACGQYLAGMAFNSAGLGLVHALAHQPGATHNLPHGVCNA
FT                   ILLPVIEEYNRPQATRRFARIAQAMGVDTQDMSDEQASHQAIAAIRQLSLQVGIPAGFS
FT                   ALGIEESDIEGWLDKALADPCAPCNPRSADREQIRTLYLQAL"
FT   gene            complement(518082..518906)
FT                   /gene="rhaD"
FT                   /locus_tag="YP_0483"
FT                   /old_locus_tag="YP0483"
FT   CDS_pept        complement(518082..518906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhaD"
FT                   /locus_tag="YP_0483"
FT                   /old_locus_tag="YP0483"
FT                   /product="rhamnulose-1-phosphate aldolase"
FT                   /note="similar to Yersinia pestis CO92 rhaD and Yersinia
FT                   pestis KIM rhaD. Contains Class II aldolase/adducin,
FT                   N-terminal (Interpro|IPR001303)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60753"
FT                   /db_xref="GOA:Q8ZJ03"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR013447"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ03"
FT                   /protein_id="AAS60753.1"
FT                   /translation="MQAILSSWFIQGMIKATSDMWHKGWDERNGGNISLRLLAEEVEPY
FT                   RRDFYQQPRKVELTQPAPELANSWFLVTGSGKFFRNVELNPAENLVLLQVSNDGMAYHI
FT                   HWGLTQGGLPTSELAAHFQSHIVRMQVSGGTNRVIMHCHATNLIALSYVQKLENASFTR
FT                   LLWEGSTECLVVFPDGIGIVPWMVPGTDGIGTQTAEQMREHSLVLWPFHGIFGSGPTLD
FT                   DAFGLIDTAEKSAEIMVKVLSMGGKKQTISREQLIALAARFDVTPMAAALDA"
FT   gene            complement(518919..520181)
FT                   /gene="rhaA"
FT                   /locus_tag="YP_0484"
FT                   /old_locus_tag="YP0484"
FT   CDS_pept        complement(518919..520181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhaA"
FT                   /locus_tag="YP_0484"
FT                   /old_locus_tag="YP0484"
FT                   /product="L-rhamnose isomerase"
FT                   /note="similar to Yersinia pestis CO92 rhaA and Yersinia
FT                   pestis KIM rhaA."
FT                   /db_xref="EnsemblGenomes-Gn:YP_0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60754"
FT                   /db_xref="GOA:P58507"
FT                   /db_xref="InterPro:IPR009308"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58507"
FT                   /protein_id="AAS60754.1"
FT                   /translation="MHMTNSIEQAWDLAKQRFAAVGVDVDAALTRLDTLPVSMHCWQGD
FT                   DVTGFEDPDGVLTGGIQATGNYPGKARNATELRSDLELALALIPGPKRLNLHAIYLESD
FT                   TPVARNKIEPRHFSHWVAWAKKHQLGLDFNPSCFSHPLSADGFTLSHADPEIRQFWIEH
FT                   CQASRRVSAYFGEQLGTPSVMNIWIPDGMKDTPIDRLAPRQRLLSALDEVISEKLNPAH
FT                   HIDAVESKLFGIGAESYTVGSNEFYMGYAASRQTALCLDAGHFHPTEVISDKISSAMLY
FT                   VPRLLLHVSRPVRWDSDHVVLLDDETQAIASEIIRHNLFDRVHIGLDFFDASINRIAAW
FT                   VIGTRNMKKALLRALLEPTDRLRQLELRGDYTARLALLEEQKSLPWQAIWEGYCQRNDV
FT                   PVDARWLDAVREYEQQILSQR"
FT   gene            complement(520172..521629)
FT                   /gene="rhaB"
FT                   /locus_tag="YP_0485"
FT                   /old_locus_tag="YP0485"
FT   CDS_pept        complement(520172..521629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhaB"
FT                   /locus_tag="YP_0485"
FT                   /old_locus_tag="YP0485"
FT                   /product="rhamnulokinase"
FT                   /note="similar to Yersinia pestis CO92 rhaB and Yersinia
FT                   pestis KIM rhaB. Contains Carbohydrate kinase, FGGY
FT                   (Interpro|IPR000577, (GO:0005975))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60755"
FT                   /db_xref="GOA:Q8ZJ02"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR013449"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ02"
FT                   /protein_id="AAS60755.1"
FT                   /translation="MVAIDLGASSGRVMLASYYPGQQQLTLREVCRFTNQIKSIDGSDV
FT                   WDIDAIEQSIREGLSQLDSEGIALDSIGIDSWGVDFVLLDKQGKRIGQPVSYRDSRTQG
FT                   VMARAQQTLGSNAIYRRTGIQFLPFNTLYQLRALSEQQPHLLADVAHLLLIPDYLHYRL
FT                   TGQLNWEYTNASTTQLLNIETGDWDSDLLAYAGVPAHWFAKPGKPGNTIGYWHSANGQQ
FT                   VPVVAVATHDTASAVLAAPLIDADAAYLSSGTWSLMGFESGTPLTHQQAQCSNITNEGG
FT                   AEGRYRVLKNIMGLWLLQRATDELQIDDLPQLIEQAARQPACRSLINPNDSRFINPPNM
FT                   CREIQNACREHQFPVPNTAAQLARCIFDSLAMLYRQVAQELATLRGRPISHLHIVGGGC
FT                   QNQFLNQLCADACGLNVSMGPVEASTLGNIGSQLISLGEVADVTHYRRIVANNFPLHHL
FT                   SPHDNSDFAAHWLQFQSLSQLPKELCI"
FT   gene            521628..521834
FT                   /gene="purM"
FT                   /locus_tag="YP_0486"
FT                   /old_locus_tag="YP0486"
FT   CDS_pept        521628..521834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="YP_0486"
FT                   /old_locus_tag="YP0486"
FT                   /product="Phosphoribosylaminoimidazol (AIR) synthetase"
FT                   /note="similar to Yersinia pestis KIM y0588"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60756"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLQ5"
FT                   /protein_id="AAS60756.1"
FT                   /translation="MCRAAFGDVTADGEHVGCEHMGCAYVDGEHVDGVGMISGLLFLNA
FT                   NSVEICLFDDLLITANRYGLMAE"
FT   gene            522056..522877
FT                   /gene="rhaS"
FT                   /locus_tag="YP_0487"
FT                   /old_locus_tag="YP0487"
FT   CDS_pept        522056..522877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhaS"
FT                   /locus_tag="YP_0487"
FT                   /old_locus_tag="YP0487"
FT                   /product="L-rhamnose operon regulatory protein"
FT                   /note="similar to Yersinia pestis CO92 rhaS and Yersinia
FT                   pestis KIM rhaS. Contains Helix-turn-helix, AraC type
FT                   (Interpro|IPR000005, (GO:0006355))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60757"
FT                   /db_xref="GOA:Q8ZJ00"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR023609"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ00"
FT                   /protein_id="AAS60757.1"
FT                   /translation="MTVLHSIDFFSSSSAPVAIEARAPQSAFPEHHHDFYEIVIVEEGA
FT                   GVHVFNGNPYTLSRGCVCFVRDHDRHLFESTDDLFLTNVLFRAPDAFRFLSGVGHFLPR
FT                   ECDGVYPSHWRVNGQVLQQIKCLIACLEHAPKSDQVEDIALHESVFMQLLVKLWQGCQT
FT                   QVGDDQEGRLYQLLDWLQNNYSEAVEWPELADRFALPLRTLHRQLKNKTGMTPQRYLTR
FT                   LRLLQARHQLCYSDNSVTDIAYLCGFGDSNHFSTLFKREFSQSPRDLRSQL"
FT   gene            523010..523882
FT                   /gene="rhaR"
FT                   /locus_tag="YP_0488"
FT                   /old_locus_tag="YP0488"
FT   CDS_pept        523010..523882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhaR"
FT                   /locus_tag="YP_0488"
FT                   /old_locus_tag="YP0488"
FT                   /product="L-rhamnose operon transcriptional activator"
FT                   /note="similar to Yersinia pestis CO92 rhaR and Yersinia
FT                   pestis KIM rhaR. Contains Helix-turn-helix, AraC type
FT                   (Interpro|IPR000005, (GO:0006355)). Contains Cupin domain
FT                   (Interpro|IPR007113)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60758"
FT                   /db_xref="GOA:Q8ZIZ9"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR023699"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIZ9"
FT                   /protein_id="AAS60758.1"
FT                   /translation="MRAPLLLESRDYLLSEQMPVAVTNRYPQETFVEHTHQFCEIVIVW
FT                   RGNGLHVLNDHPYRITCGDVFYIQAADHHSYESVHDLVLDNIIYCPERLHLNAQWHKLL
FT                   PPLGPEQNQGYWRLTTQGMAQARPIIQQLAQESRKTDSWSIQLTEVLLLQLAIVLKRHR
FT                   YRAEQAHLLPDGEQLDLIMSALQQSLGAYFDMADFCHKNQLVERSLKQLFRQQTGMSIS
FT                   HYLRQIRLCHAKCLLRGSEHRISDIAARCGFEDSNYFSAVFTREAGMTPRDYRQRFIRS
FT                   PVLPAKNEP"
FT   gene            complement(524051..525139)
FT                   /gene="rhaT2"
FT                   /locus_tag="YP_0489"
FT                   /old_locus_tag="YP0489"
FT   CDS_pept        complement(524051..525139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhaT2"
FT                   /locus_tag="YP_0489"
FT                   /old_locus_tag="YP0489"
FT                   /product="L-rhamnose-proton symport protein"
FT                   /note="similar to Yersinia pestis CO92 rhaT and Yersinia
FT                   pestis KIM rhaT. Contains RhaT l-rhamnose-proton symport
FT                   (Interpro|IPR004673, (GO:0008645), (GO:0016021))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60759"
FT                   /db_xref="GOA:Q8ZIZ8"
FT                   /db_xref="InterPro:IPR004673"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIZ8"
FT                   /protein_id="AAS60759.1"
FT                   /translation="MRPSCSAPTRTITAKDNKMNNAIILGIIWHLVGAASAACFYAPFK
FT                   QVKKWSWETMWSIGGLVSWLILPWTVSYLLLPDFWQYYGSFSIATLLPVFLFGAMWGIG
FT                   NINYGLTMRYLGMSMGIGIAIGITLIIGTLMTPILQGRFDVLLGTPGGRMTLLGVFVAL
FT                   IGVAIVSYAGLLKERAMGIQAEEFNLKKGLILAVMCGIFSAGMSFAMDAAKPMHEAASA
FT                   LGINSLYVALPSYVIIMGGGAIINLSYCFIRLATLKNLSVKADFSVAKPLLITNILFSA
FT                   LAGLMWYLQFFFYAWGHAKIPQQYDYMSWMLHMSFYVLCGGIVGLLLKEWKCSTKKPVA
FT                   VLCIGCLVIILAANIVGLGMAA"
FT   gene            525239..525505
FT                   /locus_tag="YP_0490"
FT                   /old_locus_tag="YP0490"
FT   CDS_pept        525239..525505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0490"
FT                   /old_locus_tag="YP0490"
FT                   /product="hypothetical protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0335 and Yersinia
FT                   pestis KIM y0594"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60760"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AXH3"
FT                   /protein_id="AAS60760.1"
FT                   /translation="MMMITKWHSGGRLTGFMALTAVSQQKLRCPCSSLSLSVVDLKISS
FT                   VVDLKINKRLGINELPHLNRINAVQKGSRLLASRSNLGISLLS"
FT   gene            complement(525941..526366)
FT                   /locus_tag="YP_0491"
FT                   /old_locus_tag="YP0491"
FT   CDS_pept        complement(525941..526366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0491"
FT                   /old_locus_tag="YP0491"
FT                   /product="putative exported protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0337 and Yersinia
FT                   pestis KIM y0596"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60761"
FT                   /db_xref="GOA:A0A3N4AXE7"
FT                   /db_xref="InterPro:IPR008992"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AXE7"
FT                   /protein_id="AAS60761.1"
FT                   /translation="MRYLLSLSVFLIVSLNPAFAEWTGDNVEGMHSGMIINKFHSGQVD
FT                   GKPYFCIEAFKPSTTITACSVKDTSIWGASYNTLYDQAMYYYTTGKRIRVYYAPDVWTN
FT                   NSFVRALTANALVGFSTCISESSCFGPDRKKHKFTVH"
FT   gene            526596..526763
FT                   /locus_tag="YP_0492"
FT                   /old_locus_tag="YP0492"
FT   CDS_pept        526596..526763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0492"
FT                   /old_locus_tag="YP0492"
FT                   /product="hypothetical protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0338"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BL43"
FT                   /protein_id="AAS60762.1"
FT                   /translation="MATFSDGSFFIDNKTPYFNLLIMGEVLIIYEVLDIFQNNFLYVNI
FT                   TNELHWGFNL"
FT   gene            526778..529348
FT                   /locus_tag="YP_0493"
FT                   /old_locus_tag="YP0493"
FT   CDS_pept        526778..529348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0493"
FT                   /old_locus_tag="YP0493"
FT                   /product="enhancing factor (viral)"
FT                   /note="similar to Yersinia pestis CO92 YPO0339 and Yersinia
FT                   pestis KIM y0597. Contains Viral enhancin protein
FT                   (Interpro|IPR004954). Contains Neutral zinc
FT                   metallopeptidases, zinc-binding region (Interpro|IPR006025,
FT                   (GO:0008237), (GO:0008270))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60763"
FT                   /db_xref="InterPro:IPR004954"
FT                   /db_xref="InterPro:IPR031161"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AXF7"
FT                   /protein_id="AAS60763.1"
FT                   /translation="MRVIFMRQVTKSKKIKILPYPEWLVKAGMSKGIDHDRQHLGIILA
FT                   AGEMIKVRQVNAEYKEKLKLYLLNDNKNTQRSISFNTDWIELSVDAISVPFINTPYSDG
FT                   IIPEIVFEYPDTSKLLPVYEKGEDESIFFESWDKQNAEFGVVESEYVIILIPEVSKDRL
FT                   KSFSTSGGIDTVLGFYQDIFSFNNSLAGLSFEPQRYSDGNTRNRYFAKADKGGGGAAYY
FT                   SNNWIASSSGSINTFWLSPNATNWGCLHEIAHGYQGGFIDDKYFSTREVWNNIYAACYQ
FT                   DVMLGAEKFNKGWLYNFGKQKEVEKSILNNINNGKEVNAWGERSKLYFIMLMLEKAGVN
FT                   CFTHFNQIYRERKNTDQSVGSVLDMLSNSFATVENRVDVTLFLQMVGGHISKNQYQRNL
FT                   FSHAKAVYPLNQLLQGDELTAVKKTLDLNSELSLVDVDSIEFTDIKSNLTLQFSIDDFA
FT                   QIYGEELLILNGDNYVYNQSIMDKKQTLYNLPVGAYTLRIPTGRNKKYAPQINYLIVKN
FT                   EDSQTQVDFVHRIGSPIVSQKISLQGLNDYTFATIFFDQENDTVSVDITKTKPHYHFPG
FT                   MYARIRIKDKDNNELLNEVITGTNQSLSKNDFPLSSCYVIDIFHKEPGRVKLTPAYKGV
FT                   IDNKSSYNEFIITPYGLQNIKLNNDPKVFLLENIKSAAEMLRSHPIMWHANFSEAKDNI
FT                   YLAIDIFPSPQKEGLLEQYADCISSYYEKPNEDLGNAFSFIFKGINDREFLTTKLNLVT
FT                   KKLEVKIVSGTPHSGFKRTYAVLRYFNADGNELLNLDIIGSKKQAGQEWVFPISGYGGE
FT                   KLYLQHVEPKNRLVITNIMQGIRLSSRTSIQTYEIESLGLSRCT"
FT   gene            complement(529782..529857)
FT                   /locus_tag="YP_t7"
FT                   /old_locus_tag="tRNA-Phe_1"
FT   tRNA            complement(529782..529857)
FT                   /locus_tag="YP_t7"
FT                   /old_locus_tag="tRNA-Phe_1"
FT                   /product="tRNA-Phe"
FT                   /note="codon recognized: UUC; Cove score 84.11"
FT   gene            complement(530002..530577)
FT                   /gene="acrR1"
FT                   /locus_tag="YP_0494"
FT                   /old_locus_tag="YP0494"
FT   CDS_pept        complement(530002..530577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrR1"
FT                   /locus_tag="YP_0494"
FT                   /old_locus_tag="YP0494"
FT                   /product="putative TetR-family regulatory protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0341 and Yersinia
FT                   pestis KIM y0598. Contains Bacterial regulatory protein
FT                   TetR, HTH motif (Interpro|IPR001647, (GO:0006355))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60764"
FT                   /db_xref="GOA:A0A3N4B1V7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B1V7"
FT                   /protein_id="AAS60764.1"
FT                   /translation="MQREQVLSNALNLLEQQGLANTTLEMLAKALSVEVSDLTRFWPDR
FT                   EALLYDCLRYHSQQIDTWRRQLQLDETLSPQQKLLARYQTLSEQVQNQRYPGCLFIAAC
FT                   SFYPDTEHPIHQLAEQQKQASLHYTKALLQEMDADDADMVAQQMELILEGCLSKLLIKR
FT                   QLADVEVAKCLAEDILTVAQCRKNGALS"
FT   gene            530997..533012
FT                   /gene="gltD1"
FT                   /locus_tag="YP_0496"
FT                   /old_locus_tag="YP0496"
FT   CDS_pept        530997..533012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltD1"
FT                   /locus_tag="YP_0496"
FT                   /old_locus_tag="YP0496"
FT                   /product="putative oxidoreductase, Fe-S subunit"
FT                   /note="similar to Yersinia pestis KIM y0599. Contains
FT                   Pyridine nucleotide-disulphide oxidoreductase, class-II
FT                   (Interpro|IPR000103, (GO:0006118), (GO:0008246)). Contains
FT                   NAD binding site (Interpro|IPR000205). Contains Adrenodoxin
FT                   reductase (Interpro|IPR000759, (GO:0006118)). Contains
FT                   Flavin-containing monooxygenase FMO (Interpro|IPR000960,
FT                   (GO:0006118)). Contains Pyridine nucleotide-disulphide
FT                   oxidoreductase, class I (Interpro|IPR001100, (GO:0006118),
FT                   (GO:0008246)). Contains FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase (Interpro|IPR001327,
FT                   (GO:0006118), (GO:0015036)). Contains 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain (Interpro|IPR001450,
FT                   (GO:0006118), (GO:0009497)). Contains Glutamate synthase,
FT                   NADH/NADPH, small subunit 2 (Interpro|IPR006006,
FT                   (GO:0006537), (GO:0016639))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60766"
FT                   /db_xref="GOA:A0A2S9PJQ7"
FT                   /db_xref="InterPro:IPR006006"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PJQ7"
FT                   /protein_id="AAS60766.1"
FT                   /translation="MNPFIVADAESCIGCRSCEVACVVAHHEGQFPDKPEYFTPRVKVF
FT                   KGDQCATAVFCHHCEDAPCASTCPNGAIVELNNRVQVIQEKCIGCKTCMIACPFGMMTV
FT                   VTETVQPASHRLADVYRRTEAQKCDLCLDQPDGPACIKTCPTQALTLVDQQYLLHQQQQ
FT                   KRQHMALNEHNGRLFSRAVVQAASASSNKSIRDATPVNLLQRPRAPRLEPKKIPLAERK
FT                   TGFAEIYLPFTESQIHEQAERCLECGDKTICQWTCPLHNAIPKWISLAHQGRIHEAAEL
FT                   SHQTSSLPEVCGRVCPQDRLCEQSCTLNDHDGAVTIGQIERHITETALATGWRPDLSQV
FT                   KPSGKRVAIIGAGPAGLGCADILVRNGITPVVFDRYPEIGGLLTFGIPAFKLEKSVMTR
FT                   RREIFTEMGVEFCLNTEIGRDITMENLLHDFDALFLGVGTYRSMRSGLENEDAQGVYDA
FT                   LPFLIGNTQHLMGYTANGAHPYVSMQDQRVVVLGGGDTAMDCVRTSLRQGASRVVCAYR
FT                   RDEKNMPGSKREVKNAREEGAEFMFNLQPMSIVVDESGQVTGIKMVRTEMGQADAQGRR
FT                   QALPITGSEHLIPADAVIMAFGFSPHRMSWLAEHNVVLDKQGRVVAPTISGYPYQTSNP
FT                   KIFAGGDIVRGADLIVTAIAEGRKAAESIAYYLNVL"
FT   gene            533035..533592
FT                   /gene="hydN"
FT                   /locus_tag="YP_0497"
FT                   /old_locus_tag="YP0497"
FT   CDS_pept        533035..533592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hydN"
FT                   /locus_tag="YP_0497"
FT                   /old_locus_tag="YP0497"
FT                   /product="4Fe-4S ferrodoxin"
FT                   /note="similar to Yersinia pestis CO92 hydN and Yersinia
FT                   pestis KIM hydN. Contains Cytochrome c heme-binding site
FT                   (Interpro|IPR000345, (GO:0006118)). Contains 7Fe ferredoxin
FT                   (Interpro|IPR000813, (GO:0006118), (GO:0009497)). Contains
FT                   4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   (Interpro|IPR001450, (GO:0006118), (GO:0009497))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60767"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AXH9"
FT                   /protein_id="AAS60767.1"
FT                   /translation="MNRFVIADMTQCIGCRTCEIACVVAHSADNKVSTLMPEQFHPRLS
FT                   VMKSFAVSTPILCHQCEDAPCENACPNGAIITGSHGVQLLASRCIGCKTCMLVCPFGAM
FT                   SIIERPADGQQAADSQPVMASGSGRAQAHKCDLCHQRESGPACIEVCPTNALKLVTPGV
FT                   LEALQREKQLRAARGSAPGIAR"
FT   gene            533615..535762
FT                   /gene="fdhF"
FT                   /locus_tag="YP_0498"
FT                   /old_locus_tag="YP0498"
FT   CDS_pept        533615..535762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdhF"
FT                   /locus_tag="YP_0498"
FT                   /old_locus_tag="YP0498"
FT                   /product="formate dehydrogenase H"
FT                   /note="similar to Yersinia pestis CO92 fdhF and Yersinia
FT                   pestis KIM fdhF. Contains Formate dehydrogenase, alpha
FT                   subunit (Interpro|IPR006478). Contains Prokaryotic
FT                   molybdopterin oxidoreductase (Interpro|IPR006655,
FT                   (GO:0006118)). Contains Molybdopterin oxidoreductase
FT                   (Interpro|IPR006656). Contains Molydopterin dinucleotide
FT                   binding domain (Interpro|IPR006657). Contains Molybdopterin
FT                   oxidoreductase Fe4S4 domain (Interpro|IPR006963)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60768"
FT                   /db_xref="GOA:A0A380PJM3"
FT                   /db_xref="InterPro:IPR006478"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR041924"
FT                   /db_xref="UniProtKB/TrEMBL:A0A380PJM3"
FT                   /protein_id="AAS60768.1"
FT                   /translation="MKKILTVCPYCGSGCKLNLLVEDGEIVGAEPADGVTNQGALCLKG
FT                   YYGWDFLNDTRLLTPRLTTPLLRRQRGEAFQPVSWEAAIAFITAKLSAIKERHGPDAIM
FT                   MTGSSRGPGNEANYVMQKFARAAIGTNNIDCCARLCHGPSVAGLQQTLGNGAMSNSIGE
FT                   IENTDCILVFGYNAADSHPIVARRILKAKNKGAKLIVCDPRHIETARIADQWLPLKNGA
FT                   NMALVNAFIHVLIEEKLYDANYVRDHTRGFDELKAGVAAYRPEDVEPITGLSAKAVRQA
FT                   MRTYAAAPAATLLWGMGVTQWGQAVDVVKGLSSLALLTGNLGRPNVGVGPVRGQNNVQG
FT                   ACDMGVLPNTFPGYEKVTDSEARARFAHAWGVAELPAHVGYSITDVPHKVAEGKLKAYY
FT                   VFGEDPIQTEPDLAAMRAAFAALDLVVVQDIFMTKTAELADVVLPATSWGEHEGVYTSA
FT                   DRGFQHFNKAIEPKGDVKPDWEIISLISTAMGYPMAYQNTQQIWDEMRGLCPPFAGVTY
FT                   EKLAGLGYVQWPCPTEDHPGTPYLYTDNQFATADGKGLLSCAPWQPPHEQTDSDYPLAL
FT                   CTVREVGHYSCRSMTGNCGTLKILADEPGYVQIHPEDASYLGVIDQALIWISSRRGKVI
FT                   ARASVTERANRGAVYMTYQWWIGACNELTVDHVDPVSKTPEFKHCAVKVEAISDQTAAE
FT                   QYVEQQYSQLKKRLSDAAVVP"
FT   gene            complement(535824..537611)
FT                   /gene="dsbD"
FT                   /locus_tag="YP_0499"
FT                   /old_locus_tag="YP0499"
FT   CDS_pept        complement(535824..537611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbD"
FT                   /locus_tag="YP_0499"
FT                   /old_locus_tag="YP0499"
FT                   /product="thiol:disulfide interchange protein"
FT                   /note="similar to Yersinia pestis CO92 dsbD and Yersinia
FT                   pestis KIM dsbD. Contains Cytochrome c biogenesis protein,
FT                   transmembrane region (Interpro|IPR003834, Cellular
FT                   Component: membrane (GO:0016020), (GO:0017004)). Contains
FT                   Thioredoxin type domain (Interpro|IPR006662, (GO:0006118)).
FT                   Contains Thioredoxin domain 2 (Interpro|IPR006663,
FT                   (GO:0006118))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60769"
FT                   /db_xref="GOA:Q8ZIY9"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIY9"
FT                   /protein_id="AAS60769.1"
FT                   /translation="MAQRFITLILLLCSVLLAPHSAQSSLFGENASFGTKNSQSRFIPV
FT                   DQAFAFDFHQQGDQLNLSWQIHPGYYLYRQQIKIVPQQAALGAFTLQEGITHHDEFYGE
FT                   VEIFKQQLTLKIPITQAAEQASVSVTYQGCAEAGFCYPPETRVIPLDVVVAASTASGTA
FT                   AVNSSATVNPPATTQPEGDATPVPSTLPFSPLWALLIGIGIAFTPCVLPMYPLISAVIL
FT                   GREKPHSQRRILILAVVYVQGMALTYTLLGLVVAAAGLQFQAALQHPYVLIGLSVLFVL
FT                   LALSMFGLYSLQLPSSLQTRLTQWSNSQRGGSLAGVFAMGALAGLICSPCTTAPLSAIL
FT                   LYIAQSGNMLAGGGTLYLYALGMGIPLVVVTLFGNKLIPRSGPWMQYVKEAFGFVILAL
FT                   PVFLLERVLGDVWGLRLWSLLAVAFFGWAFVLSLKAHAGWVRVCQLLLLAALLIVARPL
FT                   QDWAFNGNTQQNAVKHINFQPVANLPQLQAVLAQAQGKPVMLDLYADWCVACKEFEKYT
FT                   FSDDKVQRQLANTLLLQADVTANNAEHATLLKKFNVLGLPTILFFDSQGNEITAARVTG
FT                   FMDAAQFLQHLQNTPAVTK"
FT   gene            complement(537587..537946)
FT                   /gene="cutA"
FT                   /locus_tag="YP_0500"
FT                   /old_locus_tag="YP0500"
FT   CDS_pept        complement(537587..537946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutA"
FT                   /locus_tag="YP_0500"
FT                   /old_locus_tag="YP0500"
FT                   /product="putative cation tolerance protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0346 and Yersinia
FT                   pestis KIM cutA. Contains CutA1 divalent ion tolerance
FT                   protein (Interpro|IPR004323)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60770"
FT                   /db_xref="GOA:Q74XD3"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR023700"
FT                   /db_xref="PDB:3GSD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q74XD3"
FT                   /protein_id="AAS60770.1"
FT                   /translation="MSDSDAMTDPNAVSYSNAIVVLCTAPDEASAQNLAAQVLGEKLAA
FT                   CVTLLPGATSLYYWEGKLEQEYEVQLLFKSNTDHQQALLTYIKQHHPYQTPELLVLPVR
FT                   DGDKDYLSWLNASLL"
FT   gene            complement(538131..539432)
FT                   /gene="dcuA"
FT                   /locus_tag="YP_0501"
FT                   /old_locus_tag="YP0501"
FT   CDS_pept        complement(538131..539432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcuA"
FT                   /locus_tag="YP_0501"
FT                   /old_locus_tag="YP0501"
FT                   /product="anaerobic C4-dicarboxylate transporter"
FT                   /note="similar to Yersinia pestis CO92 dcuA and Yersinia
FT                   pestis KIM dcuA. Contains Anaerobic c4-dicarboxylate
FT                   membrane transporter (Interpro|IPR004668, (GO:0016021))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60771"
FT                   /db_xref="GOA:A0A0H2W1R3"
FT                   /db_xref="InterPro:IPR004668"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W1R3"
FT                   /protein_id="AAS60771.1"
FT                   /translation="MIAIELVIVLLAIFLGARLGGIGIGFAGGIGVLVLAIIGVKPGSI
FT                   PFDVISIIMAVIAAISAMQVAGGMDYLVQQTEKLLRKNPKHITILAPLVTYFLTIFAGT
FT                   GNISLSALPVIAEVAKEQGIKPCRPLSTAVVSAQIAITASPISAAVVYMSSVMEGQGVS
FT                   YLHLLMIVIPSTLCAVFVMSLIVSWCFSSKLSDDPIYLKRLEEGLVTLRGDTVKVIKPR
FT                   AKTSVLLFLAGVLCVVAYAIINSPSVGLVETPLMNTTNAILIIMLSVATITTLVCSVDT
FT                   DSILNSSTFKAGMSACICILGVAWLGDTFVQHNLEWIKETAGSLIQAHSWLLAVIFFFC
FT                   SALLYSQAATAKALMPMALALNVSPLAAIASFAAVSGLFILPTYPTLVAAVQMDDTGTT
FT                   RIGRFVFNHPFFIPGTIGVALAVCFGFVMGGLVL"
FT   gene            complement(539552..540988)
FT                   /gene="aspA"
FT                   /locus_tag="YP_0502"
FT                   /old_locus_tag="YP0502"
FT   CDS_pept        complement(539552..540988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspA"
FT                   /locus_tag="YP_0502"
FT                   /old_locus_tag="YP0502"
FT                   /product="aspartate ammonia-lyase"
FT                   /note="similar to Yersinia pestis CO92 aspA and Yersinia
FT                   pestis KIM aspA. Contains Fumarate lyase
FT                   (Interpro|IPR000362, (GO:0003824)). Contains Delta
FT                   crystallin (Interpro|IPR003031). Contains Aspartate
FT                   ammonia-lyase (Interpro|IPR004708, (GO:0006531),
FT                   (GO:0008797))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60772"
FT                   /db_xref="GOA:A0A0H2W1L7"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W1L7"
FT                   /protein_id="AAS60772.1"
FT                   /translation="MSNNIRIEEDLLGTREVPAEAYYGVHTLRAIENFYISNSKISDVP
FT                   EFVRGMVMVKKAAAMANKELHTIPRKIADIIIQACDEVLDKGKCMDQFPVDVFQGGAGT
FT                   SLNMNTNEVLANIGLELMGHQKGEYQYLNPNDHLNKCQSTNDAYPTGFRIAVYASILKL
FT                   IDAINQLGEGFGRKSKEFEKILKMGRTQLQDAVPMTLGQEFRAFQVLLNEETKNLQRTA
FT                   ELLLEVNLGATAIGTALNTPEGYSQLAVQKLAEISGLACVPAEDLIEATSDCGAYVMVH
FT                   SALKRLAVKMSKICNDLRLLSSGPRTGLNEINLPELQAGSSIMPAKVNPVIPEVVNQVC
FT                   FKVIGNDTCITMAAEAGQLQLNVMEPVIGQAMFESIHILTNACYNLLEKCINGITANKE
FT                   VCERYVFNSIGIVTYLNPFIGHHNGDIVGKICAETGKNVREVVLERGLLTEAELDDIFS
FT                   VENLMHPAYKAKRYTDENEQ"
FT   gene            541541..542014
FT                   /gene="fxsA"
FT                   /locus_tag="YP_0504"
FT                   /old_locus_tag="YP0504"
FT   CDS_pept        541541..542014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fxsA"
FT                   /locus_tag="YP_0504"
FT                   /old_locus_tag="YP0504"
FT                   /product="putative membrane protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0349 and Yersinia
FT                   pestis KIM y0607."
FT                   /db_xref="EnsemblGenomes-Gn:YP_0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60774"
FT                   /db_xref="GOA:A0A0H2W0R9"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W0R9"
FT                   /protein_id="AAS60774.1"
FT                   /translation="MIISSCVGISLVRNQGIKTFIQMQQKLAAGESPAAEMIKSVSLVL
FT                   AGILLLIPGFFTDFLGLLLLLPWVQKTLTLKLMPHLNIYRGGSFGGAGFGNGGFGNDSF
FT                   GNRHGSGPMSGGDTFDGEFQRKDDDRFTVEHRPDKNEQVANSRSNDDSFKDDK"
FT   gene            542269..542562
FT                   /gene="groES"
FT                   /locus_tag="YP_0505"
FT                   /old_locus_tag="YP0505"
FT   CDS_pept        542269..542562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="YP_0505"
FT                   /old_locus_tag="YP0505"
FT                   /product="10 kDa chaperonin"
FT                   /note="similar to Yersinia pestis CO92 groES and Yersinia
FT                   pestis KIM mopB. Contains Chaperonin Cpn10
FT                   (Interpro|IPR001476)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60775"
FT                   /db_xref="GOA:Q8ZIY4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIY4"
FT                   /protein_id="AAS60775.1"
FT                   /translation="MKIRPLHDRVIVKRKEVESKSAGGIVLTGTAAGKSTRGEVLAVGN
FT                   GRILDNGEIKPLDVKVGDVVIFNDGYGVKAEKIDNEEVLIMSESDILAIVEA"
FT   gene            542609..544255
FT                   /gene="groEL"
FT                   /locus_tag="YP_0506"
FT                   /old_locus_tag="YP0506"
FT   CDS_pept        542609..544255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="YP_0506"
FT                   /old_locus_tag="YP0506"
FT                   /product="60 kDa chaperonin"
FT                   /note="similar to Yersinia pestis CO92 groEL and Yersinia
FT                   pestis KIM mopA. Contains Chaperonin Cpn60
FT                   (Interpro|IPR001844). Contains Chaperonin Cpn60/TCP-1
FT                   (Interpro|IPR002423)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60776"
FT                   /db_xref="GOA:Q8ZIY3"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIY3"
FT                   /protein_id="AAS60776.1"
FT                   /translation="MAAKDVKFGNDARIKMLRGVNILADAVKVTLGPKGRNVVLDKSFG
FT                   SPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIITEGL
FT                   KAVAAGMNPMDLKRGIDKAVIAAVEELKKLSVPCSDSKAIAQVGTISANSDSTVGELIA
FT                   QAMEKVGKEGVITVEEGSGLQDELDVVEGMQFDRGYLSPYFINKPETGSIELESPFILL
FT                   ADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGF
FT                   GDRRKAMLQDIATLTAGTVISEEIGLELEKTTLEDLGQAKRVVINKDTTIIIDGVGDEA
FT                   AIQGRVAQIRQQIEDATSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDA
FT                   LHATRAAVEEGVVAGGGVALIRAAHAIAGLKGDNEDQNVGIKVALRAMESPLRQIVVNA
FT                   GEEASVIANKVKAGEGSFGYNAYTEEYGDMIAMGILDPTKVTRSALQYAASIAGLMITT
FT                   ECMVTDLPRDDKGADMGAGGMGGMGGMGGMM"
FT   gene            544879..545277
FT                   /locus_tag="YP_0508"
FT                   /old_locus_tag="YP0508"
FT   CDS_pept        544879..545277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0508"
FT                   /old_locus_tag="YP0508"
FT                   /product="putative lipoprotein"
FT                   /note="similar to Yersinia pestis CO92 YPO0352."
FT                   /db_xref="EnsemblGenomes-Gn:YP_0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60778"
FT                   /db_xref="InterPro:IPR025294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BBF1"
FT                   /protein_id="AAS60778.1"
FT                   /translation="MRINVLLRSHILLKSNVLLKIKTLLGLSAVLVLAGCSSSNTLSSA
FT                   GEQVKFSDTQPGSECQLVGQVTGTQSNWLSGQGGESSSMRGAANDLRNKAAAMGGNVIY
FT                   GATSPSETFLSSFAPLESKMVGQVYKCP"
FT   gene            complement(545562..546590)
FT                   /gene="kamA"
FT                   /locus_tag="YP_0509"
FT                   /old_locus_tag="YP0509"
FT   CDS_pept        complement(545562..546590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kamA"
FT                   /locus_tag="YP_0509"
FT                   /old_locus_tag="YP0509"
FT                   /product="Lysine 2,3-aminomutase"
FT                   /note="similar to Yersinia pestis CO92 YPO0353 and Yersinia
FT                   pestis KIM y0611. Contains Protein of unknown function
FT                   DUF160 (Interpro|IPR003739)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60779"
FT                   /db_xref="GOA:A0A3N4B122"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022462"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B122"
FT                   /protein_id="AAS60779.1"
FT                   /translation="MASIVTRNMPIREDWLQQLADVITDPDELLRILFLNEHPHLQQGS
FT                   GARRLFPLRVPRAFVARMQPGNASDPLLLQVLTAREEFITAPGFTHDPLDEQRSVVPGL
FT                   LHKYRNRALLLVKGGCAVNCRYCFRRHFPYQDNQGNKANWLQALDYIRQHPELDEIIFS
FT                   GGDPLMAKDHELSWLLDQLEDIKHIRRLRIHTRLPVVIPARITATLCQRLGSSRLQVLM
FT                   VTHINHANEIDPPLRDSMARLKQAGVTLLNQSVLLRGVNNDADVLATLSNALFDAGILP
FT                   YYIHVLDKVQGAAHFMVDDDEARQLMKGLLSRVSGYLVPRLTREVGGEPSKTPLDLRLT
FT                   QN"
FT   gene            546560..547192
FT                   /gene="efp1"
FT                   /locus_tag="YP_0510"
FT                   /old_locus_tag="YP0510"
FT   CDS_pept        546560..547192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp1"
FT                   /locus_tag="YP_0510"
FT                   /old_locus_tag="YP0510"
FT                   /product="elongation factor P"
FT                   /note="similar to Yersinia pestis CO92 efp and Yersinia
FT                   pestis KIM efp. Contains Elongation factor P (EF-P)
FT                   (Interpro|IPR001059, (GO:0006414))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60780"
FT                   /db_xref="GOA:Q8ZIY0"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIY0"
FT                   /protein_id="AAS60780.1"
FT                   /translation="MACFGLQCLPFFRLTTSFLRTIMASYYSNDFRPGLKIMFEGEPYA
FT                   VESSEFVKPGKGQAFARVKMRRLLTGGRVEKTFKSTDSLEGADVNDMNLTYLYNDGEFW
FT                   HFMNNETYEQLQADAKAVGDNGKWLIDQAECIVTLWNGQPIAVTPPNFVELEIVDTDPG
FT                   LKGDTAGTGGKPATLSTGAVVKVPLFVQVGEIIKVDTRSGEYVSRVK"
FT   gene            547292..547753
FT                   /gene="sugE"
FT                   /locus_tag="YP_0511"
FT                   /old_locus_tag="YP0511"
FT   CDS_pept        547292..547753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sugE"
FT                   /locus_tag="YP_0511"
FT                   /old_locus_tag="YP0511"
FT                   /product="suppresses groEL, may be chaperone"
FT                   /note="similar to Yersinia pestis KIM sugE. Contains Small
FT                   multidrug resistance protein (Interpro|IPR000390). Contains
FT                   Protein of unknown function DUF6 (Interpro|IPR000620)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60781"
FT                   /db_xref="GOA:Q8D1E4"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8D1E4"
FT                   /protein_id="AAS60781.1"
FT                   /translation="MAVFCYLGLAILPLIIEHDNVSRLSLCWLGRPSYASVFRGRPRLS
FT                   EVVTMAWIILVIAGLLEVIWAIGLKYSHGFSRLTPSIITLVAMAASVFLLAYAMKSLPA
FT                   GTAYAVWTGIGAVGTAILGIVLLGESASLARILSLGLILAGIIGLKLAS"
FT   gene            complement(547918..548274)
FT                   /gene="frdD"
FT                   /locus_tag="YP_0512"
FT                   /old_locus_tag="YP0512"
FT   CDS_pept        complement(547918..548274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frdD"
FT                   /locus_tag="YP_0512"
FT                   /old_locus_tag="YP0512"
FT                   /product="fumarate reductase hydrophobic protein"
FT                   /note="similar to Yersinia pestis CO92 frdD and Yersinia
FT                   pestis KIM frdD. Contains Fumarate reductase, D subunit
FT                   (Interpro|IPR003418, (GO:0016020))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60782"
FT                   /db_xref="GOA:Q8ZIX8"
FT                   /db_xref="InterPro:IPR003418"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIX8"
FT                   /protein_id="AAS60782.1"
FT                   /translation="MNQVPKRSDEPIFWGLFGAGGMWGAIIAPVIILLVAILLPLGAFP
FT                   GDALSYERILAFCQSFIGRVFLLLMIILPLWCGLHRIHHAMHDLKIHVPAGKWVFYGLA
FT                   AILSVVTFIGVLTL"
FT   gene            complement(548291..548683)
FT                   /gene="frdC"
FT                   /locus_tag="YP_0513"
FT                   /old_locus_tag="YP0513"
FT   CDS_pept        complement(548291..548683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frdC"
FT                   /locus_tag="YP_0513"
FT                   /old_locus_tag="YP0513"
FT                   /product="fumarate reductase hydrophobic protein"
FT                   /note="similar to Yersinia pestis CO92 frdC and Yersinia
FT                   pestis KIM frdC. Contains Fumarate reductase, subunit C
FT                   (Interpro|IPR003510, (GO:0006118), (GO:0016020))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60783"
FT                   /db_xref="GOA:Q8ZIX7"
FT                   /db_xref="InterPro:IPR003510"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIX7"
FT                   /protein_id="AAS60783.1"
FT                   /translation="MTTKRKAYVRTMAPNWWQQLGFYRFYMLREGTSIPAVWFSVLLIY
FT                   GVFALKSGPAGWEGFVSFLQNPLVLFLNILTLFAALLHTKTWFELAPKAVNIIVKSEKM
FT                   GPEPMIKALWVVTVVASAIILAVALL"
FT   gene            complement(548700..549434)
FT                   /gene="frdB"
FT                   /locus_tag="YP_0514"
FT                   /old_locus_tag="YP0514"
FT   CDS_pept        complement(548700..549434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frdB"
FT                   /locus_tag="YP_0514"
FT                   /old_locus_tag="YP0514"
FT                   /product="fumarate reductase iron-sulfur protein"
FT                   /note="similar to Yersinia pestis CO92 frdB and Yersinia
FT                   pestis KIM frdB. Contains Ferredoxin (Interpro|IPR001041,
FT                   (GO:0006118), (GO:0008042)). Contains 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain (Interpro|IPR001450,
FT                   (GO:0006118), (GO:0009497)). Contains Succinate
FT                   dehydrogenase/fumarate reductase iron-sulfur protein
FT                   (Interpro|IPR004489, (GO:0006118), (GO:0016491)). Contains
FT                   2Fe-2S ferredoxin (Interpro|IPR006058, (GO:0006118),
FT                   (GO:0008042))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60784"
FT                   /db_xref="GOA:A0A3N4AYV4"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AYV4"
FT                   /protein_id="AAS60784.1"
FT                   /translation="MTDMKVLKMEVMRYNPERDSEPHFETFEVPYDEQTSLLDALGYIK
FT                   DNLAPDLSYRWSCRMAICGSCGMMVNKVPKLACKTFLREYTAGMKVEALGNFPIERDLV
FT                   VDMTHFIESLEAIKPYIIGNERLPKDGPNKQTPAQMAKYHQFSGCINCGLCYAACPQFG
FT                   LNPEFIGPAAITLAHRYNLDNRDHGKKERMPQLNGKNGVWSCTFVGYCSEVCPKHVDPA
FT                   AAIQQGKIDSAKDFMIAMLKPQ"
FT   gene            complement(549427..551250)
FT                   /gene="frdA"
FT                   /locus_tag="YP_0515"
FT                   /old_locus_tag="YP0515"
FT   CDS_pept        complement(549427..551250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frdA"
FT                   /locus_tag="YP_0515"
FT                   /old_locus_tag="YP0515"
FT                   /product="fumarate reductase flavoprotein subunit"
FT                   /note="similar to Yersinia pestis CO92 frdA and Yersinia
FT                   pestis KIM frdA. Contains Myb DNA-binding domain
FT                   (Interpro|IPR001005, (GO:0005634)). Contains Pyridine
FT                   nucleotide-disulphide oxidoreductase, class I
FT                   (Interpro|IPR001100, (GO:0006118), (GO:0008246)). Contains
FT                   FAD-dependent pyridine nucleotide-disulphide oxidoreductase
FT                   (Interpro|IPR001327, (GO:0006118), (GO:0015036)). Contains
FT                   Ribokinase (Interpro|IPR002139, (GO:0006014)). Contains
FT                   Fumarate reductase/succinate dehydrogenase, FAD-binding
FT                   site (Interpro|IPR003952, (GO:0006118), (GO:0008246)).
FT                   Contains Fumarate reductase/succinate dehydrogenase
FT                   flavoprotein, N-terminal (Interpro|IPR003953, (GO:0006118),
FT                   (GO:0008246)). Contains Fumarate reductase/succinate
FT                   dehydrogenase flavoprotein, C-terminal (Interpro|IPR004112,
FT                   (GO:0008246), (GO:0016491)). Contains Fumarate reductase,
FT                   flavoprotein subunit (Interpro|IPR005884, (GO:0006118),
FT                   (GO:0008246), (GO:0009061))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60785"
FT                   /db_xref="GOA:A0A3N4B1X8"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005884"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B1X8"
FT                   /protein_id="AAS60785.1"
FT                   /translation="MQTFNADLAIIGAGGAGLRAAIAAAEANPQLKIALISKVYPMRSH
FT                   TVAAEGGSAAVTQDHDTFDYHFHDTVAGGDWLCEQDVVDHFVHSCPEEMAQLEIWGCPW
FT                   SRKEDGSVNVRRFGGMKIERTWFAADKTGFHMLHTLFQTSLKYPQIQRFDEHFVLDILV
FT                   DEGQARGVVAMNMMEGTRVQIRANAVIMATGGAGRVYRYNTNGGIVTGDGMGMAFHHGV
FT                   PLRDMEFVQYHPTGLPGSGILMTEGCRGEGGILVNKDGYRYLQDYGMGPETPLGEPKNK
FT                   YMELGPRDKVSQAFWHEWRAGRTVATPRGDVVYLDLRHLGEKKLLERLPFICELAKAYV
FT                   GVDPVKEPIPVRPTAHYTMGGIETNPQCETRIKGLFAVGECSSVGLHGANRLGSNSLAE
FT                   LVVFGRVAGEQAALRAMESGPANGSALDAQTRDVETRLSNLMKQEGTENWSKIRDEMGL
FT                   SMEEGCGIYRTPELMQKTVDKLAELKERFKRVKITDHSSVFNTDLLYTIELGYGLDVAE
FT                   CMAHSALNRKESRGAHQRLDEGCTERDDVNFLKHTLAFHTPGGAPRIEYSDVKITKLVP
FT                   AKRVYGGEATAQDAKDAKDAQDLKDKEQAND"
FT   gene            551357..551548
FT                   /locus_tag="YP_0516"
FT                   /old_locus_tag="YP0516"
FT   CDS_pept        551357..551548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0516"
FT                   /old_locus_tag="YP0516"
FT                   /product="putative membrane protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0361"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60786"
FT                   /db_xref="GOA:A0A3N4BBG0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BBG0"
FT                   /protein_id="AAS60786.1"
FT                   /translation="MSHYSLGILNIIIPLTYFSAVNLMILRIAISYFLYGIIILNDKSQ
FT                   KFDVIDCFVLFEPPQMHY"
FT   gene            551708..552685
FT                   /locus_tag="YP_0517"
FT                   /old_locus_tag="YP0517"
FT   CDS_pept        551708..552685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0517"
FT                   /old_locus_tag="YP0517"
FT                   /product="putative lysyl-tRNA synthetase"
FT                   /note="similar Yersinia pestis CO92 YPO0362 and Yersinia
FT                   pestis KIM y0618."
FT                   /db_xref="EnsemblGenomes-Gn:YP_0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60787"
FT                   /db_xref="GOA:Q8ZIX3"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004525"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIX3"
FT                   /protein_id="AAS60787.1"
FT                   /translation="MSDTASWQPSAPIANLLKRAAIMAEIRRFFADRGVLEVETPTMSQ
FT                   ATVTDIHLVPFETRFVGPGAADGLTLYMMTSPEYHMKRLLAAGSGPIYQLGRSFRNEEA
FT                   GRYHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQILDCNSAETLSYQQAFLRHLNIDPLS
FT                   AEKAQLREVAAKLDLSNIADTEEDRDTLLQLLFTVGVEPYIGRDKPAFIYHFPASQASL
FT                   AEISTEDHRVAERFEVYFKGIELANGFRELTDGDEQLQRFEQDNRNRAKRGLPQNPIDM
FT                   NLIAALKQGLPDCSGVALGVDRLVMLALNAERLSDVIAFPVNIA"
FT   gene            complement(552806..556165)
FT                   /locus_tag="YP_0518"
FT                   /old_locus_tag="YP0518"
FT   CDS_pept        complement(552806..556165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0518"
FT                   /old_locus_tag="YP0518"
FT                   /product="putative membrane transport protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0363 and Yersinia
FT                   pestis KIM y0619. Contains Mechanosensitive (MS) ion
FT                   channel (Interpro|IPR006685). Contains Mechanosensitive
FT                   (MS) ion channel subdomain (Interpro|IPR006686)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60788"
FT                   /db_xref="GOA:A0A0H2W1S1"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR024393"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W1S1"
FT                   /protein_id="AAS60788.1"
FT                   /translation="MLRSSYVRPIISWSFGLLLSFFLLMPLHAATQPNEEQVRQELKLA
FT                   ESNKTTPNQAEIVQALQGALSWLADAKESDIRAQQYQKAIDDFPKLTRELRQQLAQEGD
FT                   KPLPVPSNLSTSDLEQQVLQVSSQLLELNRLSQQEQDRAREISESLGQLPQQQSEARRM
FT                   LAEIGPRIQSQSNPSTPVAQAQLTLLQAEAVARKAKVNELELSQLSANNRQELSRLQVE
FT                   LYKKREARVQAQLQSLRNNLNNQRQQAAEQALERTELLAEQGGDLPESITQQLQRNREL
FT                   SQALNQQVQRIDLISSQQRQAVAQTQQVRQALNTIREQAQWLGVSTALGETLRAQVARL
FT                   PEMPKSQQLDRDMAQLRVQRLQYEDMLEKLQQQKTTLKQDDGTPLTPDQQRILDAQWRT
FT                   QSELLNSLLSGYDTQILELTKLKVANSQLVDALNGVREATHRYLFWVADVSPISLSYPL
FT                   AVAQDLTRLLSLDTLSQLSGAFVMMMTNQETLLPIIAALLFVGFSVSSRRHYHAFLERA
FT                   SSRVGKVTQDHLSLTLRTVFWSILMALPLPVLWAALGYGLQNAWSYPMAIAIGNAVTAT
FT                   VPVLWVFMISASFAHPHGLFITHFRWSPTQVARAMRFYRLSVWLIVPLMMALITFENYN
FT                   DREFAGTLGRLCFILLCIALSLVTNSLKRAGIPLYLDKKGSGENMINVALWGLLLSAPL
FT                   IAALASALGYLTTSQALLARLETSVAIWFFLLVVYHIIRRWMLIQRRRIAFDRAKQRRA
FT                   DILAQRARGEEDSPHSNSTEGSIDVEEPIIDLDVISAQSLRLVRSILTMIALVSVIVLW
FT                   SEIHSAFGFLENIRLWDVSSTINGIESVQPITMGSLLIAVLVLIITAQLVRNLPALLEL
FT                   ALLQHLDLTPGTGYAISTITKYLVILFGGLLGFSLLGIEWAKFQWLVAALGLGLGFGLQ
FT                   EIFANFVSGLIILFEKPIRIGDTVTIRDLTGSVTKINTRATTISDWDRKEIIVPNKAFI
FT                   TEQFINWSLSDSITRVVLTVPAPAETSSEEVTNVLMTAAQRCTLVLDTPPPEVYLVDLQ
FT                   QGIQIFELRIYAAEMGHRMPLRHEIHQLILAGYREHGITLPFPPFQARLETLGRGTGRT
FT                   ISSGRSRTPGSL"
FT   gene            complement(556189..557070)
FT                   /gene="psd"
FT                   /locus_tag="YP_0519"
FT                   /old_locus_tag="YP0519"
FT   CDS_pept        complement(556189..557070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="YP_0519"
FT                   /old_locus_tag="YP0519"
FT                   /product="phosphatidylserine decarboxylase proenzyme"
FT                   /note="similar to Yersinia pestis CO92 psd and Yersinia
FT                   pestis KIM psd. Contains Phosphatidylserine
FT                   decarboxylase-related (Interpro|IPR003817, (GO:0008654)).
FT                   Contains Phosphatidylserine decarboxylase
FT                   (Interpro|IPR005221)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60789"
FT                   /db_xref="GOA:Q8ZIX1"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIX1"
FT                   /protein_id="AAS60789.1"
FT                   /translation="MLDSIKIKLQYLLPKQGLTQLAGWGANKQGGWLTQLVIKAFARYY
FT                   KVDMKEAQDPEFSAYRTFNEFFVRPLRAGVRPVVAEENLLAQPADGAISQLGAIREGQI
FT                   LQAKGHNYSLEALLAGNYLLAAEFQNGQFVTTYLAPRDYHRVHMPCDGVLREMIYVPGD
FT                   LFSVNPLTAANVPNLFARNERVICIFDTAFGPMAQILVGATIVGSIETVWAGTITPPRE
FT                   GVIRRWTYPQAGCEGAITLEKGQEMGRFKLGSTVINLFAEGKVYFAPQLNSGAVTRMGE
FT                   VLAEAVPTTPSY"
FT   gene            complement(557395..558447)
FT                   /locus_tag="YP_0520"
FT                   /old_locus_tag="YP0520"
FT   CDS_pept        complement(557395..558447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0520"
FT                   /old_locus_tag="YP0520"
FT                   /product="putative GTPases"
FT                   /note="similar to Yersinia pestis CO92 YPO0365 and Yersinia
FT                   pestis KIM y0622. Contains ATP/GTP-binding site motif A
FT                   (P-loop) (Interpro|IPR001687, (GO:0005524)). Contains
FT                   Protein of unknown function DUF258 (Interpro|IPR004881,
FT                   (GO:0005554))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60790"
FT                   /db_xref="GOA:Q8ZIX0"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIX0"
FT                   /protein_id="AAS60790.1"
FT                   /translation="MSKNKLSKGQQRRVQANHQRRLRTDRKPELDDSQLGDAQEGIVIS
FT                   RFGQHADVEAVDGTQHRCNIRRTIKSLVTGDRVVWRPGLQAQEGVRVKGIVEAVHERTS
FT                   VLTRPDLYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLEVEPLIVLNKIDL
FT                   LDADGRKFVDGMMDIYRRIGYDVLEVSSQTREGMEAFENALTGRISIFAGQSGVGKSSL
FT                   LNALLPPTDNEILVNTVSGNSGLGQHTTTAARLYHFQHGGDVIDSPGVREFGLWHLAPE
FT                   QITQGFVEFRDYLGHCKFRDCSHTNDPGCALREAVEQGKIAEERFDNYHRILESMEQAK
FT                   PRKTSDSDEK"
FT   gene            558500..559192
FT                   /gene="orn"
FT                   /locus_tag="YP_0521"
FT                   /old_locus_tag="YP0521"
FT   CDS_pept        558500..559192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orn"
FT                   /locus_tag="YP_0521"
FT                   /old_locus_tag="YP0521"
FT                   /product="Oligoribonuclease (3'->5' exoribonuclease)"
FT                   /note="similar to Yersinia pestis KIM y0623. Contains
FT                   Exonuclease (Interpro|IPR006055, (GO:0005622))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60791"
FT                   /db_xref="GOA:Q8ZIW9"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIW9"
FT                   /protein_id="AAS60791.1"
FT                   /translation="MLAMFACHLLATPSSLDISLVATKRTMIHIILLINRLFGCSPGLQ
FT                   IGNIMAENQNNLIWIDLEMTGLDPERDRIIEIATLVTDANLNILAEGPVLAVHQSAEQL
FT                   GLMDEWNVRTHTGSGLVERVKASPFNDRDAELQTIEFLKQWVPAGVSPICGNSVGQDRR
FT                   FLFRYMPELEAYFHYRYVDVSTLKELARRWKPEILAGFKKQNTHQALDDIRESVAELAY
FT                   YREHFIQS"
FT   gene            559750..559825
FT                   /locus_tag="YP_t8"
FT                   /old_locus_tag="tRNA-Gly_1"
FT   tRNA            559750..559825
FT                   /locus_tag="YP_t8"
FT                   /old_locus_tag="tRNA-Gly_1"
FT                   /product="tRNA-Gly"
FT                   /note="codon recognized: GGC; Cove score 93.74"
FT   gene            complement(560137..561372)
FT                   /locus_tag="YP_0523"
FT                   /old_locus_tag="YP0523"
FT   CDS_pept        complement(560137..561372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0523"
FT                   /old_locus_tag="YP0523"
FT                   /product="putative iron-sulfur cluster-binding protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0367 and Yersinia
FT                   pestis KIM y0624. Contains 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain (Interpro|IPR001450, (GO:0006118),
FT                   (GO:0009497)). Contains Fe_S cluster binding
FT                   (Interpro|IPR004453)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60793"
FT                   /db_xref="GOA:Q7CKM4"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CKM4"
FT                   /protein_id="AAS60793.1"
FT                   /translation="MAHPLDLNQLAQHIKQWGQSLGFQQVGICDTDLTAEEPRLQAWLD
FT                   KQYHGEMAWMARHGMLRARPHELLPGTLRVISVRMNYLPAKAAFASTLNNPELGYVSRY
FT                   ALGRDYHKLLRQRLKKLGDQIQHYCLEQNNLDRHDLELHDLEQHDSERQGQPEQHTASE
FT                   INFRPFVDSAPIMERSLAAKAGIGWVGKHSLILNRDAGSWFFLGELLIDLPLPVDKPQE
FT                   EQCGRCVACMTTCPTGAIVAPYTVDARRCISYLTIELEGAIPEEFRPLMGNRIYGCDDC
FT                   QLICPWNRFSQLTDEDDFSPRAVLHTPQLLDLFAWNEEKFLRVTEGSAIRRIGHLRWLR
FT                   NISVALGNAPYLDSIVLALETRRGLHPMLDEHIEWAISQQLARRATQAVEVQLPQKKRL
FT                   IRAIEKGLPRDA"
FT   gene            561371..562885
FT                   /locus_tag="YP_0524"
FT                   /old_locus_tag="YP0524"
FT   CDS_pept        561371..562885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0524"
FT                   /old_locus_tag="YP0524"
FT                   /product="putative sugar kinase"
FT                   /note="similar to Yersinia pestis CO92 YPO0368 and Yersinia
FT                   pestis KIM y0625. Contains Protein of unknown function
FT                   UPF0031 (Interpro|IPR000631, (GO:0005554)). Contains
FT                   YjeF-related protein, N-terminal (Interpro|IPR004443,
FT                   (GO:0005554))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60794"
FT                   /db_xref="GOA:A0A3N4AYW4"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AYW4"
FT                   /protein_id="AAS60794.1"
FT                   /translation="MTDHSKKQTRVSLPHSVFSADWVRQNEAAAAAHFSLTLFDLMVRA
FT                   GNAAFELAHKQYPIARHWLILCGHGNNGGDGYIVANRALAAGIDVTLIACPGNRPLPAE
FT                   AKEAQSQWLAIGGVIHQPDTQWPQDIDLIIDGLLGIGLRAAPQGIYETLIDMANRHRAA
FT                   KVALDIPSGLCADNGAALGSVLRADHTLTFVALKPGLLTGQARDWVGQLHYDDLGLATW
FT                   LDTQSAQIERITADHLPQWLKPRRPCAHKGDYGRLLLVGGDRGFGGAIRMAGEAALRSG
FT                   AGLVRVLTHFEHVAPILAARPELMVQALTAETLEQSMQWADVLVVGPGLGQSDWSRNAL
FT                   KRLQQSDKPTLWDADALNLLALNPHRRQNWVLTPHPGEAARLLGCRVVDIESDRLLSAR
FT                   NIVKQYGGVVVLKGAGTLIANEQGEMAIADVGNAGMASGGMGDILSGIIGGLIAQKLAL
FT                   YDAACAGCVVHGVAADKLAEVQGTRGLLATDLLPVIPKYINPELAK"
FT   gene            562896..563366
FT                   /locus_tag="YP_0525"
FT                   /old_locus_tag="YP0525"
FT   CDS_pept        562896..563366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0525"
FT                   /old_locus_tag="YP0525"
FT                   /product="putative ATPase or kinase"
FT                   /note="similar to Yersinia pestis CO92 YPO0369 and Yersinia
FT                   pestis KIM y0626. Contains ATP/GTP-binding site motif A
FT                   (P-loop) (Interpro|IPR001687, (GO:0005524)). Contains
FT                   Protein of unknown function UPF0079 (Interpro|IPR003442)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60795"
FT                   /db_xref="GOA:A0A3N4B1Y8"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4B1Y8"
FT                   /protein_id="AAS60795.1"
FT                   /translation="MKELVLLLPDEAATVALGATLAQAFGGASVIYLFGDLGAGKTTFS
FT                   RGFLQALGHNGHVKSPTYTLVEPYTLTPRPVYHFDLYRLADPEELEFMGIRDYFDPQAI
FT                   CLVEWPQQGAGFLPQADVELHLTYQAAGREARLVAISEAGADVLRRLAAVQG"
FT   gene            563374..565287
FT                   /gene="amiB"
FT                   /locus_tag="YP_0526"
FT                   /old_locus_tag="YP0526"
FT   CDS_pept        563374..565287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amiB"
FT                   /locus_tag="YP_0526"
FT                   /old_locus_tag="YP0526"
FT                   /product="N-acetylmuramoyl-l-alanine amidase II"
FT                   /note="similar to Yersinia pestis KIM amiB. Contains
FT                   ATP/GTP-binding site motif A (P-loop) (Interpro|IPR001687,
FT                   (GO:0005524)). Contains Peptidoglycan-binding LysM
FT                   (Interpro|IPR002482, (GO:0016998)). Contains Cell wall
FT                   hydrolase/autolysin (Interpro|IPR002508, (GO:0009253))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60796"
FT                   /db_xref="GOA:Q8D1E3"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q8D1E3"
FT                   /protein_id="AAS60796.1"
FT                   /translation="MMHSLSLICRWKHGFATIRHFTTICHFTTVHRVITARRFATVTRM
FT                   IIGLLTLSLFALPPAFAMKLTDIKVTNGASESKVTLSFDGKPIYAFFSLNSPERVVLDV
FT                   RQSGNISGLPLEFSGQNLLKRIRSSTPKDEQSTRLVLELTQKVKTRAVTQQSGNNYTVV
FT                   LTMTAVASAPVRQAQASLNQTNTPSPNAGRVVPQVTSKDSVAKNPFNNKPVVVVSSENV
FT                   TTNTARPIKTVSAANSSRVVVAIDAGHGGQDPGAIGQNGLKEKNVTISIARRLEALLNR
FT                   DPMFKPVLTRNGDYFISVMGRSDVARKQGANVLISIHADAAPNRSATGASVWVLSNRRA
FT                   NSEMGNWLEQHEKQSELLGGAGDVLANTASDPYLSQAVLDLQFGHSQRVGYDVATKVLR
FT                   ELQTVGDIHKRKPEHASLGVLRSPDIPSLLVETGFISNSTEERLLGSSAYQEKIAQAIY
FT                   KGLRSYFLANPLQSDPKVESRPLIETAAVDSSTQRSGISQPEPIVNNISSNAQSGRSSA
FT                   TLPAGKSKIHNVQRGETLSGIASQYGVSMAVLRQNNTLKNDVVWVGQRLKVPASGSTVT
FT                   AVKPKTAAVAKSKPIKHQVKRGDTLSAIAARYGVSMSEIERVNKIKSGNVQLGQTLTIP
FT                   QS"
FT   gene            565303..567210
FT                   /gene="mutL1"
FT                   /locus_tag="YP_0527"
FT                   /old_locus_tag="YP0527"
FT   CDS_pept        565303..567210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutL1"
FT                   /locus_tag="YP_0527"
FT                   /old_locus_tag="YP0527"
FT                   /product="DNA mismatch repair protein"
FT                   /note="similar to Yersinia pestis CO92 mutL and Yersinia
FT                   pestis KIM mutL. Contains DNA mismatch repair protein
FT                   (Interpro|IPR002099, (GO:0006298)). Contains ATP-binding
FT                   region, ATPase-like (Interpro|IPR003594, (GO:0005524))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60797"
FT                   /db_xref="GOA:Q8ZIW4"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIW4"
FT                   /protein_id="AAS60797.1"
FT                   /translation="MPIQILPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDID
FT                   IERGGAKLIRIRDNGCGISKDDLALALARHATSKISSLEDLEAILSMGFRGEALASISS
FT                   VSRLILTSRTAEQSEAWQAYAEGRDMAVTIKPAAHPVGSTLEVLDLFYNTPARRKFMRT
FT                   EKTEFGHIDEVVRRIALARFDVAINLNHNGKLIRQYRAAPDPAQHERRLASICGPAFLQ
FT                   HALAIAWQHGDLNIHGWVADPAASHTLSEMQYCYVNNRMMRDRLINHAIRQAYQDRLND
FT                   AQQPAYVLYLDIDPHQVDVNVHPAKHEVRFHQARLVHDFIYQAVTAVLQQTNAPILNIS
FT                   EEGEVDAPRWQQENRVAAGTNKYAQPEAAKSSAAEQAVARERSSARERAAPAYKEDHPY
FT                   QKQQGELYRQLLQPSAAAKPATSPAAIPASSVSSPSIPVQRITQAEEPLHGDNYSFGRV
FT                   LTVFPPCYALIEYQGGVALLSLAVAERWLKQAQLSPPEEGLRPQPLLIPLKITLDKNEI
FT                   AACQNHEKLLITMGIELSVEQGRATLRAVSLPLRQQNLQKLIPELLGYLSQHEEISPDT
FT                   LATWLARHLGSEHEVWNVSQAIQLLTEVERLCPQLVQSPPAGLLQPIDIKAALATLTHE
FT                   "
FT   gene            567203..568144
FT                   /gene="miaA"
FT                   /locus_tag="YP_0528"
FT                   /old_locus_tag="YP0528"
FT   CDS_pept        567203..568144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="YP_0528"
FT                   /old_locus_tag="YP0528"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /note="similar to Yersinia pestis CO92 miaA and Yersinia
FT                   pestis KIM miaA. Contains ATP/GTP-binding site motif A
FT                   (P-loop) (Interpro|IPR001687, (GO:0005524)). Contains tRNA
FT                   isopentenyltransferase (Interpro|IPR002627, (GO:0008033))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60798"
FT                   /db_xref="GOA:Q8ZIW3"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIW3"
FT                   /protein_id="AAS60798.1"
FT                   /translation="MNDIENLDRPPAIFIMGPTASGKTALSIALRQRLPVELVSVDSAL
FT                   IYRGMDIGTAKPSAQELALAPHRLIDIRDPAESYSAADFRKDALKEMADITAAGRIPLL
FT                   VGGTMLYFKALLDGLSPLPSADPQVRQRIEQQASELGWGALHQQLAVIDPVAAARIHPN
FT                   DPQRLSRALEVFFISGKTLTELTKISGETLPYRVHQFAIAPASRELLHQRIELRFHQML
FT                   DAGFEAEARVLFDRGDLHTDLPAIRCVGYRQMWSYLSGEIDYNDMVYRGVCATRQLAKR
FT                   QMTWLRGWSSVQWLDSDKPGEALDSVIQVVSA"
FT   gene            568260..568565
FT                   /gene="ymr"
FT                   /locus_tag="YP_0529"
FT                   /old_locus_tag="YP0529"
FT   CDS_pept        568260..568565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ymr"
FT                   /locus_tag="YP_0529"
FT                   /old_locus_tag="YP0529"
FT                   /product="multiple regulator"
FT                   /note="similar to Yersinia pestis CO92 ymr and Yersinia
FT                   pestis KIM hfq. Contains Host factor Hfq
FT                   (Interpro|IPR005001, (GO:0003723))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60799"
FT                   /db_xref="GOA:Q8ZIW2"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIW2"
FT                   /protein_id="AAS60799.1"
FT                   /translation="MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVIL
FT                   LKNTVSQMVYKHAISTVVPSRPVSHHSNTPSGSTNNYHGSNPSAPQQPQQDSDDAE"
FT   gene            568664..569950
FT                   /gene="hflX"
FT                   /locus_tag="YP_0530"
FT                   /old_locus_tag="YP0530"
FT   CDS_pept        568664..569950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflX"
FT                   /locus_tag="YP_0530"
FT                   /old_locus_tag="YP0530"
FT                   /product="GTP-binding protein"
FT                   /note="similar to Yersinia pestis CO92 hflX and Yersinia
FT                   pestis KIM hflX. Contains Dynamin (Interpro|IPR001401,
FT                   (GO:0005525)). Contains ATP/GTP-binding site motif A
FT                   (P-loop) (Interpro|IPR001687, (GO:0005524)). Contains Ras
FT                   GTPase superfamily (Interpro|IPR001806, (GO:0007264)).
FT                   Contains GTP1/OBG family (Interpro|IPR006073)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60800"
FT                   /db_xref="GOA:A0A3N4BL86"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4BL86"
FT                   /protein_id="AAS60800.1"
FT                   /translation="MFDRYEAGEQAVLVHIYFSQNKDTEDLREFEALVSSAGVEALQIV
FT                   TGSRKAPHPKYFVGEGKAEEIADAVKASGASVVLFDHALSAAQERNLERLCQCRVIDRT
FT                   GLILDIFAQRARTHEGKLQVELAQLRHIATRLVRGWTHLERQKGGIGLRGPGETQLETD
FT                   RRLLRDRISLILSRLERVAKQREQGRRARTRADIPTVSLVGYTNAGKSSLFNKITAADV
FT                   YAADQLFATLDPTLRRINVADVGDTVLADTVGFIRHLPHDLVAAFKATLQETRQASLLL
FT                   HIIDAADPRVAENMAAVDTVLAEIEADEIPTLLVMNKIDLLDDFVPRIDRNEDNLPVRV
FT                   WLSAQTGAGIPLLFQALTERLSGEIAHFELRLPPQAGRLRSRFYQLQAIEKEWIDEDGN
FT                   VGMVVRMPIVDWRRLCKQEQELVSYIQNN"
FT   gene            570191..571450
FT                   /gene="hflK"
FT                   /locus_tag="YP_0531"
FT                   /old_locus_tag="YP0531"
FT   CDS_pept        570191..571450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflK"
FT                   /locus_tag="YP_0531"
FT                   /old_locus_tag="YP0531"
FT                   /product="putative membrane protein"
FT                   /note="similar to Yersinia pestis CO92 hflK and Yersinia
FT                   pestis KIM hflK. Contains Band 7 protein
FT                   (Interpro|IPR001107). Contains Stomatin
FT                   (Interpro|IPR001972). Contains Eggshell protein
FT                   (Interpro|IPR002952)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60801"
FT                   /db_xref="GOA:A0A3N4AXI8"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR020980"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AXI8"
FT                   /protein_id="AAS60801.1"
FT                   /translation="MAWNQPGNNGQDRDPWGSSNNNGGNSGGNNNKGGRDQGPPDLDDI
FT                   FRKLSKKLSSLGGKGSGSGGNGASHGPGFSGRVVGIAVVAVVVIWAASGFYTIKEAERG
FT                   VVTRLGKLSHIVQPGLNWKPTFIDEVVPVNVEAVRELAASGVMLTSDENVVRVEMNVQY
FT                   RVTDPAAYLFSVTNPDDSLRQATDSAVRGVIGKYTMDKILTEGRTIVRSDTQRVLEETI
FT                   RPYQMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQA
FT                   QRLLEDARAYAARKVLEAQGEVAGFAKLLPEYKAAPEITRERLYIETMEKVLGKTNKVL
FT                   ANDKGNNLMVLPLDQMLRGQGAANKVDGNKDTSLIRLNPAPSSQQTGASNSNTSSGSGS
FT                   IMDQRRVNAQRDTSTRVGRE"
FT   gene            571454..572458
FT                   /gene="hflC1"
FT                   /locus_tag="YP_0532"
FT                   /old_locus_tag="YP0532"
FT   CDS_pept        571454..572458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflC1"
FT                   /locus_tag="YP_0532"
FT                   /old_locus_tag="YP0532"
FT                   /product="putative membrane protein"
FT                   /note="similar to Yersinia pestis CO92 hflC and Yersinia
FT                   pestis KIM hflC. Contains Band 7 protein
FT                   (Interpro|IPR001107). Contains Band 7 protein
FT                   (Interpro|IPR001107). Contains Stomatin
FT                   (Interpro|IPR001972)"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60802"
FT                   /db_xref="GOA:A0A3N4AXK6"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3N4AXK6"
FT                   /protein_id="AAS60802.1"
FT                   /translation="MRKSFLLIVVVVLIALFASLFVVEEGQRGIVLRFGKVLRDSDNKP
FT                   LVYAPGLHFKIPFIETVKRLDARIQTMDNQADRFVTNEKKDLIVDSYLKWRISDFSRYY
FT                   LATGGGDVSQAEVLLKRKFSDRLRSEIGRLNVRDIVTDSRGRLTSDVRDALNTGSVGDE
FT                   AATTEADDAIASAAARVEQETRGKQPAVNPNSMAALGIEVVDVRIKQINLPAEVSDAIF
FT                   QRMRAEREAVARRHRSQGQEEAEKLRATADYEVTRTLAEAERQARITRGGGDAEAARLF
FT                   AEAFSQDPDFYAFIRSLRAYENSFSSGNDVMVLSPDSDFFRYMKSPDNSSKRP"
FT   gene            572522..572830
FT                   /locus_tag="YP_0533"
FT                   /old_locus_tag="YP0533"
FT   CDS_pept        572522..572830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0533"
FT                   /old_locus_tag="YP0533"
FT                   /product="putative membrane protein"
FT                   /note="similar to Yersinia pestis CO92 YPO0377."
FT                   /db_xref="EnsemblGenomes-Gn:YP_0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60803"
FT                   /db_xref="GOA:A0A0H2W0T5"
FT                   /db_xref="InterPro:IPR019201"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W0T5"
FT                   /protein_id="AAS60803.1"
FT                   /translation="MLSPCILLEYVLERNTEARLVRAFSCVEADNFLGQTMNSTILLAL
FT                   GLVLVLEGLGPMLYPKAWRKMIQAMTQLPDATLRRFGGGLVVAGCVIYYMLRSHMGS"
FT   gene            572918..574228
FT                   /gene="purA"
FT                   /locus_tag="YP_0534"
FT                   /old_locus_tag="YP0534"
FT   CDS_pept        572918..574228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="YP_0534"
FT                   /old_locus_tag="YP0534"
FT                   /product="adenylosuccinate synthetase"
FT                   /note="similar to Yersinia pestis CO92 purA and Yersinia
FT                   pestis KIM purA. Contains Adenylosuccinate synthetase
FT                   (Interpro|IPR001114, (GO:0006164))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60804"
FT                   /db_xref="GOA:Q8ZIV7"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="PDB:3HID"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIV7"
FT                   /protein_id="AAS60804.1"
FT                   /translation="MIFEMGKNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAG
FT                   HTLVINGEKTVLHLIPSGILRENVISIIGNGVVLAPDALMKEMTELEARGVPVRERLLL
FT                   SEACPLILPYHVALDNAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVSDLFNKETFA
FT                   IKLKEIVEYHNFQLVHYYKEAAVDYQKVLDDVLAIADILTAMVVDVSELLDNARKQGEL
FT                   IMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGLGPRYVDYVLGIVKAYSTRVGAG
FT                   PFPTELNDETGEFLRKQGNEYGATTGRSRRTGWLDIVAVRRAVQINSLSGFCMTKLDVL
FT                   DGLKEVKLCVGYRMPDGREVDTTPLAAEGWEGIEPIYETMPGWSETTFGVKEHSKLPQA
FT                   ALNYIQRVEELTGVPIDIISTGPDRDETMILRDPFDA"
FT   gene            574546..575022
FT                   /locus_tag="YP_0535"
FT                   /old_locus_tag="YP0535"
FT   CDS_pept        574546..575022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YP_0535"
FT                   /old_locus_tag="YP0535"
FT                   /product="putative transcriptional regulator"
FT                   /note="similar to Yersinia pestis CO92 YPO0379 and Yersinia
FT                   pestis KIM y0636. Contains Bacterial regulatory protein,
FT                   GntR family (Interpro|IPR000524, (GO:0006355)). Contains
FT                   Protein of unknown function UPF0074 (Interpro|IPR000944,
FT                   (GO:0005554))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60805"
FT                   /db_xref="GOA:Q0WJT1"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR023761"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0WJT1"
FT                   /protein_id="AAS60805.1"
FT                   /translation="MSFQMGVSRVNGYSGVYVQLTSFTDYGLRALIYMASLPDGQMTSI
FT                   SQVTEVYGVSRNHMVKIINQLSRVGLVTAVRGKNGGIRLGKPADQILIGDVVRQMEPLT
FT                   LVNCSSDFCHITPACRLKQVLNQAVQSFLKELDNYTLADMVKDNSPLYKLLLVE"
FT   gene            575263..577797
FT                   /gene="rnr"
FT                   /locus_tag="YP_0536"
FT                   /old_locus_tag="YP0536"
FT   CDS_pept        575263..577797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnr"
FT                   /locus_tag="YP_0536"
FT                   /old_locus_tag="YP0536"
FT                   /product="ribonuclease R"
FT                   /note="similar to Yersinia pestis CO92 rnr and Yersinia
FT                   pestis KIM vacB. Contains Ribonuclease II
FT                   (Interpro|IPR001900, (GO:0004540)). Contains Cold-shock
FT                   DNA-binding domain (Interpro|IPR002059, (GO:0006355)).
FT                   Contains RNA binding S1 (Interpro|IPR003029, (GO:0003723)).
FT                   Contains VacB and RNase II family 3'-5' exoribonuclease
FT                   (Interpro|IPR004476, (GO:0016070))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60806"
FT                   /db_xref="GOA:A0A2S9PJS8"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR013668"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2S9PJS8"
FT                   /protein_id="AAS60806.1"
FT                   /translation="MSQDPFLEREAEKYESPIPSREFILAHLAKRETPASREELANELN
FT                   LTGEEPLEALRRRLRAMERDGQLVFTRRQCYALPERLDLLRGTVIGHRDGYGFLRVEGS
FT                   KDDLYLSAEQMKMAIHGDVVLAQVVGADRKGRREARIVRVLVPKTSQIVGRYFTDAGTG
FT                   FVVPDDSRLSFDILIPAEATCGARMGFVVVVELTQRPTRRTKAVGKIVEVLGENMGTSM
FT                   AVDIALRTHEIPHTWPPQVEKQVADLKEQVPEEAKKGRVDLRDLPLVTIDGEDARDFDD
FT                   AVYCEKKRGGGWRLWVAIADVSYYVRPQTALDDEARSRGNSVYFPSQVIPMLPEVLSNG
FT                   LCSLNPQVDRLCMVCEMTISSQGKLSSYKFYEAVMSSHARLTYTKVWRIIDGEESLREQ
FT                   YKPLVPHLEELHAMYKVLDQARAERGGIAFETEEAKFIFNAERRIERIEPTVRNDAHKL
FT                   IEECMILANIAAARFVEKHEEPALFRVHDRPSDDHIVALRSVLNELGLTLGGGLKPQPK
FT                   DYSVLMDEISDRPDHEMLQTMLLRSMKQAVYDPENRGHFGLALASYGHFTSPIRRYPDL
FT                   AMHRAIKYQLAKEHGNLKDRWTPTGGWHSDFEDMLQLGQHCSMTERRADEATRDVADWL
FT                   KCDFMLDQVGNVFTGIIASVTGFGFFVRLDDLFIDGLVHVSSLDNDYYRYDNIGQRLIG
FT                   ESSGVVYRLGDTVEIRVDAVHMDERKIDFALVSSTRKPRGEGKTARDKAKNNGQRTLRS
FT                   NSAGRGSSSGSSRRDGAPTAGGQKRPRRAKKPVNFEPDSAFRPDAAAAKPDDKALAEKK
FT                   AKAKAKRASAKTKKIAAATKAKRAKKKTTSDQ"
FT   gene            577916..578656
FT                   /gene="spoU"
FT                   /locus_tag="YP_0537"
FT                   /old_locus_tag="YP0537"
FT   CDS_pept        577916..578656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoU"
FT                   /locus_tag="YP_0537"
FT                   /old_locus_tag="YP0537"
FT                   /product="putative methylase"
FT                   /note="similar to Yersinia pestis CO92 YPO0381 and Yersinia
FT                   pestis KIM y0638. Contains tRNA/rRNA methyltransferase
FT                   (SpoU) (Interpro|IPR001537, (GO:0008173)). Contains RNA
FT                   methyltransferase TrmH family, group 3 (Interpro|IPR004441,
FT                   (GO:0009451))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60807"
FT                   /db_xref="GOA:Q8ZIV4"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR024915"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIV4"
FT                   /protein_id="AAS60807.1"
FT                   /translation="MSEIIYGIHAVKALLERDPQRFLEVFILKGRDDRRLQPLIAELEA
FT                   AGLVIQVASRQWLDSQVEGGVHQGIVARVREGRQYQENDLPALLESVETPFLLVLDGVT
FT                   DPHNLGACLRSADAAGVHAVIVPRDRSAQLNAIAKKVASGAAENVPLIKVTNLARTLRV
FT                   LQEHNVWIVGTAGEADHTLYQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGSV
FT                   SSLNVSVATGVCLFEVVRQRGLKA"
FT   gene            579034..580707
FT                   /gene="aidB"
FT                   /locus_tag="YP_0538"
FT                   /old_locus_tag="YP0538"
FT   CDS_pept        579034..580707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aidB"
FT                   /locus_tag="YP_0538"
FT                   /old_locus_tag="YP0538"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /note="similar to Yersinia pestis CO92 aidB and Yersinia
FT                   pestis KIM aidB. Contains Acyl-CoA dehydrogenase
FT                   (Interpro|IPR006089, (GO:0006118)). Contains Acyl-CoA
FT                   dehydrogenase, C-terminal (Interpro|IPR006090,
FT                   (GO:0008246), (GO:0016491)). Contains Acyl-CoA
FT                   dehydrogenase, central domain (Interpro|IPR006091,
FT                   (GO:0006118)). Contains Acyl-CoA dehydrogenase, N-terminal
FT                   (Interpro|IPR006092, (GO:0006118))"
FT                   /db_xref="EnsemblGenomes-Gn:YP_0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAS60808"
FT                   /db_xref="GOA:A0A0H2W1S6"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR041504"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W1S6"
FT