(data stored in ACNUC17686 zone)

EMBL: AE017194

ID   AE017194; SV 1; circular; genomic DNA; STD; PRO; 5224283 BP.
XX
AC   AE017194; AE017264-AE017281;
XX
PR   Project:PRJNA74;
XX
DT   22-DEC-2005 (Rel. 86, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
XX
DE   Bacillus cereus ATCC 10987, complete genome.
XX
KW   .
XX
OS   Bacillus cereus ATCC 10987
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus;
OC   Bacillus cereus group.
XX
RN   [1]
RP   1-5224283
RX   DOI; 10.1093/nar/gkh258.
RX   PUBMED; 14960714.
RA   Rasko D.A., Ravel J., Okstad O.A., Helgason E., Cer R.Z., Jiang L.,
RA   Shores K.A., Fouts D.E., Tourasse N.J., Angiuoli S.V., Kolonay J.,
RA   Nelson W.C., Kolsto A.-B., Fraser C.M., Read T.D.;
RT   "The genome sequence of Bacillus cereus ATCC 10987 reveals metabolic
RT   adaptations and a large plasmid related to Bacillus anthracis pXO1";
RL   Nucleic Acids Res. 32(3):977-988(2004).
XX
RN   [2]
RP   1-5224283
RA   Rasko D.A., Ravel J., Okstad O.A., Helgason E., Cer R.Z., Jiang L.,
RA   Shores K.A., Fouts D.E., Tourasse N.J., Angiuoli S.V., Kolonay J.,
RA   Nelson W.C., Kolsto A.-B., Fraser C.M., Read T.D.;
RT   ;
RL   Submitted (19-FEB-2004) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
DR   MD5; c68afda9d3e16a6bd4ee7c9ef6859984.
DR   BioSample; SAMN02603979.
DR   EnsemblGenomes-Gn; BCE_5640.
DR   EnsemblGenomes-Gn; BCE_5641.
DR   EnsemblGenomes-Gn; BCE_5642.
DR   EnsemblGenomes-Gn; BCE_5643.
DR   EnsemblGenomes-Gn; BCE_5644.
DR   EnsemblGenomes-Gn; BCE_5645.
DR   EnsemblGenomes-Gn; BCE_5646.
DR   EnsemblGenomes-Gn; BCE_5647.
DR   EnsemblGenomes-Gn; BCE_5648.
DR   EnsemblGenomes-Gn; BCE_5649.
DR   EnsemblGenomes-Gn; BCE_5650.
DR   EnsemblGenomes-Gn; BCE_5651.
DR   EnsemblGenomes-Gn; BCE_5652.
DR   EnsemblGenomes-Gn; BCE_5653.
DR   EnsemblGenomes-Gn; BCE_5654.
DR   EnsemblGenomes-Gn; BCE_5655.
DR   EnsemblGenomes-Gn; BCE_5656.
DR   EnsemblGenomes-Gn; BCE_5657.
DR   EnsemblGenomes-Gn; BCE_5658.
DR   EnsemblGenomes-Gn; BCE_5659.
DR   EnsemblGenomes-Gn; BCE_5660.
DR   EnsemblGenomes-Gn; BCE_5661.
DR   EnsemblGenomes-Gn; BCE_5662.
DR   EnsemblGenomes-Gn; BCE_5663.
DR   EnsemblGenomes-Gn; BCE_5664.
DR   EnsemblGenomes-Gn; BCE_5665.
DR   EnsemblGenomes-Gn; BCE_5666.
DR   EnsemblGenomes-Gn; BCE_5667.
DR   EnsemblGenomes-Gn; BCE_5668.
DR   EnsemblGenomes-Gn; BCE_5669.
DR   EnsemblGenomes-Gn; BCE_5670.
DR   EnsemblGenomes-Gn; BCE_5671.
DR   EnsemblGenomes-Gn; BCE_5672.
DR   EnsemblGenomes-Gn; BCE_5673.
DR   EnsemblGenomes-Gn; BCE_5674.
DR   EnsemblGenomes-Gn; BCE_5675.
DR   EnsemblGenomes-Gn; BCE_5676.
DR   EnsemblGenomes-Gn; BCE_5677.
DR   EnsemblGenomes-Gn; BCE_5678.
DR   EnsemblGenomes-Gn; BCE_5679.
DR   EnsemblGenomes-Gn; BCE_5680.
DR   EnsemblGenomes-Gn; BCE_5681.
DR   EnsemblGenomes-Gn; BCE_5682.
DR   EnsemblGenomes-Gn; BCE_5683.
DR   EnsemblGenomes-Gn; BCE_5684.
DR   EnsemblGenomes-Gn; BCE_5685.
DR   EnsemblGenomes-Gn; BCE_5686.
DR   EnsemblGenomes-Gn; BCE_5687.
DR   EnsemblGenomes-Gn; BCE_5688.
DR   EnsemblGenomes-Gn; BCE_5689.
DR   EnsemblGenomes-Gn; BCE_5690.
DR   EnsemblGenomes-Gn; BCE_5691.
DR   EnsemblGenomes-Gn; BCE_5692.
DR   EnsemblGenomes-Gn; BCE_5693.
DR   EnsemblGenomes-Gn; BCE_5694.
DR   EnsemblGenomes-Gn; BCE_5695.
DR   EnsemblGenomes-Gn; BCE_5696.
DR   EnsemblGenomes-Gn; BCE_5697.
DR   EnsemblGenomes-Gn; BCE_5698.
DR   EnsemblGenomes-Gn; BCE_5699.
DR   EnsemblGenomes-Gn; BCE_5700.
DR   EnsemblGenomes-Gn; BCE_5701.
DR   EnsemblGenomes-Gn; BCE_5702.
DR   EnsemblGenomes-Gn; BCE_5703.
DR   EnsemblGenomes-Gn; BCE_5704.
DR   EnsemblGenomes-Gn; BCE_5705.
DR   EnsemblGenomes-Gn; BCE_5706.
DR   EnsemblGenomes-Gn; BCE_5707.
DR   EnsemblGenomes-Gn; BCE_5708.
DR   EnsemblGenomes-Gn; BCE_5710.
DR   EnsemblGenomes-Gn; BCE_5711.
DR   EnsemblGenomes-Gn; BCE_5712.
DR   EnsemblGenomes-Gn; BCE_5713.
DR   EnsemblGenomes-Gn; BCE_5714.
DR   EnsemblGenomes-Gn; BCE_5715.
DR   EnsemblGenomes-Gn; BCE_5716.
DR   EnsemblGenomes-Gn; BCE_5717.
DR   EnsemblGenomes-Gn; BCE_5718.
DR   EnsemblGenomes-Gn; BCE_5719.
DR   EnsemblGenomes-Gn; BCE_5720.
DR   EnsemblGenomes-Gn; BCE_5721.
DR   EnsemblGenomes-Gn; BCE_5722.
DR   EnsemblGenomes-Gn; BCE_5723.
DR   EnsemblGenomes-Gn; BCE_5724.
DR   EnsemblGenomes-Gn; BCE_5725.
DR   EnsemblGenomes-Gn; BCE_5726.
DR   EnsemblGenomes-Gn; BCE_5727.
DR   EnsemblGenomes-Gn; BCE_5728.
DR   EnsemblGenomes-Gn; BCE_5729.
DR   EnsemblGenomes-Gn; BCE_5730.
DR   EnsemblGenomes-Gn; BCE_5731.
DR   EnsemblGenomes-Gn; BCE_5732.
DR   EnsemblGenomes-Gn; BCE_5733.
DR   EnsemblGenomes-Gn; BCE_5734.
DR   EnsemblGenomes-Gn; BCE_5735.
DR   EnsemblGenomes-Gn; BCE_5736.
DR   EnsemblGenomes-Gn; BCE_5737.
DR   EnsemblGenomes-Gn; BCE_5738.
DR   EnsemblGenomes-Gn; BCE_5739.
DR   EnsemblGenomes-Gn; BCE_5740.
DR   EnsemblGenomes-Gn; BCE_5741.
DR   EnsemblGenomes-Gn; BCE_5742.
DR   EnsemblGenomes-Gn; BCE_5743.
DR   EnsemblGenomes-Gn; BCE_5744.
DR   EnsemblGenomes-Gn; BCE_5745.
DR   EnsemblGenomes-Gn; BCE_5746.
DR   EnsemblGenomes-Gn; BCE_5747.
DR   EnsemblGenomes-Gn; BCE_5748.
DR   EnsemblGenomes-Gn; BCE_5749.
DR   EnsemblGenomes-Gn; BCE_5750.
DR   EnsemblGenomes-Gn; BCE_5751.
DR   EnsemblGenomes-Gn; BCE_5752.
DR   EnsemblGenomes-Gn; BCE_5753.
DR   EnsemblGenomes-Gn; BCE_5754.
DR   EnsemblGenomes-Gn; BCE_5755.
DR   EnsemblGenomes-Gn; BCE_5756.
DR   EnsemblGenomes-Gn; BCE_5757.
DR   EnsemblGenomes-Gn; BCE_5758.
DR   EnsemblGenomes-Gn; BCE_5759.
DR   EnsemblGenomes-Gn; BCE_5760.
DR   EnsemblGenomes-Gn; BCE_5761.
DR   EnsemblGenomes-Gn; BCE_5762.
DR   EnsemblGenomes-Gn; BCE_5763.
DR   EnsemblGenomes-Gn; BCE_5764.
DR   EnsemblGenomes-Gn; BCE_5765.
DR   EnsemblGenomes-Gn; BCE_5766.
DR   EnsemblGenomes-Gn; BCE_5767.
DR   EnsemblGenomes-Gn; BCE_5768.
DR   EnsemblGenomes-Gn; BCE_5769.
DR   EnsemblGenomes-Gn; BCE_5770.
DR   EnsemblGenomes-Gn; BCE_5771.
DR   EnsemblGenomes-Gn; BCE_5772.
DR   EnsemblGenomes-Gn; BCE_5773.
DR   EnsemblGenomes-Gn; EBG00001113744.
DR   EnsemblGenomes-Gn; EBG00001113745.
DR   EnsemblGenomes-Gn; EBG00001113746.
DR   EnsemblGenomes-Gn; EBG00001113747.
DR   EnsemblGenomes-Gn; EBG00001113748.
DR   EnsemblGenomes-Gn; EBG00001113749.
DR   EnsemblGenomes-Gn; EBG00001113750.
DR   EnsemblGenomes-Gn; EBG00001113751.
DR   EnsemblGenomes-Gn; EBG00001113752.
DR   EnsemblGenomes-Gn; EBG00001113753.
DR   EnsemblGenomes-Gn; EBG00001113754.
DR   EnsemblGenomes-Gn; EBG00001113755.
DR   EnsemblGenomes-Gn; EBG00001113756.
DR   EnsemblGenomes-Gn; EBG00001113757.
DR   EnsemblGenomes-Gn; EBG00001113758.
DR   EnsemblGenomes-Gn; EBG00001113759.
DR   EnsemblGenomes-Gn; EBG00001113760.
DR   EnsemblGenomes-Gn; EBG00001113761.
DR   EnsemblGenomes-Gn; EBG00001113762.
DR   EnsemblGenomes-Gn; EBG00001113763.
DR   EnsemblGenomes-Gn; EBG00001113764.
DR   EnsemblGenomes-Gn; EBG00001113765.
DR   EnsemblGenomes-Gn; EBG00001113766.
DR   EnsemblGenomes-Gn; EBG00001113767.
DR   EnsemblGenomes-Gn; EBG00001113768.
DR   EnsemblGenomes-Gn; EBG00001113769.
DR   EnsemblGenomes-Gn; EBG00001113770.
DR   EnsemblGenomes-Gn; EBG00001113771.
DR   EnsemblGenomes-Gn; EBG00001113772.
DR   EnsemblGenomes-Gn; EBG00001113773.
DR   EnsemblGenomes-Gn; EBG00001113774.
DR   EnsemblGenomes-Gn; EBG00001113775.
DR   EnsemblGenomes-Gn; EBG00001113776.
DR   EnsemblGenomes-Gn; EBG00001113777.
DR   EnsemblGenomes-Gn; EBG00001113778.
DR   EnsemblGenomes-Gn; EBG00001113779.
DR   EnsemblGenomes-Gn; EBG00001113780.
DR   EnsemblGenomes-Gn; EBG00001113781.
DR   EnsemblGenomes-Gn; EBG00001113782.
DR   EnsemblGenomes-Gn; EBG00001113783.
DR   EnsemblGenomes-Gn; EBG00001113784.
DR   EnsemblGenomes-Gn; EBG00001113785.
DR   EnsemblGenomes-Gn; EBG00001113786.
DR   EnsemblGenomes-Gn; EBG00001113787.
DR   EnsemblGenomes-Gn; EBG00001113788.
DR   EnsemblGenomes-Gn; EBG00001113789.
DR   EnsemblGenomes-Gn; EBG00001113790.
DR   EnsemblGenomes-Gn; EBG00001113791.
DR   EnsemblGenomes-Gn; EBG00001113792.
DR   EnsemblGenomes-Gn; EBG00001113793.
DR   EnsemblGenomes-Gn; EBG00001113794.
DR   EnsemblGenomes-Gn; EBG00001113795.
DR   EnsemblGenomes-Gn; EBG00001113796.
DR   EnsemblGenomes-Gn; EBG00001113797.
DR   EnsemblGenomes-Gn; EBG00001113798.
DR   EnsemblGenomes-Gn; EBG00001113799.
DR   EnsemblGenomes-Gn; EBG00001113800.
DR   EnsemblGenomes-Gn; EBG00001113801.
DR   EnsemblGenomes-Gn; EBG00001113802.
DR   EnsemblGenomes-Gn; EBG00001113803.
DR   EnsemblGenomes-Gn; EBG00001113804.
DR   EnsemblGenomes-Gn; EBG00001113805.
DR   EnsemblGenomes-Gn; EBG00001113806.
DR   EnsemblGenomes-Gn; EBG00001113807.
DR   EnsemblGenomes-Gn; EBG00001113808.
DR   EnsemblGenomes-Gn; EBG00001113809.
DR   EnsemblGenomes-Gn; EBG00001113810.
DR   EnsemblGenomes-Gn; EBG00001113811.
DR   EnsemblGenomes-Gn; EBG00001113812.
DR   EnsemblGenomes-Gn; EBG00001113813.
DR   EnsemblGenomes-Gn; EBG00001113814.
DR   EnsemblGenomes-Gn; EBG00001113815.
DR   EnsemblGenomes-Gn; EBG00001113816.
DR   EnsemblGenomes-Gn; EBG00001113817.
DR   EnsemblGenomes-Gn; EBG00001113818.
DR   EnsemblGenomes-Gn; EBG00001113819.
DR   EnsemblGenomes-Gn; EBG00001113820.
DR   EnsemblGenomes-Gn; EBG00001113821.
DR   EnsemblGenomes-Gn; EBG00001113822.
DR   EnsemblGenomes-Gn; EBG00001113823.
DR   EnsemblGenomes-Gn; EBG00001113824.
DR   EnsemblGenomes-Gn; EBG00001113825.
DR   EnsemblGenomes-Gn; EBG00001113826.
DR   EnsemblGenomes-Gn; EBG00001113827.
DR   EnsemblGenomes-Gn; EBG00001113828.
DR   EnsemblGenomes-Gn; EBG00001113829.
DR   EnsemblGenomes-Gn; EBG00001113830.
DR   EnsemblGenomes-Gn; EBG00001113831.
DR   EnsemblGenomes-Gn; EBG00001113832.
DR   EnsemblGenomes-Gn; EBG00001113833.
DR   EnsemblGenomes-Gn; EBG00001113834.
DR   EnsemblGenomes-Gn; EBG00001113835.
DR   EnsemblGenomes-Gn; EBG00001113836.
DR   EnsemblGenomes-Gn; EBG00001113837.
DR   EnsemblGenomes-Gn; EBG00001113838.
DR   EnsemblGenomes-Gn; EBG00001113839.
DR   EnsemblGenomes-Gn; EBG00001113840.
DR   EnsemblGenomes-Gn; EBG00001113841.
DR   EnsemblGenomes-Gn; EBG00001113842.
DR   EnsemblGenomes-Gn; EBG00001113843.
DR   EnsemblGenomes-Gn; EBG00001113844.
DR   EnsemblGenomes-Gn; EBG00001113845.
DR   EnsemblGenomes-Gn; EBG00001113846.
DR   EnsemblGenomes-Gn; EBG00001113847.
DR   EnsemblGenomes-Gn; EBG00001113848.
DR   EnsemblGenomes-Gn; EBG00001113849.
DR   EnsemblGenomes-Gn; EBG00001113850.
DR   EnsemblGenomes-Gn; EBG00001113851.
DR   EnsemblGenomes-Gn; EBG00001113852.
DR   EnsemblGenomes-Gn; EBG00001113853.
DR   EnsemblGenomes-Gn; EBG00001113854.
DR   EnsemblGenomes-Gn; EBG00001113855.
DR   EnsemblGenomes-Gn; EBG00001113856.
DR   EnsemblGenomes-Gn; EBG00001113857.
DR   EnsemblGenomes-Gn; EBG00001113858.
DR   EnsemblGenomes-Gn; EBG00001113859.
DR   EnsemblGenomes-Gn; EBG00001113860.
DR   EnsemblGenomes-Gn; EBG00001113861.
DR   EnsemblGenomes-Gn; EBG00001113862.
DR   EnsemblGenomes-Gn; EBG00001113863.
DR   EnsemblGenomes-Gn; EBG00001113864.
DR   EnsemblGenomes-Gn; EBG00001113865.
DR   EnsemblGenomes-Gn; EBG00001113866.
DR   EnsemblGenomes-Gn; EBG00001113867.
DR   EnsemblGenomes-Gn; EBG00001113868.
DR   EnsemblGenomes-Gn; EBG00001113869.
DR   EnsemblGenomes-Gn; EBG00001113870.
DR   EnsemblGenomes-Gn; EBG00001113871.
DR   EnsemblGenomes-Gn; EBG00001113872.
DR   EnsemblGenomes-Gn; EBG00001113873.
DR   EnsemblGenomes-Gn; EBG00001113874.
DR   EnsemblGenomes-Gn; EBG00001113875.
DR   EnsemblGenomes-Gn; EBG00001113876.
DR   EnsemblGenomes-Gn; EBG00001113877.
DR   EnsemblGenomes-Gn; EBG00001113878.
DR   EnsemblGenomes-Gn; EBG00001113879.
DR   EnsemblGenomes-Gn; EBG00001113880.
DR   EnsemblGenomes-Gn; EBG00001113881.
DR   EnsemblGenomes-Gn; EBG00001113882.
DR   EnsemblGenomes-Gn; EBG00001113883.
DR   EnsemblGenomes-Gn; EBG00001113884.
DR   EnsemblGenomes-Gn; EBG00001113885.
DR   EnsemblGenomes-Gn; EBG00001113886.
DR   EnsemblGenomes-Gn; EBG00001113887.
DR   EnsemblGenomes-Gn; EBG00001113888.
DR   EnsemblGenomes-Gn; EBG00001113889.
DR   EnsemblGenomes-Gn; EBG00001113890.
DR   EnsemblGenomes-Gn; EBG00001113891.
DR   EnsemblGenomes-Gn; EBG00001113892.
DR   EnsemblGenomes-Gn; EBG00001113893.
DR   EnsemblGenomes-Gn; EBG00001113894.
DR   EnsemblGenomes-Gn; EBG00001113895.
DR   EnsemblGenomes-Gn; EBG00001113896.
DR   EnsemblGenomes-Gn; EBG00001113897.
DR   EnsemblGenomes-Gn; EBG00001113898.
DR   EnsemblGenomes-Gn; EBG00001113899.
DR   EnsemblGenomes-Gn; EBG00001113900.
DR   EnsemblGenomes-Gn; EBG00001113901.
DR   EnsemblGenomes-Gn; EBG00001113902.
DR   EnsemblGenomes-Gn; EBG00001113903.
DR   EnsemblGenomes-Gn; EBG00001113904.
DR   EnsemblGenomes-Gn; EBG00001113905.
DR   EnsemblGenomes-Gn; EBG00001113906.
DR   EnsemblGenomes-Gn; EBG00001113907.
DR   EnsemblGenomes-Gn; EBG00001113908.
DR   EnsemblGenomes-Gn; EBG00001113909.
DR   EnsemblGenomes-Gn; EBG00001113910.
DR   EnsemblGenomes-Gn; EBG00001113911.
DR   EnsemblGenomes-Gn; EBG00001113912.
DR   EnsemblGenomes-Gn; EBG00001113913.
DR   EnsemblGenomes-Gn; EBG00001113914.
DR   EnsemblGenomes-Gn; EBG00001113915.
DR   EnsemblGenomes-Gn; EBG00001113916.
DR   EnsemblGenomes-Gn; EBG00001113917.
DR   EnsemblGenomes-Gn; EBG00001113918.
DR   EnsemblGenomes-Tr; BCE_5640-1.
DR   EnsemblGenomes-Tr; BCE_5641-1.
DR   EnsemblGenomes-Tr; BCE_5642-1.
DR   EnsemblGenomes-Tr; BCE_5643-1.
DR   EnsemblGenomes-Tr; BCE_5644-1.
DR   EnsemblGenomes-Tr; BCE_5645-1.
DR   EnsemblGenomes-Tr; BCE_5646-1.
DR   EnsemblGenomes-Tr; BCE_5647-1.
DR   EnsemblGenomes-Tr; BCE_5648-1.
DR   EnsemblGenomes-Tr; BCE_5649-1.
DR   EnsemblGenomes-Tr; BCE_5650-1.
DR   EnsemblGenomes-Tr; BCE_5651-1.
DR   EnsemblGenomes-Tr; BCE_5652-1.
DR   EnsemblGenomes-Tr; BCE_5653-1.
DR   EnsemblGenomes-Tr; BCE_5654-1.
DR   EnsemblGenomes-Tr; BCE_5655-1.
DR   EnsemblGenomes-Tr; BCE_5656-1.
DR   EnsemblGenomes-Tr; BCE_5657-1.
DR   EnsemblGenomes-Tr; BCE_5658-1.
DR   EnsemblGenomes-Tr; BCE_5659-1.
DR   EnsemblGenomes-Tr; BCE_5660-1.
DR   EnsemblGenomes-Tr; BCE_5661-1.
DR   EnsemblGenomes-Tr; BCE_5662-1.
DR   EnsemblGenomes-Tr; BCE_5663-1.
DR   EnsemblGenomes-Tr; BCE_5664-1.
DR   EnsemblGenomes-Tr; BCE_5665-1.
DR   EnsemblGenomes-Tr; BCE_5666-1.
DR   EnsemblGenomes-Tr; BCE_5667-1.
DR   EnsemblGenomes-Tr; BCE_5668-1.
DR   EnsemblGenomes-Tr; BCE_5669-1.
DR   EnsemblGenomes-Tr; BCE_5670-1.
DR   EnsemblGenomes-Tr; BCE_5671-1.
DR   EnsemblGenomes-Tr; BCE_5672-1.
DR   EnsemblGenomes-Tr; BCE_5673-1.
DR   EnsemblGenomes-Tr; BCE_5674-1.
DR   EnsemblGenomes-Tr; BCE_5675-1.
DR   EnsemblGenomes-Tr; BCE_5676-1.
DR   EnsemblGenomes-Tr; BCE_5677-1.
DR   EnsemblGenomes-Tr; BCE_5678-1.
DR   EnsemblGenomes-Tr; BCE_5679-1.
DR   EnsemblGenomes-Tr; BCE_5680-1.
DR   EnsemblGenomes-Tr; BCE_5681-1.
DR   EnsemblGenomes-Tr; BCE_5682-1.
DR   EnsemblGenomes-Tr; BCE_5683-1.
DR   EnsemblGenomes-Tr; BCE_5684-1.
DR   EnsemblGenomes-Tr; BCE_5685-1.
DR   EnsemblGenomes-Tr; BCE_5686-1.
DR   EnsemblGenomes-Tr; BCE_5687-1.
DR   EnsemblGenomes-Tr; BCE_5688-1.
DR   EnsemblGenomes-Tr; BCE_5689-1.
DR   EnsemblGenomes-Tr; BCE_5690-1.
DR   EnsemblGenomes-Tr; BCE_5691-1.
DR   EnsemblGenomes-Tr; BCE_5692-1.
DR   EnsemblGenomes-Tr; BCE_5693-1.
DR   EnsemblGenomes-Tr; BCE_5694-1.
DR   EnsemblGenomes-Tr; BCE_5695-1.
DR   EnsemblGenomes-Tr; BCE_5696-1.
DR   EnsemblGenomes-Tr; BCE_5697-1.
DR   EnsemblGenomes-Tr; BCE_5698-1.
DR   EnsemblGenomes-Tr; BCE_5699-1.
DR   EnsemblGenomes-Tr; BCE_5700-1.
DR   EnsemblGenomes-Tr; BCE_5701-1.
DR   EnsemblGenomes-Tr; BCE_5702-1.
DR   EnsemblGenomes-Tr; BCE_5703-1.
DR   EnsemblGenomes-Tr; BCE_5704-1.
DR   EnsemblGenomes-Tr; BCE_5705-1.
DR   EnsemblGenomes-Tr; BCE_5706-1.
DR   EnsemblGenomes-Tr; BCE_5707-1.
DR   EnsemblGenomes-Tr; BCE_5708-1.
DR   EnsemblGenomes-Tr; BCE_5710-1.
DR   EnsemblGenomes-Tr; BCE_5711-1.
DR   EnsemblGenomes-Tr; BCE_5712-1.
DR   EnsemblGenomes-Tr; BCE_5713-1.
DR   EnsemblGenomes-Tr; BCE_5714-1.
DR   EnsemblGenomes-Tr; BCE_5715-1.
DR   EnsemblGenomes-Tr; BCE_5716-1.
DR   EnsemblGenomes-Tr; BCE_5717-1.
DR   EnsemblGenomes-Tr; BCE_5718-1.
DR   EnsemblGenomes-Tr; BCE_5719-1.
DR   EnsemblGenomes-Tr; BCE_5720-1.
DR   EnsemblGenomes-Tr; BCE_5721-1.
DR   EnsemblGenomes-Tr; BCE_5722-1.
DR   EnsemblGenomes-Tr; BCE_5723-1.
DR   EnsemblGenomes-Tr; BCE_5724-1.
DR   EnsemblGenomes-Tr; BCE_5725-1.
DR   EnsemblGenomes-Tr; BCE_5726-1.
DR   EnsemblGenomes-Tr; BCE_5727-1.
DR   EnsemblGenomes-Tr; BCE_5728-1.
DR   EnsemblGenomes-Tr; BCE_5729-1.
DR   EnsemblGenomes-Tr; BCE_5730-1.
DR   EnsemblGenomes-Tr; BCE_5731-1.
DR   EnsemblGenomes-Tr; BCE_5732-1.
DR   EnsemblGenomes-Tr; BCE_5733-1.
DR   EnsemblGenomes-Tr; BCE_5734-1.
DR   EnsemblGenomes-Tr; BCE_5735-1.
DR   EnsemblGenomes-Tr; BCE_5736-1.
DR   EnsemblGenomes-Tr; BCE_5737-1.
DR   EnsemblGenomes-Tr; BCE_5738-1.
DR   EnsemblGenomes-Tr; BCE_5739-1.
DR   EnsemblGenomes-Tr; BCE_5740-1.
DR   EnsemblGenomes-Tr; BCE_5741-1.
DR   EnsemblGenomes-Tr; BCE_5742-1.
DR   EnsemblGenomes-Tr; BCE_5743-1.
DR   EnsemblGenomes-Tr; BCE_5744-1.
DR   EnsemblGenomes-Tr; BCE_5745-1.
DR   EnsemblGenomes-Tr; BCE_5746-1.
DR   EnsemblGenomes-Tr; BCE_5747-1.
DR   EnsemblGenomes-Tr; BCE_5748-1.
DR   EnsemblGenomes-Tr; BCE_5749-1.
DR   EnsemblGenomes-Tr; BCE_5750-1.
DR   EnsemblGenomes-Tr; BCE_5751-1.
DR   EnsemblGenomes-Tr; BCE_5752-1.
DR   EnsemblGenomes-Tr; BCE_5753-1.
DR   EnsemblGenomes-Tr; BCE_5754-1.
DR   EnsemblGenomes-Tr; BCE_5755-1.
DR   EnsemblGenomes-Tr; BCE_5756-1.
DR   EnsemblGenomes-Tr; BCE_5757-1.
DR   EnsemblGenomes-Tr; BCE_5758-1.
DR   EnsemblGenomes-Tr; BCE_5759-1.
DR   EnsemblGenomes-Tr; BCE_5760-1.
DR   EnsemblGenomes-Tr; BCE_5761-1.
DR   EnsemblGenomes-Tr; BCE_5762-1.
DR   EnsemblGenomes-Tr; BCE_5763-1.
DR   EnsemblGenomes-Tr; BCE_5764-1.
DR   EnsemblGenomes-Tr; BCE_5765-1.
DR   EnsemblGenomes-Tr; BCE_5766-1.
DR   EnsemblGenomes-Tr; BCE_5767-1.
DR   EnsemblGenomes-Tr; BCE_5768-1.
DR   EnsemblGenomes-Tr; BCE_5769-1.
DR   EnsemblGenomes-Tr; BCE_5770-1.
DR   EnsemblGenomes-Tr; BCE_5771-1.
DR   EnsemblGenomes-Tr; BCE_5772-1.
DR   EnsemblGenomes-Tr; BCE_5773-1.
DR   EnsemblGenomes-Tr; EBT00001704600.
DR   EnsemblGenomes-Tr; EBT00001704601.
DR   EnsemblGenomes-Tr; EBT00001704602.
DR   EnsemblGenomes-Tr; EBT00001704603.
DR   EnsemblGenomes-Tr; EBT00001704604.
DR   EnsemblGenomes-Tr; EBT00001704605.
DR   EnsemblGenomes-Tr; EBT00001704606.
DR   EnsemblGenomes-Tr; EBT00001704607.
DR   EnsemblGenomes-Tr; EBT00001704608.
DR   EnsemblGenomes-Tr; EBT00001704609.
DR   EnsemblGenomes-Tr; EBT00001704610.
DR   EnsemblGenomes-Tr; EBT00001704611.
DR   EnsemblGenomes-Tr; EBT00001704612.
DR   EnsemblGenomes-Tr; EBT00001704613.
DR   EnsemblGenomes-Tr; EBT00001704614.
DR   EnsemblGenomes-Tr; EBT00001704615.
DR   EnsemblGenomes-Tr; EBT00001704616.
DR   EnsemblGenomes-Tr; EBT00001704617.
DR   EnsemblGenomes-Tr; EBT00001704618.
DR   EnsemblGenomes-Tr; EBT00001704619.
DR   EnsemblGenomes-Tr; EBT00001704620.
DR   EnsemblGenomes-Tr; EBT00001704621.
DR   EnsemblGenomes-Tr; EBT00001704622.
DR   EnsemblGenomes-Tr; EBT00001704623.
DR   EnsemblGenomes-Tr; EBT00001704624.
DR   EnsemblGenomes-Tr; EBT00001704625.
DR   EnsemblGenomes-Tr; EBT00001704626.
DR   EnsemblGenomes-Tr; EBT00001704627.
DR   EnsemblGenomes-Tr; EBT00001704628.
DR   EnsemblGenomes-Tr; EBT00001704629.
DR   EnsemblGenomes-Tr; EBT00001704630.
DR   EnsemblGenomes-Tr; EBT00001704631.
DR   EnsemblGenomes-Tr; EBT00001704632.
DR   EnsemblGenomes-Tr; EBT00001704633.
DR   EnsemblGenomes-Tr; EBT00001704634.
DR   EnsemblGenomes-Tr; EBT00001704635.
DR   EnsemblGenomes-Tr; EBT00001704636.
DR   EnsemblGenomes-Tr; EBT00001704637.
DR   EnsemblGenomes-Tr; EBT00001704638.
DR   EnsemblGenomes-Tr; EBT00001704639.
DR   EnsemblGenomes-Tr; EBT00001704640.
DR   EnsemblGenomes-Tr; EBT00001704641.
DR   EnsemblGenomes-Tr; EBT00001704642.
DR   EnsemblGenomes-Tr; EBT00001704643.
DR   EnsemblGenomes-Tr; EBT00001704644.
DR   EnsemblGenomes-Tr; EBT00001704645.
DR   EnsemblGenomes-Tr; EBT00001704646.
DR   EnsemblGenomes-Tr; EBT00001704647.
DR   EnsemblGenomes-Tr; EBT00001704648.
DR   EnsemblGenomes-Tr; EBT00001704649.
DR   EnsemblGenomes-Tr; EBT00001704650.
DR   EnsemblGenomes-Tr; EBT00001704651.
DR   EnsemblGenomes-Tr; EBT00001704652.
DR   EnsemblGenomes-Tr; EBT00001704653.
DR   EnsemblGenomes-Tr; EBT00001704654.
DR   EnsemblGenomes-Tr; EBT00001704655.
DR   EnsemblGenomes-Tr; EBT00001704656.
DR   EnsemblGenomes-Tr; EBT00001704657.
DR   EnsemblGenomes-Tr; EBT00001704658.
DR   EnsemblGenomes-Tr; EBT00001704659.
DR   EnsemblGenomes-Tr; EBT00001704660.
DR   EnsemblGenomes-Tr; EBT00001704661.
DR   EnsemblGenomes-Tr; EBT00001704662.
DR   EnsemblGenomes-Tr; EBT00001704663.
DR   EnsemblGenomes-Tr; EBT00001704664.
DR   EnsemblGenomes-Tr; EBT00001704665.
DR   EnsemblGenomes-Tr; EBT00001704666.
DR   EnsemblGenomes-Tr; EBT00001704667.
DR   EnsemblGenomes-Tr; EBT00001704668.
DR   EnsemblGenomes-Tr; EBT00001704669.
DR   EnsemblGenomes-Tr; EBT00001704670.
DR   EnsemblGenomes-Tr; EBT00001704671.
DR   EnsemblGenomes-Tr; EBT00001704672.
DR   EnsemblGenomes-Tr; EBT00001704673.
DR   EnsemblGenomes-Tr; EBT00001704674.
DR   EnsemblGenomes-Tr; EBT00001704675.
DR   EnsemblGenomes-Tr; EBT00001704676.
DR   EnsemblGenomes-Tr; EBT00001704677.
DR   EnsemblGenomes-Tr; EBT00001704678.
DR   EnsemblGenomes-Tr; EBT00001704679.
DR   EnsemblGenomes-Tr; EBT00001704680.
DR   EnsemblGenomes-Tr; EBT00001704681.
DR   EnsemblGenomes-Tr; EBT00001704682.
DR   EnsemblGenomes-Tr; EBT00001704683.
DR   EnsemblGenomes-Tr; EBT00001704684.
DR   EnsemblGenomes-Tr; EBT00001704685.
DR   EnsemblGenomes-Tr; EBT00001704686.
DR   EnsemblGenomes-Tr; EBT00001704687.
DR   EnsemblGenomes-Tr; EBT00001704688.
DR   EnsemblGenomes-Tr; EBT00001704689.
DR   EnsemblGenomes-Tr; EBT00001704690.
DR   EnsemblGenomes-Tr; EBT00001704691.
DR   EnsemblGenomes-Tr; EBT00001704692.
DR   EnsemblGenomes-Tr; EBT00001704693.
DR   EnsemblGenomes-Tr; EBT00001704694.
DR   EnsemblGenomes-Tr; EBT00001704695.
DR   EnsemblGenomes-Tr; EBT00001704696.
DR   EnsemblGenomes-Tr; EBT00001704697.
DR   EnsemblGenomes-Tr; EBT00001704698.
DR   EnsemblGenomes-Tr; EBT00001704699.
DR   EnsemblGenomes-Tr; EBT00001704700.
DR   EnsemblGenomes-Tr; EBT00001704701.
DR   EnsemblGenomes-Tr; EBT00001704702.
DR   EnsemblGenomes-Tr; EBT00001704703.
DR   EnsemblGenomes-Tr; EBT00001704704.
DR   EnsemblGenomes-Tr; EBT00001704705.
DR   EnsemblGenomes-Tr; EBT00001704706.
DR   EnsemblGenomes-Tr; EBT00001704707.
DR   EnsemblGenomes-Tr; EBT00001704708.
DR   EnsemblGenomes-Tr; EBT00001704709.
DR   EnsemblGenomes-Tr; EBT00001704710.
DR   EnsemblGenomes-Tr; EBT00001704711.
DR   EnsemblGenomes-Tr; EBT00001704712.
DR   EnsemblGenomes-Tr; EBT00001704713.
DR   EnsemblGenomes-Tr; EBT00001704714.
DR   EnsemblGenomes-Tr; EBT00001704715.
DR   EnsemblGenomes-Tr; EBT00001704716.
DR   EnsemblGenomes-Tr; EBT00001704717.
DR   EnsemblGenomes-Tr; EBT00001704718.
DR   EnsemblGenomes-Tr; EBT00001704719.
DR   EnsemblGenomes-Tr; EBT00001704720.
DR   EnsemblGenomes-Tr; EBT00001704721.
DR   EnsemblGenomes-Tr; EBT00001704722.
DR   EnsemblGenomes-Tr; EBT00001704723.
DR   EnsemblGenomes-Tr; EBT00001704724.
DR   EnsemblGenomes-Tr; EBT00001704725.
DR   EnsemblGenomes-Tr; EBT00001704726.
DR   EnsemblGenomes-Tr; EBT00001704727.
DR   EnsemblGenomes-Tr; EBT00001704728.
DR   EnsemblGenomes-Tr; EBT00001704729.
DR   EnsemblGenomes-Tr; EBT00001704730.
DR   EnsemblGenomes-Tr; EBT00001704731.
DR   EnsemblGenomes-Tr; EBT00001704732.
DR   EnsemblGenomes-Tr; EBT00001704733.
DR   EnsemblGenomes-Tr; EBT00001704734.
DR   EnsemblGenomes-Tr; EBT00001704735.
DR   EnsemblGenomes-Tr; EBT00001704736.
DR   EnsemblGenomes-Tr; EBT00001704737.
DR   EnsemblGenomes-Tr; EBT00001704738.
DR   EnsemblGenomes-Tr; EBT00001704739.
DR   EnsemblGenomes-Tr; EBT00001704740.
DR   EnsemblGenomes-Tr; EBT00001704741.
DR   EnsemblGenomes-Tr; EBT00001704742.
DR   EnsemblGenomes-Tr; EBT00001704743.
DR   EnsemblGenomes-Tr; EBT00001704744.
DR   EnsemblGenomes-Tr; EBT00001704745.
DR   EnsemblGenomes-Tr; EBT00001704746.
DR   EnsemblGenomes-Tr; EBT00001704747.
DR   EnsemblGenomes-Tr; EBT00001704748.
DR   EnsemblGenomes-Tr; EBT00001704749.
DR   EnsemblGenomes-Tr; EBT00001704750.
DR   EnsemblGenomes-Tr; EBT00001704751.
DR   EnsemblGenomes-Tr; EBT00001704752.
DR   EnsemblGenomes-Tr; EBT00001704753.
DR   EnsemblGenomes-Tr; EBT00001704754.
DR   EnsemblGenomes-Tr; EBT00001704755.
DR   EnsemblGenomes-Tr; EBT00001704756.
DR   EnsemblGenomes-Tr; EBT00001704757.
DR   EnsemblGenomes-Tr; EBT00001704758.
DR   EnsemblGenomes-Tr; EBT00001704759.
DR   EnsemblGenomes-Tr; EBT00001704760.
DR   EnsemblGenomes-Tr; EBT00001704761.
DR   EnsemblGenomes-Tr; EBT00001704762.
DR   EnsemblGenomes-Tr; EBT00001704763.
DR   EnsemblGenomes-Tr; EBT00001704764.
DR   EnsemblGenomes-Tr; EBT00001704765.
DR   EnsemblGenomes-Tr; EBT00001704766.
DR   EnsemblGenomes-Tr; EBT00001704767.
DR   EnsemblGenomes-Tr; EBT00001704768.
DR   EnsemblGenomes-Tr; EBT00001704769.
DR   EnsemblGenomes-Tr; EBT00001704770.
DR   EnsemblGenomes-Tr; EBT00001704771.
DR   EnsemblGenomes-Tr; EBT00001704772.
DR   EnsemblGenomes-Tr; EBT00001704773.
DR   EnsemblGenomes-Tr; EBT00001704774.
DR   EuropePMC; PMC1287610; 16269689.
DR   EuropePMC; PMC1352193; 16391023.
DR   EuropePMC; PMC1475869; 16600039.
DR   EuropePMC; PMC1479350; 16600037.
DR   EuropePMC; PMC1855776; 17194796.
DR   EuropePMC; PMC1888693; 17517121.
DR   EuropePMC; PMC2151433; 17709462.
DR   EuropePMC; PMC2238731; 18215273.
DR   EuropePMC; PMC2289816; 18307761.
DR   EuropePMC; PMC2293152; 18296540.
DR   EuropePMC; PMC2504315; 18587153.
DR   EuropePMC; PMC2936356; 20723231.
DR   EuropePMC; PMC3039983; 21340017.
DR   EuropePMC; PMC3298126; 22247129.
DR   EuropePMC; PMC3526280; 23034806.
DR   EuropePMC; PMC3592412; 23125367.
DR   EuropePMC; PMC373394; 14960714.
DR   EuropePMC; PMC4448311; 25928324.
DR   EuropePMC; PMC5433235; 28515790.
DR   EuropePMC; PMC5497173; 27798597.
DR   EuropePMC; PMC5911993; 29164822.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00516; ylbH.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01410; BsrC.
DR   RFAM; RF01411; BsrF.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01735; epsC.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01764; yjdF.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01820; RsaE.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02004; group-II-D1D4-5.
DR   SILVA-LSU; AE017194.
DR   SILVA-SSU; AE017194.
DR   StrainInfo; 95588; 0.
XX
CC   On or before Dec 20, 2005 this sequence version replaced
CC   gi:42734996, gi:42735279, gi:42735559, gi:42735829, gi:42736135,
CC   gi:42736432, gi:42736785, gi:42737084, gi:42737403, gi:42737718,
CC   gi:42738058, gi:42738379, gi:42738687, gi:42738974, gi:42739327,
CC   gi:42739648, gi:42739980, gi:42740294.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5224283
FT                   /organism="Bacillus cereus ATCC 10987"
FT                   /strain="ATCC 10987"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:222523"
FT   gene            408..1748
FT                   /gene="dnaA"
FT                   /locus_tag="BCE_0001"
FT                   /old_locus_tag="BCE0001"
FT   CDS_pept        408..1748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="BCE_0001"
FT                   /old_locus_tag="BCE0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by match to protein family HMM PF00308;
FT                   match to protein family HMM TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38937"
FT                   /db_xref="GOA:Q73FK5"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73FK5"
FT                   /protein_id="AAS38937.1"
FT                   /translation="MENISDLWNSALKELEKKVSKPSYETWLKSTTAHNLKKDVLTITA
FT                   PNEFARDWLESHYSELISETLYDLTGAKLAIRFIIPQSQAEEEIDLPPSKPNSAQDDSN
FT                   HLPQSMLNPKYTFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHA
FT                   IGHYVIEHNPNAKVVYLSSEKFTNEFINSIRDNKAVDFRNKYRNVDVLLIDDIQFLAGK
FT                   EQTQEEFFHTFNALHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETR
FT                   IAILRKKAKAEGLDIPNEVMLYIANQIDSNIRELEGALIRVVAYSSLINKDINADLAAE
FT                   ALKDIIPNSKPKIISIYDIQKAVGDVYQVKLEDFKAKKRTKSVAFPRQIAMYLSRELTD
FT                   SSLPKIGEEFGGRDHTTVIHAHEKISKLLKTDTQLQKQVEEINDILK"
FT   gene            1927..3066
FT                   /gene="dnaN"
FT                   /locus_tag="BCE_0002"
FT                   /old_locus_tag="BCE0002"
FT   CDS_pept        1927..3066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="BCE_0002"
FT                   /old_locus_tag="BCE0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00712;
FT                   match to protein family HMM PF02767; match to protein
FT                   family HMM PF02768; match to protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38938"
FT                   /db_xref="GOA:Q73FK4"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FK4"
FT                   /protein_id="AAS38938.1"
FT                   /translation="MRFTIQKDYLVRSVQDVMKAVSSRTTIPILTGIKVVATEEGVTLT
FT                   GSDADISIESFIPVEENGKEIVEVKQSGSIVLQAKYFSEIVKKLPKETVEISVENHLMT
FT                   KITSGKSEFNLNGLDSAEYPLLPQIEEHHVFKIPTDLLKHMIRQTVFAVSTSETRPILT
FT                   GVNWKVYNSELTGIATDSHRLALRKAKIEGIADEFQANVVIPGKSLNELSKILDESEEM
FT                   VDIVITEYQVLFRTKHLLFFSRLLEGNYPDTTRLIPAESKTDIFVNTKEFLQAIDRASL
FT                   LARDGRNNVVKLSTLEQAMLEISSNSPEIGKVVEEVQCEKVDGEELKISFSAKYMMDAL
FT                   KALDSTEIKISFTGAMRPFLIRTVNDESIIQLILPVRTY"
FT   gene            3182..3406
FT                   /locus_tag="BCE_0003"
FT                   /old_locus_tag="BCE0003"
FT   CDS_pept        3182..3406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0003"
FT                   /old_locus_tag="BCE0003"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38939"
FT                   /db_xref="GOA:Q73FK3"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FK3"
FT                   /protein_id="AAS38939.1"
FT                   /translation="MSDFMKRIKISTEYITLGQFLKLADVIDTGGAVKWFLQEYEVYVN
FT                   QELENRRGRKLYANDIIEIPGSGSFQVQS"
FT   gene            3418..4545
FT                   /gene="recF"
FT                   /locus_tag="BCE_0004"
FT                   /old_locus_tag="BCE0004"
FT   CDS_pept        3418..4545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="BCE_0004"
FT                   /old_locus_tag="BCE0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="identified by match to protein family HMM PF02463;
FT                   match to protein family HMM TIGR00611"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38940"
FT                   /db_xref="GOA:Q73FK2"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73FK2"
FT                   /protein_id="AAS38940.1"
FT                   /translation="MFISEIQLKNYRNYEKLELSFEDKVNVIIGENAQGKTNLMEAIYV
FT                   LAMAKSHRTSNDRELIRWDEDFGQIKGKLQKRNSSLSLELNISKKGKKAKLNQLEQQKL
FT                   SQYIGVMNVVMFAPEDLNLVKGSPQVRRRFLDMELGQIAPVYLYELSQYQKVLTQRNHL
FT                   LKKMQGNSKNEETMLDVFTLQLIEHGTKILQKRFEFLHLLQEWAAPIHRGISRGLEELE
FT                   IVYKPSVDVSESMDLSKIKEVYYESFQSVKQREIFRGTTLIGPHRDDLQFFVNSKNVQV
FT                   FGSQGQQRTTALSLKLAEIELIYSEVKEYPILLLDDVLSELDDYRQSHLLNTIQGKVQT
FT                   FVTTTSVDGIEHETLKEAKTIHVTNGTVDCEIDRA"
FT   gene            4584..6506
FT                   /gene="gyrB"
FT                   /locus_tag="BCE_0005"
FT                   /old_locus_tag="BCE0005"
FT   CDS_pept        4584..6506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="BCE_0005"
FT                   /old_locus_tag="BCE0005"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00204;
FT                   match to protein family HMM PF00986; match to protein
FT                   family HMM PF01751; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38941"
FT                   /db_xref="GOA:Q73FK1"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FK1"
FT                   /protein_id="AAS38941.1"
FT                   /translation="MEQKQMQENSYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLV
FT                   WEIVDNSIDEALAGYCDEINVSIEEDNSIRVTDNGRGIPVGIQEKMGRPAVEVIMTVLH
FT                   AGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHREGKIHYQKYERGIPVADLKVIG
FT                   DTDQTGTITRFKPDPEIFQETTVYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEF
FT                   HYEGGIKSYVEHLNRSKQPIHEEPVYVEGSKDGIQVEVSLQYNEGYTNNIYSFTNNIHT
FT                   YEGGTHEVGFKTALTRVINDYGRKNSILKDADSNLTGEDVREGLTAIVSIKHPNPQFEG
FT                   QTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVEKGTMAARARVAAKKARELTR
FT                   RKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIIN
FT                   VEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLT
FT                   FFYRYMRQIIEHGYIYIAQPPLFKIQQGKKIQYAYNEKELEKILAELPAQPKPGIQRYK
FT                   GLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYV
FT                   KNLDI"
FT   gene            6595..9066
FT                   /gene="gyrA"
FT                   /locus_tag="BCE_0006"
FT                   /old_locus_tag="BCE0006"
FT   CDS_pept        6595..9066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="BCE_0006"
FT                   /old_locus_tag="BCE0006"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00521;
FT                   match to protein family HMM PF03989; match to protein
FT                   family HMM TIGR01063"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38942"
FT                   /db_xref="GOA:Q73FK0"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FK0"
FT                   /protein_id="AAS38942.1"
FT                   /translation="MSDNQQQARIREINISHEMRTSFLDYAMSVIVSRALPDVRDGLKP
FT                   VHRRVLYAMNDLGITADKAYKKSARIVGEVIGKYHPHGDSAVYETMVRMAQDFSQRYML
FT                   VDGHGNFGSVDGDSAAAMRYTEARMSKISMELIRDISKNTIDYQDNYDGSEREPIVLPA
FT                   RFPNLLVNGTTGIAVGMATNIPPHQLGEVIDGVLALSHNPDITIAELMECIPGPDFPTA
FT                   GLILGRSGIRRAYETGRGSIILRAKVEIEEKSNGKQSIIVTELPYQVNKARLIEKIAEL
FT                   VRDKKIEGITDLRDESDRNGMRIVMEVRRDANANVLLNNLYKHTALQTSFGINMLSLVN
FT                   GEPQVLNLKQNLYHYLEHQKVVIRRRTAYELEKAEARAHILEGLRIALDHLDEVITLIR
FT                   SSKTAEIAKQGLMERFGLSEKQAQAILDMRLQRLTGLEREKIEQEYQDLMKLIAELKAI
FT                   LADEEKVLEIIREELTEVKERFNDKRRTEITIGGMESIEDEDLIPEQNIAITLTHNGYI
FT                   KRLPASTYKTQNRGGRGVQGMGTNDDDFVEHLLTTSTHDHILFFTNKGKVYRTKGYEIP
FT                   EYSRTAKGIPIINLLGVDKGEWINAIIPIREFGDDEFLFFTTKQGISKRTPLSSFANIR
FT                   TNGLIAISLREEDEVISVRLTSGDKDIIVGTSNGMLIRFNEQDVRSMGRNAAGVKAITL
FT                   GEEDQVVGMEIVEEDVNVLIVTKNGYGKRTPIDEYRLQSRGGKGLKTCNITDKNGKLVA
FT                   VKSVTGEEDIMLITAAGVIIRMPVDQISQMGRNTQGVRLIRLEDEQEVATVAKAQKDDE
FT                   EETSEEVSSEE"
FT   gene            9241..9339
FT                   /locus_tag="BCE_0007"
FT                   /old_locus_tag="BCE0007"
FT   CDS_pept        9241..9339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0007"
FT                   /old_locus_tag="BCE0007"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38943"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FJ9"
FT                   /protein_id="AAS38943.1"
FT                   /translation="MKTKRNKQRETSIFILDARQTKFIGEFDPGSG"
FT   gene            9335..10842
FT                   /locus_tag="BCE_5738"
FT                   /old_locus_tag="BCE5738"
FT                   /note="Bc16SA"
FT   rRNA            9335..10842
FT                   /locus_tag="BCE_5738"
FT                   /old_locus_tag="BCE5738"
FT                   /product="16S ribosomal RNA"
FT   gene            10991..11067
FT                   /locus_tag="BCE_5640"
FT                   /old_locus_tag="BCE5640"
FT                   /note="tRNA-Ala"
FT   tRNA            10991..11067
FT                   /locus_tag="BCE_5640"
FT                   /old_locus_tag="BCE5640"
FT                   /product="tRNA-Ala"
FT   gene            11076..11151
FT                   /locus_tag="BCE_5641"
FT                   /old_locus_tag="BCE5641"
FT                   /note="tRNA-Ile"
FT   tRNA            11076..11151
FT                   /locus_tag="BCE_5641"
FT                   /old_locus_tag="BCE5641"
FT                   /product="tRNA-Ile"
FT   gene            11246..14153
FT                   /locus_tag="BCE_5739"
FT                   /old_locus_tag="BCE5739"
FT                   /note="Bc23SA"
FT   rRNA            11246..14153
FT                   /locus_tag="BCE_5739"
FT                   /old_locus_tag="BCE5739"
FT                   /product="23S ribosomal RNA"
FT   gene            14203..14318
FT                   /locus_tag="BCE_5740"
FT                   /old_locus_tag="BCE5740"
FT                   /note="Bc5SA"
FT   rRNA            14203..14318
FT                   /locus_tag="BCE_5740"
FT                   /old_locus_tag="BCE5740"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(14353..15354)
FT                   /locus_tag="BCE_0008"
FT                   /old_locus_tag="BCE0008"
FT   CDS_pept        complement(14353..15354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0008"
FT                   /old_locus_tag="BCE0008"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38944"
FT                   /db_xref="InterPro:IPR026988"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FJ8"
FT                   /protein_id="AAS38944.1"
FT                   /translation="MHQTHCTWQQLSFFFSSQNVQRYLARCYEKSSIQNAEKKSFENCY
FT                   PFIYYLEHGKNYYELYKVAPFSIQPMLLFYGMSQLFKACLLTIDPNYPESTTVLAHGVT
FT                   TRKRKKQGYQFLEDEVKVQKNGLFTHVAEQLFHMKHLESEKFNMLDLMGNIPELQSLFR
FT                   YSQRGSTLYKIDSTNANELSFSVNILDRLHMTSERFSRYIESICKHLSVQHVPGKTGAS
FT                   NLLFTAPIQSWNPIYSTPLYYEYLADTYYLPLTTDPRNPTPVLPELLVHYLLLYNLSMI
FT                   SRYETDWWYDLLGSYGSEDYPFIYQFLTISAQKIPYYISNFLLAEPNLFHGK"
FT   gene            15470..16933
FT                   /gene="guaB"
FT                   /locus_tag="BCE_0009"
FT                   /old_locus_tag="BCE0009"
FT   CDS_pept        15470..16933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="BCE_0009"
FT                   /old_locus_tag="BCE0009"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="identified by match to protein family HMM PF00478;
FT                   match to protein family HMM PF00571; match to protein
FT                   family HMM TIGR01302"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38945"
FT                   /db_xref="GOA:Q73FJ7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FJ7"
FT                   /protein_id="AAS38945.1"
FT                   /translation="MWESKFVKEGLTFDDVLLVPAKSDVLPREVSVKTVLSESLQLNIP
FT                   LISAGMDTVTEADMAIAMARQGGLGIIHKNMSIEQQAEQVDKVKRSESGVISDPFFLTP
FT                   EHQVYDAEHLMGKYRISGVPVVNNLDERKLVGIITNRDMRFIQDYSIKISDVMTKEQLI
FT                   TAPVGTTLDEAEKILQKYKIEKLPLVDNNGVLQGLITIKDIEKVIEFPNSAKDKQGRLL
FT                   VGAAVGVTADAMTRIDALVKASVDAIVLDTAHGHSQGVIDKVKEVRAKYPSLNIIAGNV
FT                   ATAEATRALIEAGANVVKVGIGPGSICTTRVVAGVGVPQLTAVYDCATEARKHGIPVIA
FT                   DGGIKYSGDMVKALAAGAHVVMLGSMFAGVAESPGETEIYQGRQFKVYRGMGSVGAMEK
FT                   GSKDRYFQEGNKKLVPEGIEGRVPYKGPLADTVHQLVGGLRAGMGYCGAQDLEFLRENA
FT                   QFVRMSGAGLLESHPHHVQITKEAPNYSL"
FT   gene            17038..18354
FT                   /gene="dacA"
FT                   /locus_tag="BCE_0010"
FT                   /old_locus_tag="BCE0010"
FT   CDS_pept        17038..18354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacA"
FT                   /locus_tag="BCE_0010"
FT                   /old_locus_tag="BCE0010"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="identified by match to protein family HMM PF00768"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38946"
FT                   /db_xref="GOA:Q73FJ6"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FJ6"
FT                   /protein_id="AAS38946.1"
FT                   /translation="MKGMFCKRFIALVTMFTLACSMLLPYSNASAETGAALNIEAGAAI
FT                   LVEANSGKIVYQKNADELLSIASMTKMMSEYLVHEAVDKGKLKWDQKIKVSEYAYKVSQ
FT                   DASLSNVALENGGSYTVKELYEAMAIFSANGATIALAEAIAGKEVDFVKMMNDKSKELG
FT                   LKNYKFVNSTGLTNKDLKGMHPEGTTADEENKMSAKDVATLAQHLIKDYPKVLDTAKIP
FT                   KKEFRPEKEKFAMSNWNWMLKGLVKEYDGVDGLKTGSTPEAGDCFTGTVERNGMRFISV
FT                   VIKTSSHTARFDETKKLYDYGFANFEMKQMYKKGSSVKGQETVRVENAKDKDVAVQTKQ
FT                   AISLPVPKGSKDVYKTELKESSKGQEAPIKKGAALGQMVITPKDTNDPGFLTGKSLQVD
FT                   LVTTAEVEEANWFTRAMRGIGSFFSGIWNSAVDTVKGWF"
FT   gene            18516..19403
FT                   /locus_tag="BCE_0011"
FT                   /old_locus_tag="BCE0011"
FT   CDS_pept        18516..19403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0011"
FT                   /old_locus_tag="BCE0011"
FT                   /product="pyridoxine biosynthesis protein"
FT                   /note="identified by match to protein family HMM PF01680;
FT                   match to protein family HMM TIGR00343"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38947"
FT                   /db_xref="GOA:Q73FJ5"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73FJ5"
FT                   /protein_id="AAS38947.1"
FT                   /translation="MTNVTGTERVKRGMAEMQKGGVIMDVINAEQAKIAEEAGAVAVMA
FT                   LERVPADIRAAGGVSRMADPTIVEEVMGAVSIPVMAKCRIGHLVEARVLESLGVDYIDE
FT                   SEVLTPADEVYHLNKRDYTVPFVCGCRDIGEAARRIAEGASMLRTKGEPGTGNIVEAVR
FT                   HMRQVNAEIRQVASLREDELMTYAKNTGAPYEVLLEIKRLGRLPVVNFAAGGVATPADA
FT                   ALMMQLGADGVFVGSGIFKSENPAKFARAIVEATTHYEDYELIASLSKGLGNAMKGIEI
FT                   STLLPEQRMQERGW"
FT   gene            19422..20012
FT                   /locus_tag="BCE_0012"
FT                   /old_locus_tag="BCE0012"
FT   CDS_pept        19422..20012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0012"
FT                   /old_locus_tag="BCE0012"
FT                   /product="glutamine amidotransferase, SNO family"
FT                   /note="identified by match to protein family HMM PF01174"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38948"
FT                   /db_xref="GOA:Q73FJ4"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73FJ4"
FT                   /protein_id="AAS38948.1"
FT                   /translation="MVKIGVLGLQGAVREHVKSVEASGAEAVVVKRIEQLEEIDGLILP
FT                   GGESTTMRRLIDKYAFMEPLRTFAKSGKPMFGTCAGMILLAKTLIGYDEAHIGAMDITV
FT                   ERNAFGRQKDSFEAALSIKGVGEDFVGVFIRAPYVVNVADNVEVLSTHGDRMVAVRQGP
FT                   FLAASFHPELTDDHRVTAYFVEMVKEAKMKKVV"
FT   gene            20340..21614
FT                   /gene="serS"
FT                   /locus_tag="BCE_0013"
FT                   /old_locus_tag="BCE0013"
FT   CDS_pept        20340..21614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="BCE_0013"
FT                   /old_locus_tag="BCE0013"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF02403; match to protein
FT                   family HMM TIGR00414"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38949"
FT                   /db_xref="GOA:Q73FJ3"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73FJ3"
FT                   /protein_id="AAS38949.1"
FT                   /translation="MLDIKFLRTNFEEVKAKLQHRGEDLTDFGRFEELDTRRRELLVQT
FT                   EELKSKRNEVSQQISVLKREKKDAESLILEMREVGEKVKDLDNELRTVEEDLERLMLSI
FT                   PNIPHESAPVGETEDDNVVARTWGEVKEFAFEPKPHWDLATDLGILDFERAGKVTGSRF
FT                   VFYKGAGARLERALISFMLDLHTDEHGYEEVLPPYMVNRASMTGTGQLPKFEEDAFRIE
FT                   SEDYFLIPTAEVPVTNMHRDEILNKEQLPIRYAAFSSCFRSEAGSAGRDTRGLIRQHQF
FT                   NKVELVKFVKPEDSYEELEKLXNDAERVLQLLELPYRVMSMCTGDLGFTAAKKYDIEVW
FT                   IPSYGTYREISSCSNFEAFQARRANIRFRREPNGKPEHVHTLNGSGLAIGRTVAAILEN
FT                   YQQEDGTIIIPEVLRPYMGGKTVIK"
FT   gene            21771..21863
FT                   /locus_tag="BCE_5642"
FT                   /old_locus_tag="BCE5642"
FT                   /note="tRNA-Ser"
FT   tRNA            21771..21863
FT                   /locus_tag="BCE_5642"
FT                   /old_locus_tag="BCE5642"
FT                   /product="tRNA-Ser"
FT   gene            21897..22421
FT                   /locus_tag="BCE_0014"
FT                   /old_locus_tag="BCE0014"
FT   CDS_pept        21897..22421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0014"
FT                   /old_locus_tag="BCE0014"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38950"
FT                   /db_xref="GOA:Q73FJ2"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR024256"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FJ2"
FT                   /protein_id="AAS38950.1"
FT                   /translation="MENSLPHVTSFYFKTNHKVWCKAILSLLHTHIPMIIFIDMKGVNM
FT                   DLIIQTFPLDGKTLYYVQCPVCKNNRILNSGANVSRIISDDTFRKLCGCTCDVKQTATK
FT                   VEAPKKVKKEAGKKEAAPKRTGKVLTAVINGKEMTVKEIAEAYDISTSTVRQRINAGKP
FT                   ESEIIAPTKKK"
FT   gene            complement(22457..23125)
FT                   /locus_tag="BCE_0015"
FT                   /old_locus_tag="BCE0015"
FT   CDS_pept        complement(22457..23125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0015"
FT                   /old_locus_tag="BCE0015"
FT                   /product="deoxynucleoside kinase family protein"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by match to protein family HMM PF01712"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38951"
FT                   /db_xref="GOA:Q73FJ1"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FJ1"
FT                   /protein_id="AAS38951.1"
FT                   /translation="MNLRQKYDIPNDAVITIAGTVGVGKSTMTTALANALGYRTSFEKV
FT                   DSNPYLDKFYADFTRWSFHLQVYFLAERFKEQKRIFEYGGGFVQDRSIYEDTGIFAKMH
FT                   HEKGTMTETDYETYKGLFDAMVMTPYFPHPDLLIYLEGSFDDIVDRIQERGRPMEQQTP
FT                   IEYWKEMHGRYENWINNFNSCPVLRLNINEYDILKDGDSIEPIIKKIGHFLKQTRKLVK
FT                   "
FT   gene            complement(23128..23763)
FT                   /locus_tag="BCE_0016"
FT                   /old_locus_tag="BCE0016"
FT   CDS_pept        complement(23128..23763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0016"
FT                   /old_locus_tag="BCE0016"
FT                   /product="deoxynucleoside kinase family protein"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by match to protein family HMM PF01712"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38952"
FT                   /db_xref="GOA:Q73FJ0"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FJ0"
FT                   /protein_id="AAS38952.1"
FT                   /translation="MTGVPFITVEGPIGVGKTSLAKEISTHMQLHLLKEIVDENPFLGK
FT                   FYEDIDEWSFQTEMFFLCNRYKQLEDINIKYLNQRKPVVADYHIFKNVIFASRTLKDSQ
FT                   YDKYMQIYRILTQDMPVPNVIVYLTASLETLQKRIAMRGREFEKNMDPNYLLQLTKDYE
FT                   TAMDAFKKDHPDIPVLKFNGDDMDFVKNPDDLNVILSALQNTLLKESK"
FT   gene            complement(23889..24428)
FT                   /locus_tag="BCE_0017"
FT                   /old_locus_tag="BCE0017"
FT   CDS_pept        complement(23889..24428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0017"
FT                   /old_locus_tag="BCE0017"
FT                   /product="isochorismatase family protein"
FT                   /note="identified by match to protein family HMM PF00857"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38953"
FT                   /db_xref="GOA:Q73FI9"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FI9"
FT                   /protein_id="AAS38953.1"
FT                   /translation="MKNTALLIIDMINDFQFSHGPILAKKCEIITTPILQLKKTMKSFG
FT                   CPIIYINDHYQLWRSDIDQLITHCTNEYSENIIHKIAPNADDYIFIKPHYSAFYETPLN
FT                   SLLGYLKIENLILTGVAGNICILFTANDAHMRNYTLYVPQDCIASNDDQDNLHALKIME
FT                   TTLKANIVPSFQIKFD"
FT   gene            24406..24546
FT                   /locus_tag="BCE_0018"
FT                   /old_locus_tag="BCE0018"
FT   CDS_pept        24406..24546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0018"
FT                   /old_locus_tag="BCE0018"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38954"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FI8"
FT                   /protein_id="AAS38954.1"
FT                   /translation="MSKAVFFICNPLSFFLGWIEFVKVIPCVVNGNKCTLFVMKGLCYG
FT                   T"
FT   gene            24536..25036
FT                   /locus_tag="BCE_0019"
FT                   /old_locus_tag="BCE0019"
FT   CDS_pept        24536..25036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0019"
FT                   /old_locus_tag="BCE0019"
FT                   /product="cytidine/deoxycytidylate deaminase zinc-binding
FT                   domain protein"
FT                   /note="identified by match to protein family HMM PF00383"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38955"
FT                   /db_xref="GOA:Q73FI7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FI7"
FT                   /protein_id="AAS38955.1"
FT                   /translation="MERDQDIYFMQLAIEEAKKAEAIQEVPIGAVIVLNGEVISVAHNL
FT                   RETEQRSIAHAELLAIDEACKKLGTWRLEDATLYVTLEPCPMCAGGIVLSRVKRVVYGA
FT                   SDPKGGCAGTLMNLLTDERFNHQCEVVAGVLEEECGTLLTNFFRALRKKRKAIKKLEKS
FT                   KEN"
FT   gene            25513..27201
FT                   /gene="dnaX"
FT                   /locus_tag="BCE_0020"
FT                   /old_locus_tag="BCE0020"
FT   CDS_pept        25513..27201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="BCE_0020"
FT                   /old_locus_tag="BCE0020"
FT                   /product="DNA polymerase III, gamma and tau subunits"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00004"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38956"
FT                   /db_xref="GOA:Q73FI6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FI6"
FT                   /protein_id="AAS38956.1"
FT                   /translation="MSYQALYRTWRPQKFEDVVGQKHVTKTLQNALLQEKVSHAYLFSG
FT                   PRGTGKTTIAKVFAKAINCEHAPVAEPCNECPSCLGITQGSISDVLEIDAASNNGVDEI
FT                   RDIRDKVKYAPSAVEYKVYIIDEVHMLSMGAFNALLKTLEEPPGHVIFILATTEPHKIP
FT                   PTIISRCQRFEFRKISVNDIVERLSTVVNNEGTQVEDEALQIVARAAEGGMRDALSLID
FT                   QAISYSDETVTTEDVLAVTGSVSQQYLGNLVECIRENDVSRALRIIDEMMGKGKDPVRF
FT                   MEDFIYYYRDMLLYQTSPQLEHMLERVMVDEQFRTLSEEMQPEVIYEIIHTLSKAQQEM
FT                   KWTNHPRIFLEVVMVQLCQQFMMQANGADRLQAIMNRMQQLEKELEQVKKNGVPAGVQQ
FT                   EVRETRAAPKPVRTGSMKIPVGRVNEVLKQAKRQDLEQLKAVWGELLGRLKAYNKVAFA
FT                   VLLENSEPVAASDDTYVLAFQYEIHCKMASENREAMDTVEQTLFELLSKRLNMIAIPKS
FT                   EWGKIREDFLQREGGSSEESPEKKEDPLIEEAVKLVGQELIEIKE"
FT   gene            27224..27553
FT                   /locus_tag="BCE_0021"
FT                   /old_locus_tag="BCE0021"
FT   CDS_pept        27224..27553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0021"
FT                   /old_locus_tag="BCE0021"
FT                   /product="conserved hypothetical protein TIGR00103"
FT                   /note="identified by match to protein family HMM PF02575;
FT                   match to protein family HMM TIGR00103"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38957"
FT                   /db_xref="GOA:Q73FI5"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73FI5"
FT                   /protein_id="AAS38957.1"
FT                   /translation="MMRGGMGNMNNMMKQMQKMQKEMAKAQEELGEKTVEGTAGGGMIT
FT                   VIANGHKQILEVKVKEEVVDPEDIEMLQDLVLAATNDALKKADELSNSTMGKFTKGLNL
FT                   PGGMF"
FT   gene            27568..28164
FT                   /gene="recR"
FT                   /locus_tag="BCE_0022"
FT                   /old_locus_tag="BCE0022"
FT   CDS_pept        27568..28164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="BCE_0022"
FT                   /old_locus_tag="BCE0022"
FT                   /product="recombination protein RecR"
FT                   /note="identified by match to protein family HMM PF01751;
FT                   match to protein family HMM PF02132; match to protein
FT                   family HMM TIGR00615"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38958"
FT                   /db_xref="GOA:Q73FI4"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73FI4"
FT                   /protein_id="AAS38958.1"
FT                   /translation="MHYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLDMKEDDVLGFAK
FT                   ALVNAKRDLAYCSVCGHITDRDPCYICNDSHRDQSVVCVVQEPKDVIAMEKMKEYQGVY
FT                   HVLRGAISPMEGIGPEDINIPQLLKRLHDETVQEVILATNPNIEGEATAMYISRLLKPT
FT                   GIKVTRIAHGLPVGGDLEYADEVTLSKALEGRREV"
FT   gene            28179..28400
FT                   /locus_tag="BCE_0023"
FT                   /old_locus_tag="BCE0023"
FT   CDS_pept        28179..28400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0023"
FT                   /old_locus_tag="BCE0023"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38959"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FI3"
FT                   /protein_id="AAS38959.1"
FT                   /translation="MFFQKKGKLRKEYDDKLIVLLEKVKNEWLRQKRMVEQSVEPSQDV
FT                   LCSLKIAEAKYFFLLKEAKRRPVKMEQW"
FT   gene            28316..28495
FT                   /locus_tag="BCE_0024"
FT                   /old_locus_tag="BCE0024"
FT   CDS_pept        28316..28495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0024"
FT                   /old_locus_tag="BCE0024"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38960"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FI2"
FT                   /protein_id="AAS38960.1"
FT                   /translation="MFFENSRGEIFLLAKRSKTSSCKDGAMVKGSAEKAEPFYFICLER
FT                   SINVFCEERVAESR"
FT   gene            28593..28862
FT                   /gene="bofA"
FT                   /locus_tag="BCE_0025"
FT                   /old_locus_tag="BCE0025"
FT   CDS_pept        28593..28862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bofA"
FT                   /locus_tag="BCE_0025"
FT                   /old_locus_tag="BCE0025"
FT                   /product="sigma-k factor processing regulatory protein
FT                   BofA"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38961"
FT                   /db_xref="GOA:Q73FI1"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FI1"
FT                   /protein_id="AAS38961.1"
FT                   /translation="MNSTIIIVGILALVFIFLVFGVSSKPLRFIGKALFHVTLGVALLF
FT                   IVNVVGTYFDFHLPINLGTATITSLLGLPGVAALVVIKLYIMPR"
FT   gene            29109..30616
FT                   /locus_tag="BCE_5741"
FT                   /old_locus_tag="BCE5741"
FT                   /note="Bc16SB"
FT   rRNA            29109..30616
FT                   /locus_tag="BCE_5741"
FT                   /old_locus_tag="BCE5741"
FT                   /product="16S ribosomal RNA"
FT   gene            30765..30841
FT                   /locus_tag="BCE_5643"
FT                   /old_locus_tag="BCE5643"
FT                   /note="tRNA-Ile"
FT   tRNA            30765..30841
FT                   /locus_tag="BCE_5643"
FT                   /old_locus_tag="BCE5643"
FT                   /product="tRNA-Ile"
FT   gene            30850..30925
FT                   /locus_tag="BCE_5644"
FT                   /old_locus_tag="BCE5644"
FT                   /note="tRNA-Ala"
FT   tRNA            30850..30925
FT                   /locus_tag="BCE_5644"
FT                   /old_locus_tag="BCE5644"
FT                   /product="tRNA-Ala"
FT   gene            31020..33927
FT                   /locus_tag="BCE_5742"
FT                   /old_locus_tag="BCE5742"
FT                   /note="Bc23SB"
FT   rRNA            31020..33927
FT                   /locus_tag="BCE_5742"
FT                   /old_locus_tag="BCE5742"
FT                   /product="23S ribosomal RNA"
FT   gene            33977..34092
FT                   /locus_tag="BCE_5743"
FT                   /old_locus_tag="BCE5743"
FT                   /note="Bc5SB"
FT   rRNA            33977..34092
FT                   /locus_tag="BCE_5743"
FT                   /old_locus_tag="BCE5743"
FT                   /product="5S ribosomal RNA"
FT   gene            34288..34467
FT                   /locus_tag="BCE_0026"
FT                   /old_locus_tag="BCE0026"
FT   CDS_pept        34288..34467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0026"
FT                   /old_locus_tag="BCE0026"
FT                   /product="csfB protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38962"
FT                   /db_xref="InterPro:IPR019700"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FI0"
FT                   /protein_id="AAS38962.1"
FT                   /translation="MKSQNEVCIVCETERKEGIYVYNNLICYECEKDMVNTETNDPKYI
FT                   YYLKQLRKLEVSYF"
FT   gene            34540..35961
FT                   /gene="cad"
FT                   /locus_tag="BCE_0027"
FT                   /old_locus_tag="BCE0027"
FT   CDS_pept        34540..35961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cad"
FT                   /locus_tag="BCE_0027"
FT                   /old_locus_tag="BCE0027"
FT                   /product="lysine decarboxylase"
FT                   /EC_number="4.1.1.18"
FT                   /note="identified by match to protein family HMM PF01276;
FT                   match to protein family HMM PF03711"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38963"
FT                   /db_xref="GOA:Q73FH9"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FH9"
FT                   /protein_id="AAS38963.1"
FT                   /translation="MNQNRIPLYEALIEFKERRPLSFHVPGHKNGLNFPQGAVEEFKDI
FT                   LSIDVTELSGLDDLHSPFECIDEAQQLLADVYEVEKSYFLINGSTVGNLAMILSCCREH
FT                   DIVLVQRNCHKSIINGLKLAGANPIFLDSWIDEAYNVPVGIHDEIIKEAIEKYPNAKAL
FT                   ILTHPNYYGMGMDLEASIAYAHAHKIPVLVDEAHGAHFCLGGAFPKSALAYGADIVVHS
FT                   AHKTLPAMTMGSYLHINSRLVKEERVSTYLSMLQSSSPSYPIMASLDIARFTIARIKEK
FT                   GHDEIVEFLREFKEELSSIPQIAILQYPLQDELKVTVQTRCQLSGYELQSVLEKVGIYT
FT                   EMADPYNVLFILPLQVNKTYMKAVEMIRAALQSYEVKDKTESIRYTYKGEISPLPYTYK
FT                   QLEGYETKVVSVEEAVGMIAAEMVIPYPPGIPLIMYGERITSEHKEQIMHLERAGARFQ
FT                   GSTKYMKVYDIESRF"
FT   gene            35963..36589
FT                   /gene="tmk"
FT                   /locus_tag="BCE_0028"
FT                   /old_locus_tag="BCE0028"
FT   CDS_pept        35963..36589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="BCE_0028"
FT                   /old_locus_tag="BCE0028"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="identified by match to protein family HMM PF02223;
FT                   match to protein family HMM TIGR00041"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38964"
FT                   /db_xref="GOA:Q73FH8"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73FH8"
FT                   /protein_id="AAS38964.1"
FT                   /translation="MKGLFVTIEGPEGSGKTTLIQGLLPYFEQKEQKVMATREPGGIAI
FT                   SEDIRTILHKQEYTMMEARTEALLYAAARRQHLVEKVMPALDEDYLVLCDRFIDSSLAY
FT                   QGYARGLGMDKVFEINRFATEDCMPSLTIYLDIEPEVGLARIAKDAGREVNRLDMEDIT
FT                   FHKRVREGYLQVVERFSDRIVLVNADQPMEKLIEEVIQVIEDKLL"
FT   gene            36625..37608
FT                   /gene="holB"
FT                   /locus_tag="BCE_0029"
FT                   /old_locus_tag="BCE0029"
FT   CDS_pept        36625..37608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="BCE_0029"
FT                   /old_locus_tag="BCE0029"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM TIGR00678"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38965"
FT                   /db_xref="GOA:Q73FH7"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FH7"
FT                   /protein_id="AAS38965.1"
FT                   /translation="MTKTWEQLSAIQPIGVKMLMNSIAKERISHAYLLEGGKGTGKFAT
FT                   AIQMAKSFLCSQRNGVEPCHVCTNCKRIDSGNHPNLHIVKPDGLSIKKQQIHDLQEEFS
FT                   KTGLEANKKVYVIEHADRMTANAANTLLKFLEEPSSDTTAILLTEQSHQILNTILSRCQ
FT                   VVTFRPLPTESLIRRLQDEGVTTSLSTLAAQLTNSFDEALALCSDEWFAQARALVIKLC
FT                   EALEKDKASIFFVQEKWGKHFGEKEQLQQGLDMLLLIYKDLLYVQLGEEDRLVFHEQKE
FT                   MFESFSYAQKRIVSALFNILEAKNRINANVNAQLVFEQLVLRLQEG"
FT   gene            37605..38441
FT                   /locus_tag="BCE_0030"
FT                   /old_locus_tag="BCE0030"
FT   CDS_pept        37605..38441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0030"
FT                   /old_locus_tag="BCE0030"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04468"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38966"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FH6"
FT                   /protein_id="AAS38966.1"
FT                   /translation="MTVLYDVVGVRFKKAGKVYYFDPNQFDISENEFVIVETVRGIEYG
FT                   KVVITKKQVDENDVVLPLKKVIRIANENDRTIVEENKHAAKEAYQVCQQKVVEHNLDMK
FT                   LVDVEYTFDRNKIIFYFTADGRIDFRELVKDLAAIFRTRIELRQIGVRDEAKMLGGIGP
FT                   CGRMLCCSTFLGDFEPVSIKMAKDQNLSLNPAKISGLCGRLMCCLKYENDEYEAAKEQL
FT                   PDLDQRIQTPHGTGRVIGLNILERLIQVELVDKERIVEYTLDELVNKGVVSSQTTD"
FT   gene            38441..38806
FT                   /locus_tag="BCE_0031"
FT                   /old_locus_tag="BCE0031"
FT   CDS_pept        38441..38806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0031"
FT                   /old_locus_tag="BCE0031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38967"
FT                   /db_xref="GOA:Q73FH5"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73FH5"
FT                   /protein_id="AAS38967.1"
FT                   /translation="MRWVLVEKKDIFASVSSMEEQIGHLYKQLGELKQHLAELLEENQH
FT                   IKMENENLRHRFEEVQIKEKQKTQKRKEVKPKTDIGEGYDNLARLYQEGFHICNLHYGS
FT                   VRKEGDCLFCLSFLNKK"
FT   gene            38927..39667
FT                   /locus_tag="BCE_0032"
FT                   /old_locus_tag="BCE0032"
FT   CDS_pept        38927..39667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0032"
FT                   /old_locus_tag="BCE0032"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38968"
FT                   /db_xref="GOA:Q73FH4"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FH4"
FT                   /protein_id="AAS38968.1"
FT                   /translation="MNLYEDERLDYLLAQDLKIIQSPSVFNFSLDAVLLADFAWVPIQK
FT                   GNLLDLCTGNAVVPLLLSTRTKGNITGVEIQERLYDMGIRSVQYNKLEERIHLIHGDLK
FT                   DMPEKLGRHQYDVVTCNPPYFQTPATSEKNMNEHLAIARHEIMCTLEDVVSASSQLVKQ
FT                   GGKVAFVHRPGRLLDIVTLMRKYKIEPKRVRFVYPKAGKEANTLLIEGIKDGNADLKIL
FT                   PPLFVYEENNEYTKEIRSILYGEE"
FT   gene            39654..39944
FT                   /locus_tag="BCE_0033"
FT                   /old_locus_tag="BCE0033"
FT   CDS_pept        39654..39944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0033"
FT                   /old_locus_tag="BCE0033"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01541"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38969"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73FH3"
FT                   /protein_id="AAS38969.1"
FT                   /translation="MEKNKHCFYVVECSDGSYYAGYTNHIEKRIETHNSGKGAKYTRAR
FT                   LPVALKYVEFHEDKRTAMQAEYYFKQLNRKQKEEYMQKGEPYVATKKFSTK"
FT   gene            39913..40788
FT                   /locus_tag="BCE_0034"
FT                   /old_locus_tag="BCE0034"
FT   CDS_pept        39913..40788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0034"
FT                   /old_locus_tag="BCE0034"
FT                   /product="conserved hypothetical protein TIGR00096"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38970"
FT                   /db_xref="GOA:Q73FH2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FH2"
FT                   /protein_id="AAS38970.1"
FT                   /translation="MWQQKSFQQNEKGVLYLVPTPIGNLEDMTFRAIRILKEADLIAAE
FT                   DTRQTKKLCNYFEIETPVMSYHEHNKEVSGKKILDKLDEGKTVALVSDAGMPCISDPGY
FT                   DIVVEAVAEQYHVIPLPGANAALTALIASGLETKQFYFYGFLQRNKKERKMELEKLRYI
FT                   QTTMMFYEAPHRLDDTLISMQEVLGNREIVLCRELTKKFEEFIRGTVEEAIEWTKQNEV
FT                   RGEFCILVAGSTEEPAPEEQWWETISVYDHIEHYINEKGMNSKEAIKTVAKDRDLSKRD
FT                   VYQIYHVDKK"
FT   gene            complement(40809..41093)
FT                   /gene="abrB"
FT                   /locus_tag="BCE_0035"
FT                   /old_locus_tag="BCE0035"
FT   CDS_pept        complement(40809..41093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abrB"
FT                   /locus_tag="BCE_0035"
FT                   /old_locus_tag="BCE0035"
FT                   /product="transition state transcriptional regulatory
FT                   protein AbrB"
FT                   /note="identified by match to protein family HMM PF04014;
FT                   match to protein family HMM TIGR01439"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38971"
FT                   /db_xref="GOA:Q73FH1"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR040678"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FH1"
FT                   /protein_id="AAS38971.1"
FT                   /translation="MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIIL
FT                   KKYKPNMTCQVTGEVSDGNLSLAEGKIILSKEGAEQILNELQDYIETAK"
FT   gene            41611..43593
FT                   /gene="metS"
FT                   /locus_tag="BCE_0036"
FT                   /old_locus_tag="BCE0036"
FT   CDS_pept        41611..43593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metS"
FT                   /locus_tag="BCE_0036"
FT                   /old_locus_tag="BCE0036"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM PF01588; match to protein
FT                   family HMM TIGR00398; match to protein family HMM
FT                   TIGR00399"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38972"
FT                   /db_xref="GOA:Q73FH0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FH0"
FT                   /protein_id="AAS38972.1"
FT                   /translation="MTKENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYN
FT                   VHYLTGTDEHGQKIQKKAEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHK
FT                   DVVEKIFKQLVDQGDIYLDEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHD
FT                   VELVREESYFFRMGKYVDRLLKFYEENPHFIQPESRKNEMINNFIKPGLEDLAVSRTSF
FT                   DWGVRVPGNPKHVIYVWVDALSNYITALGYGTENEEMYKKFWPADVHLVGKEIVRFHTI
FT                   YWPIILMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLRE
FT                   VPFGSDGVFTPEGFVERINFDLANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDGTL
FT                   VTFAQDTLKKVEEAMENMEFSVALSSIWQLISRTNKYIDETQPWVLAKDENDREKLASV
FT                   MAHLAEVLRQTGIMLMPFLTVAPSKMFAQLGLTEEAHTSWESLSTIGCIPAGTKVEKGN
FT                   PIFPRLEMEVEVAYIKEQMKASAPKVEEKKEEEPKAEEITIDDFFKVELRVAEVLSAEP
FT                   VKKADKLLKIQLDLGTEKRQVVSGIAKFYSPEDLKGKKVICVTNLKPVKLRGELSQGMI
FT                   LAGEENGVLSLASIDQNLPNGTKIK"
FT   gene            43759..44526
FT                   /locus_tag="BCE_0037"
FT                   /old_locus_tag="BCE0037"
FT   CDS_pept        43759..44526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0037"
FT                   /old_locus_tag="BCE0037"
FT                   /product="deoxyribonuclease, TatD family"
FT                   /note="identified by match to protein family HMM PF01026;
FT                   match to protein family HMM TIGR00010"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38973"
FT                   /db_xref="GOA:Q73FG9"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FG9"
FT                   /protein_id="AAS38973.1"
FT                   /translation="MLFDTHSHLNAEQFEEDLQEVIARMKEAGVTYTVVVGFDEVTIKK
FT                   AIELAEAYDFIYAAVGWHPVDAIDMTEEHLAWLEELASHPKVVALGEMGLDYHWDKSPK
FT                   EIQKEVFRKQIALAKKVKLPIIIHNRDATQDIVDILEEENAAEVGGIMHCFSGSVEVAE
FT                   RCVDMNFLISLGGPVTFKNAKKPKEVATEIPLEKLLIETDCPYLTPHPFRGKRNEPSYV
FT                   KLVAEEIAKLKGISYEEVAEMTTKNAKVLFGVE"
FT   gene            44740..45297
FT                   /locus_tag="BCE_0038"
FT                   /old_locus_tag="BCE0038"
FT   CDS_pept        44740..45297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0038"
FT                   /old_locus_tag="BCE0038"
FT                   /product="primase-related protein"
FT                   /note="identified by match to protein family HMM PF01751;
FT                   match to protein family HMM TIGR00334"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38974"
FT                   /db_xref="GOA:Q73FG8"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FG8"
FT                   /protein_id="AAS38974.1"
FT                   /translation="MKIKEIIVVEGKDDTVAIKRAVDADTIETNGSAIGDHVIEQVKLA
FT                   LQKRGVIIFTDPDYPGERIRKIISDKVPGCKHAFLPKEEALAKRKKGVGIEHASNESIR
FT                   RALENIHEEMEAYTSEISWSDLVDAGLVGGEMAKSRRERMGKLLKIGYTNAKQLHKRLQ
FT                   MFQVSKESFAEAYKQVIQEERK"
FT   gene            45294..46172
FT                   /gene="ksgA"
FT                   /locus_tag="BCE_0039"
FT                   /old_locus_tag="BCE0039"
FT   CDS_pept        45294..46172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="BCE_0039"
FT                   /old_locus_tag="BCE0039"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF00398;
FT                   match to protein family HMM TIGR00755"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38975"
FT                   /db_xref="GOA:Q73FG7"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73FG7"
FT                   /protein_id="AAS38975.1"
FT                   /translation="MKDIATPNRTKDIVEKYGFSFKKSLGQNFLIDTNVLNRIVDHAEI
FT                   GSESGAIEIGPGIGALTEQLAKRAKKVVAFEIDQRLLPILDETLAPYGNVTVINKDVLK
FT                   ADVHEVFSEQFEEGQDVMVVANLPYYITTPILFKLLEEKLPVRGFVVMMQKEVGDRLAA
FT                   KPGTKEYGSLSIAIQYYTEVETVMTVPRTVFVPQPNVDSAIIRLLKRPKPVVEVTDETF
FT                   FFEVVRASFAQRRKTLMNNLSNNLNGFPKDKELLDRILTEVGIDPKRRGETLSIEEFAT
FT                   LSNALVLHKLS"
FT   gene            46283..47146
FT                   /locus_tag="BCE_0040"
FT                   /old_locus_tag="BCE0040"
FT   CDS_pept        46283..47146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0040"
FT                   /old_locus_tag="BCE0040"
FT                   /product="yabG protein"
FT                   /note="identified by match to protein family HMM PF05582"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38976"
FT                   /db_xref="InterPro:IPR008764"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FG6"
FT                   /protein_id="AAS38976.1"
FT                   /translation="MALHVGELVERYSHNRDILFRIIEIKGEIAILFGEEIRLVADAPL
FT                   EDLISIDQREHKKRAKREKETMERTYRLFQQDYVLMKQRHEHTSTGGYTSEVNYFQMPG
FT                   RVLHIDGDPLYLRKCLDLYNKIGVPVQGIHCKETEMHEKVVDLIDHFRPDILVITGHDA
FT                   YTKSKGVKGDLAAYRHSRHFVQAVREVRKKYPSLDQLVIFAGACQSHFEALIRAGANFA
FT                   SSPSRINIHALDPVYVVGKISFTSFMERVNVWDVVRNTITGEKGLGGIETRGILRTGLP
FT                   FQHYEE"
FT   gene            47385..47645
FT                   /locus_tag="BCE_0041"
FT                   /old_locus_tag="BCE0041"
FT   CDS_pept        47385..47645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0041"
FT                   /old_locus_tag="BCE0041"
FT                   /product="veg protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38977"
FT                   /db_xref="GOA:Q73FG5"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FG5"
FT                   /protein_id="AAS38977.1"
FT                   /translation="MSKRLDEIKSELDHHLGQRLMLKANSGRRKTVEQSGVLAETYRSV
FT                   FVVQLDQQEDALQRVSYSYADVLTETVELTFYGEPHNEVIL"
FT   gene            47737..47916
FT                   /gene="sspF"
FT                   /locus_tag="BCE_0042"
FT                   /old_locus_tag="BCE0042"
FT   CDS_pept        47737..47916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspF"
FT                   /locus_tag="BCE_0042"
FT                   /old_locus_tag="BCE0042"
FT                   /product="small, acid-soluble spore protein"
FT                   /note="identified by match to protein family HMM PF00269"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38978"
FT                   /db_xref="GOA:Q73FG4"
FT                   /db_xref="InterPro:IPR001448"
FT                   /db_xref="InterPro:IPR018126"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FG4"
FT                   /protein_id="AAS38978.1"
FT                   /translation="MSRRRGVMSNQFKEELAKELGFYDVVQKEGWGGIRAKDAGNMVKR
FT                   AIEIAEQQLMKQNQ"
FT   gene            48113..48982
FT                   /gene="ispE"
FT                   /locus_tag="BCE_0043"
FT                   /old_locus_tag="BCE0043"
FT   CDS_pept        48113..48982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="BCE_0043"
FT                   /old_locus_tag="BCE0043"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="identified by match to protein family HMM PF00288;
FT                   match to protein family HMM TIGR00154"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38979"
FT                   /db_xref="GOA:Q73FG3"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73FG3"
FT                   /protein_id="AAS38979.1"
FT                   /translation="MKLLVKAPAKINLSLDVLGKRQDGYHEVKMIMTTIDLADRLELME
FT                   LAEDRIEILSHNRYVPDDQRNLAYQAAKLLKEKFNVKKGVSITIEKTIPVAAGLAGGSS
FT                   DAAATLRGLNKLWNLGLTIDQLAELGAEIGSDVSFCVYGGTAIATGRGEQIEHIKTPPS
FT                   CWVILAKPHIGVSTADVYGNLKLNRVTHPNVDKMVDVINAGDYKGICDTVGNVLEDVTF
FT                   AMHPEVARIKAQMKRFGADAVLMSGSGPTVFGLVHHDSRMHRIYNGLKGFCEQVYAVRL
FT                   LGERETLE"
FT   gene            49037..49885
FT                   /gene="purR"
FT                   /locus_tag="BCE_0044"
FT                   /old_locus_tag="BCE0044"
FT   CDS_pept        49037..49885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purR"
FT                   /locus_tag="BCE_0044"
FT                   /old_locus_tag="BCE0044"
FT                   /product="pur operon repressor PurR"
FT                   /EC_number="2.4.2.-"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01743"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38980"
FT                   /db_xref="GOA:Q73FG2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FG2"
FT                   /protein_id="AAS38980.1"
FT                   /translation="MKIRRSTRLVDMTYYLLQNPRQLVSLTFFAERYQSAKSSISEDLV
FT                   IIKQTFEQQGVGTLQTIPGAAGGVKYIPYISEEEADLIIGELCSLFENPDRILPGGYLY
FT                   MTDLLSNPRHINGAGRLFASVFARQPIDAVMTVATKGIPLAYAVANYLDVPVVIARKDN
FT                   KVTEGPTVSINYVSGSSKRIQTMTLAKRSLPEGSNVLIIDDFMKAGGTIQGMMSMLEEF
FT                   KANVVGIGVLVESTDIEERLINNYVSLIRLSEVDVKEKAIQVEKGNYSLAPFDEGLVEA
FT                   E"
FT   gene            49999..50382
FT                   /locus_tag="BCE_0045"
FT                   /old_locus_tag="BCE0045"
FT   CDS_pept        49999..50382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0045"
FT                   /old_locus_tag="BCE0045"
FT                   /product="endoribonuclease L-PSP, putative"
FT                   /note="identified by match to protein family HMM PF01042;
FT                   match to protein family HMM TIGR00004"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38981"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FG1"
FT                   /protein_id="AAS38981.1"
FT                   /translation="MKSMKVVQTKNAPQAIGPYSQGIIVNNMFYSSGQIPLTASGELVV
FT                   GDVTVQTEQVFQNLQAVLEEAGASFDTVVKTTVFLKDMDDFNAVNEVYGSYFSAHKPAR
FT                   SCVQVAKLPKDVSVEIEVIALVK"
FT   gene            50481..50828
FT                   /gene="spoVG"
FT                   /locus_tag="BCE_0046"
FT                   /old_locus_tag="BCE0046"
FT   CDS_pept        50481..50828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVG"
FT                   /locus_tag="BCE_0046"
FT                   /old_locus_tag="BCE0046"
FT                   /product="stage V sporulation protein G"
FT                   /note="identified by match to protein family HMM PF04026"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38982"
FT                   /db_xref="GOA:Q73FG0"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73FG0"
FT                   /protein_id="AAS38982.1"
FT                   /translation="MWNLYKYIAYLEKGGEHKMEVTDVRLRRVNTEGRMRAIASITLDH
FT                   EFVVHDIRVIDGNNGLFVAMPSKRTPDGEFRDIAHPINSGTRSKIQDAVLTEYHRLGEL
FT                   EEVEFEEAGAS"
FT   gene            51151..52530
FT                   /gene="gcaD"
FT                   /locus_tag="BCE_0047"
FT                   /old_locus_tag="BCE0047"
FT   CDS_pept        51151..52530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcaD"
FT                   /locus_tag="BCE_0047"
FT                   /old_locus_tag="BCE0047"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /EC_number="2.7.7.23"
FT                   /note="identified by match to protein family HMM PF00132;
FT                   match to protein family HMM PF00483; match to protein
FT                   family HMM TIGR01173"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38983"
FT                   /db_xref="GOA:Q73FF9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73FF9"
FT                   /protein_id="AAS38983.1"
FT                   /translation="MSNRFAVILAAGKGTRMKSKLYKVLHPVCGKPMVQHVVDQVSQLG
FT                   LQKLVTVVGHGAEMVQEQLGNVSEFALQAEQLGTAHAVDQAASVLANEEGTTLVICGDT
FT                   PLITAETMEALLQQHKEAGAMATVLTAYIEEPAGYGRIVRNENGHVEKIVEHKDANEKE
FT                   LAIKEINTGTYCFDNKALFASLSKVSNDNVQGEYYLPDVIEILKNEGHIVSAYQTEHFD
FT                   ETLGVNDRVALSQAEIIMKNRINRKNMVNGVTIIDPSNTYISADAIIGSDTVLHPGTII
FT                   EGNTVIGSDCEIGPHTVIRDSEIGDRTTIRQSTVHDSKLGTEVSVGPFAHIRPDSVIGD
FT                   EVRVGNFVEIKKTVFGNRSKASHLSYIGDAQVGEDVNLGCGSITVNYDGKNKFKTVIGN
FT                   GVFIGCNSNLVAPVTVEDGAYVAAGSTITENVPSKALSVARARQVNKEDYVDQLLNKKK
FT                   S"
FT   gene            52549..53502
FT                   /gene="prs"
FT                   /locus_tag="BCE_0048"
FT                   /old_locus_tag="BCE0048"
FT   CDS_pept        52549..53502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prs"
FT                   /locus_tag="BCE_0048"
FT                   /old_locus_tag="BCE0048"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01251"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38984"
FT                   /db_xref="GOA:Q73FF8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FF8"
FT                   /protein_id="AAS38984.1"
FT                   /translation="MSTQYLNSNLKVFSLNSNKELAEQIAKHIGVGLGKCSVDRFSDGE
FT                   VQINIEESIRGCDVFIIQSTSFPVNEHIMELLIMIDALKRASAKTINIVIPYYGYARQD
FT                   RKARSREPITSKLVANLLETAGATRVITLDLHAPQIQGFFDIPIDHLMGVPILSDYFET
FT                   KGLKDIVIVSPDHGGVTRARKMADRLKAPIAIIDKRRPRPNVSEVMNIIGNIEGKTAIL
FT                   IDDIIDTAGTITLAANALVENGASEVYACCTHPVLSGPAIERIQNSNIKELVVTNSIVL
FT                   PEEKKIDKVHELSVAPLIGEAIIRVYEEESVSVLFN"
FT   gene            53503..54135
FT                   /gene="spoVC"
FT                   /locus_tag="BCE_0049"
FT                   /old_locus_tag="BCE0049"
FT   CDS_pept        53503..54135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVC"
FT                   /locus_tag="BCE_0049"
FT                   /old_locus_tag="BCE0049"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="identified by match to protein family HMM PF01195;
FT                   match to protein family HMM TIGR00447"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38985"
FT                   /db_xref="GOA:Q73FF7"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73FF7"
FT                   /protein_id="AAS38985.1"
FT                   /translation="MDRMRRNQDWLRLFVSKKESSGTRMKLIVGLGNPGREYELTRHNI
FT                   GFMAIDELAKRWNISLNEQKFKGVFGAGFVNGEKVILLKPLTYMNLSGESIRPLMDYYK
FT                   IDVEDFVVLYDDLDIPVGKLRLRMKGSAGGHNGVKSTISHLGTQEFQRIRMGIDRPKNG
FT                   MKVVDYVLGRFTSEEIPGVNHSIEKAADACEEWLNKPFLQIMNTFNS"
FT   gene            54206..54430
FT                   /locus_tag="BCE_0050"
FT                   /old_locus_tag="BCE0050"
FT   CDS_pept        54206..54430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0050"
FT                   /old_locus_tag="BCE0050"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38986"
FT                   /db_xref="GOA:Q73FF6"
FT                   /db_xref="InterPro:IPR020115"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FF6"
FT                   /protein_id="AAS38986.1"
FT                   /translation="MEGYYYCRHCGSNVGSVTAEKVYSDVLFQLTEQEVVEMIHFHENG
FT                   NIYIKTICELCQETLASYPEYYEYEKFLQ"
FT   gene            54537..58067
FT                   /gene="mfd"
FT                   /locus_tag="BCE_0051"
FT                   /old_locus_tag="BCE0051"
FT   CDS_pept        54537..58067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="BCE_0051"
FT                   /old_locus_tag="BCE0051"
FT                   /product="transcription-repair coupling factor"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF02559; match to protein family HMM PF03461;
FT                   match to protein family HMM TIGR00580; match to protein
FT                   family HMM TIGR01612"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38987"
FT                   /db_xref="GOA:Q73FF5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FF5"
FT                   /protein_id="AAS38987.1"
FT                   /translation="MIGLLEQFYKNEEIQSVINGLEDGLKEQLVSGMATSSRSLLMAAL
FT                   YKKTKKSQLIVTHNLYQAQKVHEDLVALLGEKDVWLYPVNELIASELGVASPELKAQRI
FT                   EVLNRLAAGEHGIIVAPVAGLRRFLPMKELWKQRQIEISLGQEIDLDTFLHTLHHIGYE
FT                   RKSMVEAPGEFSLRGGILDIYPLTEELPFRIEFFDTEVDSIRLFDVDEQRSQDKKESVR
FT                   FGPATEFLFSQEELKSGIKHLEEGLTKTMQKLSDDKLKTTVLETVSHEIEMLKNGQSIE
FT                   QMFKYLSIFYNEPASLIDYLPEDGVVILDEISRIQETASHLETEEAEWYISLLGEGTII
FT                   QDLSFSHSFEEFLHHKKRSFVYLTLFLRHIAHTHPQNIVNVTCKTMQDFHGQMQLLKTE
FT                   IDRWNEGHFTTVVLGTDDERVKKLQHILSDYDIEADIVEGTDILLPGRLQIAVGDLHAG
FT                   FEMPMQKLVVITEKELFHKKVKKSQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFL
FT                   GIETLEINGVHKDYLNIKYQGNDKLYVPIEQIDQVQKYVGSEGKDPKVYKLGGNDWKKV
FT                   KTKVEKSVQDIADDLIKLYAEREASKGYAYTPDTAEQQEFESSFPYQETEDQLRSIEEI
FT                   KKDMERGRPMDRLLCGDVGYGKTEVAIRAAFKAIMDEKQVAILVPTTILAQQHYETIRE
FT                   RFQDYPINIGLLSRFRTRKQQNETIKGLKDGTVDIVIGTHRILSKDVTYKDLGLLIIDE
FT                   EQRFGVTHKEKIKQLKANVDVLTLTATPIPRTLHMSMLGVRDLSVIETPPENRFPVQTY
FT                   VVEYNPALMREAIERELARGGQVYFLYNRVEDIERKADEISMLVPDARVTYAHGKMNES
FT                   ELESVMLSFLEGQHDVLVSTTIIETGVDIPNVNTLIVFDADRMGLSQLYQLRGRVGRSN
FT                   RVAYAYFAYKRDKVLSEVAEKRLQAIKEFTELGSGFKIAMRDLSIRGAGNLLGAEQHGF
FT                   IDSVGFDLYSQMLKDAIEQRRGTDGVENTVNVEIDLEVDAYLPDAYISDSKQKIMMYKQ
FT                   FRGVSAIEDIEELQEEMIDRFGDYPQEVGYLLQIANIKVLAMKEQIELIKQNKFEVTIL
FT                   FSEQASQNIDGGKLFMLGNSFGRMIGLGMEGSQLKIVMKTNGLETSKWLTIAENLLKGL
FT                   PDVKKEVINA"
FT   gene            58204..58740
FT                   /gene="spoVT"
FT                   /locus_tag="BCE_0052"
FT                   /old_locus_tag="BCE0052"
FT   CDS_pept        58204..58740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVT"
FT                   /locus_tag="BCE_0052"
FT                   /old_locus_tag="BCE0052"
FT                   /product="stage V sporulation protein T"
FT                   /note="identified by match to protein family HMM PF04014;
FT                   match to protein family HMM TIGR01439"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38988"
FT                   /db_xref="GOA:Q73FF4"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR014213"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FF4"
FT                   /protein_id="AAS38988.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRDGEVI
FT                   LKKYSPISELGDFAKEYADALYDSLGHNVLVCDRDSIIAVSGVSKKEYLNKSVGDLIEK
FT                   TMEERKSVIMTDESDISIIDGVTEKVHSYTVGPIVANGDPIGAVIIFSKEAIISEIEHK
FT                   AVNTAASFLAKQMEQ"
FT   gene            58971..60572
FT                   /locus_tag="BCE_0053"
FT                   /old_locus_tag="BCE0053"
FT   CDS_pept        58971..60572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0053"
FT                   /old_locus_tag="BCE0053"
FT                   /product="stage V sporulation protein B, putative"
FT                   /note="identified by match to protein family HMM PF01943"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38989"
FT                   /db_xref="GOA:Q73FF3"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FF3"
FT                   /protein_id="AAS38989.1"
FT                   /translation="MESKKYQAFWRGAIILTIASFVTKVLSAFYRIPYQNIAGDVGFYI
FT                   YQQIYPFYGFCLILATYGFPIIISKMVAERLERGKKQEAEEIICVSFWFLLGIGFIGFF
FT                   TLFFGAEAIAIAMGDIHLDKLLRVISFSFILMPFLSVARGYFQGFNNMMPTAVSQVIEQ
FT                   TIRVSIIVFLSLFLIAHEFDLYTVGAGAMLGSIAGGLIGIIVLILYMRHDFRSIFFKSV
FT                   KRIKGKKKIIKILFWQGLAICVSNLVLIFIQMADSISFYSLLIGAGEPAESAKVLKGVY
FT                   DRSIPLMQLGTVVTTSFSLSLIPIITAAKERGDLTFIREKVRLAMKITFVIGFAAAIGL
FT                   TCIIQPTNIMLFENSDGSDVLSILSLSILFSSLSITTASILQGLGQTLKPAIFVIFGGC
FT                   LKLALNYILMPYFSVKGAAIATLVALIVISILNSVLLMRAVSESLIDKRNMLGVVISGI
FT                   GMGFVLMMFMRVLQMSGLVMDTSHRGVATLEALLGVAIGGLAYMFFILKLRVFTKAEIG
FT                   TVMKKEKKEGSLKKSG"
FT   gene            60678..62045
FT                   /locus_tag="BCE_0054"
FT                   /old_locus_tag="BCE0054"
FT   CDS_pept        60678..62045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0054"
FT                   /old_locus_tag="BCE0054"
FT                   /product="tetrapyrrole methylase family protein/MazG family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM PF03819; match to protein
FT                   family HMM TIGR00444"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38990"
FT                   /db_xref="GOA:Q73FF2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="InterPro:IPR024180"
FT                   /db_xref="InterPro:IPR035013"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FF2"
FT                   /protein_id="AAS38990.1"
FT                   /translation="MFVRTKEHPVIEELEKEGIQYTAFDNVYEAHDTFEIVYETIANTL
FT                   LEQAEDTEIIYAVPGHPLVAERTVQLLLKKSEVANVEVRIEGGQSFLDPMFASLKIDPI
FT                   EGFQLIDATSFERGQLELRQHLIFCQVYDAFVASDVKLTLMEMLPDDYEVYIVTAAGTS
FT                   FEQVKKVPLYMLDHETELNNLTSVYVPPVQERASLYQQFDVLREIIADLRGPNGCPWDK
FT                   KQTHQSLKKYLIEEAYEVLEAIDEEDDDHLVEELGDVLLQVMLHAQIGEDEGWFSIDDI
FT                   IRTLSEKMVRRHPHVFGNTDVNNADEVIANWEEIKKQEKGFVKESVLNGVPKSLPQLLR
FT                   AYEIQKKAGKVGFDWVDVQPMIEKALEEWQEFQQEVANMDEAKMLSEFGDLLFAFVNIA
FT                   RHYKIDPEEALRSTNEKFVSRFLYMEAKVAEMNKEMQDLSLEQLDVFWEEAKQTER"
FT   gene            62060..62335
FT                   /locus_tag="BCE_0055"
FT                   /old_locus_tag="BCE0055"
FT   CDS_pept        62060..62335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0055"
FT                   /old_locus_tag="BCE0055"
FT                   /product="S4 domain protein"
FT                   /note="identified by match to protein family HMM PF01479"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38991"
FT                   /db_xref="GOA:Q73FF1"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FF1"
FT                   /protein_id="AAS38991.1"
FT                   /translation="MRLDKFLKVSRLIKRRTLAKEVADQGRISINGQVAKASSDVKVAD
FT                   ELTIRFGQKIVTVKINELKETTKKEDAANMYSLVREEKVKAEEGLF"
FT   gene            62394..62702
FT                   /locus_tag="BCE_0056"
FT                   /old_locus_tag="BCE0056"
FT   CDS_pept        62394..62702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0056"
FT                   /old_locus_tag="BCE0056"
FT                   /product="yabP protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38992"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FF0"
FT                   /protein_id="AAS38992.1"
FT                   /translation="MNNGYSPMSSNQQNVSVEHDIIMRGRRVIDITGVKQVESFDSEEF
FT                   LLETVMGFLTIRGQNLQMKNLDVEKGVVSIKGKVHEMLYIDENQGEKTKGFFSKLFK"
FT   gene            62699..63352
FT                   /locus_tag="BCE_0057"
FT                   /old_locus_tag="BCE0057"
FT   CDS_pept        62699..63352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0057"
FT                   /old_locus_tag="BCE0057"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38993"
FT                   /db_xref="GOA:Q73FE9"
FT                   /db_xref="InterPro:IPR014242"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FE9"
FT                   /protein_id="AAS38993.1"
FT                   /translation="MSLTIQLYTMLSMIGMGAWIGASLDTYQRFLKRQERKRWIVFIHD
FT                   ILFWIVQALFVFYVLLLVNEAELRIYVFLALLCGFAAYQSMLKAIYMRLLNFLIYIFVQ
FT                   TTHFFVQIIQLLMIKPVIIIAQLFIAFILFLFRILLSIGHVLWKMVIWILLFIWKVFFW
FT                   PVRFIASLIWKLLPNRVKLFIMKHVGFLQYIAKLKGHIFQLWERIKKKLGGPRK"
FT   gene            63310..63708
FT                   /gene="divIC"
FT                   /locus_tag="BCE_0058"
FT                   /old_locus_tag="BCE0058"
FT   CDS_pept        63310..63708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="divIC"
FT                   /locus_tag="BCE_0058"
FT                   /old_locus_tag="BCE0058"
FT                   /product="cell division protein DivIC"
FT                   /note="identified by match to protein family HMM PF04977"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38994"
FT                   /db_xref="GOA:Q73FE8"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FE8"
FT                   /protein_id="AAS38994.1"
FT                   /translation="MGAYKKEVRGTSEMRELRQRTIEKQSPNPVKEHIIQTDENRKRLY
FT                   RRLAVFLVFAFTIIASISVTFYQQNSSIKAKEAKVKDMKKELDSLTNKEKSLKDEVQKL
FT                   NDEEYVLKIARRDYFFSGKGEIIFPVSK"
FT   gene            63796..64278
FT                   /locus_tag="BCE_0059"
FT                   /old_locus_tag="BCE0059"
FT   CDS_pept        63796..64278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0059"
FT                   /old_locus_tag="BCE0059"
FT                   /product="S1 RNA binding domain protein"
FT                   /note="identified by match to protein family HMM PF00575"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38995"
FT                   /db_xref="GOA:Q73FE7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FE7"
FT                   /protein_id="AAS38995.1"
FT                   /translation="MSIEVGSKLQGKVTGITNFGAFVELPEGLTGLVHISEVADNYVKD
FT                   INDHLKVGDQVEVKVINVEKDGKIGLSIKKAKEREKTEGDRPRGEYQRGGDQQRSGRPQ
FT                   RNRSFNRDNRGGGNDRAPKETFEQKMARFLKDSEDRLTSLKRNTESKRGGRGARRG"
FT   gene            64439..64512
FT                   /locus_tag="BCE_5645"
FT                   /old_locus_tag="BCE5645"
FT                   /note="tRNA-Met"
FT   tRNA            64439..64512
FT                   /locus_tag="BCE_5645"
FT                   /old_locus_tag="BCE5645"
FT                   /product="tRNA-Met"
FT   gene            64526..64597
FT                   /locus_tag="BCE_5646"
FT                   /old_locus_tag="BCE5646"
FT                   /note="tRNA-Glu"
FT   tRNA            64526..64597
FT                   /locus_tag="BCE_5646"
FT                   /old_locus_tag="BCE5646"
FT                   /product="tRNA-Glu"
FT   gene            64950..67328
FT                   /gene="spoIIE"
FT                   /locus_tag="BCE_0060"
FT                   /old_locus_tag="BCE0060"
FT   CDS_pept        64950..67328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIE"
FT                   /locus_tag="BCE_0060"
FT                   /old_locus_tag="BCE0060"
FT                   /product="stage II sporulation protein E"
FT                   /EC_number="3.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38996"
FT                   /db_xref="GOA:Q73FE6"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014221"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FE6"
FT                   /protein_id="AAS38996.1"
FT                   /translation="MKFEQVFFRWGFIIVVIGFLLGRAYILTNILPFALPFFAAVYVMK
FT                   RDKMPLAFLALMGGALSVSIDNLFFTFASIFTFFIYNIFFSRFTRKTVGLVPFQVFISA
FT                   LTAHLVVVYFAQQTVTMYDLLVSTIEAGLSFVLTMIFLQSVPLLVERKGKQQALETEEI
FT                   VCLIILLASVLTGTTDWFIYDASIQHIFTRYLVLVFAFIAGAATGSTVGVVTGLILSLA
FT                   NVSSLSQLSLLAFSGLLGGLLKEGKRLGVSLGLLIGTSLITLYVDKQTNIVTTLIESGV
FT                   AIAFFLLTPKLVMDRIAKFMPGTQEHSQDQQQYLRRMRDVTANKINQFANVFAALSNSF
FT                   SVYGYVEEEDKETEADLFLSTITAKTCQTCFKKDQCWVVNFDKTYDYMKQIMSETEEGT
FT                   LQHNRKLVREWDKHCVRGKKVTDLVAGELDHFYEGQKLRKQMKENRRIVAEQLLGVSKV
FT                   MEDFAKEIQRERENHQVQEEQILQAFRDFGVEIEHVDIYCLDRGSIDIEMLIPVASNEH
FT                   GECEKLVAPMLSDILKENIVVKHEEKSSYPNGHSLISFGSAKTYSLDTGLATAAKGGGF
FT                   VSGDSYAMMDLSVGKYALAISDGMGNGQRAHMESKETVKLLQKILQSGIDEEIAIKSIN
FT                   SILSLRTTEEMFTTLDLAMVDLRDASAKFLKIGSTPSFVKRANNILKIEASNLPMGIIE
FT                   DVEVDVVGEQLKTGDILIMMSDGIFEGAQHVENHELWMKRKIKELQTEDPQEIADIIME
FT                   EVIRSGDGYINDDMTIVVAKVKKNMPKWATIPIVGMQAQ"
FT   gene            67554..68984
FT                   /locus_tag="BCE_0061"
FT                   /old_locus_tag="BCE0061"
FT   CDS_pept        67554..68984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0061"
FT                   /old_locus_tag="BCE0061"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01171"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38997"
FT                   /db_xref="GOA:Q73FE5"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73FE5"
FT                   /protein_id="AAS38997.1"
FT                   /translation="MKDTFVEKVDDFVKQHDVLKERSTIVVGVSGGPDSVALLYYLLEK
FT                   RAAKQFEIVVAHVDHMFRGDESHEDLQFVQDLCKELGVICETIRINVSQYQQQYGMNAQ
FT                   VAARECRYAFLERIMKKYDARYVALGHHGDDQVETILMRLVRGSTPKGYAGIAVKRPFH
FT                   NGYLIRPLLGVTKEEIVDYCHKLKIIPRIDPSNKKEVYTRNRLRKYVLPHLKEENPQVH
FT                   EKFQKFSMQMQEDEAYLQELAFEKMNKVITKKSDKQISLSIPAFESMSMPLQRRGIQLI
FT                   LNYLYEYKIPSSLSSIHIDKVIEFFKRTQPSGSLDFPGDLKIVRAYEECSFGFKQEIVS
FT                   PFLQDLSVPGTITLSNGDKLVTEVSEDIPSNMNETVFVAKYNDISYPLRIRSRENGDRM
FT                   SIQGMNGTKKIKAIFIEAKVPREKREEWPVVCDARGNVIWLPLLKRSAFAISKETAKKD
FT                   KYMIIHYKSKESSGRIMK"
FT   gene            68981..69523
FT                   /gene="hpt"
FT                   /locus_tag="BCE_0062"
FT                   /old_locus_tag="BCE0062"
FT   CDS_pept        68981..69523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="BCE_0062"
FT                   /old_locus_tag="BCE0062"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01203"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38998"
FT                   /db_xref="GOA:Q73FE4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FE4"
FT                   /protein_id="AAS38998.1"
FT                   /translation="MMNQDIEKVLISEEQIQEKVLELGAIIAEDYKNTVPLAIGVLKGA
FT                   MPFMADLLKRTDTYLEMDFMAVSSYGHSTVSTGEVKILKDLDTSVEGRDILIVEDIIDS
FT                   GLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQ
FT                   YRNLPYVGVLKPSVYSN"
FT   gene            69609..71510
FT                   /gene="ftsH"
FT                   /locus_tag="BCE_0063"
FT                   /old_locus_tag="BCE0063"
FT   CDS_pept        69609..71510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="BCE_0063"
FT                   /old_locus_tag="BCE0063"
FT                   /product="cell division protein FtsH"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF01434; match to protein
FT                   family HMM TIGR01241"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAS38999"
FT                   /db_xref="GOA:Q73FE3"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FE3"
FT                   /protein_id="AAS38999.1"
FT                   /translation="MNRIFRNTIFYLLIFLVVIGIVSYFNGSTQKTTSVSYDKFITKLE
FT                   KGEVRNVQLQPKNGVFEVKGQFNNSSQGEQFVTYAPNTEELQKKINDKAQGAEVKYQPA
FT                   EETSAWVTFFTSIIPFVIIFILFFFLLNQAQGGGSRVMNFGKSKAKLYNDEKKKVRFRD
FT                   VAGADEEKQELVEVVEFLKDPRKFAEVGARIPKGVLLVGPPGTGKTLLARAVAGEAGVP
FT                   FFSISGSDFVEMFVGVGASRVRDLFENAKKNAPCIIFIDEIDAVGRQRGAGLGGGHDER
FT                   EQTLNQLLVEMDGFGANEGIIIIAATNRPDILDPALLRPGRFDRQITVDRPDVNGREAV
FT                   LKVHARNKPLDENINLRAIATRTPGFSGADLENLLNEAALVAARQDKKKIDMSDIDEAT
FT                   DRVIAGPAKKSRVISEKERNIVAFHEAGHTVIGVVLDEADVVHKVTIVPRGQAGGYAVM
FT                   LPKEDRYFMTKPELLDKITGLLGGRVAEEIVFGEVSTGAHNDFQRATGIARRMVTEFGM
FT                   SDKLGPMQFGSSQGGQVFLGRDFHSEQNYSDAIAHDIDVEMQTIMKECYARAKDILTEN
FT                   RDKLDLIAKTLLEVETLDAEQINHLCDYGRLPERPTSSADVKVNINMKKDDEESEDK"
FT   gene            71736..72524
FT                   /locus_tag="BCE_0064"
FT                   /old_locus_tag="BCE0064"
FT   CDS_pept        71736..72524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0064"
FT                   /old_locus_tag="BCE0064"
FT                   /product="transcriptional activator, putative, Baf family"
FT                   /note="identified by match to protein family HMM PF03309;
FT                   match to protein family HMM TIGR00671"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39000"
FT                   /db_xref="GOA:Q73FE2"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73FE2"
FT                   /protein_id="AAS39000.1"
FT                   /translation="MIFVLDVGNTNAVLGVFEEGELRQHWRMETDRHKTEDEYGMLVKQ
FT                   LLEHEGLSFEDVKGIIVSSVVPPIMFALERMCEKYFKIKPLVVGPGIKTGLNIKYENPR
FT                   EVGADRIVNAVAGIHLYGSPLIIVDFGTATTYCYINEEKHYMGGVITPGIMISAEALYS
FT                   RAAKLPRIEITKPSSVVGKNTVSAMQSGILYGYVGQVEGIVKRMKEEAKQEPKVIATGG
FT                   LAKLISEESNVIDVVDPFLTLKGLYMLYERNANLQHEKGE"
FT   gene            72531..73406
FT                   /gene="hslO"
FT                   /locus_tag="BCE_0065"
FT                   /old_locus_tag="BCE0065"
FT   CDS_pept        72531..73406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="BCE_0065"
FT                   /old_locus_tag="BCE0065"
FT                   /product="chaperonin, 33 kDa"
FT                   /note="identified by match to protein family HMM PF01430"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39001"
FT                   /db_xref="GOA:Q73FE1"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73FE1"
FT                   /protein_id="AAS39001.1"
FT                   /translation="MKDYLVKALAFDGEVRAYSVRTTNTVSEAQRRHDTWRTASAALGR
FT                   SLTAGTMMGAMLKGDQKLTIKVEGNGPIGPILVDAHANGDVRGYVTNPHVDFEGTEQGK
FT                   LRVYQAVGTEGFVTVIKDIGMREPFIGQSPIVSGELGEDFTYYFAVSEQTPSSVGVGVL
FT                   VNGDDSILAAGGFILQIMPGAQEETISFIEERLQKIPPVSTLIEQGLSPEELLYAVLGE
FT                   DKVKVLETMDVQFNCTCSRERIESVLISLGKTELEQVREEEEETEVHCHFCNERYKFSK
FT                   EDITNLIENL"
FT   gene            73511..74434
FT                   /gene="cysK"
FT                   /locus_tag="BCE_0066"
FT                   /old_locus_tag="BCE0066"
FT   CDS_pept        73511..74434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="BCE_0066"
FT                   /old_locus_tag="BCE0066"
FT                   /product="cysteine synthase A"
FT                   /EC_number="2.5.1.47"
FT                   /note="identified by match to protein family HMM PF00291;
FT                   match to protein family HMM TIGR01136; match to protein
FT                   family HMM TIGR01139"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39002"
FT                   /db_xref="GOA:Q73FE0"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FE0"
FT                   /protein_id="AAS39002.1"
FT                   /translation="MRVAQSVSELIGKTPIVKLNRIVESDSADIYLKLEFMNPGSSVKD
FT                   RIALAMIEDAEKKGLLKEGDTIIEPTSGNTGIGLAMVAAAKGYKAILVMPETMSIERRN
FT                   LLRAYGAELVLTPGPEGMGGAIRKATELAKENGYFIPQQFKNQSNPEIHRLTTGPEIVE
FT                   QMGDQLDAFIAGIGTGGTITGAGEVLKEAYKDIKIYAVEPADSPVLSGGKPGPHKIQGI
FT                   GAGFIPETLDVEVYDEIVQVKTEQAFEYARRVAKEEGILVGISSGAVIYAATEIAKKLG
FT                   KGKKVLVIIPSNGERYLSTPLYQFES"
FT   gene            74609..76051
FT                   /gene="pabB"
FT                   /locus_tag="BCE_0067"
FT                   /old_locus_tag="BCE0067"
FT   CDS_pept        74609..76051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabB"
FT                   /locus_tag="BCE_0067"
FT                   /old_locus_tag="BCE0067"
FT                   /product="para-aminobenzoate synthase, component I"
FT                   /EC_number="4.1.3.-"
FT                   /note="identified by match to protein family HMM PF00425;
FT                   match to protein family HMM PF04715"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39003"
FT                   /db_xref="GOA:Q73FD9"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FD9"
FT                   /protein_id="AAS39003.1"
FT                   /translation="MVNIRGWDKRRRGVDMQRRKSLALSIPYQLDFFKQYKFLSKDKPQ
FT                   HILLESGRGGRYNIVGLNPVAVIRGKGKTLHISESGKETIKQGNPLDLMQEYMERWKTD
FT                   YNPEYPPFQGGAIGYFSYDCIRYIEKLPSLAEDDINIPDIFFLLFDDVFVYDQEEKVLW
FT                   IITHYADKHEEAKERLNEWKVLWTTEAPEVTMPFACPEKKSEAVAFTEEGFMKAVECIQ
FT                   EYIGAGDVFQVNLSTRQERTLQTHPLEIYTSLREINPSPYMGYLELGDFQIVSGSPELL
FT                   IKKQGAEVSTRPIAGTRSRGANEQEDEELARELIENEKERAEHVMLVDLERNDLGRVCK
FT                   YGTVEVDEFMVIEKYSHVMHIVSNVRGEVEEDKDAFDLVKAVFPGGTITGAPKIRTMEI
FT                   IEELEPVRRGIYTGSIGWIGYSGDTELNIVIRTLLAKDGKAHVQAGAGIVIDSNPENEY
FT                   KESLKKAIALWRAKERSEETVR"
FT   gene            76057..76644
FT                   /gene="pabA"
FT                   /locus_tag="BCE_0068"
FT                   /old_locus_tag="BCE0068"
FT   CDS_pept        76057..76644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /locus_tag="BCE_0068"
FT                   /old_locus_tag="BCE0068"
FT                   /product="para-aminobenzoate synthase glutamine
FT                   amidotransferase, component II"
FT                   /EC_number="4.1.3.27"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM TIGR00566"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39004"
FT                   /db_xref="GOA:Q73FD8"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FD8"
FT                   /protein_id="AAS39004.1"
FT                   /translation="MILMIDNYDSFTFNLVQFLGELGQELVVKRNDEVTISDIENMKPD
FT                   FLMISPGPCSPNEAGISMEVIRYFAGKIPIFGVCLGHQSIAQVFGGEVVRAERLMHGKT
FT                   SLMHHDEKTIFSDIPNPFTATRYHSLIVKKETLPECLEVTSWTEEGEIMALRHTTLPIE
FT                   GVQFHPESIMTSHGKELLQNFIRKYSPSVTSC"
FT   gene            76638..77510
FT                   /gene="pabC"
FT                   /locus_tag="BCE_0069"
FT                   /old_locus_tag="BCE0069"
FT   CDS_pept        76638..77510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabC"
FT                   /locus_tag="BCE_0069"
FT                   /old_locus_tag="BCE0069"
FT                   /product="4-amino-4-deoxychorismate lyase PabC"
FT                   /note="identified by match to protein family HMM PF01063"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39005"
FT                   /db_xref="GOA:Q73FD7"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FD7"
FT                   /protein_id="AAS39005.1"
FT                   /translation="MLIYVNGQYVEASEARISPYDHGYLYGLGVFETFRIYNGHPFLLD
FT                   DHYDRLIDALDTLQIKWSMTKDEVMLILKNLLVKNKLEHAYVRFNVSAGIDEIGLQTEM
FT                   YEEPSIIVFIKPLAAPGDVVEKEGVVLNQVRNTPEGASRLKSHHYLNNILGKREIGNVV
FT                   NKEGIFLTETGYVAEGIVSNLFFVKGDILYTPSLKTGILNGITRAFIIKVAEKMGIEVK
FT                   EGLFTKDELLSADEVFVTNSIQEIVPLNCIEGRDFPGKVGVVTKRFMNLYEMQREKLWS
FT                   RNELRRGDV"
FT   gene            77503..78345
FT                   /gene="folP"
FT                   /locus_tag="BCE_0070"
FT                   /old_locus_tag="BCE0070"
FT   CDS_pept        77503..78345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="BCE_0070"
FT                   /old_locus_tag="BCE0070"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="identified by match to protein family HMM PF00809;
FT                   match to protein family HMM TIGR01496"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39006"
FT                   /db_xref="GOA:Q73FD6"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FD6"
FT                   /protein_id="AAS39006.1"
FT                   /translation="MCSLKWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEV
FT                   DAAVRHAKEMREEGAHIIDIGGESTRPGFAKVSVEEEIKRVVPMIQAVSKEVKLPISID
FT                   TYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADM
FT                   IADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSR
FT                   KSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMARMAKMMDAMIGKGVK"
FT   gene            78346..78708
FT                   /gene="folB"
FT                   /locus_tag="BCE_0071"
FT                   /old_locus_tag="BCE0071"
FT   CDS_pept        78346..78708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="BCE_0071"
FT                   /old_locus_tag="BCE0071"
FT                   /product="dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /note="identified by match to protein family HMM PF02152;
FT                   match to protein family HMM TIGR00525; match to protein
FT                   family HMM TIGR00526"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39007"
FT                   /db_xref="GOA:Q73FD5"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FD5"
FT                   /protein_id="AAS39007.1"
FT                   /translation="MDKIYIHDMEFYGYHGVFPEENKLGQRFKVDLTVELDLKQAGESD
FT                   DLEQSVNYGELFELCRKVVEVRTYKLVESIAENIATDILKQYESISRCTIKVIKPDPPI
FT                   PGHYRAVAVEITRERP"
FT   gene            78705..79220
FT                   /gene="folK"
FT                   /locus_tag="BCE_0072"
FT                   /old_locus_tag="BCE0072"
FT   CDS_pept        78705..79220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="BCE_0072"
FT                   /old_locus_tag="BCE0072"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="identified by match to protein family HMM PF01288;
FT                   match to protein family HMM TIGR01498"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39008"
FT                   /db_xref="GOA:Q73FD4"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FD4"
FT                   /protein_id="AAS39008.1"
FT                   /translation="MNNIAYIALGSNIGERYTYLTEAIQFLNKNPYIKVEDVSSVYETE
FT                   PVGYTDQSCFLNLVIKISTNLSPQELLKVTQKVENDLGRKREIRWGPRTIDLDILLYNQ
FT                   ENIEAENLIVPHPRMFERAFVIVPLLEINQDIKQNISRSQVEEMKRREGVTVWKQKNGE
FT                   DAFVLFEN"
FT   gene            79172..79375
FT                   /locus_tag="BCE_0073"
FT                   /old_locus_tag="BCE0073"
FT   CDS_pept        79172..79375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0073"
FT                   /old_locus_tag="BCE0073"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39009"
FT                   /db_xref="GOA:Q73FD3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FD3"
FT                   /protein_id="AAS39009.1"
FT                   /translation="MEAEKWGRRIRAFRKLKGYTQEGFAKELGVSVSVLGEVERGNRSP
FT                   SQDFVVEVAKALKVSIDELMPK"
FT   gene            79399..80397
FT                   /locus_tag="BCE_0074"
FT                   /old_locus_tag="BCE0074"
FT   CDS_pept        79399..80397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0074"
FT                   /old_locus_tag="BCE0074"
FT                   /product="TIM-barrel protein, putative, NifR3 family"
FT                   /note="identified by match to protein family HMM PF01207;
FT                   match to protein family HMM TIGR00737"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39010"
FT                   /db_xref="GOA:Q73FD2"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FD2"
FT                   /protein_id="AAS39010.1"
FT                   /translation="MLKIANIEMKNPVVLAPMAGVCNSAFRLTVKEFGAGLVCAEMVSD
FT                   KAILLNNKRTLDMLYIDEREKPLSLQIFGGEKETLVDAAKYVDQYTTADIIDINMGCPV
FT                   PKIVKCDAGAKWLLDPNKIYEMVAAVVDAVEKPVTVKMRIGWDEDHIFAIENAKAVERA
FT                   GGQAVAVHGRTRVQMYEGKADWDIIKQVKQAVNIPVIGNGDVATPQDAKRMLDEIGVDG
FT                   VMIGRAALGDPWMIYRTVKYLETGELMPEPTVREKIDVCMLHLDRLIDLKNENVAVREM
FT                   RKHAAWYLKGIRGNATVRNGINACNTREDLANVLGTFVEEVEAKQQTIHVG"
FT   gene            80557..82056
FT                   /gene="lysS"
FT                   /locus_tag="BCE_0075"
FT                   /old_locus_tag="BCE0075"
FT   CDS_pept        80557..82056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="BCE_0075"
FT                   /old_locus_tag="BCE0075"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="identified by match to protein family HMM PF00152;
FT                   match to protein family HMM PF01336; match to protein
FT                   family HMM TIGR00499"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39011"
FT                   /db_xref="GOA:Q73FD1"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73FD1"
FT                   /protein_id="AAS39011.1"
FT                   /translation="MDNMNHEELNDQLLVRREKLHNLREQGIDPFGKRFERTNATNELL
FT                   SLYGEFSKEELEEKEISVSIAGRIMTKRGKGKAGFAHIQDLHGQVQIYVRKDAVGDEEY
FT                   ELFKTADLGDLVGIEGKVFKTNVGELSVKATGFTLLTKSLRPLPDKYHGLKDVEQRYRQ
FT                   RYLDLITSMESRETFVTRSKIIREMRRYLDDNGYLEVETPMMHAIAGGASARPFITHHN
FT                   ALDMELYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADY
FT                   KDIMKLTENMVAHIAKQVLGTTTIQYGDYEINLEPEWTRLHMVDAIKEHSGADFWNPMS
FT                   VEEARELAKEHNVEIKDTMEVGHIINEFFEQKVEDKLIQPTFIYGHPVEISPLAKKNDE
FT                   DPRFTDRFELFIVAREHANAFTELNDPIDQKERFEAQLKEREQGNDEAHMMDDDYIEAL
FT                   EYGMPPTGGLGIGIDRLVMLLTNAPSIRDVLLFPAMRHKQD"
FT   gene            82152..82286
FT                   /locus_tag="BCE_0076"
FT                   /old_locus_tag="BCE0076"
FT   CDS_pept        82152..82286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0076"
FT                   /old_locus_tag="BCE0076"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39012"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FD0"
FT                   /protein_id="AAS39012.1"
FT                   /translation="MLFLYFFTKLKILLEKLLHFNNQTGIFIFVATKGNKQNKRKTTY"
FT   gene            82283..82408
FT                   /locus_tag="BCE_0077"
FT                   /old_locus_tag="BCE0077"
FT   CDS_pept        82283..82408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0077"
FT                   /old_locus_tag="BCE0077"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39013"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FC9"
FT                   /protein_id="AAS39013.1"
FT                   /translation="MKKVVDENITKCYINKVASERRSSSLKTERNKQRETSIFIL"
FT   gene            82453..83960
FT                   /locus_tag="BCE_5744"
FT                   /old_locus_tag="BCE5744"
FT                   /note="Bc16SC"
FT   rRNA            82453..83960
FT                   /locus_tag="BCE_5744"
FT                   /old_locus_tag="BCE5744"
FT                   /product="16S ribosomal RNA"
FT   gene            84136..87044
FT                   /locus_tag="BCE_5745"
FT                   /old_locus_tag="BCE5745"
FT                   /note="Bc23SC"
FT   rRNA            84136..87044
FT                   /locus_tag="BCE_5745"
FT                   /old_locus_tag="BCE5745"
FT                   /product="23S ribosomal RNA"
FT   gene            87094..87209
FT                   /locus_tag="BCE_5746"
FT                   /old_locus_tag="BCE5746"
FT                   /note="Bc5SC"
FT   rRNA            87094..87209
FT                   /locus_tag="BCE_5746"
FT                   /old_locus_tag="BCE5746"
FT                   /product="5S ribosomal RNA"
FT   gene            87416..87877
FT                   /gene="ctsR"
FT                   /locus_tag="BCE_0078"
FT                   /old_locus_tag="BCE0078"
FT   CDS_pept        87416..87877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctsR"
FT                   /locus_tag="BCE_0078"
FT                   /old_locus_tag="BCE0078"
FT                   /product="transcriptional regulator CtsR"
FT                   /note="identified by match to protein family HMM PF05848"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39014"
FT                   /db_xref="GOA:Q73FC8"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FC8"
FT                   /protein_id="AAS39014.1"
FT                   /translation="MRNISDIIEQYLKQVIDLSNNNVIEIKRNEIADRFECVPSQINYV
FT                   INTRFTLERGFVVESKRGGGGYIRIIKVKLHDDIDIIDQMLHMIDHSVAQGNAESMIIR
FT                   LIEEGIITNREAKLMLSVLDRSVLSMDVPSRDELRARILCAMLRTLKYK"
FT   gene            88051..88599
FT                   /locus_tag="BCE_0079"
FT                   /old_locus_tag="BCE0079"
FT   CDS_pept        88051..88599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0079"
FT                   /old_locus_tag="BCE0079"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02151"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39015"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FC7"
FT                   /protein_id="AAS39015.1"
FT                   /translation="MTCQNCNIRPATLHYTKVINEKKAEVHLCEQCAEQSGYTSFFQSS
FT                   QSNFSFHDLFAGLLHGESTMFEEGKSGFSNTNILRCPDCKMTYEQLTKVGRFGCASCYD
FT                   TFKEHLKPLLKRLHGGHTDHCGKIPERIEGNIHLKKELDELKLILKQYVQKEEFEKAAE
FT                   VRDKIRNLENQLSEHREGE"
FT   gene            88604..89668
FT                   /locus_tag="BCE_0080"
FT                   /old_locus_tag="BCE0080"
FT   CDS_pept        88604..89668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0080"
FT                   /old_locus_tag="BCE0080"
FT                   /product="phosphotransferase domain protein"
FT                   /note="identified by match to protein family HMM PF00217"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39016"
FT                   /db_xref="GOA:Q73FC6"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73FC6"
FT                   /protein_id="AAS39016.1"
FT                   /translation="MSLDKIMNEAISPWMKGDGPDSDIVLSSRIRLARNFKKYQFSTMQ
FT                   NEEEAKLIQELFKKEFINKTVEPFGEFELLKMNELTPLQRRVLVEKHLISPNLAGTEYG
FT                   ACLLSESEHISVMLNEEDHIRIQCLFSGLQLSEALQSANQIDNWIEKEVEYAFDESLGY
FT                   ITSCPTNVGTGLRASVMIHLPGLVLTKRISRIIQVIQKLGLVVRGIYGEGSEALGNIFQ
FT                   VSNQMTLGKSEEDIIADLKSVIQQIIQQEKMARELIVQNSSIELEDKVYRSYGILANSR
FT                   LIQSAEAANCLSDLRLGIDLGYIKGISRNILTELMVLTQPGILQQYAGGPLGPEERDYR
FT                   RATLIRERLRIEKN"
FT   gene            89691..92126
FT                   /locus_tag="BCE_0081"
FT                   /old_locus_tag="BCE0081"
FT   CDS_pept        89691..92126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0081"
FT                   /old_locus_tag="BCE0081"
FT                   /product="negative regulator of genetic competence
FT                   ClpC/MecB"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF02151; match to protein
FT                   family HMM PF02861"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39017"
FT                   /db_xref="GOA:Q73FC5"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FC5"
FT                   /protein_id="AAS39017.1"
FT                   /translation="MMFGRFTERAQKVLALSQEEAIRIGHNNIGTEHILLGLVREGEGI
FT                   AAKALIALGLSPEKVQKEVEALIGRGTEASQTVHYTPRAKKVIELSMDEARKLGHSYVG
FT                   TEHILLGLIREGEGVAARVLNNLGVSLNKARQQVLQLLGSNEASSGHQGGSSTNANTPT
FT                   LDSLARDLTVVARENRLDPVIGRGKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGL
FT                   AQQIVNNEVPETLRDKRVMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNIILFIDE
FT                   LHTLIGAGGAEGAIDASNILKPSLARGELQCIGATTLDEYRKYIEKDAALERRFQPIHV
FT                   DEPSLDESTQILKGLRDRYEAHHRVSITDDAIDAAVKLSDRYITDRFLPDKAIDLIDEA
FT                   ASKVRLRSYTTPPNLKELEVKLEEIRKEKDAAVQSQEFEKAASLRDMEQRLREKLEDTK
FT                   RQWKEQQGKENSEVTVEDIANVVSTWTRIPVSKLAQTETDKLLNLESILHDRVIGQDEA
FT                   VVAVAKAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARALAESMFGDEDAMIRIDMS
FT                   EYMEKHSTSRLVGSPPGYVGYEEGGQLTEKVRRKPYSVVLLDEVEKAHPDVFNILLQVL
FT                   EDGRLTDSKGRTVDFRNTIVIMTSNVGAEALKRNKHLGFNVQDESRDYSDMKGKVMDEL
FT                   KKAFRPEFLNRIDEIIVFHMLEKKHIQEIVTLMVNQLVNRLKEQEIELHLTEGAISAIA
FT                   DKGFDREYGARPLRRAIQKHVEDRLSEELLKGAIEKGQKVIFDVEGESFVIHSAEKVK"
FT   gene            92223..93599
FT                   /gene="radA"
FT                   /locus_tag="BCE_0082"
FT                   /old_locus_tag="BCE0082"
FT   CDS_pept        92223..93599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="BCE_0082"
FT                   /old_locus_tag="BCE0082"
FT                   /product="DNA repair protein RadA"
FT                   /note="identified by match to protein family HMM TIGR00416"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39018"
FT                   /db_xref="GOA:Q73FC4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FC4"
FT                   /protein_id="AAS39018.1"
FT                   /translation="MAKKKTKFTCQECGYQSPKYMGKCPGCGQWNTLVEEMEPVVSSRR
FT                   LNYANAIQTEVTKPRRLTEVETKSEARIETKFQEFNRVLGGGIVDGSLVLIGGDPGIGK
FT                   STLLLQISSQLADSSYDVLYISGEESAKQIKLRADRLHVNGSNLFVVSETDLQRIATHI
FT                   EEVNPAFVVIDSIQTIHLPEVTSAPGSVAQVRECTAELMKLAKTKGIPIFIVGHVTKEG
FT                   AIAGPRMLEHMVDAVLYFEGDRHHTYRILRAVKNRFGSTNEMGIFEMKELGLAEVLNPS
FT                   EIFLEERPVGVAGSTVVASMEGTRPVLVEIQALISPTSFGNPRRMATGIDHNRVSLIMA
FT                   VLEKRTGLLLQNQDAYLKVAGGLKLDEPAIDLAVALSIASSFRDKSTAPTDAVIGEVGL
FT                   TGEIRRVSRIEQRVQEAAKLGFQRAIIPRKNLGGWTIPDGIEVVGVSNLGEALRLTLGG
FT                   "
FT   gene            93603..94676
FT                   /locus_tag="BCE_0083"
FT                   /old_locus_tag="BCE0083"
FT   CDS_pept        93603..94676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0083"
FT                   /old_locus_tag="BCE0083"
FT                   /product="DNA-binding protein, putative"
FT                   /note="identified by match to protein family HMM PF00633;
FT                   match to protein family HMM PF02457"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39019"
FT                   /db_xref="GOA:Q73FC3"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73FC3"
FT                   /protein_id="AAS39019.1"
FT                   /translation="MEENKQRVKSMINILQLVAPGTPLREGIDNVLRAQTGGLIVLGYN
FT                   EQIKSIVDGGFHINCAFSPASLYELAKMDGALILNETGSKILIANAQLVPESSIDSIET
FT                   GMRHRTAERVAKQTGSLVVAISQRRNVITLYQGNLRYTLKDIGVILTKANQAIQTLEKY
FT                   KAVWNDGITNLGILEFEEVVTMSEVVHVLHSVEMVLRIKNEILSYIHELGTEGRLIRLQ
FT                   LTELLADLEAEAALLIKDYYQEKTQDHHQILKKLQELANTQLLEDSDLVKLLGYPGQTS
FT                   LEESVTPRGYRITSKISRVPPLIIENLINRFKTLQGVCRATINELDDVEGIGEVRAKKI
FT                   REGLKRIQEHLYMSRHN"
FT   gene            94837..95946
FT                   /locus_tag="BCE_0084"
FT                   /old_locus_tag="BCE0084"
FT   CDS_pept        94837..95946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0084"
FT                   /old_locus_tag="BCE0084"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01850;
FT                   match to protein family HMM PF01938"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39020"
FT                   /db_xref="GOA:Q73FC2"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FC2"
FT                   /protein_id="AAS39020.1"
FT                   /translation="MLKRIVQLFFLVIGGALGIYLIPKVINVLDIGAVPLLEGSYVRAI
FT                   IGAIILFLTTFWLVDYIVQLIKHIEEALVKAPVADVLFGTLGLISGLIVAYLILIPIRE
FT                   FTIPVISTVLQVFFTLLLGYLGFQVGFKKRNELLGLFTLPQRGKKKNNNSENEEPENEV
FT                   EESLAHWKILDTSVIIDGRIADICQTKFLEGTIVIPQFVLEELQHIADSSDALKRNRGR
FT                   RGLDILNRIQKEMPIPVEIYEGDFDDIQEVDSKLVKLAKITGGTVVTNDFNLNKVSELQ
FT                   GVTVLNINDLANAIKPVVLPGEELSVYVVKDGKEQNQGVAYLDDGTMIVVEDGREYVGS
FT                   QLDVLVTSVLQTSAGRMIFAKRKLLEKAL"
FT   gene            95963..96643
FT                   /gene="ispD"
FT                   /locus_tag="BCE_0085"
FT                   /old_locus_tag="BCE0085"
FT   CDS_pept        95963..96643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="BCE_0085"
FT                   /old_locus_tag="BCE0085"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.60"
FT                   /note="identified by match to protein family HMM PF01128;
FT                   match to protein family HMM TIGR00453"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39021"
FT                   /db_xref="GOA:Q73FC1"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73FC1"
FT                   /protein_id="AAS39021.1"
FT                   /translation="MYTLIIPAAGQGKRMGAGKNKLFLLINEVPIIVHTLRAFEKDKAC
FT                   KNIIMAINEEERPYFEELMQKYPVKKPVQFIQGGAERQDSVYNAIQHTSDVEYVLVHDG
FT                   ARPFVTNKVIQDVLTAAEKYGASICAVPVKDTVKKVEQGVVVETVERSQLKAVQTPQGF
FT                   SVSLLLEAHRSAKQSCFLGTDDASLVERIGKQVGVVEGSYYNIKVTTPEDLLIAESFLH
FT                   VQKK"
FT   gene            96759..97235
FT                   /gene="ispF"
FT                   /locus_tag="BCE_0086"
FT                   /old_locus_tag="BCE0086"
FT   CDS_pept        96759..97235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispF"
FT                   /locus_tag="BCE_0086"
FT                   /old_locus_tag="BCE0086"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="identified by match to protein family HMM PF02542;
FT                   match to protein family HMM TIGR00151"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39022"
FT                   /db_xref="GOA:Q73FC0"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73FC0"
FT                   /protein_id="AAS39022.1"
FT                   /translation="MFRIGQGFDVHEFAEGRPLIIGGVTIPHEKGLIGHSDADVLLHTI
FT                   ADACLGAIAAGDIGKHFPDTDPAFKDADSAVLLQKVWEFVREQGYELGNLDCTIIAQKP
FT                   KMAPHIESMRKRISELLETSIDNINVKATTTEKLGFTGREEGIASQAVVLLQKK"
FT   gene            97325..98782
FT                   /gene="gltX"
FT                   /locus_tag="BCE_0087"
FT                   /old_locus_tag="BCE0087"
FT   CDS_pept        97325..98782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="BCE_0087"
FT                   /old_locus_tag="BCE0087"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="identified by match to protein family HMM PF00749;
FT                   match to protein family HMM TIGR00464"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39023"
FT                   /db_xref="GOA:Q73FB9"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73FB9"
FT                   /protein_id="AAS39023.1"
FT                   /translation="MEKQVRVRYAPSPTGHLHIGNARTALFNYLFARHQDGKFIIRIED
FT                   TDVKRNVAGGEESQLKYLKWLGMDWDEGVDVGGEFGPYRQTERLDIYKKLYEDLLERGL
FT                   AYKCYMTEEELEAEREGQIARGETPRYAGNHRDLTEAQVKEFEAEGRIPSIRFRVPADR
FT                   DYTFKDIVKDEVAFHSNDFGDFVIVKKDGIPTYNFAVAVDDHLMEITHVLRGDDHISNT
FT                   PKQMMIYEAFGWDIPQFGHMTLIVNESRKKLSKRDESIIQFIEQYKELGYLPEAIFNFI
FT                   ALLGWSPVGEEEIFSQEEFIKMFDAARLSKSPALFDSQKLKWMNNQYMKKQDLDTVVEL
FT                   SLPHLVKAGRIGETLSEQEQAWIRDVIALYHEQMSFGAEIVELSEMFFKDHVDYEEEGQ
FT                   EVLKGEQVPEVLRAFAGQVEALEAMEPAAIKAAIKAVQKETGHKGKNLFMPIRVATTGQ
FT                   THGPELPNAIALLGKEKVLXRLQKVIG"
FT   gene            99213..99878
FT                   /gene="cysE"
FT                   /locus_tag="BCE_0088"
FT                   /old_locus_tag="BCE0088"
FT   CDS_pept        99213..99878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="BCE_0088"
FT                   /old_locus_tag="BCE0088"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="identified by match to protein family HMM PF00132;
FT                   match to protein family HMM TIGR01172"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39024"
FT                   /db_xref="GOA:Q73FB8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FB8"
FT                   /protein_id="AAS39024.1"
FT                   /translation="MFKRLREDIEVVFEQDPAARSYFEVILTYSGLHAVWAHRIAHAFY
FT                   KKNFFFIARWISQVSRFFTGIEIHPGATIGRRFFIDHGMGVVIGETCEIGDNVTIYQGV
FT                   TLGGTGKEKGKRHPTIQDNVLIATGAKVLGSITVGENSKIGAGSVVLKEVPAHSTVVGI
FT                   PGRVVIQNGVKIGQELNHSDLPDPIFDKLKVMEVELDKLKKQLEVKVERKDKNDYSHL"
FT   gene            99859..101256
FT                   /gene="cysS"
FT                   /locus_tag="BCE_0089"
FT                   /old_locus_tag="BCE0089"
FT   CDS_pept        99859..101256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="BCE_0089"
FT                   /old_locus_tag="BCE0089"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="identified by match to protein family HMM PF01406;
FT                   match to protein family HMM TIGR00435"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39025"
FT                   /db_xref="GOA:Q73FB7"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73FB7"
FT                   /protein_id="AAS39025.1"
FT                   /translation="MTIHIYNTLTRQKEEFIPLEENKVKMYVCGPTVYNYIHIGNARPP
FT                   MVFDTVRRYLEYKGYDVQYVSNFTDVDDKLIKAANELGEDVPTIADRFVEAYFEDVTAL
FT                   GCKHATVHPRVTENMDIIIEFIQELVNKGYAYESEGDVYFRTKEFEGYGKLSHQPIADL
FT                   RHGARIEVGEKKQDPLDFALWKAAKEGEIFWESPWGQGRPGWHIECSAMARKYLGDTID
FT                   IHAGGQDLAFPHHENEIAQSEALTGKTFARYWMHNGYININNEKMSKSLGNFILVHDII
FT                   KQYDPQLIRFFMLSVHYRHPINFSEELLQSTNNGLERIKTAYGNLKHRMESSTDLTDHN
FT                   EKWLADLEKFQTAFEEAMNDDFNTANAITELYNVANHANQYLLEEHTSTVVIQAYVKQL
FT                   ETLFDILGLELAQEELLDEEIEALIQKRIEARKNRDFALSDQIRDDLKDRNIILEDTAQ
FT                   GTRWKRG"
FT   gene            101259..101666
FT                   /locus_tag="BCE_0090"
FT                   /old_locus_tag="BCE0090"
FT   CDS_pept        101259..101666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0090"
FT                   /old_locus_tag="BCE0090"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39026"
FT                   /db_xref="GOA:Q73FB6"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FB6"
FT                   /protein_id="AAS39026.1"
FT                   /translation="MIDAKQLNSLALAYMGDAVYEQYIRYHLLQKGKVRPNQLHRLGTS
FT                   FVSAKAQAKVVYHLLETAFLTEEEEAVLRRGRNANSGTVPKNTDVQTYRHSTAFEALIG
FT                   YHHLLNNRERLDEIVYKAIAVLEEKEGGTSS"
FT   gene            101663..102406
FT                   /locus_tag="BCE_0091"
FT                   /old_locus_tag="BCE0091"
FT   CDS_pept        101663..102406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0091"
FT                   /old_locus_tag="BCE0091"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="identified by match to protein family HMM PF00588;
FT                   match to protein family HMM TIGR00186"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39027"
FT                   /db_xref="GOA:Q73FB5"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FB5"
FT                   /protein_id="AAS39027.1"
FT                   /translation="MSSEYIIGRNPVIEALRSGRDINKIWIAEGAAKGQVQIVLALAKE
FT                   NKIILQHAPKKKLDQLVEGNHQGVIAQVAAYQYAELEDLFKVAEKRNEDPFFLILDEIE
FT                   DPHNLGSIMRTADATGAHGIIIPKRRAVGLTASVAKASTGAIEYIPVARVTNLSRTIDE
FT                   LKERGLWIAGTDAKGKTDYRNLDGKMPIGLVIGSEGKGMSRIIGEKCDFLITLPMVGKV
FT                   TSLNASVAASLLMYEVYRKRNEIGK"
FT   gene            102410..102922
FT                   /locus_tag="BCE_0092"
FT                   /old_locus_tag="BCE0092"
FT   CDS_pept        102410..102922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0092"
FT                   /old_locus_tag="BCE0092"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39028"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FB4"
FT                   /protein_id="AAS39028.1"
FT                   /translation="MNDILIVDGYNIIGAWGDLKKLRDVDLQSSRDALIDKMADYQGYT
FT                   GTKVMIVFDAYTVHGIEKKMKQSRVEVIFTRKNQTADEKIEQLAIELRNINTQIYVATS
FT                   DYTEQWVIFAQGALRKSARELELEVQAMEQQVRRRTQDTKEKQPAMRKIFSKDITEKLE
FT                   KLRRGER"
FT   gene            102990..103649
FT                   /gene="sigH"
FT                   /locus_tag="BCE_0093"
FT                   /old_locus_tag="BCE0093"
FT   CDS_pept        102990..103649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigH"
FT                   /locus_tag="BCE_0093"
FT                   /old_locus_tag="BCE0093"
FT                   /product="RNA polymerase sigma-30 factor"
FT                   /note="identified by match to protein family HMM PF04542"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39029"
FT                   /db_xref="GOA:Q73FB3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014218"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FB3"
FT                   /protein_id="AAS39029.1"
FT                   /translation="MEAGFVSVGDVTFRDLEDEAIVELVRKGNTDALEYLIHKYKNFVR
FT                   AKSRSYFLVGADREDIVQEGMIGLFKAIRDYKEDKLSSFKAFAELCITRQIITAIKTAT
FT                   RQKHIPLNSYVSLDKPIYDEESDRTLLDVISEAKVTDPEEMIISQEEYTDIESKISELL
FT                   SDLERKVLSLYLDGRSYQEISEQLNRHVKSIDNALQRVKRKLERYMEMRESTTLNS"
FT   gene            103777..103923
FT                   /gene="rpmG"
FT                   /locus_tag="BCE_0094"
FT                   /old_locus_tag="BCE0094"
FT   CDS_pept        103777..103923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="BCE_0094"
FT                   /old_locus_tag="BCE0094"
FT                   /product="ribosomal protein L33"
FT                   /note="identified by match to protein family HMM PF00471;
FT                   match to protein family HMM TIGR01023"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39030"
FT                   /db_xref="GOA:Q73FB2"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73FB2"
FT                   /protein_id="AAS39030.1"
FT                   /translation="MRKKVVLSCEECKNRNYSTMKDTSSVERLEIKKFCKTCNQHTVHK
FT                   ETK"
FT   gene            103956..104135
FT                   /locus_tag="BCE_0095"
FT                   /old_locus_tag="BCE0095"
FT   CDS_pept        103956..104135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0095"
FT                   /old_locus_tag="BCE0095"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="identified by match to protein family HMM PF00584;
FT                   match to protein family HMM TIGR00964"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39031"
FT                   /db_xref="GOA:Q73FB1"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FB1"
FT                   /protein_id="AAS39031.1"
FT                   /translation="MRLTNFFGDVGREMKKVSWPKKDELLRSTATVIATVVFFAIFFAV
FT                   VDMGISSLIRLILG"
FT   gene            104267..104800
FT                   /gene="nusG"
FT                   /locus_tag="BCE_0096"
FT                   /old_locus_tag="BCE0096"
FT   CDS_pept        104267..104800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="BCE_0096"
FT                   /old_locus_tag="BCE0096"
FT                   /product="transcription antitermination protein NusG"
FT                   /note="identified by match to protein family HMM PF00467;
FT                   match to protein family HMM PF02357; match to protein
FT                   family HMM TIGR00922"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39032"
FT                   /db_xref="GOA:Q73FB0"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FB0"
FT                   /protein_id="AAS39032.1"
FT                   /translation="MEKSWYVVHTYSGYENKVKANLEKRVESMGMQDKIFRVVVPEEVE
FT                   VEMKNGKEKLMKRKVFPGYVLVELIMTDDSWYVVRNTPGVTGFVGSSGSGSKPSPLLEE
FT                   EVVTIMKHMGMDNEVVDFDFELHETVRVNEGPFADYTGAIEEIDVEKKKVSVLVDMFGR
FT                   ETPVELDFHQIEKL"
FT   gene            104968..105393
FT                   /gene="rplK"
FT                   /locus_tag="BCE_0097"
FT                   /old_locus_tag="BCE0097"
FT   CDS_pept        104968..105393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="BCE_0097"
FT                   /old_locus_tag="BCE0097"
FT                   /product="ribosomal protein L11"
FT                   /note="identified by match to protein family HMM PF00298;
FT                   match to protein family HMM PF03946; match to protein
FT                   family HMM TIGR01632"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39033"
FT                   /db_xref="GOA:P62431"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62431"
FT                   /protein_id="AAS39033.1"
FT                   /translation="MAKKVIKMVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNAR
FT                   TADQAGLIIPVEITVFEDRSFTFITKTPPAAVLLKKVAGIESGSGEPNRNKVATVKRDK
FT                   VREIAETKMPDLNAASVEAAMRMVEGTARSMGIVIED"
FT   gene            105571..106263
FT                   /gene="rplA"
FT                   /locus_tag="BCE_0098"
FT                   /old_locus_tag="BCE0098"
FT   CDS_pept        105571..106263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="BCE_0098"
FT                   /old_locus_tag="BCE0098"
FT                   /product="ribosomal protein L1"
FT                   /note="identified by match to protein family HMM PF00687;
FT                   match to protein family HMM TIGR01169"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39034"
FT                   /db_xref="GOA:Q73FA8"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73FA8"
FT                   /protein_id="AAS39034.1"
FT                   /translation="MAKRGKKYVEAAKLVDRAAAYSATEAVELVKKTNTAKFDATVEAA
FT                   FRLGVDPKKADQQIRGAVVLPHGTGKVQRVLVFAKGEKAKEAEAAGADFVGDADYIGKI
FT                   QQGWFDFDVVVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTFDVTKAVNEIKAGKVEY
FT                   RVDKAGNIHVPIGKVSFEDAKLVENFRTIADTLQKVKPAAAKGTYMKNVTVASTMGPGV
FT                   RVDVSTLA"
FT   gene            106496..106996
FT                   /gene="rplJ"
FT                   /locus_tag="BCE_0099"
FT                   /old_locus_tag="BCE0099"
FT   CDS_pept        106496..106996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="BCE_0099"
FT                   /old_locus_tag="BCE0099"
FT                   /product="ribosomal protein L10"
FT                   /note="identified by match to protein family HMM PF00466"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39035"
FT                   /db_xref="GOA:Q73FA7"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73FA7"
FT                   /protein_id="AAS39035.1"
FT                   /translation="MSKVIETKQQVVTEIADKLRASKSTIVVDYRGLTVSEATELRKQL
FT                   REAGVEFKVYKNSLTRRAAESAEMAELNEFLTGPNAIAFSNEDVVAPAKVLNDFAKDHE
FT                   ALEIKAGVIEGKLVTLDEVKAIATLPSREGLLSMLLSVLQAPIRNLALATKAVADQKEE
FT                   QGA"
FT   gene            107064..107423
FT                   /gene="rplL"
FT                   /locus_tag="BCE_0100"
FT                   /old_locus_tag="BCE0100"
FT   CDS_pept        107064..107423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="BCE_0100"
FT                   /old_locus_tag="BCE0100"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="identified by match to protein family HMM PF00542;
FT                   match to protein family HMM TIGR00855"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39036"
FT                   /db_xref="GOA:Q73FA6"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73FA6"
FT                   /protein_id="AAS39036.1"
FT                   /translation="MTKEQIIEAVKSMTVLELNDLVKAIEEEFGVTAAAPVAVAGGAGE
FT                   AAAEKTEFDVELTSAGAQKIKVIKVVREITGLGLKEAKELVDNTPKVIKEAAAKEEAEE
FT                   IKAKLEEVGAAVEVK"
FT   gene            107500..108099
FT                   /locus_tag="BCE_0101"
FT                   /old_locus_tag="BCE0101"
FT   CDS_pept        107500..108099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0101"
FT                   /old_locus_tag="BCE0101"
FT                   /product="ybxB protein"
FT                   /note="identified by match to protein family HMM PF05175"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39037"
FT                   /db_xref="GOA:Q73FA5"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FA5"
FT                   /protein_id="AAS39037.1"
FT                   /translation="MADHYFSNDPSSKSDRKRWEFTLRGSQFTFLSDRGVFSKNEVDFG
FT                   SRLLIEAFQVPDIKGDILDVGCGYGPIGLSLAKEFQDRKVHMVDVNERALELAKENAAN
FT                   NRIGNVHIFQSSVYENVDGMYAAILSNPPIRAGKDIVHEILEKAVEHLVPGGELWIVIQ
FT                   KKQGAPSALKKLEEVFSEVEVVEKKKGYYIIKSKKR"
FT   gene            108393..111926
FT                   /gene="rpoB"
FT                   /locus_tag="BCE_0102"
FT                   /old_locus_tag="BCE0102"
FT   CDS_pept        108393..111926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="BCE_0102"
FT                   /old_locus_tag="BCE0102"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF00562;
FT                   match to protein family HMM PF04560; match to protein
FT                   family HMM PF04561; match to protein family HMM PF04563;
FT                   match to protein family HMM PF04565"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39038"
FT                   /db_xref="GOA:Q73FA4"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73FA4"
FT                   /protein_id="AAS39038.1"
FT                   /translation="MTGQLVQYGRHRQRRSYARISEVLELPNLIEIQTSSYQWFLDEGL
FT                   REMFQDISPIEDFTGNLSLEFIDYSLGEPKYSVDECKERDVTYAAPLRVKVRLINKETG
FT                   EVKEQDVFMGDFPLMTETGTFVINGAERVIVSQLVRSPSVYYSGKVDKNGKRGFTATVI
FT                   PNRGAWLEYETDAKDVVYVRIDRTRKLPVTVLLRALGFGSDQEITELLGDNEYLSNTLE
FT                   KDNTDSTEKALLEIYERLRPGEPPTVENAKSLLVSRFFDPKRYDLANVGRYKINKKLHI
FT                   KNRLFNQRLAETLVDPETGEILAAEGTILDRRTLDRILPYLEKNIGFKTAKPMGGVVEG
FT                   DVELQSIKIYAPESEGERVINVIGNANITRDVKHITPGDILASISYFFNLLYKVGDTDD
FT                   IDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQDTNAITPQALINIRPVIASIK
FT                   EFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLTRERAGFEVRDVHYSHYGRMCPIE
FT                   TPEGPNIGLINSLSSFAKVNEFGFIETPYRRVDPETGLVTGHVDYLTADEEDNYVVAQA
FT                   NMKLSEEGEFLDEDIVARFRGENIVTNKERIDYMDVSPKQVVSAATACIPFLENDDSNR
FT                   ALMGANMQRQAVPLMNPESPIVGTGMEYVSAKDSGAAVICKHPGIVERVEAREVWVRRY
FT                   VEVDGQTVKGDLDRYKMQKFIRSNQGTCYNQRPIVSVGNEVVKGEILADGPSMELGELA
FT                   LGRNVLVGFMTWDGYNYEDAIIMSERLVKDDVYTSIHIEEYESEARDTKLGPEEITRDI
FT                   PNVGEDALRNLDERGIIRVGAEVKDGDLLVGKVTPKGVTELTAEERLLHAIFGEKAREV
FT                   RDTSLRVPHGGGGIILDVKVFNREDGDELPPGVNQLVRAYIVQKRKISEGDKMAGRHGN
FT                   KGVISRILPEEDMPYLPDGTPIDIMLNPLGVPSRMNIGQVLELHLGMAARYLGIHIATP
FT                   VFDGAREEDVWGTIEEAGMANDAKTILYDGRTGEPFDNRVSVGVMYMIKLAHMVDDKLH
FT                   ARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVKSDDVVGRVK
FT                   TYEAIVKGENVPEPGVPESFKVLIKELQSLGMDVKMMSSDDTEIEMRDTEDDDDHQSAD
FT                   KLNVEVETTKE"
FT   gene            111964..115575
FT                   /gene="rpoC"
FT                   /locus_tag="BCE_0103"
FT                   /old_locus_tag="BCE0103"
FT   CDS_pept        111964..115575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="BCE_0103"
FT                   /old_locus_tag="BCE0103"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF00623;
FT                   match to protein family HMM PF04983; match to protein
FT                   family HMM PF04997; match to protein family HMM PF04998;
FT                   match to protein family HMM PF05000"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39039"
FT                   /db_xref="GOA:Q73FA3"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73FA3"
FT                   /protein_id="AAS39039.1"
FT                   /translation="MIDVNNFEYMKIGLASPDKIRSWSYGEVKKPETINYRTLKPEKDG
FT                   LFCERIFGPQKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLVLDMSPRALEEVIYFASYVVTESGDTPLDKKQLLSEKEYRAYRDRYG
FT                   STFQAAMGAEAIKKLLQDIDLDKEVDFLKEELKTAQGQRRTRAIKRLEVLEAFRNSGNE
FT                   PSWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVEKGLAHNIKSAKRKIERVQPEVWD
FT                   VLESVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVH
FT                   VPLSSEAQAEARLLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLEREGAIGEGMVFK
FT                   DANEALLAYQNGYVHLHTRVAVAASAVNNATFTEEQKSMLLLTTVGKLIFNEILPESFP
FT                   YINEPTNSNLEKETPAKYFVEKGANIKEIIASREEVAPFSKKILGNIIAEVFKRFKITE
FT                   TSRMLDRMKNLGFKYSTKAGITVGVSDILVLGEKDEILHEAQAKVDNVIKQFRRGLITE
FT                   EERYDRVISIWSNAKDVIQGKLMKSLNKRNPIFMMSDSGARGNASNFTQLAGMRGLMAN
FT                   PSGRIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVI
FT                   VREDDCGTDRGLLIGAIKEGNEVIESLYDRLVGRFARKTVKHPETGEVLVAENQLITED
FT                   IAHIVENSGVETVNIRSAFTCNTRHGVCKKCYGRNLATGTDVEVGEAVGIIAAQSIGEP
FT                   GTQLTMRTFHTGGVAGDDITQGLPRIQEIFEARNPKGQAVISEIDGVIAAINDVKDRQE
FT                   VVVQGEVETRTYAIPYGARLKVIPGQQISHGKELTEGSIDPKELLKVTDITAVQEYLLR
FT                   EVQKVYRMQGVEIGDKHVEVMVRQMLRKVRVSDAGETDVLPGTLLDIHQFTDANAKVLL
FT                   QGKQPATARPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVII
FT                   GKLVPAGTGMNRYRKVDLVKTTQDDMNVENDEVYVEQ"
FT   gene            115656..115937
FT                   /locus_tag="BCE_0104"
FT                   /old_locus_tag="BCE0104"
FT   CDS_pept        115656..115937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0104"
FT                   /old_locus_tag="BCE0104"
FT                   /product="ribosomal protein L7A family"
FT                   /note="identified by match to protein family HMM PF01248"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39040"
FT                   /db_xref="GOA:Q73FA2"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q73FA2"
FT                   /protein_id="AAS39040.1"
FT                   /translation="MLLNDALEDIYMSYQKVSNAENVVVGHKRTLEAIKNGIVKEVVIA
FT                   EDADMRLTHVIIRTALQHNIPITKVESVRKLGKVAGIQVGASAIGIIS"
FT   gene            116052..116474
FT                   /gene="rpsL"
FT                   /locus_tag="BCE_0105"
FT                   /old_locus_tag="BCE0105"
FT   CDS_pept        116052..116474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="BCE_0105"
FT                   /old_locus_tag="BCE0105"
FT                   /product="ribosomal protein S12"
FT                   /note="identified by match to protein family HMM PF00164;
FT                   match to protein family HMM TIGR00981"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39041"
FT                   /db_xref="GOA:Q73FA1"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73FA1"
FT                   /protein_id="AAS39041.1"
FT                   /translation="MPTINQLVRNGRTDKVWKSKSPALNKGFNSLKKKSTDISAPQKRG
FT                   VCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIVRGALDTAGVDKRMQGRSKYGTKKPKAAKK"
FT   gene            116504..116974
FT                   /gene="rpsG"
FT                   /locus_tag="BCE_0106"
FT                   /old_locus_tag="BCE0106"
FT   CDS_pept        116504..116974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="BCE_0106"
FT                   /old_locus_tag="BCE0106"
FT                   /product="ribosomal protein S7"
FT                   /note="identified by match to protein family HMM PF00177;
FT                   match to protein family HMM TIGR01029"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39042"
FT                   /db_xref="GOA:Q73FA0"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73FA0"
FT                   /protein_id="AAS39042.1"
FT                   /translation="MPRKGPVAKRDVLPDPMYNSKLVTRLINKMMVDGKKGKSQTILYN
FT                   AFDIVSERTGKEPMEVFEQALKNIMPVLEVRARRVGGANYQVPVEVRPERRTTLGLRWL
FT                   VNYARLRGEKTMEERLANEILDAANNAGASVKKREDTHKMAEANKAFAHYRW"
FT   gene            117181..119259
FT                   /gene="fusA"
FT                   /locus_tag="BCE_0107"
FT                   /old_locus_tag="BCE0107"
FT   CDS_pept        117181..119259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="BCE_0107"
FT                   /old_locus_tag="BCE0107"
FT                   /product="translation elongation factor G"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF00679; match to protein
FT                   family HMM PF03144; match to protein family HMM PF03764;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR00484"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39043"
FT                   /db_xref="GOA:Q73F99"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73F99"
FT                   /protein_id="AAS39043.1"
FT                   /translation="MGREFSLENTRNIGIMAHIDAGKTTATERILYYTGRIHKIGETHE
FT                   GASQMDWMEQEQERGITITSAATTAQWKGHRVNIIDTPGHVDFTVEVERSLRVLDGAVA
FT                   VLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKIGADFLYSVGTIHDRLQANAHPIQ
FT                   LPIGAEDEFNGIIDLVEECAYMYGNDLGTDIQRVEIPEEHKELAEEYRGKLIEAVAELD
FT                   EEMMMKYLEGEEITVEELKAGIRKATTSVEFFPVICGSAFKNKGVQILLDAVIDYLPSP
FT                   LDVPAIKGIVPDTDEEVERKSSDEEPFSALAFKIMTDPYVGKLTFFRVYSGVLNSGSYV
FT                   KNSTKGKRERVGRILQMHANSREEISTVYAGDIAAAVGLKDTTTGDTLCDEKSLVILES
FT                   MEFPEPVISVAIEPKSKADQDKMGTALAKLSEEDPTFRAHTDQETGQTIIAGMGELHLD
FT                   IIVDRMRREFKVEANVGAPQVAYRETFRSAAKVEGKFARQSGGRGQFGHVWIEFEPNEE
FT                   GKGFEFENKIVGGVVPREYIPAVGAGLEDALKNGVLAGYPVVDIKAALVDGSYHDVDSS
FT                   EMAFKIAASMALKAAVSKCNPVILEPMMKVEVVIPEEYMGDIMGDVTSRRGRVEGMEAR
FT                   GNAQVVRAMVPLSEMFGYATSLRSNTQGRGTFSMVFDHYEEVPKSVSEEIIKKNKGE"
FT   gene            119377..120564
FT                   /gene="tuf"
FT                   /locus_tag="BCE_0108"
FT                   /old_locus_tag="BCE0108"
FT   CDS_pept        119377..120564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="BCE_0108"
FT                   /old_locus_tag="BCE0108"
FT                   /product="translation elongation factor Tu"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF03143; match to protein
FT                   family HMM PF03144; match to protein family HMM TIGR00231;
FT                   match to protein family HMM TIGR00485"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39044"
FT                   /db_xref="GOA:Q73F98"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73F98"
FT                   /protein_id="AAS39044.1"
FT                   /translation="MAKAKFERSKPHVNIGTIGHVDHGKTTLTAAITTVLAKAGGAEAR
FT                   GYDQIDAAPEERERGITISTAHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGGIL
FT                   VVSAADGPMPQTREHILLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYGF
FT                   PGDDIPVIKGSALKALQGEADWEAKIIELMAEVDAYIPTPERETDKPFLMPVEDVFSIT
FT                   GRGTVATGRVERGIVKVGDVVEIIGLAEENASTTVTGVEMFRKLLDQAQAGDNIGALLR
FT                   GVAREDIQRGQVLAKSGSVKAHAKFKAEVFVLSKEEGGRHTPFFANYRPQFYFRTTDVT
FT                   GIIQLPEGTEMVMPGDNVEMTIELIAPIAIEEGTKFSIREGGRTVGYGVVATIVE"
FT   gene            120965..121273
FT                   /gene="rpsJ"
FT                   /locus_tag="BCE_0109"
FT                   /old_locus_tag="BCE0109"
FT   CDS_pept        120965..121273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="BCE_0109"
FT                   /old_locus_tag="BCE0109"
FT                   /product="ribosomal protein S10"
FT                   /note="identified by match to protein family HMM PF00338;
FT                   match to protein family HMM TIGR01049"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39045"
FT                   /db_xref="GOA:Q73F97"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73F97"
FT                   /protein_id="AAS39045.1"
FT                   /translation="MAKEKIRIRLKAYDHRILDQSAEKIVETAKRSGATVSGPIPLPTE
FT                   KTVYTILRAVHKYKDSREQFEMRTHKRLIDIVSPTPQTVDSLMRLDLXSGVDIEIKL"
FT   gene            121308..121940
FT                   /gene="rplC"
FT                   /locus_tag="BCE_0110"
FT                   /old_locus_tag="BCE0110"
FT   CDS_pept        121308..121940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="BCE_0110"
FT                   /old_locus_tag="BCE0110"
FT                   /product="ribosomal protein L3"
FT                   /note="identified by match to protein family HMM PF00297"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39046"
FT                   /db_xref="GOA:Q73F96"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73F96"
FT                   /protein_id="AAS39046.1"
FT                   /translation="MTKGILGRKIGMTQVFAENGELIPVTVIAANPNVVLQKKTTETDG
FT                   YNAIQLGFEDKREKLTNKPEQGHTAKASTTPKRFIREIRDADVDGLEVGQEVKVDVFAT
FT                   GEIVDVTGISKGKGFQGVIKRHGQSRGPMSHGSRYHRRPGSMGPVAPNRVFKGKKLAGR
FT                   MGGDQVTIQNLEIVQVDTERNLLLVKGNVPGAKKSLVVVQGAVKVSK"
FT   gene            121966..122589
FT                   /gene="rplD"
FT                   /locus_tag="BCE_0111"
FT                   /old_locus_tag="BCE0111"
FT   CDS_pept        121966..122589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="BCE_0111"
FT                   /old_locus_tag="BCE0111"
FT                   /product="ribosomal protein L4"
FT                   /note="identified by match to protein family HMM PF00573"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39047"
FT                   /db_xref="GOA:Q73F95"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73F95"
FT                   /protein_id="AAS39047.1"
FT                   /translation="MPKVTVYNQTGSQVGEIELAEAIFGIEPNEAVLFEAVMMQRASLR
FT                   QGTHKVKTRSEVRGGGRKPWRQKGTGRARQGSIRSPQWRGGGTVFGPTPRSYAYKLPKK
FT                   VRRLAIKSALATKVVENNIVVLEDLVLNAPKTKDMLAVLKGLTVEKKALIVTADANESV
FT                   ELSARNIPGVTVITADGVNVLDVLHHDKLIMTKAAVEKVEEVLA"
FT   gene            122589..122879
FT                   /gene="rplW"
FT                   /locus_tag="BCE_0112"
FT                   /old_locus_tag="BCE0112"
FT   CDS_pept        122589..122879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="BCE_0112"
FT                   /old_locus_tag="BCE0112"
FT                   /product="ribosomal protein L23"
FT                   /note="identified by match to protein family HMM PF00276"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39048"
FT                   /db_xref="GOA:Q73F94"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73F94"
FT                   /protein_id="AAS39048.1"
FT                   /translation="MRDPRDIIKRPVITERSMEMMAEKKYTFDVDVKSNKTEVKDALEA
FT                   IFGVKVEKVNIMNYKPKAKRVGRHAGFTSRRRKAIVKLTADSKEIEIFQGV"
FT   gene            122908..123738
FT                   /gene="rplB"
FT                   /locus_tag="BCE_0113"
FT                   /old_locus_tag="BCE0113"
FT   CDS_pept        122908..123738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="BCE_0113"
FT                   /old_locus_tag="BCE0113"
FT                   /product="ribosomal protein L2"
FT                   /note="identified by match to protein family HMM PF00181;
FT                   match to protein family HMM PF03947; match to protein
FT                   family HMM TIGR01171"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39049"
FT                   /db_xref="GOA:Q73F93"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73F93"
FT                   /protein_id="AAS39049.1"
FT                   /translation="MGIKKYNPTTNGRRNMTTNDFAEITTDRPEKSLLAPLSKKAGRNN
FT                   QGKITVRHQGGGHKRQYRIIDFKRNKDGIPGRVATIEYDPNRSANIALINYVDGEKRYI
FT                   LAPKNLEVGMEIMSGAEADIKIGNALPLINIPVGTVVHNIELKPGRGGQLVRSAGTSAQ
FT                   VLGKEGKYVLVRLTSGEVRLVLSACRATVGQVGNESHELIKIGKAGRSRWLGKRPTVRG
FT                   SVMNPVDHPHGGGEGRSPIGRKSPMSPWGKPTLGFKTRKKNKASDKFIVRRRKK"
FT   gene            123799..124077
FT                   /gene="rpsS"
FT                   /locus_tag="BCE_0114"
FT                   /old_locus_tag="BCE0114"
FT   CDS_pept        123799..124077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="BCE_0114"
FT                   /old_locus_tag="BCE0114"
FT                   /product="ribosomal protein S19"
FT                   /note="identified by match to protein family HMM PF00203;
FT                   match to protein family HMM TIGR01050"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39050"
FT                   /db_xref="GOA:Q73F92"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73F92"
FT                   /protein_id="AAS39050.1"
FT                   /translation="MARSLKKGPFVDDHLMSKIAKLNETEQKQVVKTWSRRSTIFPQFI
FT                   GHTIAVYDGRKHVPVYVTEDMVGHKLGEFAPTRTYKGHDADDKKTRR"
FT   gene            124095..124436
FT                   /gene="rplV"
FT                   /locus_tag="BCE_0115"
FT                   /old_locus_tag="BCE0115"
FT   CDS_pept        124095..124436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="BCE_0115"
FT                   /old_locus_tag="BCE0115"
FT                   /product="ribosomal protein L22"
FT                   /note="identified by match to protein family HMM PF00237;
FT                   match to protein family HMM TIGR01044"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39051"
FT                   /db_xref="GOA:Q73F91"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73F91"
FT                   /protein_id="AAS39051.1"
FT                   /translation="MQAKAVARTVRIAPRKVRLVVDLIRGKQVGEAIAILNHTPKTASP
FT                   VVEKVLKSAIANAEHNYEMDINNLVVEKVFVDEGPTLKRFRPRAMGRASQINKRTSHIT
FT                   VVVSEKKEG"
FT   gene            124440..125099
FT                   /gene="rpsC"
FT                   /locus_tag="BCE_0116"
FT                   /old_locus_tag="BCE0116"
FT   CDS_pept        124440..125099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="BCE_0116"
FT                   /old_locus_tag="BCE0116"
FT                   /product="ribosomal protein S3"
FT                   /note="identified by match to protein family HMM PF00013;
FT                   match to protein family HMM PF00189; match to protein
FT                   family HMM PF00417; match to protein family HMM TIGR01009"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39052"
FT                   /db_xref="GOA:Q73F90"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73F90"
FT                   /protein_id="AAS39052.1"
FT                   /translation="MGQKVNPIGLRVGVIRDWESRWFAEKDYATLLHEDIKIREYINVR
FT                   LKDSAVAKVEIERAANRVNVTIHTAKPGMVIGKGGTEVEALRKALNQLTGKRVHINILE
FT                   VKRADLNAKLVGENIARQLENRVSFRRAQKQVIQRAMRAGAKGIKTQVSGRLGGADIAR
FT                   AESYSEGTVPLHTLRADIDYAAVEADTTYGKLGVKVWIYRGEVLPTKKKASEEGGK"
FT   gene            125101..125535
FT                   /gene="rplP"
FT                   /locus_tag="BCE_0117"
FT                   /old_locus_tag="BCE0117"
FT   CDS_pept        125101..125535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="BCE_0117"
FT                   /old_locus_tag="BCE0117"
FT                   /product="ribosomal protein L16"
FT                   /note="identified by match to protein family HMM PF00252;
FT                   match to protein family HMM TIGR01164"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39053"
FT                   /db_xref="GOA:Q73F89"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73F89"
FT                   /protein_id="AAS39053.1"
FT                   /translation="MLMPKRVKYRREHRGKMRGRAKGGTEVAFGEFGLQAQAASWITNR
FT                   QIEAARRAMTRYMKRGGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKIMF
FT                   EIAGVSEEVAREALRLAAHKLPVKCKFVKREENGGESNEN"
FT   gene            125501..125725
FT                   /gene="rpmC"
FT                   /locus_tag="BCE_0118"
FT                   /old_locus_tag="BCE0118"
FT   CDS_pept        125501..125725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="BCE_0118"
FT                   /old_locus_tag="BCE0118"
FT                   /product="ribosomal protein L29"
FT                   /note="identified by match to protein family HMM PF00831;
FT                   match to protein family HMM TIGR00012"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39054"
FT                   /db_xref="GOA:Q73F88"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73F88"
FT                   /protein_id="AAS39054.1"
FT                   /translation="MKKMVVNLMKTNDIRELTTAEIETKVKALKEELFNLRFQLATGQL
FT                   ENPTRIREVRKAIARMKTVVREREIGINR"
FT   gene            125746..126009
FT                   /gene="rpsQ"
FT                   /locus_tag="BCE_0119"
FT                   /old_locus_tag="BCE0119"
FT   CDS_pept        125746..126009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="BCE_0119"
FT                   /old_locus_tag="BCE0119"
FT                   /product="ribosomal protein S17"
FT                   /note="identified by match to protein family HMM PF00366"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39055"
FT                   /db_xref="GOA:Q73F87"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73F87"
FT                   /protein_id="AAS39055.1"
FT                   /translation="MSERNQRKVYTGRVVSDKMDKTITVLVETYKTHSLYGKRVKYSKK
FT                   YKAHDEQNQAKLGDIVKIMETRPLSATKRFRLVEIVEEAVII"
FT   gene            126053..126421
FT                   /gene="rplN"
FT                   /locus_tag="BCE_0120"
FT                   /old_locus_tag="BCE0120"
FT   CDS_pept        126053..126421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="BCE_0120"
FT                   /old_locus_tag="BCE0120"
FT                   /product="ribosomal protein L14"
FT                   /note="identified by match to protein family HMM PF00238;
FT                   match to protein family HMM TIGR01067"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39056"
FT                   /db_xref="GOA:Q73F86"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73F86"
FT                   /protein_id="AAS39056.1"
FT                   /translation="MIQQESRLKVADNSGARELLTIKVLGGSGRKYANIGDIIVATVKQ
FT                   ATPGGVVKKGDVVKAVVVRTKSGARRPDGSYIKFDENAAVIIKDDKSPRGTRIFGPVAR
FT                   ELRDSNFMKIVSLAPEVL"
FT   gene            126460..126771
FT                   /gene="rplX"
FT                   /locus_tag="BCE_0121"
FT                   /old_locus_tag="BCE0121"
FT   CDS_pept        126460..126771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="BCE_0121"
FT                   /old_locus_tag="BCE0121"
FT                   /product="ribosomal protein L24"
FT                   /note="identified by match to protein family HMM PF00467;
FT                   match to protein family HMM TIGR01079"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39057"
FT                   /db_xref="GOA:Q73F85"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73F85"
FT                   /protein_id="AAS39057.1"
FT                   /translation="MHVKKGDKVQVITGKDKGKQGVILVAFPKQNRVIVEGVNIVKKHS
FT                   KPSQLNPQGGIITKEAPIHVSNVMILDPKTGEPTRVGFKVEDGKKVRIAKKSGELLDK"
FT   gene            126798..127337
FT                   /gene="rplE"
FT                   /locus_tag="BCE_0122"
FT                   /old_locus_tag="BCE0122"
FT   CDS_pept        126798..127337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="BCE_0122"
FT                   /old_locus_tag="BCE0122"
FT                   /product="ribosomal protein L5"
FT                   /note="identified by match to protein family HMM PF00281;
FT                   match to protein family HMM PF00673"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39058"
FT                   /db_xref="GOA:Q73F84"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73F84"
FT                   /protein_id="AAS39058.1"
FT                   /translation="MNRLKEKFQKEITPALMSKFNYKSVMQVPKIEKIVINTGVGDAVS
FT                   NSKALDNAVEELTQIAGQKPVVTRAKKSIAGFRLREGMPIGAKVTLRGEQMYEFFDKLV
FT                   SVSLPRVRDFRGVSKKSFDGRGNYTLGVKEQLIFPEIDYDKVSKVRGMDIVIVTTANTD
FT                   EEARELLTQFGMPFQK"
FT   gene            127371..127556
FT                   /gene="rpsN"
FT                   /locus_tag="BCE_0123"
FT                   /old_locus_tag="BCE0123"
FT   CDS_pept        127371..127556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="BCE_0123"
FT                   /old_locus_tag="BCE0123"
FT                   /product="ribosomal protein S14"
FT                   /note="identified by match to protein family HMM PF00253"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39059"
FT                   /db_xref="GOA:Q73F83"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73F83"
FT                   /protein_id="AAS39059.1"
FT                   /translation="MAKKSMIAKQKRTPKFKVQEYTRCERCGRPHSVYRKFKLCRICFR
FT                   ELAYKGQIPGVKKASW"
FT   gene            127586..127984
FT                   /gene="rpsH"
FT                   /locus_tag="BCE_0124"
FT                   /old_locus_tag="BCE0124"
FT   CDS_pept        127586..127984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="BCE_0124"
FT                   /old_locus_tag="BCE0124"
FT                   /product="ribosomal protein S8"
FT                   /note="identified by match to protein family HMM PF00410"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39060"
FT                   /db_xref="GOA:Q73F82"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73F82"
FT                   /protein_id="AAS39060.1"
FT                   /translation="MVMTDPIADMLTRIRNANMVRHEKLEVPASKIKKEIAELLKREGF
FT                   IRDVEYIEDNKQGILRIFLKYGANNERVITGLKRISKPGLRVYAKADEVPRVLNGLGIA
FT                   LVSTSKGVMTDKDARQLQTGGEVVAYVW"
FT   gene            128017..128556
FT                   /gene="rplF"
FT                   /locus_tag="BCE_0125"
FT                   /old_locus_tag="BCE0125"
FT   CDS_pept        128017..128556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="BCE_0125"
FT                   /old_locus_tag="BCE0125"
FT                   /product="ribosomal protein L6"
FT                   /note="identified by match to protein family HMM PF00347"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39061"
FT                   /db_xref="GOA:Q73F81"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73F81"
FT                   /protein_id="AAS39061.1"
FT                   /translation="MSRIGKKILEIPAGVTITVAEDNTVTVKGPKGELTRTFNADMLIK
FT                   IEENTLTVERPSEQKEHRALHGTTRALIGNMVEGVTEGFARGLELVGVGYRAQKQGDKL
FT                   VLSVGYSHPVEMTPEAGLEVEVPAPTKIVIKGIDKQRVGEFAANIRAVRAPEPYKGKGI
FT                   RYEGEVVRRKEGKTAK"
FT   gene            128588..128950
FT                   /gene="rplR"
FT                   /locus_tag="BCE_0126"
FT                   /old_locus_tag="BCE0126"
FT   CDS_pept        128588..128950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="BCE_0126"
FT                   /old_locus_tag="BCE0126"
FT                   /product="ribosomal protein L18"
FT                   /note="identified by match to protein family HMM PF00861;
FT                   match to protein family HMM TIGR00060"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39062"
FT                   /db_xref="GOA:Q73F80"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73F80"
FT                   /protein_id="AAS39062.1"
FT                   /translation="MITKADKNATRKKRHARVRAKLTGTAERPRLNVFRSNQHIYAQVI
FT                   DDVNGVTLVSASTLDKDLALNGTSNIEAATKVGESVAKRAVEKGVKEVVFDRGGYLYHG
FT                   RVKALAEAAREAGLQF"
FT   gene            128972..129472
FT                   /gene="rpsE"
FT                   /locus_tag="BCE_0127"
FT                   /old_locus_tag="BCE0127"
FT   CDS_pept        128972..129472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="BCE_0127"
FT                   /old_locus_tag="BCE0127"
FT                   /product="ribosomal protein S5"
FT                   /note="identified by match to protein family HMM PF00333;
FT                   match to protein family HMM PF03719; match to protein
FT                   family HMM TIGR01021"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39063"
FT                   /db_xref="GOA:Q73F79"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73F79"
FT                   /protein_id="AAS39063.1"
FT                   /translation="MHRIDPSKLELEERVVTINRVAKVVKGGRRFRFAALVVVGDKNGH
FT                   VGFGTGKAQEVPDAIRKAIEDAKKNLIAVPLVGTTIPHTINGHFGAGEVFLKPAAEGTG
FT                   VIAGGPVRAVLELAGVQDILSKSLGSNTPINMIRATVNGLSELKRAEDVAKLRGKSVEE
FT                   LLG"
FT   gene            129486..129668
FT                   /gene="rpmD"
FT                   /locus_tag="BCE_0128"
FT                   /old_locus_tag="BCE0128"
FT   CDS_pept        129486..129668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="BCE_0128"
FT                   /old_locus_tag="BCE0128"
FT                   /product="ribosomal protein L30"
FT                   /note="identified by match to protein family HMM PF00327;
FT                   match to protein family HMM TIGR01308"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39064"
FT                   /db_xref="GOA:Q73F78"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73F78"
FT                   /protein_id="AAS39064.1"
FT                   /translation="MAKKLEITLTRSVIGRPQDQRATVEALGLKKLNSTVVKEETPAIL
FT                   GMINKVSHLVTVKEA"
FT   gene            129702..130142
FT                   /gene="rplO"
FT                   /locus_tag="BCE_0129"
FT                   /old_locus_tag="BCE0129"
FT   CDS_pept        129702..130142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="BCE_0129"
FT                   /old_locus_tag="BCE0129"
FT                   /product="ribosomal protein L15"
FT                   /note="identified by match to protein family HMM PF00256;
FT                   match to protein family HMM PF01305; match to protein
FT                   family HMM TIGR01071"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39065"
FT                   /db_xref="GOA:Q73F77"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73F77"
FT                   /protein_id="AAS39065.1"
FT                   /translation="MKLHELKPAEGSRKVRNRVGRGIGSGNGKTAGKGHKGQNARSGGG
FT                   VRLGFEGGQTPLFRRLPKRGFTNINRKEFAIVNLSTLNRFEDGTEVTPELLLETGVISK
FT                   LNDGVKILASGAVEKKLTVKAHKFSSSAKEAIEAAGGSVEVI"
FT   gene            130142..131443
FT                   /gene="secY"
FT                   /locus_tag="BCE_0130"
FT                   /old_locus_tag="BCE0130"
FT   CDS_pept        130142..131443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="BCE_0130"
FT                   /old_locus_tag="BCE0130"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="identified by match to protein family HMM PF00344;
FT                   match to protein family HMM TIGR00967"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39066"
FT                   /db_xref="GOA:Q73F76"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F76"
FT                   /protein_id="AAS39066.1"
FT                   /translation="MFRTISNFMRVAEIRRKILFTLAMLIVFRIGTFIPVPFTNGDVLK
FT                   AQDQLNALGILNTFGGGALKNFSIFAMGIMPYITASIIVQLLQMDVVPKFSEWAKQGEM
FT                   GRRKLTQFTRYFTIVLAFIQGFGMSIGFNGMVGGQLILNPGWSTYLYIATVLTAGTAFL
FT                   MWLGEQITAKGVGNGISILIFGGIAAAIPSVISQVYQQQFQNIGDQLFMSIVKVALILL
FT                   AVLAVIVGVIFIQQAVRKIPIQYAKRVTGGNGGYAGAQNTHLPLKVNSAGVIPVIFAVS
FT                   FLITPPTIAQFFPKHDVSQWIIANFNYSHPVGMIIYVALIVAFTYFYAFVQVNPEQMSE
FT                   NLNKQGGYVPGIRPGKNTEQYLTKILYRLTFVGSIFLAAIAILPVIFTKLGNLPPSAQI
FT                   GGTSMLIVVGVALETMKQLESQLVKRHYKGFIKQ"
FT   gene            131500..132150
FT                   /gene="adk"
FT                   /locus_tag="BCE_0131"
FT                   /old_locus_tag="BCE0131"
FT   CDS_pept        131500..132150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="BCE_0131"
FT                   /old_locus_tag="BCE0131"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="identified by match to protein family HMM PF00406;
FT                   match to protein family HMM PF05191; match to protein
FT                   family HMM TIGR01351"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39067"
FT                   /db_xref="GOA:Q73F75"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73F75"
FT                   /protein_id="AAS39067.1"
FT                   /translation="MNLILMGLPGAGKGTQAEQIVAKYNIPHISTGDMFRAAMKAETEM
FT                   GLQAKSFIDKGALVPDEVTIGIVRERLSQEDCVRGFLLDGFPRTVAQASALEEIMKDLG
FT                   KKIDYVLNINVDSGLLLKRLTGRRICKECGATYHLEFNPPAKADVCDKCGGELYQRSDD
FT                   NEETVANRLDVNIKQTKPLLDFYEELGYLQSINGEQDINKVFADIDVLIGGLA"
FT   gene            132150..132896
FT                   /gene="maP"
FT                   /locus_tag="BCE_0132"
FT                   /old_locus_tag="BCE0132"
FT   CDS_pept        132150..132896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maP"
FT                   /locus_tag="BCE_0132"
FT                   /old_locus_tag="BCE0132"
FT                   /product="methionine aminopeptidase"
FT                   /EC_number="3.4.11.18"
FT                   /note="identified by match to protein family HMM PF00557;
FT                   match to protein family HMM TIGR00500"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39068"
FT                   /db_xref="GOA:Q73F74"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F74"
FT                   /protein_id="AAS39068.1"
FT                   /translation="MIICKTPREIEIMREAGRIVALTHQELKQHITPGITTKELDQIAE
FT                   KTIQKYGATPSFKGYNGFPGSICASVNEELVHGIPGKRKLKEGDIISIDIGAKYNGYHG
FT                   DSAWTYPVGNISESVQKLLDVTEKSLYLGLEQVKPGERLSNISHAVQTHAEENGFSIVR
FT                   EYVGHGIGQDLHEDPQIPHYGPPNRGPRLKPGMVICVEPMVNQGRRYVKTLSDDWTVVT
FT                   VDGKWCAHFEHTIALTEAGYEILTTL"
FT   gene            132965..133183
FT                   /gene="infA"
FT                   /locus_tag="BCE_0133"
FT                   /old_locus_tag="BCE0133"
FT   CDS_pept        132965..133183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="BCE_0133"
FT                   /old_locus_tag="BCE0133"
FT                   /product="translation initiation factor IF-1"
FT                   /note="identified by match to protein family HMM PF00575;
FT                   match to protein family HMM TIGR00008"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39069"
FT                   /db_xref="GOA:P61684"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:P61684"
FT                   /protein_id="AAS39069.1"
FT                   /translation="MAKDDVIEVEGTVLETLPNAMFKVELENGHVVLAHVSGKIRMNFI
FT                   RILPGDKVTVELSPYDLNRGRITYRFK"
FT   gene            133219..133332
FT                   /gene="rpmJ"
FT                   /locus_tag="BCE_0134"
FT                   /old_locus_tag="BCE0134"
FT   CDS_pept        133219..133332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="BCE_0134"
FT                   /old_locus_tag="BCE0134"
FT                   /product="ribosomal protein L36"
FT                   /note="identified by match to protein family HMM PF00444;
FT                   match to protein family HMM TIGR01022"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39070"
FT                   /db_xref="GOA:Q73F72"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73F72"
FT                   /protein_id="AAS39070.1"
FT                   /translation="MKVRPSVKPICEKCKVIRRRGKVMVICENPKHKQKQG"
FT   gene            133354..133719
FT                   /gene="rpsM"
FT                   /locus_tag="BCE_0135"
FT                   /old_locus_tag="BCE0135"
FT   CDS_pept        133354..133719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="BCE_0135"
FT                   /old_locus_tag="BCE0135"
FT                   /product="ribosomal protein S13"
FT                   /note="identified by match to protein family HMM PF00416"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39071"
FT                   /db_xref="GOA:Q73F71"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73F71"
FT                   /protein_id="AAS39071.1"
FT                   /translation="MARIAGVDIPRDKRVVISLTYVFGIGRTTAEKILAEAGVSEETRV
FT                   RDLTEDELGRIRDIIDRIKVEGDLRREVSLNIKRLMEIGSYRGLRHRRGLPVRGQNSKN
FT                   NARTRKGPRRTVANKKK"
FT   gene            133744..134133
FT                   /gene="rpsK"
FT                   /locus_tag="BCE_0136"
FT                   /old_locus_tag="BCE0136"
FT   CDS_pept        133744..134133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="BCE_0136"
FT                   /old_locus_tag="BCE0136"
FT                   /product="ribosomal protein S11"
FT                   /note="identified by match to protein family HMM PF00411"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39072"
FT                   /db_xref="GOA:Q73F70"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73F70"
FT                   /protein_id="AAS39072.1"
FT                   /translation="MARKTNTRKKRVKKNIEAGVAHIRSTFNNTIVTLTDTHGNALSWS
FT                   SAGALGFRGSRKSTPFAAQMAAETAAKAAMEHGLKTLEVTVKGPGAGREAAIRALQAAG
FT                   LEVTAIRDVTPVPHNGCRPPKRRRV"
FT   gene            134314..135258
FT                   /gene="rpoA"
FT                   /locus_tag="BCE_0137"
FT                   /old_locus_tag="BCE0137"
FT   CDS_pept        134314..135258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="BCE_0137"
FT                   /old_locus_tag="BCE0137"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF01000;
FT                   match to protein family HMM PF03118"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39073"
FT                   /db_xref="GOA:Q73F69"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73F69"
FT                   /protein_id="AAS39073.1"
FT                   /translation="MIEIEKPKIETVELNEDAKYGKFVIEPLERGYGTTLGNSLRRILL
FT                   SSLPGAAVTAIQIDGVLHEFSTVEGVVEDVTTIILNLKKLALKIYSEEEKTLEIDVQGE
FT                   GIVTAADITHDSDVEILNPDLHIATLAKDAHFRVRLTAKRGRGYTPADANKSEDQPIGV
FT                   IPIDSIYTPVSRVTYQVEKTRVGQVANYDKLTLDVWTDGSIGPKEAISLGAKILTEHLN
FT                   IFVGLTDEAQNAEIMVEKEEDQKEKVLEMTIEELDLSVRSYNCLKRAGINTVQELANKT
FT                   EEDMMKVRNLGRKSLEEVKHKLEELGLGLRKDD"
FT   gene            135294..135656
FT                   /gene="rplQ"
FT                   /locus_tag="BCE_0138"
FT                   /old_locus_tag="BCE0138"
FT   CDS_pept        135294..135656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="BCE_0138"
FT                   /old_locus_tag="BCE0138"
FT                   /product="ribosomal protein L17"
FT                   /note="identified by match to protein family HMM PF01196;
FT                   match to protein family HMM TIGR00059"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39074"
FT                   /db_xref="GOA:Q73F68"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73F68"
FT                   /protein_id="AAS39074.1"
FT                   /translation="MAYRKLGRTSAQRKAMLRDLATDLIINERIQTTETRAKELRSVVE
FT                   KMITLGKRGDLHARRQAAAFIRNEVANAETGQDALQKLFADVAPRYAERQGGYTRIAKI
FT                   GPRRGDAAPMVIIELV"
FT   gene            135760..136602
FT                   /locus_tag="BCE_0139"
FT                   /old_locus_tag="BCE0139"
FT   CDS_pept        135760..136602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0139"
FT                   /old_locus_tag="BCE0139"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39075"
FT                   /db_xref="GOA:Q73F67"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73F67"
FT                   /protein_id="AAS39075.1"
FT                   /translation="MKKEKLRTENISFQYPGAATYALKDVSFSLYEGEWVSVIGQNGSG
FT                   KSTLAKLLNGLFLPEAGTITVNDTMVLSEETVWDVRKQIGMVFQNPDNQFVGTTVQDDV
FT                   VFGLENIGMPREQMVERLDQALRLVRMEDFLNDEPHSLSGGQKQRVAIAGVLALQPSIL
FT                   ILDEATSMLDPQGRREVVETVRQLVNEKGITVLSITHDLEEAAQSDRVIILNKGEILEE
FT                   GTPEQIFKSSHMLQEIGLDVPFSVKIAELLKRNEILLQNTHLTMESLVNELWRLHSKK"
FT   gene            136578..137459
FT                   /locus_tag="BCE_0140"
FT                   /old_locus_tag="BCE0140"
FT   CDS_pept        136578..137459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0140"
FT                   /old_locus_tag="BCE0140"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39076"
FT                   /db_xref="GOA:Q73F66"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73F66"
FT                   /protein_id="AAS39076.1"
FT                   /translation="MEITFQKVEHRYQHKTPFERRALYDVDVSFPSGGYYAIIGHTGSG
FT                   KSTMIQHLNGLLQPTNGTVQIGEHFISAGKKEKKLKPLRKKVGVVFQFPEHQLFEETVE
FT                   KDICFGPTNFGVSVEEAKQKAREAIELVGLEPELLARSPFELSGGQMRRVAIAGVLAME
FT                   PEVLVLDEPTAGLDPKGQNELMEMFYKLHKEKGLTVILVTHNMEDAAKYAEQIVVMHKG
FT                   TVFLQGSAEEVFSHADELEKIGVDLPMSLKYKRAIEEKFGISIPKATLSLEDLTHEVVQ
FT                   VLRKGGHESCSS"
FT   gene            137447..138241
FT                   /locus_tag="BCE_0141"
FT                   /old_locus_tag="BCE0141"
FT   CDS_pept        137447..138241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0141"
FT                   /old_locus_tag="BCE0141"
FT                   /product="cobalt transport protein"
FT                   /note="identified by match to protein family HMM PF02361"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39077"
FT                   /db_xref="GOA:Q73F65"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR024919"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F65"
FT                   /protein_id="AAS39077.1"
FT                   /translation="MQQLIIGRYIPGNSLIHQLDPRTKLLIVFLYVFVVFLANNAISYG
FT                   FLFLYALIALFFAKVPIRYVLSGLKPILWIFLFTFFLHILTNKEGEVLFQLGWFSIHEK
FT                   GLEQGIYISIRFFVIILMTTLLTLTTTPIEITDGLETLLKPLKRIKVPVHEIALMMSIS
FT                   LRFIPTLMDETSKIMKAQSSRGIDFAGGPIKDRMKAIISLLVPLFISAFKRAEDLAIAM
FT                   EARGYQSGEGRTKFRQLRWKTSDTVTIISLLCLACILAWVRS"
FT   gene            138256..138999
FT                   /gene="truA"
FT                   /locus_tag="BCE_0142"
FT                   /old_locus_tag="BCE0142"
FT   CDS_pept        138256..138999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="BCE_0142"
FT                   /old_locus_tag="BCE0142"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="4.2.1.70"
FT                   /note="identified by match to protein family HMM PF01416;
FT                   match to protein family HMM TIGR00071"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39078"
FT                   /db_xref="GOA:Q73F64"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73F64"
FT                   /protein_id="AAS39078.1"
FT                   /translation="MDRIKCTVAYDGMHFCGYQIQPQHRTVQQEIEKALQKLHKGELVR
FT                   VQASGRTDSTVHAKGQVIHFDTPLSLEEWQWNNALNTMLPDDIVITQVEKKTEEFHARY
FT                   GVERKEYRYRVLLSKTADVFRRNYVYQYPYPLEINAIRKAIPYFIGTHDFTSFCSAKTD
FT                   KKDKVRTIYEIELIEQDDELIFRFVGNGFLYNMVRIIVGTLLSVGQGKLDPDSIPEILA
FT                   KQNRQFAGKMAPGHGLYLWQVNYNN"
FT   gene            139152..139589
FT                   /gene="rplM"
FT                   /locus_tag="BCE_0143"
FT                   /old_locus_tag="BCE0143"
FT   CDS_pept        139152..139589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="BCE_0143"
FT                   /old_locus_tag="BCE0143"
FT                   /product="ribosomal protein L13"
FT                   /note="identified by match to protein family HMM PF00572;
FT                   match to protein family HMM TIGR01066"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39079"
FT                   /db_xref="GOA:Q73F63"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73F63"
FT                   /protein_id="AAS39079.1"
FT                   /translation="MRTTFMAKANEVERKWYVVDAEGQTLGRLASEVASILRGKNKPTF
FT                   TPHVDTGDHVIIINAEKIHLTGNKLNDKIYYRHTNHPGGLKQRTALEMRTNYPVQMLEL
FT                   AIKGMLPKGRLGRQVSKKLNVYAGAEHPHQAQKPEVYELRG"
FT   gene            139611..140003
FT                   /gene="rpsI"
FT                   /locus_tag="BCE_0144"
FT                   /old_locus_tag="BCE0144"
FT   CDS_pept        139611..140003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="BCE_0144"
FT                   /old_locus_tag="BCE0144"
FT                   /product="ribosomal protein S9"
FT                   /note="identified by match to protein family HMM PF00380"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39080"
FT                   /db_xref="GOA:Q73F62"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73F62"
FT                   /protein_id="AAS39080.1"
FT                   /translation="MAQVQYYGTGRRKSSVARVRLVPGEGRVIINGRDFENYIPFAALR
FT                   EVVKQPLVATETLGNYDVLVNVNGGGYTGQAGAIRHGISRALLKADPEYRLTLKRAGLL
FT                   TRDARMKERKKYGLKGARRAPQFSKR"
FT   gene            140166..140594
FT                   /locus_tag="BCE_0145"
FT                   /old_locus_tag="BCE0145"
FT   CDS_pept        140166..140594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0145"
FT                   /old_locus_tag="BCE0145"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39081"
FT                   /db_xref="InterPro:IPR019667"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F61"
FT                   /protein_id="AAS39081.1"
FT                   /translation="MNVIVSLQEKQKEKQLKYERKMLRELSLKTLRSNIRDAFQMQELH
FT                   RQYEDYCIELGIESYLLGARYSKFGYYGESFFDVKYRALEEEQQLTETLFQFLTSMTMR
FT                   EIKLQDEELLFESCQQFIGLWWQEGYEKGERRYRLKLH"
FT   gene            140661..141374
FT                   /gene="cwlD"
FT                   /locus_tag="BCE_0146"
FT                   /old_locus_tag="BCE0146"
FT   CDS_pept        140661..141374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cwlD"
FT                   /locus_tag="BCE_0146"
FT                   /old_locus_tag="BCE0146"
FT                   /product="germination-specific N-acetylmuramoyl-L-alanine
FT                   amidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="identified by match to protein family HMM PF01520"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39082"
FT                   /db_xref="GOA:Q73F60"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR014234"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F60"
FT                   /protein_id="AAS39082.1"
FT                   /translation="MKRIRIISFALAAVILFFLVKQEFQITKSWRAWNLPLSGKVIVLD
FT                   AGHGGPDGGAVGGKDIVEKDITLEITKKVQDYLQEQGALVILTREGDYDLAQKDTKSYS
FT                   RRKAEDLKKRVEIINKPDVDFFASIHLNALTSSGSKGAQTFYYRSSIENERAAKFIQAE
FT                   LRTSLENTNRSAKTISHVYLLKYAKTPGALIEAGFLSNVNERYMLNSEKYQQKVAAAVY
FT                   RGILRYFTEKGNPPE"
FT   gene            141519..142586
FT                   /locus_tag="BCE_0147"
FT                   /old_locus_tag="BCE0147"
FT   CDS_pept        141519..142586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0147"
FT                   /old_locus_tag="BCE0147"
FT                   /product="mrp protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39083"
FT                   /db_xref="GOA:Q73F59"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F59"
FT                   /protein_id="AAS39083.1"
FT                   /translation="MVTKEQVVEALEGIVDPFLHKTLKETGAIKEVTVKPEKEHVSVKI
FT                   AILKTGTAEQMQLQSGIVKLVKELGAATVGLRFAEFTEEELAQFAPEQEEEQTESLLSP
FT                   NSKTTFLAVASGKGGVGKSTVSVNLAIALARLGKKVGIIDADIYGFSVPDMMGIEKRPV
FT                   VRGDKIIPVERLGVKVISMGFFVEDNAPVIWRGPMLGKMLNHFFTEVEWGDLDYLVLDL
FT                   PPGTGDVALDLHSMLPACKEIIVTTPHPTAAFVAARAGAMALRTEHSILGVVENMAYFE
FT                   SKTTGEKEYVFGRGGGDKLATELQTEVLGRIPLQQPDWNKEDFAPSVYEDTHTTGLIYR
FT                   TIAETVIDKTTVAQK"
FT   gene            complement(142643..143260)
FT                   /gene="gerD"
FT                   /locus_tag="BCE_0148"
FT                   /old_locus_tag="BCE0148"
FT   CDS_pept        complement(142643..143260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerD"
FT                   /locus_tag="BCE_0148"
FT                   /old_locus_tag="BCE0148"
FT                   /product="spore germination protein GerD"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39084"
FT                   /db_xref="InterPro:IPR041262"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F58"
FT                   /protein_id="AAS39084.1"
FT                   /translation="MKRMLLVLTSSFLFLVLVACAQEKEAKSELDYDQTKKMIVDILKT
FT                   DQGKKAIQDVLTDEKMKQALILDETVVKKTIEDAMVSDKGQQFWEKLFKDPEFSSKFAK
FT                   SMGKEQTALMKTLLKDPEYQAGVMEIMKNPEVEKMMLQTMKSKEYRQYLQQVLTETAES
FT                   PLFQAKMIDIISKGVQKAEKSGSDKKEAGGEGGSQEGKKEQQ"
FT   gene            143400..144011
FT                   /gene="kbaA"
FT                   /locus_tag="BCE_0149"
FT                   /old_locus_tag="BCE0149"
FT   CDS_pept        143400..144011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kbaA"
FT                   /locus_tag="BCE_0149"
FT                   /old_locus_tag="BCE0149"
FT                   /product="kinb signaling pathway activation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39085"
FT                   /db_xref="GOA:Q73F57"
FT                   /db_xref="InterPro:IPR024164"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F57"
FT                   /protein_id="AAS39085.1"
FT                   /translation="MNSRKWVRLFFTTLFLGGVSTVIIGFVLEWDKYAEFFQNFDGKEI
FT                   LAVSFWLMGVGFIFSVISQMGFFAYLTIHRFGLGMFRSSSLWNIVQLFFIAFVLFDFVY
FT                   LRSVLIANGEVSLGNNILVAGVLFMFGAIVAYIKSKETNKKAFVPALFFMVVVTILEWV
FT                   PALRINDTDWLYLMVIPLLLCNAYQLLILHRLIGKASKSA"
FT   gene            complement(144116..144880)
FT                   /locus_tag="BCE_0150"
FT                   /old_locus_tag="BCE0150"
FT   CDS_pept        complement(144116..144880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0150"
FT                   /old_locus_tag="BCE0150"
FT                   /product="polysaccharide deacetylase, putative"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39086"
FT                   /db_xref="GOA:Q73F56"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR014132"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F56"
FT                   /protein_id="AAS39086.1"
FT                   /translation="MFFFFITSKRNFKHISLIVILSLFTAWLLFLKTYSHESAFSTATG
FT                   PKVIYKGDTSKKQVAFTFDISWGDKKAIPILDTLKERDIKNATFFLSAAWAERHPDVVE
FT                   RIIKDGHEIGSMGYNYTSYTSLEANEIRRDLLRAQDVFTKLGVKQIKLLRPPSGDFNKA
FT                   TLKIAESLGYTVVHWSNNSNDWKNPGVNNIVSTVSNNLKGGDIVLLHASDSALQTNKAL
FT                   PLLLQKLKSDGYEQISVSQLISNTSTKSKDVQ"
FT   gene            145051..145269
FT                   /locus_tag="BCE_0151"
FT                   /old_locus_tag="BCE0151"
FT   CDS_pept        145051..145269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0151"
FT                   /old_locus_tag="BCE0151"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39087"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F55"
FT                   /protein_id="AAS39087.1"
FT                   /translation="MLGFMLTKEEKKEMEYILKRELEELLFDFEDERIHDVVKKAMEER
FT                   YKIIFCLFRRVANAEECIRYVRKRTFY"
FT   gene            145427..145525
FT                   /locus_tag="BCE_0152"
FT                   /old_locus_tag="BCE0152"
FT   CDS_pept        145427..145525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0152"
FT                   /old_locus_tag="BCE0152"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39088"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F54"
FT                   /protein_id="AAS39088.1"
FT                   /translation="MKTERNKQRETSIFILDARQTNFIGEFDPGSG"
FT   gene            145521..147029
FT                   /locus_tag="BCE_5747"
FT                   /old_locus_tag="BCE5747"
FT                   /note="Bc16SD"
FT   rRNA            145521..147029
FT                   /locus_tag="BCE_5747"
FT                   /old_locus_tag="BCE5747"
FT                   /product="16S ribosomal RNA"
FT   gene            147206..150113
FT                   /locus_tag="BCE_5748"
FT                   /old_locus_tag="BCE5748"
FT                   /note="Bc23SD"
FT   rRNA            147206..150113
FT                   /locus_tag="BCE_5748"
FT                   /old_locus_tag="BCE5748"
FT                   /product="23S ribosomal RNA"
FT   gene            150202..150312
FT                   /locus_tag="BCE_5749"
FT                   /old_locus_tag="BCE5749"
FT                   /note="Bc5SD"
FT   rRNA            150202..150312
FT                   /locus_tag="BCE_5749"
FT                   /old_locus_tag="BCE5749"
FT                   /product="5S ribosomal RNA"
FT   gene            150325..150399
FT                   /locus_tag="BCE_5647"
FT                   /old_locus_tag="BCE5647"
FT                   /note="tRNA-Asn"
FT   tRNA            150325..150399
FT                   /locus_tag="BCE_5647"
FT                   /old_locus_tag="BCE5647"
FT                   /product="tRNA-Asx"
FT   gene            150404..150476
FT                   /locus_tag="BCE_5648"
FT                   /old_locus_tag="BCE5648"
FT                   /note="tRNA-Thr"
FT   tRNA            150404..150476
FT                   /locus_tag="BCE_5648"
FT                   /old_locus_tag="BCE5648"
FT                   /product="tRNA-Thr"
FT   gene            150501..150575
FT                   /locus_tag="BCE_5649"
FT                   /old_locus_tag="BCE5649"
FT                   /note="tRNA-Glu"
FT   tRNA            150501..150575
FT                   /locus_tag="BCE_5649"
FT                   /old_locus_tag="BCE5649"
FT                   /product="tRNA-Glu"
FT   gene            150581..150656
FT                   /locus_tag="BCE_5650"
FT                   /old_locus_tag="BCE5650"
FT                   /note="tRNA-Val"
FT   tRNA            150581..150656
FT                   /locus_tag="BCE_5650"
FT                   /old_locus_tag="BCE5650"
FT                   /product="tRNA-Val"
FT   gene            150674..150757
FT                   /locus_tag="BCE_5651"
FT                   /old_locus_tag="BCE5651"
FT                   /note="tRNA-Tyr"
FT   tRNA            150674..150757
FT                   /locus_tag="BCE_5651"
FT                   /old_locus_tag="BCE5651"
FT                   /product="tRNA-Tyr"
FT   gene            150823..150897
FT                   /locus_tag="BCE_5652"
FT                   /old_locus_tag="BCE5652"
FT                   /note="tRNA-Gln"
FT   tRNA            150823..150897
FT                   /locus_tag="BCE_5652"
FT                   /old_locus_tag="BCE5652"
FT                   /product="tRNA-Gln"
FT   gene            150903..150978
FT                   /locus_tag="BCE_5653"
FT                   /old_locus_tag="BCE5653"
FT                   /note="tRNA-Lys"
FT   tRNA            150903..150978
FT                   /locus_tag="BCE_5653"
FT                   /old_locus_tag="BCE5653"
FT                   /product="tRNA-Lys"
FT   gene            150984..151055
FT                   /locus_tag="BCE_5654"
FT                   /old_locus_tag="BCE5654"
FT                   /note="tRNA-Gly"
FT   tRNA            150984..151055
FT                   /locus_tag="BCE_5654"
FT                   /old_locus_tag="BCE5654"
FT                   /product="tRNA-Gly"
FT   gene            151066..151138
FT                   /locus_tag="BCE_5655"
FT                   /old_locus_tag="BCE5655"
FT                   /note="tRNA-Ala"
FT   tRNA            151066..151138
FT                   /locus_tag="BCE_5655"
FT                   /old_locus_tag="BCE5655"
FT                   /product="tRNA-Ala"
FT   gene            151254..152399
FT                   /locus_tag="BCE_0153"
FT                   /old_locus_tag="BCE0153"
FT   CDS_pept        151254..152399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0153"
FT                   /old_locus_tag="BCE0153"
FT                   /product="glycerate kinase"
FT                   /note="identified by match to protein family HMM PF02595;
FT                   match to protein family HMM TIGR00045"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39089"
FT                   /db_xref="GOA:Q9XBL1"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9XBL1"
FT                   /protein_id="AAS39089.1"
FT                   /translation="MKVVIASDSYKESLKAIEVCEAIERGFGAIFPKAEYVKIPIGDGG
FT                   EGTVDSLVDATSGRIISFHVTGPLRESVQAFYGMSKDKKTAFIEMAAASGLQHVPAKKR
FT                   NPLITTTKGTGELILHALDEGAEHIILGLGGSATNDGGAGMLSALGVRFINGKGEVIEP
FT                   SGGTLHSIVSIDFSQMDSRLKHIKIEAACDVDNPLVGIRGASFVFGRQKGADEEMMKEL
FT                   DENLKHYAHILKQYLFCDVSKIPGAGAAGGMGAAVIAVLKGSLRRGIEIVLDYTNFDKH
FT                   IEGADLIITGEGRIDEQTAYGKAPVGVAERAKLFHIPVIAIGGSVSPNYSAVHEKGIDA
FT                   VFSITTSPTTLEEAYKVAEENIEMTAKNIAAVWKIASEKHF"
FT   gene            152609..153502
FT                   /gene="rocF"
FT                   /locus_tag="BCE_0154"
FT                   /old_locus_tag="BCE0154"
FT   CDS_pept        152609..153502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocF"
FT                   /locus_tag="BCE_0154"
FT                   /old_locus_tag="BCE0154"
FT                   /product="arginase"
FT                   /EC_number="3.5.3.1"
FT                   /note="identified by match to protein family HMM PF00491;
FT                   match to protein family HMM TIGR01229"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39090"
FT                   /db_xref="GOA:Q73F53"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F53"
FT                   /protein_id="AAS39090.1"
FT                   /translation="MKKEISVIGVPMDLGQMRRGVDMGPSAIRYAGVIERIEEIGYDVK
FT                   DMGDICIEREKEVDVNTSLRNLTQVATVCNELASKVDHIIEEGRFPLVLGGDHSIAIGT
FT                   LAGVAKHYKNLGVIWYDAHGDLNTEETSPSGNIHGMSLAASLGYGHPALVDLYGAYPKV
FT                   KKENVVIIGARALDEGEKDFIRNEGIKVFSMHEIDRMGMTAVMEETIAYLSHTDGVHLS
FT                   LDLDGLDPHDAPGVGTPVIGGLSYRESHLAMEMLAEADIVTSAEFVEVNTILDERNRTA
FT                   TTAVALMGSLFGEKLK"
FT   gene            153751..154572
FT                   /locus_tag="BCE_0155"
FT                   /old_locus_tag="BCE0155"
FT   CDS_pept        153751..154572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0155"
FT                   /old_locus_tag="BCE0155"
FT                   /product="conserved hypothetical protein TIGR00159"
FT                   /note="identified by match to protein family HMM PF02457;
FT                   match to protein family HMM TIGR00159"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39091"
FT                   /db_xref="GOA:Q73F52"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F52"
FT                   /protein_id="AAS39091.1"
FT                   /translation="MPFEDTTILKYLSTALDIAVVWFIIYKLILIIRGTKAVQLLKGIT
FT                   VIIVVRMISIFLGLRTLYWLTEQVLTWGFLAVIIIFQPELRRALEQLGRGSLFSRTGTH
FT                   EDDEPEMVATAIAKATEYMGKRRIGALITLSKETGMGDYVETGIPLNANVSSELLINIF
FT                   IPNTPLHDGAVIMQGSTIKAAACYLPLSESPFISKELGTRHRAAMGVSEVTDSITVVVS
FT                   EETGQISLTKNGKLHRDLKTEQLKDMLLAEFSANEKTTSSSLWNWRRKRHG"
FT   gene            154565..156052
FT                   /locus_tag="BCE_0156"
FT                   /old_locus_tag="BCE0156"
FT   CDS_pept        154565..156052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0156"
FT                   /old_locus_tag="BCE0156"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39092"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F51"
FT                   /protein_id="AAS39092.1"
FT                   /translation="MDKLMENHWFLKGISLLLACMLFMSATLTEKNTTSGILPFANDAK
FT                   ETLTNYAINVKYDEEKYIVSGIPAEGVKVKLEGPKAAVATAKAKKQFDIPVDLRGSEKG
FT                   TYEVSLKTNGLPDDVKGTVQPSTIKITLHEKARKYVHVDLKLSNEDQMSAGATLEKSNI
FT                   KPDTVEVVGTKEEIESISSAKAYVDLKGVNKTVTKTPEVTLYNKEGKRLNVRTSPSKIS
FT                   VTLNVATQATANNTEKTVPITYAKKGSLPEGLAVTNVSVEPREVTIAGPKDILDNIQSI
FT                   EGVEVDLSQLTESTTFDTSVLLPKGVTSAKPNQVKVSVGVQKTKQTKTRTIDGISIQKN
FT                   GLSKDVTAQLLSPQDGKISVDISGETSIVDKITAAQITAVINLQNVSPGTKDVAIQVSG
FT                   PGNISIEPKQKSAKVTIVKKENPDKEVQGNGEQPNSNNNKDNQTEKPKNPEPEPKPDPE
FT                   KEKEKEKEPEQNKDKETSQEPTVDNQKEPEKGANHNG"
FT   gene            156045..157391
FT                   /gene="glmM"
FT                   /locus_tag="BCE_0157"
FT                   /old_locus_tag="BCE0157"
FT   CDS_pept        156045..157391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmM"
FT                   /locus_tag="BCE_0157"
FT                   /old_locus_tag="BCE0157"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="identified by match to protein family HMM PF00408;
FT                   match to protein family HMM PF02878; match to protein
FT                   family HMM PF02879; match to protein family HMM PF02880;
FT                   match to protein family HMM TIGR01455"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39093"
FT                   /db_xref="GOA:Q73F50"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73F50"
FT                   /protein_id="AAS39093.1"
FT                   /translation="MGKYFGTDGVRGVANQELTPELAFKIGRFGGYVLTKDTDRPKVII
FT                   GRDTRISGHMLEGALVAGLLSTGAEVMRLGVISTPGVAYLTKALDAQAGVMISASHNPV
FT                   QDNGIKFFGSDGFKLTDEQEAEIEALLDKEVDELPRPTGTNLGQVSDYFEGGQKYLQYI
FT                   KQTVEEDFSGLHIALDCAHGATSSLAPYLFADLEADISTMGTSPNGMNINDGVGSTHPE
FT                   VLAELVKEKGADIGLAFDGDGDRLIAVDEKGNIVDGDQIMFICAKYMKETGQLKHNTVV
FT                   STVMSNLGFYKALEANGITSDKTAVGDRYVMEEMKRGGYNLGGEQSGHIILLDYITTGD
FT                   GMLSALQLVNIMKMTKKPLSELAGEMTKFPQLLVNVRVTDKKLALENEKIKEIIRVVEE
FT                   EMNGDGRILVRPSGTEPLIRVMAEAPTQEVCDAYVHRIVEVVKAEVGAE"
FT   gene            157876..159678
FT                   /gene="glmS"
FT                   /locus_tag="BCE_0158"
FT                   /old_locus_tag="BCE0158"
FT   CDS_pept        157876..159678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="BCE_0158"
FT                   /old_locus_tag="BCE0158"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase (isomerizing)"
FT                   /EC_number="2.6.1.16"
FT                   /note="identified by match to protein family HMM PF00310;
FT                   match to protein family HMM PF01380; match to protein
FT                   family HMM TIGR01135"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39094"
FT                   /db_xref="GOA:Q73F49"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73F49"
FT                   /protein_id="AAS39094.1"
FT                   /translation="MCGIVGFIGEQDAKEILLKGLEKLEYRGYDSAGIAVQAENGVVVY
FT                   KEKGRIAKLREIVDENVATSVGIGHTRWATHGVPSKVNAHPHQSTSKRFTLVHNGVIEN
FT                   YELVKKEYLQDVTFVSETDTEVIVQLMEQQVSTGLSVEEAFRNTLSLLHGSYAIGLLDA
FT                   ENPNMIYVAKNKSPLLVGVGDNFNVVASDAMAMLQVTDQFIELMDKEIVIVTKESITIK
FT                   NLQGETIERAPFTAELDASDIEKGTYPHFMLKEIDEQPLVIRNIIQKYQDENGEIELDQ
FT                   DIRNAILDSDRIYIIACGTSYHAGLVGKQFIEKFAKMPVEVHVASEFSYNMPLLTERPF
FT                   FIYISQSGETADSRAVLVQTNEMGHKALTITNVPGSTLSREADYTLPLYAGPEIAVAST
FT                   KAYTAQLAVLSILAADIAKAKGEVLGFDLTHELGLVANAMVQLCDQKEEMDALAKQFLA
FT                   TTRNCFFIGRSVDFYVGLEGALKLKEISYIQAEGFAGGELKHGTIALIENGTPVIALAT
FT                   QEHVNLGIRGNVKEVVARGANPCIISMKGLEMEGDSFVLPAVHEALAPLVAVIPLQLIS
FT                   YYAALHRECDVDKPRNLAKSVTVE"
FT   gene            160105..162642
FT                   /locus_tag="BCE_0159"
FT                   /old_locus_tag="BCE0159"
FT   CDS_pept        160105..162642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0159"
FT                   /old_locus_tag="BCE0159"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39095"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR024402"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F48"
FT                   /protein_id="AAS39095.1"
FT                   /translation="MKKKRNFKKRDMKIAASTQVLEKDNDELSIEDIHWEYSVNEKFEP
FT                   DTYDKLMPLLYPKEIHEEGISEEEIKHRFAVEKLFYEKDNLSLLLKYIYGKCGKLSKAS
FT                   VEATHFLMVISRIMYLYHTLGDFKGALELLKVAGVGNCSKALLKIDEEAREQELVNYYY
FT                   FVFLYLITKKENEEFLEEDKEITVNLFELCIDNRIELQNISYYRVDTYYIARLFFMNYQ
FT                   HLYSKVGKQKFEHVVMNFSHLLLNKKFYFFDSINGWKSSTQNFLEEWDEFYSGVEELIL
FT                   NDLVIRFLYFIKPVFKGYIYFEFRDPIEGVLPKFKTFFKKWKVDFVMKYRDVLGTLTKK
FT                   ICEIDDYGQNFICSQQDITCFFDLLDESKHTKYKKKFAEEYILSNITSYSFMKFYEEKM
FT                   YRQFALLYNKCENEKLKEQVKNGLSFELAYCLSESGEKEQAKEIYEAMIKKGKEGSGVF
FT                   NNLGVIYRDIDKNYMKALDLFNKANKILPNDQIIIQNINTTKKMIDEQKSHPQKIVERY
FT                   FKKTDSQHKKIIFTIYRFQGQEYVSNELLMNATNFKGRYFEKLIRHLQSLELIYFDAGR
FT                   GWYIDQAIKENVESYINPKLERQIIKWDNNCFYRPIFYHEAEINLYRVLKELFPMHLVF
FT                   PNMDLKTIIDAEKIRDYLDNDILDYFFKAHVDFAIVDTTNYFPIMTYERDSTYQDHEPQ
FT                   KSNAIKKNIIFQTSGLPLIRLRYSPSMDYERLKEEIKQTTKEFLLEIQQGNNSESKRIL
FT                   KSFDLKKFDIYNELPNINDIQDKWSAIVGELIAENTIEIQMLKETGIVIIFLSEKVKSI
FT                   VEMGKENIKKSMYQEFPVLNALEFKWESSKKED"
FT   gene            163032..165779
FT                   /locus_tag="BCE_0160"
FT                   /old_locus_tag="BCE0160"
FT   CDS_pept        163032..165779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0160"
FT                   /old_locus_tag="BCE0160"
FT                   /product="ATP-dependent helicase, DinG family, putative"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39096"
FT                   /db_xref="GOA:Q73F47"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F47"
FT                   /protein_id="AAS39096.1"
FT                   /translation="MNSKADVILDIFEEKLIKHYGTSIIRASQLQMALDIGEFLESSKR
FT                   VMIIEAPVGTGKSLGALVPVLVDRKYNTFDKRNVMYATATINLQGQLMRSEIPLLRKLG
FT                   LVNNPIVAKGKSHYYCHFRMKNSSQKIENELFSRTDQHVLEKFFRLSKTGQRSELEEEH
FT                   GFNIEDKKWKRVELSNKSNCRACQFSMVCPTIIHRRRFKAIENDVVITNHDQLINSFLN
FT                   AMDMDSIYEPVLKTDMGLVIIDEAHDFLETFIGRLEKTFTLSYLRNLEKYIERDNYKWK
FT                   KAVDRLGAWVKRNKEYNKKSDAGRYLLTDFVFSILKTLQKILNENLFQAKYRRAEILDE
FT                   LSGILHRFLQKEKYTSWISLEDNEFHVIENNYKEVFRQMLDYIKNSNKIIFMSGTLTVN
FT                   KDFSYIKNQWNIKSGEAVTKVLNSPFDYKNQALIYIPKKLGNPNKDEFIENALKEIRKL
FT                   LRLTGGRTLLLNTSKDHMDEFYNGIKVELATSNVPLYKQGESGVENLTKRFKELEESVL
FT                   VGSGSFFSGFSIAGTSLTSVIINKLPFPAFNDPIIELMSMGIKKEDRFKKVSYPMMINK
FT                   LDQAVGRLIRSIEDYGIVTILDERIYTSQGYGKDVRELLKEQGYVLTRSWEEVESFYIK
FT                   KLEKGAEAEYKPYNKEALDIGNLLSRPNRKLLAKIQKRKHIKVKMYEPKKIKKDQKLFL
FT                   EKVCKDANFKIILNGTTELVFKEVCISLAMDKLPIPQTMKDFPYRDIEEKEKLSQYLDF
FT                   KVANKTVEEIYRENEVKTTKNRVNKDQREFLKNLMEQEGITGSIKREVNDAYKVVYDEL
FT                   YSNWKDVSYLRECFPYQDEEEKRELFTYHGGTRKRAYPLCTQLGCSGECSEQEHKQIIA
FT                   YLIDTYGATKIEYMGGTGKQRVLIEPIEILDQDEFRPSELLQNV"
FT   gene            166499..166672
FT                   /locus_tag="BCE_0161"
FT                   /old_locus_tag="BCE0161"
FT   CDS_pept        166499..166672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0161"
FT                   /old_locus_tag="BCE0161"
FT                   /product="IS231-related transposase, truncation"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39097"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F46"
FT                   /protein_id="AAS39097.1"
FT                   /translation="MMNPLIQDELQLFAKGLQRYVTPVFLEELAREMGFIKRKRKFSCS
FT                   DLAPICIWISNE"
FT   gene            167219..167413
FT                   /locus_tag="BCE_0162"
FT                   /old_locus_tag="BCE0162"
FT   CDS_pept        167219..167413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0162"
FT                   /old_locus_tag="BCE0162"
FT                   /product="Unknown-related protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39098"
FT                   /db_xref="GOA:Q73F45"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F45"
FT                   /protein_id="AAS39098.1"
FT                   /translation="MLTKVKRIRLEKGMTQGELAKLTNVSRQTIGLIEQGAYNPSLNLC
FT                   IKICQTLGVTLNDLFWEEL"
FT   gene            167416..167922
FT                   /locus_tag="BCE_0163"
FT                   /old_locus_tag="BCE0163"
FT   CDS_pept        167416..167922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0163"
FT                   /old_locus_tag="BCE0163"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39099"
FT                   /db_xref="GOA:Q73F44"
FT                   /db_xref="InterPro:IPR021697"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F44"
FT                   /protein_id="AAS39099.1"
FT                   /translation="MKNMLEKMYLRFINKVSERDEYQIQEINKEFAIAGLMLWYTNILA
FT                   MFIMLVVDTINQTLSIGTIITFVVNMLYANYLMWKLKKKKLNDIECSTKEEFFKKKKQI
FT                   KKSSIRAGLLWTFEMFILMCYVFPYLSSGKISVSFSDIIIWVCAGLFFGSSMYVISLFN
FT                   LKKLY"
FT   gene            complement(168143..168349)
FT                   /locus_tag="BCE_0164"
FT                   /old_locus_tag="BCE0164"
FT   CDS_pept        complement(168143..168349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0164"
FT                   /old_locus_tag="BCE0164"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39100"
FT                   /db_xref="GOA:Q73F43"
FT                   /db_xref="InterPro:IPR019493"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F43"
FT                   /protein_id="AAS39100.1"
FT                   /translation="MNLETLTEKELLEISAGGAGKCVAGIASGAVSGFLTGAGYTWEFG
FT                   PAVIYGSGVGALAGGIAGGIGGC"
FT   gene            complement(168375..168581)
FT                   /locus_tag="BCE_0165"
FT                   /old_locus_tag="BCE0165"
FT   CDS_pept        complement(168375..168581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0165"
FT                   /old_locus_tag="BCE0165"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39101"
FT                   /db_xref="GOA:Q73F42"
FT                   /db_xref="InterPro:IPR019493"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F42"
FT                   /protein_id="AAS39101.1"
FT                   /translation="MNLETLTEKELLEISAGGAGKCVAGIASGAALGFLNGASYTWEFG
FT                   PAVIYGGGVGALAGGVAGGIGSC"
FT   gene            complement(168607..168813)
FT                   /locus_tag="BCE_0166"
FT                   /old_locus_tag="BCE0166"
FT   CDS_pept        complement(168607..168813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0166"
FT                   /old_locus_tag="BCE0166"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39102"
FT                   /db_xref="GOA:Q73F41"
FT                   /db_xref="InterPro:IPR019493"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F41"
FT                   /protein_id="AAS39102.1"
FT                   /translation="MKLELLTEKELLEISAGGAGKCVAGIASGAVGGFLTGASYTWEFG
FT                   PAVIYGSGVGALAGGVAGGIAGC"
FT   gene            169056..171275
FT                   /locus_tag="BCE_0167"
FT                   /old_locus_tag="BCE0167"
FT   CDS_pept        169056..171275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0167"
FT                   /old_locus_tag="BCE0167"
FT                   /product="ABC-type bacteriocin transporter family protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664; match to protein
FT                   family HMM PF03412; match to protein family HMM TIGR01193"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39103"
FT                   /db_xref="GOA:Q73F40"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR005897"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F40"
FT                   /protein_id="AAS39103.1"
FT                   /translation="MFKKEFFCIRQQDLKDCGPACLAMISRHYGFTTSISKIREVAGTD
FT                   LAGTNIKGLMEAGEKLGFEVKAVKATKPEDLKEIPLPSIAHVVVNGGLLHYVVIHKVKD
FT                   NKIYIADPEKGLVTYLLEEFCQMWTGILVLMSPGQNFQKGKESKGTFSRFLLLLKQQKN
FT                   LLIPLFFASIFFNLFGLLGAFYFKFLIDDIVANQLIQTLHIVSIGIIILYIFKILLSYF
FT                   RTHLILYLSRRIDIHLMLGYYRHVVGLPMNFFETRKVGEIISRFMDASKIRDALSTITV
FT                   TLMIDTLMVTIGAVLLYIHSPILFGVTLLLIPFYIGIIFAFHKPYQSINRKEMESNAKL
FT                   NSYLVESLNGIATVKSYNAEKEVFFQTESRFINLLRHVFKRGMLSNLQGSIKMGLELIG
FT                   GTIILWVGSMQVLKGNMTIGELITYNALLVYFLNPIENLIGIQPTMQSALVAGERLNEI
FT                   FDLDQEKNEKEDNKVSPKKLSGKIQCSNVTFRYGTRKNVLNNISFSIESGSQVAFVGES
FT                   GSGKTTISKLLMHYYESQQGNIYYDDYHIKEISRTALRDRIAYVSQESFFFSASIYENL
FT                   CFGLARPVTLEEVIHVCKQACIHEFISELPLRYETLLEENASNLSGGQRQRLAIARALL
FT                   KQPDILILDEATSNLDSTTEKHITDMLKKLGLQGVTVIMIAHRLSTIQHANQIFVMEQG
FT                   NIKEQGAHEELLFHKGEYYRLWKNQTVHIEHIESQSYAMRGVQDE"
FT   gene            171268..172581
FT                   /locus_tag="BCE_0168"
FT                   /old_locus_tag="BCE0168"
FT   CDS_pept        171268..172581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0168"
FT                   /old_locus_tag="BCE0168"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39104"
FT                   /db_xref="GOA:Q73F39"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F39"
FT                   /protein_id="AAS39104.1"
FT                   /translation="MSKLYSFDQLIDSKELLERKPPRFIAGLIVFLLMSLFVFLIWAYV
FT                   SKIDIVSKGTAMIQGKSDVSVSRTQIVGVIDTVAVKPGDEVKKGNILIQLKNQELTDKQ
FT                   SQMNQIVEHLEKQKGMLEQLKESIQSHKSSFLDDVDKKIREEYQAYDQRYQSIQNEKDN
FT                   EIKTIENSKISSEQDEVLQGLIAENENIQREIDIIEKQKTKENILEEQKQVIDDKKGNL
FT                   ESQKNSVEKRIQQRKETLEHERTKVDVTKEGKQVQKKDALKQYKEESIISVNQRIQSLE
FT                   QELFIKKQELDGLRHQNETTIIKAEKDGIVQFPAILQQGDLINPGQEIVSIIPKEEQKK
FT                   VRILLPAQEIKGIKKGDKVQYSFKLQKTDKQMGQITYVSAYPTFDKNTKGYMYELEATI
FT                   DTKDLQELHIGMVGRASVITGEEPVWKFILRKLDFISN"
FT   gene            complement(172574..172723)
FT                   /locus_tag="BCE_0169"
FT                   /old_locus_tag="BCE0169"
FT   CDS_pept        complement(172574..172723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0169"
FT                   /old_locus_tag="BCE0169"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39105"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F38"
FT                   /protein_id="AAS39105.1"
FT                   /translation="MLKVMFFSFAYVTDKGKELINKINMITIEKHFFILNYISLYDFIS
FT                   NYFN"
FT   gene            172623..173303
FT                   /locus_tag="BCE_0170"
FT                   /old_locus_tag="BCE0170"
FT   CDS_pept        172623..173303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0170"
FT                   /old_locus_tag="BCE0170"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39106"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F37"
FT                   /protein_id="AAS39106.1"
FT                   /translation="MKKCFSIVIMLILLMSSFPLSVTYAKEKNITLSNIEQMSSVFNDN
FT                   TSLGEKISYIRNSDLNNWSVKEMNQALDKIDNLNLSIMERASLKREVIRSSGFSNFDFK
FT                   ETNSDVLAFKELKIEIIETDQLLTLYRRSKAGEPGSKYGLGYWWGDKERNIEETRNELA
FT                   VLEAWGNPLNIQYKIKVPKGTRILKGFTAAQTQYLKGTSIIQEYREGGAMQYWINKIDN
FT                   SWLQ"
FT   gene            173324..173596
FT                   /locus_tag="BCE_0171"
FT                   /old_locus_tag="BCE0171"
FT   CDS_pept        173324..173596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0171"
FT                   /old_locus_tag="BCE0171"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39107"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F36"
FT                   /protein_id="AAS39107.1"
FT                   /translation="MTNHHEFICLALDCERIIKQNIPSNPDDVKRYHLMLNELKGLRMT
FT                   IESNQLNDKLYYLSITQMLEKNDPEEVLQAVLKLNTFYCNYYQNV"
FT   gene            complement(173774..174238)
FT                   /locus_tag="BCE_0172"
FT                   /old_locus_tag="BCE0172"
FT   CDS_pept        complement(173774..174238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0172"
FT                   /old_locus_tag="BCE0172"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39108"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F35"
FT                   /protein_id="AAS39108.1"
FT                   /translation="MYFSKLPIGFFDLNTDTETLHSLLYEHFNKTIKKGTKIQFQDYEN
FT                   QSYFFVPSPVFTEELMGNISGIDLIIYAYLCKDAYLNKTGKVKVDIPTISKETAIRKTV
FT                   IRNSINSLNRVDLIVKDSKDTYYVIEELFYYFTDNEFKEFVEVVNNSIPY"
FT   gene            174481..174981
FT                   /locus_tag="BCE_0173"
FT                   /old_locus_tag="BCE0173"
FT   CDS_pept        174481..174981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0173"
FT                   /old_locus_tag="BCE0173"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39109"
FT                   /db_xref="InterPro:IPR028102"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F34"
FT                   /protein_id="AAS39109.1"
FT                   /translation="MYQLKYRRSNNRIELITEYGEKKLLNDSISSKPTISPGGLKAIYL
FT                   SPCEWESITKLYLFDLRNGDNIQLIGDIDGAYMPKGAIWIDNSYLALIIGFGTFSDGGN
FT                   VYLYNLMDSQLIKITDWNQRKQVVKLEYNSGFLKCKGIEYLSDMMEEYIEFKEILDINL
FT                   YTL"
FT   gene            175227..176066
FT                   /locus_tag="BCE_0174"
FT                   /old_locus_tag="BCE0174"
FT   CDS_pept        175227..176066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0174"
FT                   /old_locus_tag="BCE0174"
FT                   /product="Tn7-like transposition protein A"
FT                   /note="identified by similarity to SP:P13988"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39110"
FT                   /db_xref="GOA:Q73F33"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR014832"
FT                   /db_xref="InterPro:IPR014833"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F33"
FT                   /protein_id="AAS39110.1"
FT                   /translation="MAKRKNEWTEKRIEKYIREGRGHGEGGDYKPWLTIQNLSSNGNET
FT                   RPKGWKTKRQHEFLSNLERDYFFILEWADNIIDIREQFPLDRELTYQIAVEKGISHPID
FT                   PKNKTLIVMTTDFLLTIHKEKEIKYIARTVKSSKELEDKRVIEKFEIEREYWKRKNIDW
FT                   GIVTEKDIPAEMADNIFWLHKSYYVEDIRDVSFIKLLLKSLMNTSSNTPLIDALNQFDN
FT                   QYNLDQGQAMVYFKHLVARKYIFIDILTKRVNLRNLNIKGLVFTKGEYEVCDYAISK"
FT   gene            176035..178185
FT                   /locus_tag="BCE_0175"
FT                   /old_locus_tag="BCE0175"
FT   CDS_pept        176035..178185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0175"
FT                   /old_locus_tag="BCE0175"
FT                   /product="Tn7-like transposition protein B"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39111"
FT                   /db_xref="GOA:Q73F32"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F32"
FT                   /protein_id="AAS39111.1"
FT                   /translation="MRSVIMLSVNEVFQDVDSSKVYRVLWIDDGNVIAYLIDIYHDNAL
FT                   PFGEGMKNLFDGFVSGRFSKVVAPNLISVIACEELSEKEILIRDKAWNKIKELVKREPE
FT                   IYKRKERGKLIKGIIGQQDVSNKTIYKYLKRYWQRGKVKDALIPDYKNCGNKGVEKNWG
FT                   ENKTGRPRTRNSTGINVTPEIQQLFEKAVQNYYFVNPDNTLTHTYKMMIRKAFQVDTYY
FT                   EDGINYTIIEDENNIPTLRQFRYWFNKRYGTEEIISSKYGRKKFERDHRAILGSSSFEV
FT                   FGPGSRYQIDATKANVYIVSRYNSDWVLERPTVYYVTDVYTHLIAGFYVGLESPSWLGM
FT                   MMALLNATTNKKVFCEKYGIHITEDCWPAAHLPEVILGDRGELEGFNVNHLIQGLNVTV
FT                   ENNPAYRPDWKGIVEKLFDISQEKIRPFLPGYVAKDWGKRGAKDPRLQAKLNIEQYTKI
FT                   IIRFILHYNKNFYMKDYIRDSDMIMDDVKPTPIELWKWGIKNRAGKLRIVQPDIMKFYL
FT                   MPRGSATVTAKGIRFQKMLYSCETALQNSWFAIARTKKSWKVDISFDPRDMNQIYIHTK
FT                   DERIFETCNLLEHQERYKDKSIEEVEQLHKVESEKFKEEEHVLLQNDINLFDSIESIVN
FT                   EAIKEADEKQTVNFSESKNIEKIKEHTKFEKEMRRKEEAFKLDDMKNGVPQNVISVNEN
FT                   QKNIYDRHSVKDLFNKRRGGKK"
FT   gene            178182..179834
FT                   /locus_tag="BCE_0176"
FT                   /old_locus_tag="BCE0176"
FT   CDS_pept        178182..179834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0176"
FT                   /old_locus_tag="BCE0176"
FT                   /product="Tn7-like transposition protein C"
FT                   /note="identified by similarity to SP:P05846"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39112"
FT                   /db_xref="GOA:Q73F31"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F31"
FT                   /protein_id="AAS39112.1"
FT                   /translation="MSQNPDMVQLENGTYALLASYKEQQLVEYQGNPLIEALPPILSYE
FT                   EAFDQLSFFPEYHEKEKNLSEHHRYHALLRLTRFFQPIGQTLDLERRFSRFLRYGYVNR
FT                   NPLQKQHIQALNELHQKLVKKEELGLSPDIRATASSFTLMGFSGVGKSTAIERVLSLYP
FT                   QLIVHQYPINTIQIVWLKLNCPHDGSLKSLCQNFFEKIDTLIGTNYLHKYGKSHISVSS
FT                   MVTRMGQIARLHCVGAVIIDEIQHLLSTKGDASEKMMNFFVTLINEIGIPVMMIGTMRA
FT                   RAILQKDFRQARRGSGQGDMIWQQMDNSEDWEVLLTSIWDYQWTKEYVELNQELIKLIY
FT                   EESQGIIDIAIKIFILAQGRAIETSTEKISIELIKKVVKEDLKLVQPMLKALKSGVESE
FT                   IAKYEDIIALDIKEYMLNKIPVIDMRARIQAQKEKIKKDSEANESSKLEKLILSLINLD
FT                   VNEKHAEKIAKRVLNKLPNLTIAELMKEALKCINECETXKRKKNNKALNMNMLQLLINK
FT                   GKKTKQSAYEALYDNGYIKKPLEESFYEEERLC"
FT   gene            179828..181678
FT                   /locus_tag="BCE_0177"
FT                   /old_locus_tag="BCE0177"
FT   CDS_pept        179828..181678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0177"
FT                   /old_locus_tag="BCE0177"
FT                   /product="Tn7-like transposition protein D"
FT                   /note="identified by similarity to SP:P13991"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39113"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="InterPro:IPR032750"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F30"
FT                   /protein_id="AAS39113.1"
FT                   /translation="MLTFFPNLYEEELLYGALTRYHNRSCNKEFKDTLRDLYGDTRTYI
FT                   MPDLIPDLKVLQNRLKYFNQFNINDCWEQHTFFHYYTNFLNAEVRNKVKKAILSNEQGV
FT                   NVYYQIGYITSTVKESPYFRFCAQCLQEDLQGYGETYWRVYQQLPSVFVCLKHRCLLQE
FT                   SSEQFRTGGSTLVAPLDTVHMKRTINNNDHDWSKQEMEHLIYIAKQSRKLVNTDYLYDL
FT                   NKLQKGYRYLLQKRGYVSVKGNVKQGKLARDFISYFGEKILHCMQSMLKSDESCWLKAI
FT                   TRKHRKSFHPIRHILLIYFLEESVDSISNYSQESYKPFGKGPYPCLNPATQHYLQPVIK
FT                   EVKISRCSRTKRPIGTFGCTCGFIYSRKGPDKFEEDKMKISRIKSFGYYWKERLHEYIF
FT                   IQNLSYRECARRLKVDVKTVIKYSKDMLSNSKKMQENNLLDKWKDEWKSLMNKNSDMTK
FT                   TELRNLYPNLYMRLYRNDKDWLREYSPKLKKRVKVQNRIDWGQRDMDIVEEVNIAIKSL
FT                   MNAEKPIRLTIGRIGREIKKSSLLEKKLNKLPLTRKLLHSVTESVIEFQKRRIEWVFEQ
FT                   LIKKEDDLAYWKVLRMVGLRADIDKSLQDEILARIHRKNG"
FT   gene            181707..183539
FT                   /locus_tag="BCE_0178"
FT                   /old_locus_tag="BCE0178"
FT   CDS_pept        181707..183539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0178"
FT                   /old_locus_tag="BCE0178"
FT                   /product="Tn7-like transposition protein D"
FT                   /note="identified by similarity to SP:P13991"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39114"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="InterPro:IPR032750"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F29"
FT                   /protein_id="AAS39114.1"
FT                   /translation="MLAYFPYLYENELIYSVFARYYNHTGNPSKKLNIRRKELIPGKSW
FT                   TISPHLPTSLNSLAKQLHIFLYPSVDDWIKRNTMYYYYTNFFSKVIKKKVWDIMLNGGN
FT                   VNIKSLMGSRVYPTLENQYFRYCPSCIVNDYERYGETYWRLNHQIPGVFICEKHETYLL
FT                   NSSVVCKYTNSQYLEAASIENCPITKECVNFSDKTKNHLKQIAQESFFLANEEYEFEDL
FT                   YQIYRSLLMQKGYIDNNGLINRYILYRDFLEFYGEELLVLMNSTIEDSARCWLIKMIRT
FT                   YYNSFHPIRHLLLIIFLGKSVKQLPKHNKKLITPFGEGPYICLNKAAEHYGESVIRSMK
FT                   IKKFKGQIKGIFECECGFSYSKLVPDHIGDEKDYWKIERYGNVWINKVYEYKYVKKLSV
FT                   PEISRRLDVSVGKIYYCLKLDVHYEEKQEELKQLNRKKYLKLKEKHPDFLISHFKKVNQ
FT                   NLINWLYKHDRDWLMNNKPNIKRKHNNVYREVNWLEKDQEYLNRVKKIADDLYGLEPPV
FT                   RVTKNRVAKELGLKGFSGYEEKTPITLGYLNDRAEDIEAFRLRRIKFVIKKLLEGGEVL
FT                   SKTKIKERANVPKLYFVNKDLQEELNGLKEKYSL"
FT   gene            183854..185173
FT                   /locus_tag="BCE_0179"
FT                   /old_locus_tag="BCE0179"
FT   CDS_pept        183854..185173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0179"
FT                   /old_locus_tag="BCE0179"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39115"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F28"
FT                   /protein_id="AAS39115.1"
FT                   /translation="MNVSGILERVFNKIPKEHVANIIAFKRPGWEPEKKNYKKNEIKEE
FT                   FLTLTELIEADEVEDFVEMAVMTKSIGLPAYTYKVNHLNFLTEAESAVSIENVNNMPFQ
FT                   DKYLISIEDIEQGDSMLKLTVRLKEYSDYWRRGERCLDTLSAVYRIKISLDKNARVLTI
FT                   FSGNNEVQSVIKDYFGLVLKWPIQSYRIRENINQINQIGSASFKTAVLLDFIFTRLHEQ
FT                   GIFSRFKEIKFNTKNKKHTTDGIRNITINGRNLLSSQLACEYITLGSDILSFKVDMTYN
FT                   DVDFTTLFSLKGKEEDILKIVVIDSDDDIFKQQVIDIIQSEYIELCGAGLKNVQETSNL
FT                   LKQIYEKFINGDRLVNEVIQNSSLQIIKSISRNLEKWDLDDENNLEMLYSFYEESKVIL
FT                   DSVGYDDTNEDILKIKEYIGYDEEEKEQELSEDEETAIVK"
FT   gene            185195..185842
FT                   /locus_tag="BCE_0180"
FT                   /old_locus_tag="BCE0180"
FT   CDS_pept        185195..185842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0180"
FT                   /old_locus_tag="BCE0180"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39116"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F27"
FT                   /protein_id="AAS39116.1"
FT                   /translation="MFLMEKDCILYRVTNDFQIDKLHSITPKRITYDKYDISYINNQII
FT                   RISYKWLDPIKVQEKIISREPKSVVLIYFVQRKIICCFGSSESYIGFVISKLEKKLATH
FT                   LEKINLFDICKKKYINEDNWESDLVSIYLLQKKPNSFDDYESTRVKKVKIKDIGSAELR
FT                   KHLINGEVTSFTYYFNERKTYFYLDSESVVSFPDVVKEEVVYHVIESLSDIV"
FT   gene            185811..186935
FT                   /locus_tag="BCE_0181"
FT                   /old_locus_tag="BCE0181"
FT   CDS_pept        185811..186935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0181"
FT                   /old_locus_tag="BCE0181"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39117"
FT                   /db_xref="GOA:Q73F26"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F26"
FT                   /protein_id="AAS39117.1"
FT                   /translation="MLLKALVILFKEWKLWIFFLIPFALLFFLDLGNAYNIKVYNDYKD
FT                   LTNLLSWLFTGIMSLVSFSALFIAFTFENKLVTASKSLKRILKPYSLNREDLRNTLINY
FT                   ENNLSEDKFLSVLYYVYLIITFFSILVWGTTLKFYRGFDYAEGFSLSIGTFLKVGSVAF
FT                   FAIVCLALMLISIALKLIRMNKDPLGNGYLPQIDEVCNVAYLIDNKADIMEFFSLNFPT
FT                   LEFYKNPASKTFEHEVTFNLPIKVSNFQFVIKLYQSEDRKGILTCFGNLVNQINKAEVG
FT                   ETYTCIVTNKLKEEIYNTLNEKDCYGILKIYNEEKNVVAKYILKKRIESEFNFYFEMDK
FT                   KLLTNLSGNKDRDYALIESMQHHEGKVVDYQLEI"
FT   gene            187395..188228
FT                   /locus_tag="BCE_0182"
FT                   /old_locus_tag="BCE0182"
FT   CDS_pept        187395..188228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0182"
FT                   /old_locus_tag="BCE0182"
FT                   /product="Tn7-like transposition protein A"
FT                   /note="identified by similarity to SP:P13988"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39118"
FT                   /db_xref="GOA:Q73F25"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR014832"
FT                   /db_xref="InterPro:IPR014833"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F25"
FT                   /protein_id="AAS39118.1"
FT                   /translation="MAKRKYEWDAKKIERYIKQGRGQKEGENYKPWLLAQDVPSIGRDG
FT                   QREGWKTGRNHHLLSDLESDYFYLLEWSSTVTDIREQFPLLPIEETVSIAEGLGIKHPN
FT                   DNKTKEIVVMTTDFIINVDSKEFVRTLKYAGDLENARIIEKLEIEREYWQRRNIDWGIV
FT                   TDKEIPKILCENVKWVRKEYHNSDVSKLGSFIVESIEKIVYQLIQDEITPLSIATSHTD
FT                   DRLGLEPGTSLAMIRHFIARKRWIVNMNEKIVPSLPLKGVSISTNSDYKKVEGYQ"
FT   gene            188225..190417
FT                   /locus_tag="BCE_0183"
FT                   /old_locus_tag="BCE0183"
FT   CDS_pept        188225..190417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0183"
FT                   /old_locus_tag="BCE0183"
FT                   /product="Tn7-like transposition protein B"
FT                   /note="identified by similarity to SP:P13989"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39119"
FT                   /db_xref="GOA:Q73F24"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F24"
FT                   /protein_id="AAS39119.1"
FT                   /translation="MIQQLAVNTIIQWIDSSNSDVVQVERVLWIDAIGEQLVVIALNDV
FT                   KALPTLKSSEEYVETHSGKQFKIIEWIDKFNLPLEERDALPTAYLEKRDEAWEVIKHLV
FT                   KDEPSIYNPRLRGVMIRELQERISVHKSTIYRYLRRYWQSGKVIDSLIPHYKNSGGYGK
FT                   EKSSGEVKRGRPTKVVEELGGINITEGIKHSFQAGISLFYNTKNQPNIKRAYKKTMAKF
FT                   FNIGFRVEGDEQIPILPHREQLPTYEQFYYWFRKKQDLEKSLQARVGKHAFNLKHRPIL
FT                   GSSTKESFGPGSRFQIDATVADIYLVNEFNREWIIGRPIIYIVMDVFSRIVTGFYVGLE
FT                   GPSWVGAMMALLCTSMDKVKFCKSYGVDINPEEWPIHHLPEILLADRGEFEGLKPNGLR
FT                   DSLGVDIELAAPYRADWKGVVEQQFRLLNLRSIKWIPGAVEARKRERGARDYRLDATLT
FT                   LNEFTQVIIHSILYHNNSHYMKGYDRNQFMVANDVLPIPTVLWKWGVEYRNGRLKTEAE
FT                   DIVKLALMPRGTATVTRSGIIFKGMSYSCNLAIREQWYTTAGYRGSWKAPVVYDVRNAN
FT                   EIYLLLNNGRSFEKCHLSNKAEKYYNKRFEEIEELHVLERQLDKEGAYNNLVSQIELDT
FT                   KVEAITEKAMKETQTAIENSDLSKNKRLKEINKNRKMQKEENRRTEAFVLGENGQEQNK
FT                   ETVSQSVQGESIEYVAPAEKIDKLKSILAELDGEHA"
FT   gene            190414..192081
FT                   /locus_tag="BCE_0184"
FT                   /old_locus_tag="BCE0184"
FT   CDS_pept        190414..192081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0184"
FT                   /old_locus_tag="BCE0184"
FT                   /product="Tn7-like transposition protein C"
FT                   /note="identified by similarity to SP:P05846"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39120"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F23"
FT                   /protein_id="AAS39120.1"
FT                   /translation="MSFKKFLLKGTVMAADYKRQQIEDYQGNPLIEALPEIYSETEVIK
FT                   KLANRPLYKEEEKTYPSHLRMHMVQRVYRDFFQPLSIHLEVEQRVSRIIRDGYLGRSPL
FT                   TPNYTYKVRKDAYHLITNGRDAGSKVLNASSSGFAIVGISGIGKSSTLEKVLNMNPQVV
FT                   IHTSYQEQPLHLYQVVWLKMDCPHDGSIKGLCLNSLSAMDEILGGNYYKKHGGGRKTVD
FT                   ELLPIISQIAAVHCLGVLVIDEIQNLNEAKSGGSAKMLNFFVQLVNTIGVPVILIGTYK
FT                   ASSILDGEFRNARRVSGQGDLIWSRMQNDDEWDYFLKGLWLYQWTSTFVECDEDFKEAM
FT                   YYESQGISDIAVKLFMLAQWRCIDTNKSHITPSIIKSVARDRLQLLQPALKALRTGIKD
FT                   DIEKLGDIFSKMETVDLLNEIEEKLKQKDRLELLKQEMDYNTYEPLIQEVGKWLIEGGI
FT                   EEVVASQCAKDVVSENLDKLTKVDLKQLALKHALSKLRNGTAKSKPKIKKLKATYKEAD
FT                   DLRLIYSKAKEKRILNYDALKVAGFIKQLDEFLTGQGG"
FT   gene            192085..193833
FT                   /locus_tag="BCE_0185"
FT                   /old_locus_tag="BCE0185"
FT   CDS_pept        192085..193833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0185"
FT                   /old_locus_tag="BCE0185"
FT                   /product="Tn7-like transposition protein D"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39121"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="InterPro:IPR032750"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F22"
FT                   /protein_id="AAS39121.1"
FT                   /translation="MLTFFPTPYPDEILYSAFARYHMRSANSSIKDTLDDLFGKKTVIS
FT                   TIDLPSHLYSLCNRISPLHSSITPEKLLEKHTLYPFYSPFLPANRAQQLKEMMMADNGQ
FT                   SIHMMKGIIAGSICTKHSLYYCPSCFTEDLKQYGEPYFHRIHQVPGVFVCSKHNVWLQP
FT                   FKKKDSFNKHEFIALPLTVTDSLKYEEISISKKTRNLLFQIAKDIEFLLEHGIGENLYE
FT                   AKTMYLSQLTRQGFVTVGKRIKQELLHEQFQLFYGEELLDLLECSIEGQHNWLMFIVRK
FT                   AKKAIHPLRHVLMMRFLFGTVQDFKLEDTYSNPFGHGPWPCLNKAVEHFGEMVINRVYI
FT                   SRCYNTKRPVGTFCCSCGFIYSRTGPGQSETDVCKIGRIKAFGSQWYEKLKEISQQNIS
FT                   YRAIARALNVDVNTVIKYLKLIEAERLQDQIEKEKNLYVRLQRTETVNEPERITKQRKI
FT                   SSAVRVDWKERDLVLSKLVEQECQRIWHNQDEKPVQITSTRIGKILGKEAWFQHYKNKL
FT                   PLTMENLNLYKETMEEFQVRRVRWVIKQLKLQNKVLRKWEIERLAGLRKNYSSLVYNEI
FT                   IKGISS"
FT   gene            193865..195466
FT                   /locus_tag="BCE_0186"
FT                   /old_locus_tag="BCE0186"
FT   CDS_pept        193865..195466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0186"
FT                   /old_locus_tag="BCE0186"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39122"
FT                   /db_xref="InterPro:IPR041419"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F21"
FT                   /protein_id="AAS39122.1"
FT                   /translation="MESLQFKKWPFQEDERIKVHWFRSPYRVENKEWVLDVILQREDRS
FT                   IKKRATIPFGSLPWLRLGQYIVNGKPLRESEGYIKNIQMLNVDEGSIKPAVQCIPKNLY
FT                   LLQYPKNYDENCWSVTYGDKLLVIPCIEIARALLAPSRFLANALIDPVGLQYLIDEVEE
FT                   HGRELILKLNDSIPKSYVTKNLINHFIWLMYNEKANDTWHHFYKSLYNPEDSLQQGNSK
FT                   VQVNMPLSGTCSLKVRCREVGNVILVLEIVEASGLYHPFKKVTVEHGGKKVIKLYEKDE
FT                   KATKNTKTSIDKKEGVLDDSLSPSLNEKVTSHVKVKSTKLKFTTKPNVEILDSDKVATK
FT                   RIGTDADNVEKTASNIVTTVQASRGGKVKPVEFESLEVEFETKDSGLEDFMNAVRHLII
FT                   NNDIKVLDIQIADLPGDLGISFITEHVRRKFMYVLLKVDDEREVLLIEMGRPDYKSIST
FT                   LVVVSKQSKNFESLHKKLVWRVIHLLIDNRGSWNREKLNQDRMYNFCFMKHTNGIAKFW
FT                   GERLGKRIKGLQENKN"
FT   gene            195719..196297
FT                   /locus_tag="BCE_0187"
FT                   /old_locus_tag="BCE0187"
FT   CDS_pept        195719..196297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0187"
FT                   /old_locus_tag="BCE0187"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39123"
FT                   /db_xref="GOA:Q73F20"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F20"
FT                   /protein_id="AAS39123.1"
FT                   /translation="MIRQKSRSVRYNIGSKKYRLCAFQLLEALFKKVFLFLLKFRQVMM
FT                   EVFIMPKISTFMYSEGAVNETVPNGQRLHIVAPLLIFTPMFIPGTLSFSVSMGIIGIDV
FT                   DKDHIFQFKFKTPVNGEAPLIDTGEINFPRVNDPSIYDLPLDMRGIMLNFGFQNVVFRN
FT                   EGTYISEVFLDGESLGEFPINVKGKEKLQ"
FT   gene            196294..196848
FT                   /locus_tag="BCE_0188"
FT                   /old_locus_tag="BCE0188"
FT   CDS_pept        196294..196848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0188"
FT                   /old_locus_tag="BCE0188"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39124"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F19"
FT                   /protein_id="AAS39124.1"
FT                   /translation="MMITDPIISYPSNSVDNSFTKFAVKFLATGTLVASWGLSNVSSVL
FT                   NYTDRSSKEMENSYEGVIKYSNGNEIQINPSVENRKISHHLINDGIDYSVTNEIADIMF
FT                   WTDTTKEAIVLKYQGPPLFEYEKTIHSKVINAGFLEPELNEDFEYATWDEVEDIKHVFK
FT                   FEKQVKSKVVHGGDFIFPSLD"
FT   gene            196865..197539
FT                   /locus_tag="BCE_0189"
FT                   /old_locus_tag="BCE0189"
FT   CDS_pept        196865..197539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0189"
FT                   /old_locus_tag="BCE0189"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39125"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F18"
FT                   /protein_id="AAS39125.1"
FT                   /translation="MENNWYEIINPTENISQGDILFNCPLFVPIYPSDDLDAADFDKIE
FT                   ERELTTNIYRANVIILNQACDLEVRDGQDSPKLKTVLVGTLQDVRKNEVGKNKLAPIAK
FT                   LEKPQLFLLEPSNGPIKMGHQIVHFDALASLPWKLLNTFGKTQGQRLRVKSPYIEQLSQ
FT                   HFGSHFGRVALPENREEELGKYFAIKNEYEEKRKKGNYTKMWKDLSEDEVLTMIEELKQ
FT                   SV"
FT   gene            complement(197709..197999)
FT                   /locus_tag="BCE_0190"
FT                   /old_locus_tag="BCE0190"
FT   CDS_pept        complement(197709..197999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0190"
FT                   /old_locus_tag="BCE0190"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39126"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F17"
FT                   /protein_id="AAS39126.1"
FT                   /translation="MSTFTIYEDGTNFINAFEATDTSSDVNQVSEEVKAHTKAVLQEHE
FT                   GKRINKISFTSKLFGFDNHDASKYTYRFYAVGVTYEDGTAKSYRVKGEYEN"
FT   gene            198554..200512
FT                   /locus_tag="BCE_0191"
FT                   /old_locus_tag="BCE0191"
FT   CDS_pept        198554..200512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0191"
FT                   /old_locus_tag="BCE0191"
FT                   /product="prolyl oligopeptidase family protein, putative"
FT                   /note="identified by match to protein family HMM PF00326"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39127"
FT                   /db_xref="GOA:Q73F16"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F16"
FT                   /protein_id="AAS39127.1"
FT                   /translation="MNVKEKTYLSIEEIISLPTLSSTNISDDGKNVAFIKRIANWEDNT
FT                   YRSHVWIYEKDKGQSYPLANENIDSTCPLWSPNSKDIAYLSPVDNGKNQIFVKLLDGYG
FT                   GVQITHEEEGISTFKWDPTGKGFYYITQSKECEEIKKRKELYGGFQHVGKEHQNNCLCY
FT                   IEIEKVIQNDKEEREINGVYQLTDGKDFYIHDFDISNDGKKVVCMATPSLNDHMNGDLY
FT                   ILDVEAEELQKMNVDRLLGGSVCFSPEGSKMCYAASIREKEYYRNHIQESTLEIYDMNT
FT                   GEVIQPLTNFDSTVMPLQWTAKGILIRWQDKTNYRIGLLAEDGTVKALSDKIDGFIMDA
FT                   SITRDGNHITYNKAITNETFEIYLDDKKITNENSFFDGKLKSNREIISWKNSDGLEIEG
FT                   ILSIPVEFDANKKYPLLVVIHGGPAWASFPIFSDCFNEKYPIEQFVEKGFIVLEPNYRG
FT                   SSGYGNEFLKANYRKQGFADYDDVISGVDALVEQGIVDKDRVGAMGWSNGGYISAFCST
FT                   FSSRFKAISVGGGITNWSTHYVNTDIPYFISMYLGNNPWNDPEIYKKTSPMTYIKSACT
FT                   PTLIQHGEKDVRIPITNAYELYEGLREMEVDTELMIFKGMAYSSDQPGMNVAIMKQNLM
FT                   WFSHYILGESMEGFRTI"
FT   gene            200616..201182
FT                   /locus_tag="BCE_0192"
FT                   /old_locus_tag="BCE0192"
FT   CDS_pept        200616..201182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0192"
FT                   /old_locus_tag="BCE0192"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39128"
FT                   /db_xref="InterPro:IPR025352"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F15"
FT                   /protein_id="AAS39128.1"
FT                   /translation="MTVNKNELSVEQREELLKALQARFEKNMNRHEGLEWAKVEAKIEA
FT                   NAEKLWSLNEMEVTGGEPDVVGYDEEKDEYIFCDCSKESPKGRRSLCYDLEALEARKKH
FT                   KPENNVIDVVTAMGIELLTEEQYRQLQQLGEFDMKSSSWVQTPSDIRELGGALFCDYRF
FT                   GHVFVYHNGADSYYAARGFRGSLRV"
FT   gene            complement(201229..201573)
FT                   /locus_tag="BCE_0193"
FT                   /old_locus_tag="BCE0193"
FT   CDS_pept        complement(201229..201573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0193"
FT                   /old_locus_tag="BCE0193"
FT                   /product="RNA polymerase sigma-70 factor, ECF subfamily"
FT                   /note="identified by match to protein family HMM PF04542"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39129"
FT                   /db_xref="GOA:Q73F14"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F14"
FT                   /protein_id="AAS39129.1"
FT                   /translation="MRKENILTSYLINLGEEVFKLLLAKGAIKEDAEDIIQNTFYKVYT
FT                   LLDSLTEDNIRPWFFRVALNEYIDLKRKKEQQNIYLTEEIYSKLQYTDRELDAVLNKDE
FT                   IFYLYIKPEK"
FT   gene            201962..202735
FT                   /locus_tag="BCE_0194"
FT                   /old_locus_tag="BCE0194"
FT   CDS_pept        201962..202735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0194"
FT                   /old_locus_tag="BCE0194"
FT                   /product="dehydrogenase/reductase BH0506"
FT                   /EC_number="1.1.1.100"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39130"
FT                   /db_xref="GOA:Q73F13"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F13"
FT                   /protein_id="AAS39130.1"
FT                   /translation="MNQLKNKIAVVTGVSRLDGIGAAICKELAEAGYDIFFTYWTAYDK
FT                   EMPWGVDQSEQIQLKEELLKNGVKVLSMELDLTQNDAPKELINKVTEQLGYPHILINNA
FT                   AYSTNNDFSNLTAEELDKHYMVNVRATTLLSSQFARGFDKKSGGRIVNMTSGQFQGPMV
FT                   GELAYATTKGAIDALTSSLSAEVAHLGITVNAINPGPTDTGWMTEEIKQGLKPMFPFGR
FT                   IGEPRDAARLIKFLVSEEAEWITGQVIHSEGGFKR"
FT   gene            complement(202773..203441)
FT                   /locus_tag="BCE_0195"
FT                   /old_locus_tag="BCE0195"
FT   CDS_pept        complement(202773..203441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0195"
FT                   /old_locus_tag="BCE0195"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39131"
FT                   /db_xref="GOA:Q73F12"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F12"
FT                   /protein_id="AAS39131.1"
FT                   /translation="MENKSFLDEWGKVIWEATIQTFQMTSISLLISILIALPLGVTLVL
FT                   TRPGGQHENKIIYPILNTIINIIRSLPFIILLFFILPFTKFLMGTSIGVQGVIVPLVVF
FT                   TAPYIARLMETALLEVDRGVIEAYQAMGVSTIKIIWHVMVKEARPSLVLGLTIATIGLI
FT                   GATAMAGLVGAGGLGDLAYRFGHLRYEPEVMYATVFILIILVQGLQSLGNGVARRLKKD
FT                   "
FT   gene            complement(203416..204456)
FT                   /locus_tag="BCE_0196"
FT                   /old_locus_tag="BCE0196"
FT   CDS_pept        complement(203416..204456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0196"
FT                   /old_locus_tag="BCE0196"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39132"
FT                   /db_xref="GOA:Q73F11"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73F11"
FT                   /protein_id="AAS39132.1"
FT                   /translation="MIELKNVSKVFTTKKGNVEALKSTSLQVKKGEVFGIIGYSGAGKS
FT                   TLIRCVNLLEKPTTGNIIVNSQDLTTLSAKELAKARQKIGMIFQGFNLLKTVTVYENIA
FT                   LPLRLAGISKVEIEKRVEKYLRIVDLFTRKDAYPSELSGGQKQRVAIARALSHEPEVLL
FT                   SDEATSALDPETTDSILDLLLKINEEIGITILLITHEMNVIQRICDRVAVMEHGAVVES
FT                   GTVKDIFTNPQHVTTKKFVNSAFAAKIPEDVQKELQTTGEIVTLSFIGNSSGEPALAVA
FT                   TKRFQVYPNILSGNITQLKHEAYGKLIIHMQGEQNEINRALSFLQEQGIIVEGGRTDHG
FT                   KQVLFG"
FT   gene            complement(204469..205281)
FT                   /locus_tag="BCE_0197"
FT                   /old_locus_tag="BCE0197"
FT   CDS_pept        complement(204469..205281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0197"
FT                   /old_locus_tag="BCE0197"
FT                   /product="ABC transporter, substrate-binding protein,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF03180"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39133"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F10"
FT                   /protein_id="AAS39133.1"
FT                   /translation="MKKVLLSIVSGAVLLLSACSGSSDKEVKALDEKKITVGVTGGPHE
FT                   QIFEKVKEVAAKDGLEIDIKVFNDYVAPNVSLDEKSLDVNSYQTKSYLDVFKAERNMKL
FT                   TEVFSTVTFPMGVYSKSLKDVKELKEGDAIAVPNDPTNELRALKLFEKAGVLKVDPKAT
FT                   EKATAKDVIENPKNLKIVELEASQLPTQLSEVKAAAINTNFALGAKLSPAKDSIFREGK
FT                   DSPYVNWVVVRTENKDDAVINKLKKAYQSKEVKEFIEKKFDGSILPSW"
FT   gene            complement(205564..206472)
FT                   /locus_tag="BCE_0198"
FT                   /old_locus_tag="BCE0198"
FT   CDS_pept        complement(205564..206472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0198"
FT                   /old_locus_tag="BCE0198"
FT                   /product="alcohol dehydrogenase, zinc-containing"
FT                   /EC_number="1.1.1.1"
FT                   /note="identified by match to protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39134"
FT                   /db_xref="GOA:Q73F09"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F09"
FT                   /protein_id="AAS39134.1"
FT                   /translation="MKAIICTQYGPPNVLQLQNIEKPTPKKNEVLVKIHATSVSTGDCR
FT                   IRGFNSPLLFWIPMRIILGFRKPRKPILGVELSGEIEEIGTAVTQFKKGDQIFALTELN
FT                   LGGYAEYTCVHESGLIALKPTNMTYEEAAVIPFGGTSALHFLRKGRIKKGQQVLIYGAS
FT                   GSVGTAAVQLAKYFGTTVTAVCSNSNFELVQSLGADKVIDYTKEDFTKGCERYDIIFDA
FT                   VGKYKKSLCTNTLTPNGKYVSVNGMMAKVSKEDMILLKKLTETEHLKPVIDRTYRLEEI
FT                   AEAHMYVEKGHKKGNVSITLK"
FT   gene            206660..208066
FT                   /locus_tag="BCE_0199"
FT                   /old_locus_tag="BCE0199"
FT   CDS_pept        206660..208066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0199"
FT                   /old_locus_tag="BCE0199"
FT                   /product="oxidoreductase, FAD-binding"
FT                   /note="identified by match to protein family HMM PF01565"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39135"
FT                   /db_xref="GOA:Q73F08"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F08"
FT                   /protein_id="AAS39135.1"
FT                   /translation="MAYTVLLVTSVNTYKEQLNHPIMSDVGKLLPTKIKRVESATDEHS
FT                   LIKLVQDANVSGEKISIAGMQHSQGGQTYYPHGTMLDMKGYNKILEFDPEKKRITVQSG
FT                   ATWNDIQKKVNPYGLAVQVMQSQNIFTVGGSLSVNVHGRDIRHEALIDTVESFRLLMAD
FT                   GTVRNVSREENADLFPYVIGGYGLFGVILDVTLKLTNDELYETHTKMLDYKEYTSYFKE
FT                   KVKKDENVRMHLARISVAPNSFFREMYVTDYTLAKNQNMREEYSKLKEETIIAAPKFLL
FT                   GLSRYSDWGKDTFWDIQRSYFERTDGKYETRNNVMRSDSAFMEYENPNRTEVLQEYFVP
FT                   IDFFTEYIDDLRNVLNEEEFNLLNITVRYVEKNENAVLSYAKDDMFALVLLINQGRSEH
FT                   EIKKTENVIQKMIDVTLKHNGSYYLPYYSYPSKEQLRRAYPRIEEFLQKKKEADPKERF
FT                   VNLFYREYTK"
FT   gene            208063..208596
FT                   /locus_tag="BCE_0200"
FT                   /old_locus_tag="BCE0200"
FT   CDS_pept        208063..208596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0200"
FT                   /old_locus_tag="BCE0200"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39136"
FT                   /db_xref="GOA:Q73F07"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F07"
FT                   /protein_id="AAS39136.1"
FT                   /translation="MTYRRFVASQSIIMMAGSMVFPFYILLLRNVGNSFSQFGWAYGLF
FT                   ALTSALVYPLIGRISDRVGDRKLLIIYAWSMAILMLCFPIATEVWHVYILQILMGILGA
FT                   VQRNTEKTSLARKVVQENAGYEIGKYHVWTSIGGAVAIIATGYLVDFFTIGTIFYIASI
FT                   LYVVSGVVLSSKKI"
FT   gene            208675..210396
FT                   /locus_tag="BCE_0201"
FT                   /old_locus_tag="BCE0201"
FT   CDS_pept        208675..210396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0201"
FT                   /old_locus_tag="BCE0201"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39137"
FT                   /db_xref="GOA:Q73F06"
FT                   /db_xref="InterPro:IPR025043"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F06"
FT                   /protein_id="AAS39137.1"
FT                   /translation="MKFLILAILTLFLIPWTRRSGSKLRAVDKKGDEKVVKGKKSSILV
FT                   IPVLFWIGIAIYEYFWLIDDRADSILTHYSVAVAILIGLVLFSQDQIGKLEGTLKGLLM
FT                   LVLLASYGYFGYLHDIVISQKKYDSVVKVEKDISEPFTENDQPFTVPPKTAENKMKKVF
FT                   GDIPKVAYFELGELTPQMVNGEALYVAPIEVSGFFKARKAETIPGYVTMSGTNPDAEAK
FT                   LHLGYKMKYVPSMFFGNNLERVVRQAEPNLIFKGKPKFEVDDKGKPYYTMTYGEFISGR
FT                   SGFEVEGVVVVDAQTGEVKRYDKGKAPKFVDGVLNHETASTLNTYFGKYIHGFWNTKFS
FT                   QTDMKIPTEWGTKEGVTPIFGKDGTLYYFTDFTSPKEGVDSALGYSLIDARTGKLYYYN
FT                   GKEVKGIMDGSAASEVVDNSFKREKWHGTMPVIYNVYGKPSWIVPVIDDGGLVRAHTVI
FT                   YASNAKIFATGSTQKEALENYKNALSGSGDSFRPTSNGKEAQKEGTVQRVYKEKSGENT
FT                   IVYVLLENEQKVFMIPVKKFPYAMFTEVGDPIQITYLDTGEAMSSVSKFTNSNLNK"
FT   gene            210515..211774
FT                   /locus_tag="BCE_0202"
FT                   /old_locus_tag="BCE0202"
FT   CDS_pept        210515..211774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0202"
FT                   /old_locus_tag="BCE0202"
FT                   /product="drug resistance transporter, Bcr/CflA family"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM TIGR00710"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39138"
FT                   /db_xref="GOA:Q73F05"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F05"
FT                   /protein_id="AAS39138.1"
FT                   /translation="MKKVNEVNQEIYKPVKMNRLWMILVLGTLTAIGPLSIDMYLPSLP
FT                   KLTDDLQTGASLAQLTLTACLLGLSVGQLFVGSISDIYGRRKPLIIALIIYVASSLLCA
FT                   VAPSIWTLVLLRFLQGASGSAGIVISRAMVRDMYSGSEMTKFFSLLMLVNGTAPILAPI
FT                   IGGQLLQFTTWRGVFIVLGAISVFMLISATFVLRETLPPEERETGGLSGTLATYGKLLK
FT                   DRLFMGYALSQGLVTAAMFAYISGSPFVLQNIYGASPQQFSLFFAINGIGIIIASQVTG
FT                   RLAGKVNEKTLFVSGIIIAAVGGLSLLLTILLGIGLIGVLCSLFLVVSSVGVVSTTGFS
FT                   LAMRNQKQAAGTASALLGLLQFISGALVAPLVGIGGSNTALPMGVVIALCEVGAVLCYL
FT                   FMARRSEKQFELQQRQNLEA"
FT   gene            212037..212540
FT                   /locus_tag="BCE_0203"
FT                   /old_locus_tag="BCE0203"
FT   CDS_pept        212037..212540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0203"
FT                   /old_locus_tag="BCE0203"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39139"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F04"
FT                   /protein_id="AAS39139.1"
FT                   /translation="MKKVLGIAVMGSMLLLAGCNGNKDTKEPKEKVEQSTEQTEEMKEY
FT                   RAVHEKYDLKMNKEINKALQLFEVAKEKGGKEITNAAYKEDVQEVTTSMLEDIDHIRKE
FT                   IRVPKSKEQEHEVYVGFLNESEQAMKKLQKLAKEEDSSLIRDIEINFATASTYYKRFQA
FT                   ETKK"
FT   gene            complement(212557..212820)
FT                   /locus_tag="BCE_0204"
FT                   /old_locus_tag="BCE0204"
FT   CDS_pept        complement(212557..212820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0204"
FT                   /old_locus_tag="BCE0204"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39140"
FT                   /db_xref="GOA:Q73F03"
FT                   /db_xref="InterPro:IPR025028"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F03"
FT                   /protein_id="AAS39140.1"
FT                   /translation="MSYFAYNKKRYERSYKMDPLLLATIGLPLTIVILVIIGFYKLFIK
FT                   KKSITSFYTPFDNITGQTISEFHEEQKVLVSEDEDGDGKRKK"
FT   gene            213182..214099
FT                   /locus_tag="BCE_0205"
FT                   /old_locus_tag="BCE0205"
FT   CDS_pept        213182..214099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0205"
FT                   /old_locus_tag="BCE0205"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39141"
FT                   /db_xref="GOA:Q73F02"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F02"
FT                   /protein_id="AAS39141.1"
FT                   /translation="MYVIKKLSVMVFTLWVITTVTFLIMHIIPGDPFSSDAKIFPEEVI
FT                   QNMRAKYHLDEPLWNQYVAYLDGVVHFDFGESVQSTGQGVSEIITTGFGPSAIIGLQAL
FT                   IISLLVGIAAGTFAALYHGKVIDYGVSLLAILGISIPSFILAPLFIQVFAIQFELLPVA
FT                   SWGTFEHTVLPSFALALGPIAVITRFVRSNMIEVLQSDYIKLARAKGIPIKKIIIRHAL
FT                   RNAIVPVLTFVGPLMAGLLTGTFVIEKIFSIPGLGKYFVDSIFNRDYPVIMGTTIFYSA
FT                   LLIVCIFITDIIHRIVDPRIRSIT"
FT   gene            214116..215120
FT                   /locus_tag="BCE_0206"
FT                   /old_locus_tag="BCE0206"
FT   CDS_pept        214116..215120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0206"
FT                   /old_locus_tag="BCE0206"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39142"
FT                   /db_xref="GOA:Q73F01"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F01"
FT                   /protein_id="AAS39142.1"
FT                   /translation="MGAYEINDQLLTNEEKKELTINKDQQKISRKKEVFRKFISNPIAV
FT                   LGTVTLLLIIIFSLIGESLTSFTASEQVKEATNLPPSSEHWFGTDDLGRDIWARTWAGG
FT                   KISLTVGLVAAALDIGLGVLIGGFSGYVRGRNRLGTLIDEWIIRGIEVLYGIPYLLIVI
FT                   LLLIVMKPGLFTIIIALALTGWIGMARLVRAQVLSLKQREFVIAAERLGTSHMKIIYGH
FT                   LIPNLTGIIIVNLSFTIPAAIFSESFLSFIGLGVQSPAASWGTMTNDALGTLLSGEWWQ
FT                   LFFPAIMIALIMFAFNAIGDGLQDAIDPKIVKQNRKEKKHGTALIFRKRNVSR"
FT   gene            215077..216087
FT                   /locus_tag="BCE_0207"
FT                   /old_locus_tag="BCE0207"
FT   CDS_pept        215077..216087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0207"
FT                   /old_locus_tag="BCE0207"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR01727"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39143"
FT                   /db_xref="GOA:Q73F00"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F00"
FT                   /protein_id="AAS39143.1"
FT                   /translation="MGQLLSLENVTLAVEKENSKQAIVKHVSFSISEGEIVALVGESGS
FT                   GKSVTAQSIIGLNQESIHIDDGNISFESEELTNLQESEWNQIRGKDISFIFQDPLSSLN
FT                   PTMKVGRQITEVILQHEKKSKKEAKEIAINLLNDLGIHEAEKRFEQYPHQLSGGMRQRI
FT                   CLAIAFACHPKLVIADEPTTALDVTIQKQIMELLKERKEKQNTSILLITHDLALVREVA
FT                   DRVVVMYGGRVVEKGTIEEVIGSPKHPYTKSLLQAIPNMDDSEKVLRAIEGTTPSIETL
FT                   NSFGCPFVNRCPVAIKECIHRFPERTTYSKEHSSHCWQHVLEHNKAKSKEKVNAS"
FT   gene            216084..216857
FT                   /locus_tag="BCE_0208"
FT                   /old_locus_tag="BCE0208"
FT   CDS_pept        216084..216857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0208"
FT                   /old_locus_tag="BCE0208"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39144"
FT                   /db_xref="GOA:Q73EZ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EZ9"
FT                   /protein_id="AAS39144.1"
FT                   /translation="MTTDLITVKQVTKTYGSKNKEIAALKDISLSIPKGTTLGIIGESG
FT                   SGKTTLGKLIAGIESPTSGEIDYNGQVVHKLKAAHKRDFLQKVQFIFQDSTAALNPRWK
FT                   VRDSVTEGYISFGLGDKGLKDKVAGDALERVGLDRRYIDRYPHEFSGGQRQRIAIARAL
FT                   LCEPEVLILDEPISALDVSLQIQIVHLLQKIQKEQGYTYLFIAHDLPMVHYLCEKVAVL
FT                   YKGELVEFGNTDEVFRNPQHSYTKTLLASTPKISG"
FT   gene            216871..218481
FT                   /locus_tag="BCE_0209"
FT                   /old_locus_tag="BCE0209"
FT   CDS_pept        216871..218481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0209"
FT                   /old_locus_tag="BCE0209"
FT                   /product="oligopeptide ABC transporter,
FT                   oligopeptide-binding protein"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39145"
FT                   /db_xref="GOA:Q73EZ8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EZ8"
FT                   /protein_id="AAS39145.1"
FT                   /translation="MKKFLLFVIMTVLAITSVACGKKETQKASAGKGEGDRLVTNIGSD
FT                   PYTLDSAIATDSTSGYVIGHLFSSLYTQDSDGKYQNELAEKEEVNADGTEYTIHLKKDI
FT                   KWSDGSPITANDFEFAWKRLLNPKTGSMNATEMYFIKGAEAYNTGKGEEGQVGIQVIDP
FT                   QTLKVTLEHPVSSIKQKLASSLFIPLSKKSIDDNNKLKTDPKELITNGPFTLKEWKHNQ
FT                   AITVQKNKEYYDKKVTLKEIEFRIIPDSKTAYQLYKSKELDLLSGLPQEMIEKEKGNKE
FT                   YKRVAGFSSYIYSFNVEKEPFTNAKVRKAFSLAVDRKFIVEKLYKNNAQEANAFVPEGA
FT                   KTQSGRDFRKEKGGYVKFDPAEAKKLLEEGMKEQGWSTLPEVTLKFTTDTQHKKVAEAM
FT                   QEMFKKNLGVDIKLENKEWKSYIDTYKQSDFQLAYMGWGGSLLDPITKLDLYAGDGPNN
FT                   YAKWHNKEFDALVKEAEVEQNEDKRFDLLHKAEDIMFTDSPLIPIIFPSDSYLQKQTVS
FT                   GLQYYVGSKPDLRYAKIKK"
FT   gene            complement(218503..218970)
FT                   /locus_tag="BCE_0210"
FT                   /old_locus_tag="BCE0210"
FT   CDS_pept        complement(218503..218970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0210"
FT                   /old_locus_tag="BCE0210"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39146"
FT                   /db_xref="InterPro:IPR025623"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EZ7"
FT                   /protein_id="AAS39146.1"
FT                   /translation="MRTLLSVLLALMLVPALTGCKAPAKEDTTSNKKTTEEAKNEAPAD
FT                   LKLNFNEFDLKADYQDTKKDYEADYKNVAADKKMEAKIEDHKADVKLTGDEAITKLSPL
FT                   LQELKFDKDTADQEVIDQVVNVFKLDKDYQKFDLEVVFSDGTKKEYKREIK"
FT   gene            219144..219416
FT                   /locus_tag="BCE_0211"
FT                   /old_locus_tag="BCE0211"
FT   CDS_pept        219144..219416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0211"
FT                   /old_locus_tag="BCE0211"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39147"
FT                   /db_xref="GOA:Q73EZ6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EZ6"
FT                   /protein_id="AAS39147.1"
FT                   /translation="MHEEYKEIIKKSIEYIENHLHEELTTERVASYSAVSMYHFHRIFQ
FT                   SYIGMSVTDYIRKRRLTHAAQALVSTERAVIEIWFFLTRGTYESF"
FT   gene            219524..220105
FT                   /locus_tag="BCE_0212"
FT                   /old_locus_tag="BCE0212"
FT   CDS_pept        219524..220105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0212"
FT                   /old_locus_tag="BCE0212"
FT                   /product="transcription regulator (TetR/AcrR family)
FT                   BH1965"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39148"
FT                   /db_xref="GOA:Q73EZ5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EZ5"
FT                   /protein_id="AAS39148.1"
FT                   /translation="MARSKTAEKIIQAAIELVKEKGYTAATTKEIAMRAGVNEVTIFRN
FT                   FKSKKGVIEAAVAEFSYVPHLKKFLQTEIVWELETDLKNLARHYHNFLDGVKDIIAIGI
FT                   REAGEFPELDGEIAKIPQGLKEELSIYFAKMREKGNIIDTNIEAQVMNFIWINFGYFLS
FT                   KLRFADRLTEVDDEKFIENNIVLYARALRP"
FT   gene            220163..221302
FT                   /locus_tag="BCE_0213"
FT                   /old_locus_tag="BCE0213"
FT   CDS_pept        220163..221302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0213"
FT                   /old_locus_tag="BCE0213"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39149"
FT                   /db_xref="GOA:Q73EZ4"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EZ4"
FT                   /protein_id="AAS39149.1"
FT                   /translation="MDTLKQFLKRPGTYVGMVVALSFQLIFFCVWLTAYDGVNERADQM
FT                   RIAIVNEDVNIGNKIAEGLQRNLPFQVKAERSVEKANKEMNDHVYDMIIEIPASFSKDI
FT                   NETGKSNLNFHINQANAMMAKQMMEGAAKQIRDNVNKEVASYKKQAIVGKLQAVGPENV
FT                   EVIKGLTEDSIGFTVHKVNDAKGFSVNMVPLMIVLASFVGAMIMSMELSKVAKEVKGGW
FT                   INFLSRQIINGTVSILLACITIGLMKGFQIEMHETVGSIWGFQAIVFFAFLSLTQMFLT
FT                   VFGNAGMIFNIISLSLQLVSSGVIVPHEMLSKTYQTIGELFPATYAANGYYTIIFGGVS
FT                   LERNIISLLVIVLVTQSVAVMTLAIKGMVKGKSSVVKEA"
FT   gene            complement(221347..222987)
FT                   /locus_tag="BCE_0214"
FT                   /old_locus_tag="BCE0214"
FT   CDS_pept        complement(221347..222987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0214"
FT                   /old_locus_tag="BCE0214"
FT                   /product="oligopeptide ABC transporter,
FT                   oligopeptide-binding protein, putative"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39150"
FT                   /db_xref="GOA:Q73EZ3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EZ3"
FT                   /protein_id="AAS39150.1"
FT                   /translation="MNKKVVPVVASVLGASLLLTACGGNKDHASGAKANDKAPDKQAIN
FT                   LSFASEIPTMDVAKATDGESMSVMRNVFEGLYAMGEDNKPIPGVAESVDVSPDKTKYTF
FT                   HLRDSKWSNGTPVTAKDFVFAWQRAVNPDTAAEYAFLFFDIQNAKQINQKQLPVDQLGI
FT                   KAVDDKTLEVQLDRPVPYFLSLTTFSTFLPINEEYLKSQGDKYGLETNHLIYNGAFTLD
FT                   NWKHEQSFQLKKNPNYWDAKTVKLEEINFNVVKDKSTEINLYDSGQIDRVALDAEFVDK
FT                   YKGDPNFKERAEVGIQFLRLNQKNETLKNQHARLAINGAMNKKAYVETILNNGAVPAEG
FT                   MVPAKFAKSPEGNDFRKENGNLVKDDVKTAKENWKKAKQELGTDKVTIELLTSDNALAK
FT                   KTGEYLKGELEKNLDGLTVNLKPQPRKQQLKLLLSGDYEIGIDGWGPDFADPITFLDLF
FT                   TTDSAYNFDKYSNKEYDELIHKVKTDLAGDEKARWEAMKQAEKILLQDGAVAPLYQQGR
FT                   SYLQRGFIKGLVTTDFGGEFNYKWTEVAK"
FT   gene            complement(223374..225014)
FT                   /locus_tag="BCE_0215"
FT                   /old_locus_tag="BCE0215"
FT   CDS_pept        complement(223374..225014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0215"
FT                   /old_locus_tag="BCE0215"
FT                   /product="oligopeptide ABC transporter,
FT                   oligopeptide-binding protein, putative"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39151"
FT                   /db_xref="GOA:Q73EZ2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EZ2"
FT                   /protein_id="AAS39151.1"
FT                   /translation="MKKKFVPGIASVVGVSILLTGCGSYKNEASGANAKDEAPSKQVLN
FT                   LSSPTEIRTMDTARATDTDSGQVMRNVFEGLYNLGEGNKPVPGVAKSHEVSGDKTKYTF
FT                   HLRDSKWSNGTPVTAKDFVFAWQRAVDPATASEYAFLFFDIKNATKINNKELPADQLGV
FT                   KAVDDHTFEVELERPVPYFISLTAFPTFLPINEEFFKKQGDKYALEDNTILYNGAFTLS
FT                   DWKHEQSFKFKKNPTYWDKDTVKLEEINFNVVKEKSTEVNLFESKQLDRIKLTSDFVDK
FT                   YKKDANFKERPNVGVQFLRMNQQNKVLQNVSARQAIDQTIDRKSFVNTLLNDGSTPTFG
FT                   LVPKNFAKGPDGKDFRTLNGDLTKVDTKSAQELWKKAKQELGSEKITLELLTSDADLDK
FT                   KTGEFLKGQLEKNLDGLTVNVKPQPRKQQVSLLLKGDYEIGIDGWSPDFADPITFLELF
FT                   TTNNPYNLDHYSNKEFDETIEKVKTTLAGDEKARWEALLASEKILFKDSVIAPLYQKGE
FT                   SYLERSYVKGIVQVDFAGQLNFKWAQIEK"
FT   gene            complement(225406..226239)
FT                   /locus_tag="BCE_0216"
FT                   /old_locus_tag="BCE0216"
FT   CDS_pept        complement(225406..226239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0216"
FT                   /old_locus_tag="BCE0216"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39152"
FT                   /db_xref="GOA:Q73EZ1"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EZ1"
FT                   /protein_id="AAS39152.1"
FT                   /translation="MSLTSLKDYTTLHNGVKMPWFGLGVFKVEDGSEVIESVKAAIKNG
FT                   YRSIDTAAIYQNEEGVGQAIRESGVSREELFITSKVWNSDQGYETTLQAFETTLEKLGL
FT                   EYLDLYLVHWPVKGKYTESWKALEKLYKDGRVRAIGVSNFHIHHLQDVFEIAEIKPMVN
FT                   QVEYHPRLAQEELHAFCKEHNIQLEAWSPLMQGQLLDNPTLQEIATKYNKSTAQIILRW
FT                   DLQNEVVTIPKSIKEHRIIENANIFDFELSADDMKAIQALNEDRRVGPDPDNFNF"
FT   gene            complement(226241..227044)
FT                   /locus_tag="BCE_0217"
FT                   /old_locus_tag="BCE0217"
FT   CDS_pept        complement(226241..227044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0217"
FT                   /old_locus_tag="BCE0217"
FT                   /product="pyrroline-5-carboxylate reductase, putative"
FT                   /note="identified by match to protein family HMM PF01089;
FT                   match to protein family HMM TIGR00112"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39153"
FT                   /db_xref="GOA:Q73EZ0"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EZ0"
FT                   /protein_id="AAS39153.1"
FT                   /translation="MLTKHRILFIGAGRMAEAIFSGLLKTSKEYIEEIIVSNRSNVEKL
FT                   EQLQARYNVSTTTDWKQHVTSVDTIVLAMPPSAHEGLLAELSPLLSHQLVVTVAAGIGP
FT                   SYLEERLPKGTPVAWIMPNTAAEIGKSISLYTMGQSVTEIHQETLQLLLRGIGTSQLCT
FT                   EEEVHQLTAVTGSAPAFLYYFAESLIEATKSYGVDEATAKHLVIQMISGSASMLEQTQD
FT                   PANLREQVTTPGGSTAEGLKALYEYNFSEAIQKAVEATNKKARGK"
FT   gene            227144..227239
FT                   /locus_tag="BCE_0218"
FT                   /old_locus_tag="BCE0218"
FT   CDS_pept        227144..227239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0218"
FT                   /old_locus_tag="BCE0218"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39154"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EY9"
FT                   /protein_id="AAS39154.1"
FT                   /translation="MKSRKLMVKGRVISYTGDREFITHLGRDDYD"
FT   gene            227232..227882
FT                   /locus_tag="BCE_0219"
FT                   /old_locus_tag="BCE0219"
FT   CDS_pept        227232..227882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0219"
FT                   /old_locus_tag="BCE0219"
FT                   /product="nucleoside transporter, PnuC family"
FT                   /note="identified by match to protein family HMM PF04973;
FT                   match to protein family HMM TIGR01528"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39155"
FT                   /db_xref="GOA:Q73EY8"
FT                   /db_xref="InterPro:IPR006419"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EY8"
FT                   /protein_id="AAS39155.1"
FT                   /translation="MIRSPLFLVVSSIICVLVGFYIQSSYIEIFASVMGIINVWLLARE
FT                   KVSNFLFGMITVAVFIYIFITQGLYAMAVLAAFQFIFNVYGWYYWIARSGEEEVKATVR
FT                   LDLKGWIFYIVFILAAWIGWGYYQVHYLESTSPYLDALNAVLGLVAQFMLSRKILENWH
FT                   LWILYNVVSISIYISAGLYVMLILAVINLFICVAGLLEWKNNYKRQGHVNNYI"
FT   gene            complement(227950..228801)
FT                   /locus_tag="BCE_0220"
FT                   /old_locus_tag="BCE0220"
FT   CDS_pept        complement(227950..228801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0220"
FT                   /old_locus_tag="BCE0220"
FT                   /product="glucose uptake protein"
FT                   /note="identified by similarity to GP:2226001"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39156"
FT                   /db_xref="GOA:P61403"
FT                   /db_xref="InterPro:IPR010651"
FT                   /db_xref="UniProtKB/Swiss-Prot:P61403"
FT                   /protein_id="AAS39156.1"
FT                   /translation="MDILLALLPAIAWGNILLVSVKMGGGAYSQTVGMTIGALFFATIM
FT                   YVFTQPALTMTILIVGFISGLFWALGQVNQLKTVEKLGVSTTVTISTGMQLVATSIFGV
FT                   IAFREWTTTTTIILGTIAILLIVVGVVFTSLDDKENAQPPGQLKKGLLTLIVSTFGYLV
FT                   YVIIIRWYNIDGWSAILPQAVGMFVGAVVLTSKHKPFNKYAIRNALSGLLWGTGNLFLL
FT                   LSLPRVGVATSFPLSQTGIVISTFGAIVFLGEKKTKRQLIFIALGSVLIIGGAVLLGMT
FT                   KA"
FT   gene            complement(229103..229777)
FT                   /locus_tag="BCE_0221"
FT                   /old_locus_tag="BCE0221"
FT   CDS_pept        complement(229103..229777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0221"
FT                   /old_locus_tag="BCE0221"
FT                   /product="molybdenum ABC transporter, permease protein,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39157"
FT                   /db_xref="GOA:Q73EY7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EY7"
FT                   /protein_id="AAS39157.1"
FT                   /translation="MSFDTILSPIFLSLRVATCATIIVTILGTIIGRALARSSWRYKVI
FT                   LETIFLLPMVLPPTVIGFFLIIIFGNNSPIGMWIESIFQQSIMFTSTAAIIASTVVAFP
FT                   LMYQSAKTGFSIANVQIEESARDLGASEYQVFLHVTLPLAFPALLSGMILSFVRALGEF
FT                   GATLMFAGNIPGKTQTIPTAIYMAIDASNMQLAWTLVVITISMSLLFLLCIQLINKRIT
FT                   NS"
FT   gene            complement(229783..230589)
FT                   /locus_tag="BCE_0222"
FT                   /old_locus_tag="BCE0222"
FT   CDS_pept        complement(229783..230589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0222"
FT                   /old_locus_tag="BCE0222"
FT                   /product="molybdenum ABC transporter, molybdate-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01547;
FT                   match to protein family HMM TIGR01256"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39158"
FT                   /db_xref="GOA:Q73EY6"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="InterPro:IPR041879"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EY6"
FT                   /protein_id="AAS39158.1"
FT                   /translation="MNKFTLRSIGTLIFSFLLIFSVACTNGDKKEKSTAKEGKTVELTI
FT                   SAAASLQDALKEIETKYKEKEPNIKLSFNFGASGALQQQIEQGAPADLFFSAAEDKFQT
FT                   LVKKGFINEKEGKNLLGNELVLVIPKDSSLTKFQDLKDEKIKKIALGTPESVPAGKYAK
FT                   ASLTHENLWNDVQNKFVFTKDVRQVLTYVETGNVDAGIVYKTDALISEKVKIGETAAAT
FT                   SHEPIHYPLGVIKESKHKKEATSFYEYLQSKDAQSIFKKYGFTVLS"
FT   gene            230724..231671
FT                   /locus_tag="BCE_0223"
FT                   /old_locus_tag="BCE0223"
FT   CDS_pept        230724..231671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0223"
FT                   /old_locus_tag="BCE0223"
FT                   /product="molybdopterin biosynthesis protein, putative"
FT                   /note="identified by match to protein family HMM TIGR01764"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39159"
FT                   /db_xref="GOA:Q73EY5"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EY5"
FT                   /protein_id="AAS39159.1"
FT                   /translation="MKEESEESSMDHHSYTTEEVAKRLKVSKLTVYDLIKKGELPSYRI
FT                   GRQMRIDAADLEQYIKQMKTGNVQVTPVKNNSNSISNTCIISGQELTLDMLAKRIENRL
FT                   PSSNILRAYQGSLTSLVKMYQGEGSIVSLHLFDGETGTYNVPYVKRILVGQPCTMINLL
FT                   ARNVGFYVQKGNPKNIKTWADLSQSSIRFVNREKGSGIRVLVDEQLRIQKLNKERISGY
FT                   EWEESNHLGVATQVANGKADVGVGSEKFSQIVNVDFIPIMKEQYDLVILKNKENEELIE
FT                   VVKDILQSEEFHNELKAIGGYDMTKTGQIIYEIK"
FT   gene            complement(231886..231987)
FT                   /locus_tag="BCE_0224"
FT                   /old_locus_tag="BCE0224"
FT   CDS_pept        complement(231886..231987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0224"
FT                   /old_locus_tag="BCE0224"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39160"
FT                   /db_xref="GOA:Q73EY4"
FT                   /db_xref="InterPro:IPR025034"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EY4"
FT                   /protein_id="AAS39160.1"
FT                   /translation="MNNITFNKSDFFGLASGATLLTAFIYSLAQSLV"
FT   gene            231914..232186
FT                   /locus_tag="BCE_0225"
FT                   /old_locus_tag="BCE0225"
FT   CDS_pept        231914..232186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0225"
FT                   /old_locus_tag="BCE0225"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39161"
FT                   /db_xref="GOA:Q73EY3"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EY3"
FT                   /protein_id="AAS39161.1"
FT                   /translation="MKAVRRVAPLASPKKSDLLKVMLFIIISPYLFNVVATAFASTSAD
FT                   STMPIVFKNLFDFILFIMRIRSFSNCCCPALCLNYRKYDRLQLSN"
FT   gene            complement(232243..233109)
FT                   /locus_tag="BCE_0226"
FT                   /old_locus_tag="BCE0226"
FT   CDS_pept        complement(232243..233109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0226"
FT                   /old_locus_tag="BCE0226"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39162"
FT                   /db_xref="GOA:Q73EY2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73EY2"
FT                   /protein_id="AAS39162.1"
FT                   /translation="MELRDLQIFQSVADQGSVSSAAKELNYVQSNVTARIKQLENELKT
FT                   PLFYRHKRGMTLTAEGRKMLVYVNKILQDVDELKQVFLDSETPSGILKIGTVETVSTLP
FT                   TILSSYYKSYPNVDLSLQAGLTEELIREVLDHQLDGAFISGPIKHPLIEQYDVSTEKLM
FT                   LVTQNKAFHIEEFTTTPLLVFNQGCGYRSKLERWLKDEGLLPKRIMEFNILETILNSVA
FT                   LGLGITLVPQSAVHHLSKAGKVHCHAIPEKYGSISTVFIRRKDSYMTNSMRSFLKTIEE
FT                   HHHINML"
FT   gene            233234..234205
FT                   /locus_tag="BCE_0227"
FT                   /old_locus_tag="BCE0227"
FT   CDS_pept        233234..234205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0227"
FT                   /old_locus_tag="BCE0227"
FT                   /product="transporter, EamA family"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39163"
FT                   /db_xref="GOA:Q73EY1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EY1"
FT                   /protein_id="AAS39163.1"
FT                   /translation="MVRKGQMIIGAFACLIASMSWGAMFPVADHALEYIDPFYFSLIRY
FT                   GAVAIMLIVLLLMKEGKQAFRLEGRGRLLVFFGTMAFTVYNVLIFLGQMLMGKSGVMVA
FT                   SIMEALMPMISICILWGYKRVKPKKYMITSMIIAFIGAVFVITKGDVSFFLTLKDNMFS
FT                   LACIFVGVVGWVIYTMGGQTCSDWSTLRYSTLTCVFGTTVTGIITVLITSLGYVSVPSM
FT                   GTISVVKYDLLFMMTLPGIVALLAWNYGVKILSSINGILFINFVPITTLVIMMMQGYQI
FT                   TMFDIVGTLFVIAALIRNNVCQRKEENINKKMLQEEQLRQAV"
FT   gene            234227..234367
FT                   /locus_tag="BCE_0228"
FT                   /old_locus_tag="BCE0228"
FT   CDS_pept        234227..234367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0228"
FT                   /old_locus_tag="BCE0228"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39164"
FT                   /db_xref="InterPro:IPR025417"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EY0"
FT                   /protein_id="AAS39164.1"
FT                   /translation="MLESLLFFFAVGVACELAAINRNGRKKIKQQAEMIQLLKELKEKN
FT                   I"
FT   gene            complement(234536..234637)
FT                   /locus_tag="BCE_0229"
FT                   /old_locus_tag="BCE0229"
FT   CDS_pept        complement(234536..234637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0229"
FT                   /old_locus_tag="BCE0229"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39165"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EX9"
FT                   /protein_id="AAS39165.1"
FT                   /translation="MMNKMKTNNLLNTMGMVFSALIDAKAVASTLNK"
FT   gene            234860..235465
FT                   /locus_tag="BCE_0230"
FT                   /old_locus_tag="BCE0230"
FT   CDS_pept        234860..235465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0230"
FT                   /old_locus_tag="BCE0230"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF01553;
FT                   match to protein family HMM TIGR00530"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39166"
FT                   /db_xref="GOA:Q73EX8"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EX8"
FT                   /protein_id="AAS39166.1"
FT                   /translation="MYKPITFLLKYIFKTAGKVEVQGREKLPEGGPYVVACTHTSFMDV
FT                   LMLATGMYPTEIHYMAKKELFEGKFKNWFFKNVNAFPVDRANPGPSTLKIPSRLLKEGK
FT                   VVGIFPSGTRSTEDVSLKAGAVTIAMRSNVPLIPAAYIGPSSVKELIKGKRAQLIFGDP
FT                   IQIDAEEQIDRKTAMKMMTDQLNERFEELKEALQSNQK"
FT   gene            235601..235792
FT                   /locus_tag="BCE_0231"
FT                   /old_locus_tag="BCE0231"
FT   CDS_pept        235601..235792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0231"
FT                   /old_locus_tag="BCE0231"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39167"
FT                   /db_xref="GOA:Q73EX7"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EX7"
FT                   /protein_id="AAS39167.1"
FT                   /translation="MLKVMLFIVYSPYLFNVEATAFASIRAENTMPIVFKRLFVFILFI
FT                   ILIRSFSNNGCPVSDLIV"
FT   gene            235929..236906
FT                   /locus_tag="BCE_0232"
FT                   /old_locus_tag="BCE0232"
FT   CDS_pept        235929..236906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0232"
FT                   /old_locus_tag="BCE0232"
FT                   /product="sugar-binding transcriptional regulator, LacI
FT                   family"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39168"
FT                   /db_xref="GOA:Q73EX6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EX6"
FT                   /protein_id="AAS39168.1"
FT                   /translation="MANIKDIAKMAGVSVTTVSRVLNDHPYVSEEKRRVVLEIVEKLNY
FT                   SQNANAVHLSKGKTNIVGVILPYINHPSFDAMVGGMMEGALTHNYRVLLCQTNYNKKEE
FT                   MKSLHMLKTKQLDGLIICSRANDWEMIEPYASYGTIIACEDNDISNISSVYTNHSAAFQ
FT                   LGMNHLIEKGYKKIGYCTGRKLGPSSQKRFDVYKRQLQSIDEEVNEEWIFTECFTLEDG
FT                   VRVAHKLKKMQHLPEALIVAGDEVAIGVMTEVGKLGIQVPENLAIIGLDNQPISQVLQL
FT                   TTIDQNLKGIGKAAFEMFYRQISDESSKQEKVEIPYELVERSTV"
FT   gene            237055..237384
FT                   /locus_tag="BCE_0233"
FT                   /old_locus_tag="BCE0233"
FT   CDS_pept        237055..237384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0233"
FT                   /old_locus_tag="BCE0233"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39169"
FT                   /db_xref="InterPro:IPR039519"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EX5"
FT                   /protein_id="AAS39169.1"
FT                   /translation="MNELLLNIKKFLGNDENVLAFVVGVFEKEHFTLCYQHGIFVATTR
FT                   RLLFYGKFPYYPSTFKEYSYLHIDSIVFRPYFEFICNHEIIRAKYIQKGNVEQFVRIVR
FT                   ANVNN"
FT   gene            237503..238339
FT                   /locus_tag="BCE_0234"
FT                   /old_locus_tag="BCE0234"
FT   CDS_pept        237503..238339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0234"
FT                   /old_locus_tag="BCE0234"
FT                   /product="yitT family protein"
FT                   /note="identified by match to protein family HMM PF02588"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39170"
FT                   /db_xref="GOA:Q73EX4"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EX4"
FT                   /protein_id="AAS39170.1"
FT                   /translation="MVNQRIKEITLITIGSLLFAIGINYFAIPNRLSEGGIIGLTVVTY
FT                   YLFDWSPGIVNFAINAILLAVGYKFFDKKTMVYTILGIVETSLFLYVTEHIEYHVNSDT
FT                   LLAALFAGVFVGIGLGCMFKAGGTSGGSAILARLANQYLGWSVGKGVLIIDIVVIAGSV
FT                   FIIGQEKAMYTLVAVFIGAKVIDFIVEGMDTKTAVTIISNQPELIREAITKNMTRGVTV
FT                   LEGRGGYTGKNKEVLYVVINKQELVKLKQVISRVDDDAFVVIHDVRDVLGGGFKAS"
FT   gene            238479..238835
FT                   /locus_tag="BCE_0235"
FT                   /old_locus_tag="BCE0235"
FT   CDS_pept        238479..238835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0235"
FT                   /old_locus_tag="BCE0235"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR01655"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39171"
FT                   /db_xref="InterPro:IPR006542"
FT                   /db_xref="InterPro:IPR036166"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EX3"
FT                   /protein_id="AAS39171.1"
FT                   /translation="MKKKMITTIIAMIVIVIMLLPTKLGPVIDKYNPFYKTKEYYTVVN
FT                   TIGQHIGDEWYEYEFIAFDERGREQKIKKTVKHMLKRDETLKVYAKGRYGESIEEIEAV
FT                   NIPINAKSKLLAMR"
FT   gene            239409..239522
FT                   /locus_tag="BCE_0236"
FT                   /old_locus_tag="BCE0236"
FT   CDS_pept        239409..239522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0236"
FT                   /old_locus_tag="BCE0236"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39172"
FT                   /db_xref="GOA:Q73EX2"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EX2"
FT                   /protein_id="AAS39172.1"
FT                   /translation="MRKEEVVKFPIKDFCSYFTVAVVCIGLFDIITNLIVK"
FT   gene            239581..240378
FT                   /locus_tag="BCE_0237"
FT                   /old_locus_tag="BCE0237"
FT   CDS_pept        239581..240378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0237"
FT                   /old_locus_tag="BCE0237"
FT                   /product="deoxyribonuclease, TatD family, putative"
FT                   /note="identified by match to protein family HMM PF01026"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39173"
FT                   /db_xref="GOA:Q73EX1"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EX1"
FT                   /protein_id="AAS39173.1"
FT                   /translation="MKWIDSHIHVDQYKDEEKSKLLKDVEHSKEIKGLIAVSMNYQSSK
FT                   ETVSLAKRYPFVHPAIGFHPEQPIHKEECEKIYKLIEEHVEDIVAIGEVGLPYYLRKED
FT                   KRIAVNSYISVLQRFVELASKYDLPIILHAVYEDADIVCDLLEKYKVSRAHFHWFKGSE
FT                   TTMKRMMRNGYYISITPDVLHKEKIRKIVSYYPLEYMMVETDGPWEFQDDVMTHPGMIR
FT                   EVLKEISVIKNMSVDKVMKTIYENTIQFYPTLTGNKTPTSKFD"
FT   gene            240580..242085
FT                   /locus_tag="BCE_0238"
FT                   /old_locus_tag="BCE0238"
FT   CDS_pept        240580..242085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0238"
FT                   /old_locus_tag="BCE0238"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39174"
FT                   /db_xref="InterPro:IPR031841"
FT                   /db_xref="InterPro:IPR032485"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EX0"
FT                   /protein_id="AAS39174.1"
FT                   /translation="MGRAYKKIAITMMIGTLSFAAFGCEAEKKAINSNVTQENKEEQID
FT                   PVVEKQMKENEKNGNTVGNSSNKGKMAESDGWVYYAVNGNENTGGIYRTKDQFQTSERV
FT                   VEGVNASYINIKNKVLYFIHTDEDKNAGLSSLMKYDISNKKLDTLKADTNYVYIKDQTL
FT                   FYPKKYSEHGGFDIVGIVKMDLKTGQEEEAAFKNSGWSQTIDDSILHWNKNRGTQVTKD
FT                   NKTWSKENYATISSATYDNEKLYAVVDFSLPFETNEAEHGIYEIDVQQNNEKLLVKDAL
FT                   QMNVKGDTFYYIKKDGVYKKRMNGGNEKVIYNKAVEPTKSYLYFVAGDMYLYTDNGTIM
FT                   NLDTKKSNEVKDKKLADDVMLQKVWNAQKELTNVQMAALTGNPKRVGDLSYGELVTPIY
FT                   NTKDNLETTLSTYFSKSFIAEYMKSKYMKELNGKMYYAIGDPGSKAATKFTKIISAELK
FT                   DGKIKAQVETYNDYDNVTEKVEVEFIYENNQWVINNMPRFGLS"
FT   gene            complement(242120..243769)
FT                   /locus_tag="BCE_0239"
FT                   /old_locus_tag="BCE0239"
FT   CDS_pept        complement(242120..243769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0239"
FT                   /old_locus_tag="BCE0239"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39175"
FT                   /db_xref="GOA:Q73EW9"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR018763"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EW9"
FT                   /protein_id="AAS39175.1"
FT                   /translation="MKKCIILLFSILLLIPIHTFAQTSSKPKVLVLYSTKEDKITNNIQ
FT                   ILNTQLGHFTNDITTKSLNKAHEITNSSSYTHIVYIGEQKEEFPTEAKQLIENFSGPVL
FT                   VLGQNVEQLSNRFSFITLKDNDIRTNKIEYPSNKLKNTLEEERLIQSFDTNGTILANAL
FT                   SSNNKNPLIVQHETSYYVATPNLFDWISHYVGEMLFSYFGQKPTTNKVEAYLRLEDVHP
FT                   AADINQLKEIAELLKEKKIPYMMTVIPVYKDPDTGKTVHLKDKPELVDLLRSMQDDGAA
FT                   IIMHGYTHQFYDSETGEGFEFWDVKTDQPIRQPNHEQPKSKNDFPTIDAYNAYVKKGEE
FT                   FEEKYTTDHIEKGIQELVDAKLYPVAFEAPHYTMSQKGYEILSRYFSTYVGQLQLSDTT
FT                   WKSMHSPFYTSTPSFLHGMKLMPETVGFIEEDKPHAIAKMKERAVSVAKLSDGIIGAFY
FT                   HPYLGVKPLKEVLKDLESIPNIEWIDLQKETNEVKMKDIHITTNKDGIHVEKPTSASDI
FT                   MDYVKQYGFFLILGFFIIVFLLLLRRAKKLES"
FT   gene            244020..244553
FT                   /locus_tag="BCE_0240"
FT                   /old_locus_tag="BCE0240"
FT   CDS_pept        244020..244553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0240"
FT                   /old_locus_tag="BCE0240"
FT                   /product="invasion protein IagB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39176"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EW8"
FT                   /protein_id="AAS39176.1"
FT                   /translation="MKKFFVGFLVVLGVYLYFQGKSEGMGKLVNETSYVDSEEAKQMKQ
FT                   IIIEEAKKVNLPEWIPLTIAEHESRLNPRSVGDNGTSFGLFQLHRGGGLAPDHLTDDEL
FT                   KDPRTNAQIAMPHLMKGYKRGVQKGLTDFALLKYIANTSGWPGNLGPEWTDNNMKYNIG
FT                   LEDVYYRNKGVIKE"
FT   gene            complement(244565..245359)
FT                   /locus_tag="BCE_0241"
FT                   /old_locus_tag="BCE0241"
FT   CDS_pept        complement(244565..245359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0241"
FT                   /old_locus_tag="BCE0241"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39177"
FT                   /db_xref="GOA:Q73EW7"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR012361"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="PDB:4QVU"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EW7"
FT                   /protein_id="AAS39177.1"
FT                   /translation="MDTQQLYFLNDIGKQKPESIRNRSAACPFCDRENLTDILATEGSI
FT                   IWLKNKFPTLKDTFQTVLIETDNCEDHIATYTEEHMRSLIRFSIKHWLNLQKNEEFTSV
FT                   ILYKNHGPFSGGSLHHAHMQIIGMKYVNYLDNVEQDNFQGVIVQKNEHIELNISDRPII
FT                   GFTEFNIIIEDIGCIDELANYIQQTVRYILTDFHKGCSSYNLFFYYLNEKIICKVVPRF
FT                   VVSPLYVGYKIPQVSTKIEDVKIQLAAYFTKQNDAIIHKKIE"
FT   gene            complement(245494..245616)
FT                   /locus_tag="BCE_0242"
FT                   /old_locus_tag="BCE0242"
FT   CDS_pept        complement(245494..245616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0242"
FT                   /old_locus_tag="BCE0242"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39178"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EW6"
FT                   /protein_id="AAS39178.1"
FT                   /translation="MKKAIIVIASTAIAFYTIKNRKKKHNKNDLYYPYTLLKKK"
FT   gene            245985..246176
FT                   /locus_tag="BCE_0243"
FT                   /old_locus_tag="BCE0243"
FT   CDS_pept        245985..246176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0243"
FT                   /old_locus_tag="BCE0243"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39179"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EW5"
FT                   /protein_id="AAS39179.1"
FT                   /translation="MGKYNKEVSIKFRTKEVNEMKRSLAARAKFLDFIYFCRAIFHDVV
FT                   VNGIRLPFFNNCIVAIER"
FT   gene            246152..246286
FT                   /locus_tag="BCE_0244"
FT                   /old_locus_tag="BCE0244"
FT   CDS_pept        246152..246286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0244"
FT                   /old_locus_tag="BCE0244"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39180"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EW4"
FT                   /protein_id="AAS39180.1"
FT                   /translation="MHSSYRTIEISSPIFNKRVKRELFSFLFLCRKPWGVFLPHGFLY"
FT   gene            246301..248181
FT                   /locus_tag="BCE_0245"
FT                   /old_locus_tag="BCE0245"
FT   CDS_pept        246301..248181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0245"
FT                   /old_locus_tag="BCE0245"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39181"
FT                   /db_xref="GOA:Q73EW3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EW3"
FT                   /protein_id="AAS39181.1"
FT                   /translation="MTICSVNNVTKSFGGNIIFENISLEIKNGERVGLVGRNGSGKTTI
FT                   FQLLTGMESLDAGAIHMKKGTRIGHVAQIPKFDESMTVYEVLSSAFKIEKELEREMRTL
FT                   EKHMAEEQESSVLQKLMERYGIIQEKFAFLGGYEIEANIMKVANGLQVTELFHRSFLEL
FT                   SGGEQTKVSLAYMLLQKPDLLLLDEPTNHLDLFAVEWLEQFLKEYNGTVMVISHDRYFL
FT                   DEVVTKIFDLEDGEIHVYHTNYSQFVEEKEERLLQEFQAYQEQQKKIKKMKEAIKRLRE
FT                   WANQANPPNEGLHKRARSMERALERMEKLKKPILERKQIGLQFEGQERSGKDVVVMKEV
FT                   SKRFAEHLLFNEANLHVRFQERAAIVGRNGTGKTTLLKLLLEEIEPDAGEIRIGSSVKI
FT                   GYLSQHAYGNMKSNVLEAFRECVAVTEGEARHILAKFLFYGPAVFKKVTQLSGGEKMRL
FT                   RLAQLMYQDINFLILDEPTNHLDIESREVLEEALEQYNGTILAVSHDRYFLNKLFEKTY
FT                   WIDECKLFEFAGNYAWARQKWEEKIETQVIKQRRQGRKSMETVPVKKKEVRNIEEIETE
FT                   LMHVEEDIYTLECKMEQVVDVEMLEQLYEEKTKKELLRAELYNELENIVE"
FT   gene            248578..248706
FT                   /locus_tag="BCE_0246"
FT                   /old_locus_tag="BCE0246"
FT   CDS_pept        248578..248706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0246"
FT                   /old_locus_tag="BCE0246"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39182"
FT                   /db_xref="GOA:Q73EW2"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EW2"
FT                   /protein_id="AAS39182.1"
FT                   /translation="MLIIRSAGRIGIGCPCFRPLFGYWLLVFYVSYGTNRSEFLIF"
FT   gene            248861..250564
FT                   /locus_tag="BCE_0247"
FT                   /old_locus_tag="BCE0247"
FT   CDS_pept        248861..250564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0247"
FT                   /old_locus_tag="BCE0247"
FT                   /product="oligopeptide ABC transporter, substrate-binding
FT                   protein, putative"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39183"
FT                   /db_xref="GOA:Q73EW1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EW1"
FT                   /protein_id="AAS39183.1"
FT                   /translation="MKNVFKGAIATFLSVSVLLAGCGQEEASTNEAGNVPKVKDEFIQA
FT                   SDKAKSPVKAKERKDTFVVGMPSPGGIFLPHFMENGWDGNITQAIFAPLVGLDKEGKPI
FT                   PILAKKWDISEDQLTYTFYLKDGLKFSDGSPLTADDVAFTLTLLHDPTYSGATDISQTA
FT                   IKGGQAYKEGKATFIEGIQVIDPKTITVTTEKVNAQTLSLIGGEVISKAYYGKEYKQGH
FT                   LEYLKELYGKPMGAGAYKLDKYIPGQEVRFVANENYFEGKPKIEHFIYKISKGDTKLQQ
FT                   FQAGEVDYDGFTTNTETIEQLKDLGFANINVYTGSSYGYIKMNYKKPYFKDKRVRQAFI
FT                   YGLERQKVVDTYFQGYASLVNVPITPVSWAYTEEGINKYEYNLEKAKELLDEAGWKAGS
FT                   DGIREKDGQKLKVSYFASSASKINDVMIPVMKEDYKKLGVEFNPEYMDFNTMISKVIKG
FT                   DYDLAMVSTPMIDDPSGTIEEFVSTSKRNYDGYHNPKVDELAKQALETLDIEKRKEIYK
FT                   KLYQELSEDPPVIFLNNSKVVSAHHARIQGLQEDNYNGILLSLPKLKIEQ"
FT   gene            250802..252529
FT                   /locus_tag="BCE_0248"
FT                   /old_locus_tag="BCE0248"
FT   CDS_pept        250802..252529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0248"
FT                   /old_locus_tag="BCE0248"
FT                   /product="oligopeptide ABC transporter,
FT                   oligopeptide-binding protein, putative"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39184"
FT                   /db_xref="GOA:Q73EW0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EW0"
FT                   /protein_id="AAS39184.1"
FT                   /translation="MKKKTKKWAGVFSVLLSSSLVLSACGGQEETASTEPVKKQDLKDA
FT                   KIESIPATDKKKSPEKANQRKDTFITAISKPGGVFLPYFQENGWDGNVTSVIFASLVTT
FT                   DKQSKPIPDLAEKWDISADQLTYTFHLRKNLKFSDGSPLTAEDVAFTLTLLHDKAYEGG
FT                   MDIAQYAVKGGKEYKEGKATSIEGIQVVDPQTIKITTEKVNSQALINLGGPVLSKAYYG
FT                   KDYKQNTSLDYLKALYGQPIAAGPYKFEKYVPGQEVRFVANEHYYAGKPKIKNFIYKIT
FT                   SGDTGFQLFQTGELDYSGFRANPENIDQLKGLEFANINLESSSDIAYIYVNNKKSYLKD
FT                   KKVRQALTYGLDRKKYVDTALQGYGSVANVPIAPVSWAYTEEGINKYPHDVEKAKKLLD
FT                   EAGWKVGSDGVREKDGQKLKLTYYASNTGKTNDIFIPIAKESYKEIGVELNPELMDFNT
FT                   MLSKVGKGDYDLAAVSTPGISDPSEVVSDYLSTNPKSDTGYSNPKVDDLIVKGIGTTDI
FT                   EKRKAIYKELYKELSDDPPVILLNYRKLLYAHNARIKGIDPEKYDSISSNLPVLSIEQ"
FT   gene            252638..253594
FT                   /locus_tag="BCE_0249"
FT                   /old_locus_tag="BCE0249"
FT   CDS_pept        252638..253594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0249"
FT                   /old_locus_tag="BCE0249"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39185"
FT                   /db_xref="GOA:Q73EV9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EV9"
FT                   /protein_id="AAS39185.1"
FT                   /translation="MKTYIIRRFLQMIPTLFGTSIIIFFLFALLPGDYIDSNPKLTPER
FT                   AQELRELYGLNKPIIERYFHWLVNALHGDFGFSLQYQEPVTSLLNKFIWNTFIVAVAAL
FT                   FFTWIIALIIGVISATKQHSWFDRLVTIGIFAAMSFPSFFIGLFLIKLLAVDLKLLPIG
FT                   GMIDIGSNSTGIAYILEVLRHMILPVFILTLLGVGSLTRYFRTGMLDVIRQDYIRTARA
FT                   KGLKERTVIYKHALKNAILPAITLLAFELPGLFSGAIIIEQIFNWPGIGSIQLEALNFR
FT                   DYTVLMAFTMFLSCLTIMANFLADIVYAFVDPRIRLK"
FT   gene            253608..254531
FT                   /locus_tag="BCE_0250"
FT                   /old_locus_tag="BCE0250"
FT   CDS_pept        253608..254531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0250"
FT                   /old_locus_tag="BCE0250"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39186"
FT                   /db_xref="GOA:Q73EV8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EV8"
FT                   /protein_id="AAS39186.1"
FT                   /translation="METITPIIGKKKERKKKNESSPWRQAYKKIKKNKMALCGLYVLIF
FT                   MFLFSFIGPIFSPYADGKVQVTQINKPPSLSHWLGTDQLGRDILTRLMQAGRISLTIGL
FT                   ASMLLSVILGALLGAIAGFYRGVVDHLIMRVADVLMSIPGLPLLIIMGAILSEWKLPSE
FT                   YRLYVVMIILSLVGWPGLARLVRGQILTLREQAFMQAADVLGLKDSRKIIHHLIPNVFP
FT                   LLIVVATLGVAGSILSESALSYLGLGVVPPTPSWGNMISAANSLIDFQKRPWLWIPPGF
FT                   AIFITVVSINLLGDALRDALDPKMRR"
FT   gene            254542..255522
FT                   /locus_tag="BCE_0251"
FT                   /old_locus_tag="BCE0251"
FT   CDS_pept        254542..255522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0251"
FT                   /old_locus_tag="BCE0251"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR01727"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39187"
FT                   /db_xref="GOA:Q73EV7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EV7"
FT                   /protein_id="AAS39187.1"
FT                   /translation="MSKAVVELKDLQTHFQTEEGTVKAVNHVSFTVREGETVCVVGESG
FT                   CGKSVTALSIMGLIAESGSVVGGDILYEGKSLLGMKEKELRSLRGNDIAMIFQEPMTSL
FT                   NPVFTVGEQIVETLREHELLSKNEAYKKAIELIRKVGIARADEIVHSYPHELSGGMLQR
FT                   IMIAVALSCNPKLLIADEPTTALDVTIQAQILDLLRQVKEEFKTSILLITHDLGVVAEM
FT                   ADYVVVMYGGKVIEEAPVLEIFKNPKHPYTKGLLKSKPVMGKRIDKLYSIPGQVPNLVG
FT                   LDEFCYFSGRCEHCMEICKEEAPSLNVHDENHKVACWLYEERAEQ"
FT   gene            255519..256484
FT                   /locus_tag="BCE_0252"
FT                   /old_locus_tag="BCE0252"
FT   CDS_pept        255519..256484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0252"
FT                   /old_locus_tag="BCE0252"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR01727"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39188"
FT                   /db_xref="GOA:Q73EV6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EV6"
FT                   /protein_id="AAS39188.1"
FT                   /translation="MSEPLLEVKNLKTYFPIKGGIFSRTVGHVKAVDGVSFTINKGEVF
FT                   GLVGESGSGKTTIGKTILRLVQKTEGEVKFKGQDVHSLSKEELRKHRPNMQLVFQDPFS
FT                   SLNPRMRIGEALGEPMLAHGLATKENVREKVTEVLELCGLAPYHIDRYPHEFSGGQRQR
FT                   IVIARAMVLNPEFIVADEPVAALDVSIQAQIINLFSELQEKKGLSYLFISHDLSVVEHL
FT                   CTKIGIMYLGTIVETAPRDELFINPLHPYTKALLSAVPIPDPTVKRERIILEGDIPSPA
FT                   NPPSGCRFHTRCPFATDICKQTVPEFRNVGEEHFVACHHV"
FT   gene            complement(256524..257396)
FT                   /gene="Cof2"
FT                   /locus_tag="BCE_0253"
FT                   /old_locus_tag="BCE0253"
FT   CDS_pept        complement(256524..257396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Cof2"
FT                   /locus_tag="BCE_0253"
FT                   /old_locus_tag="BCE0253"
FT                   /product="hydrolase, haloacid dehalogenase-like family"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR00099; match to protein
FT                   family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39189"
FT                   /db_xref="GOA:Q73EV5"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EV5"
FT                   /protein_id="AAS39189.1"
FT                   /translation="MKLIALDMDGTLLSSNLEISSENLQAIQTAKEAGHIVMICSGRAK
FT                   EDALKLLEEYKLSLPVGASNGAIVYVDGKVINSRCLQNDKVYKLAKLLESEGFPYKLYT
FT                   NKGVYSPYTWQDQVMQAFEENKHTLDVTLEELERITEKQKKSNLITDFQKIEDVVNNPE
FT                   LEISKFFILTFNAEHRTQLLSVLQEDTDISVTASAPTNVEIMDKHGHKGNGLQEMAAYF
FT                   NIPIEDTIAIGDNFNDVPMLQVAGLSVAMGNAEEDVKKLCDVVTLTNNEHGVAHAIEQF
FT                   VLKQTSSSK"
FT   gene            257845..257952
FT                   /locus_tag="BCE_0254"
FT                   /old_locus_tag="BCE0254"
FT   CDS_pept        257845..257952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0254"
FT                   /old_locus_tag="BCE0254"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39190"
FT                   /db_xref="GOA:Q73EV4"
FT                   /db_xref="InterPro:IPR025034"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EV4"
FT                   /protein_id="AAS39190.1"
FT                   /translation="MKEQVLQVTKGDFVGSASGAVVLTALIVFLSSVLV"
FT   gene            257994..258101
FT                   /locus_tag="BCE_0255"
FT                   /old_locus_tag="BCE0255"
FT   CDS_pept        257994..258101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0255"
FT                   /old_locus_tag="BCE0255"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39191"
FT                   /db_xref="GOA:Q73EV4"
FT                   /db_xref="InterPro:IPR025034"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EV4"
FT                   /protein_id="AAS39191.1"
FT                   /translation="MKEQVLQVTKGDFVGSASGAVVLTALIVFLSSVLV"
FT   gene            complement(258093..258371)
FT                   /locus_tag="BCE_0257"
FT                   /old_locus_tag="BCE0257"
FT   CDS_pept        complement(258093..258371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0257"
FT                   /old_locus_tag="BCE0257"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39192"
FT                   /protein_id="AAS39192.1"
FT                   /translation="MLLILPLHLLILQSHLLLLVILALSFCILLSFFFCYKVFIILTRL
FT                   IEIRLMLLTLLLHLLILRSHLLLLVIPALSFLSFSLHLFFVTKLLLY"
FT   gene            258146..258253
FT                   /locus_tag="BCE_0256"
FT                   /old_locus_tag="BCE0256"
FT   CDS_pept        258146..258253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0256"
FT                   /old_locus_tag="BCE0256"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39193"
FT                   /db_xref="GOA:Q73EV4"
FT                   /db_xref="InterPro:IPR025034"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EV4"
FT                   /protein_id="AAS39193.1"
FT                   /translation="MKEQVLQVTKGDFVGSASGAVVLTALIVFLSSVLV"
FT   gene            258296..258403
FT                   /locus_tag="BCE_0258"
FT                   /old_locus_tag="BCE0258"
FT   CDS_pept        258296..258403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0258"
FT                   /old_locus_tag="BCE0258"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39194"
FT                   /db_xref="GOA:Q73EV4"
FT                   /db_xref="InterPro:IPR025034"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EV4"
FT                   /protein_id="AAS39194.1"
FT                   /translation="MKEQVLQVTKGDFVGSASGAVVLTALIVFLSSVLV"
FT   gene            258446..258556
FT                   /locus_tag="BCE_0259"
FT                   /old_locus_tag="BCE0259"
FT   CDS_pept        258446..258556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0259"
FT                   /old_locus_tag="BCE0259"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39195"
FT                   /db_xref="GOA:Q73EU9"
FT                   /db_xref="InterPro:IPR025034"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EU9"
FT                   /protein_id="AAS39195.1"
FT                   /translation="MNSEQVLQVTKTDLLGSLGGAVVLTSFILFLANVLV"
FT   gene            258866..259984
FT                   /gene="hppD"
FT                   /locus_tag="BCE_0260"
FT                   /old_locus_tag="BCE0260"
FT   CDS_pept        258866..259984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hppD"
FT                   /locus_tag="BCE_0260"
FT                   /old_locus_tag="BCE0260"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /EC_number="1.13.11.27"
FT                   /note="identified by match to protein family HMM PF00903;
FT                   match to protein family HMM TIGR01263"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39196"
FT                   /db_xref="GOA:Q73EU8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR005956"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041735"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EU8"
FT                   /protein_id="AAS39196.1"
FT                   /translation="MKQKSMDTLAAQMEDFFPVRDVDHLEFYVGNAKQSSYYLARAFGF
FT                   KIVAYSGLETGNREKVSYVLVQKNMRFVVSGALSSDNRIAEFVKTHGDGVKDVALLVDD
FT                   VDKAYSEAVKRGAVAIAPPVELTDENGTLKKAVIGTYGDTIHTLVERKNYKGTFMPGFQ
FT                   KAEFDIPFEESGLIAVDHVVGNVEKMEEWVSYYENVMGFKQMIHFDDDDISTEYSALMS
FT                   KVMTNGSRIKFPINEPADGKRKSQIQEYLEFYNGAGVQHLALLTNDIVKTVEALRANGV
FT                   EFLDTPDTYYDELTARVGKIDEEIDKLKELKILVDRDDEGYLLQIFTKPIVDRPTLFIE
FT                   IIQRKGSRGFGEGNFKALFESIEREQERRGNL"
FT   gene            260051..261007
FT                   /locus_tag="BCE_0261"
FT                   /old_locus_tag="BCE0261"
FT   CDS_pept        260051..261007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0261"
FT                   /old_locus_tag="BCE0261"
FT                   /product="fumarylacetoacetate hydrolase family protein"
FT                   /note="identified by match to protein family HMM PF01557"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39197"
FT                   /db_xref="GOA:Q73EU7"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EU7"
FT                   /protein_id="AAS39197.1"
FT                   /translation="MKFVTFRLPSKEMRAGWLEGDKVIDMNLASGGKLPSSMFAFLEKV
FT                   DEYVEVLRNINKPEKGIYSLEEVQLVAAIPNPSSIRDFYAFEQHVKTARGRRGLDVVPE
FT                   WYDIPVFYFTNHRAVVGPDDVVISPKKSKKLDYELEIACVIGKEGRNISREQAEEYIFG
FT                   YCIMNDWSARDLQATEMKVGLGPAKGKDFATSLGAYLVTKEELDIYRNGDRYELEMTAH
FT                   VNGKLLSKGNFRDIYYTFAEMIERASEDVTLYPGDVIGSGTVGTGCILELGTEEWLQDG
FT                   DVVELTITGLGTLRNTVKIEREAGDGHVLSSHGGATS"
FT   gene            260973..262145
FT                   /locus_tag="BCE_0262"
FT                   /old_locus_tag="BCE0262"
FT   CDS_pept        260973..262145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0262"
FT                   /old_locus_tag="BCE0262"
FT                   /product="homogentisate 1,2-dioxygenase, putative"
FT                   /note="identified by match to protein family HMM PF04209"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39198"
FT                   /db_xref="GOA:Q73EU6"
FT                   /db_xref="InterPro:IPR005708"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EU6"
FT                   /protein_id="AAS39198.1"
FT                   /translation="MFYRHMGELPHKRHVQFRKKDGSLYREQVMGTKGFSGTQSILYHH
FT                   YMPTEVGHAALSHSCQLQYEEDVALSHRHFRTKENKKSGDAVSGRNFILGNEDLLIGVV
FT                   SPTEKMDYFYRNGDGDEMLFVHYGTGKIETMFGTVHYRKGDYVTIPIGTIYRVIPDEGE
FT                   TKFLVVEANSQITTPRRYRNEYGQLLEHSPFCERDIRGPEKLETYDEKGEFVVMTKSRG
FT                   YMHKHVLGHHPLDVVGWDGYLYPWVFNVEDFEPITGRIHQPPPVHQTFEGHNFVICSFV
FT                   PRLYDYHPESIPAPYYHSNVNSDEVLYYVEGNFMSRKGVEEGSITLHPSGIPHGPHPGK
FT                   TEASIGKKETLELAVMIDTFRPLRIVKQAHETEDEKYMYSWIEEGSYTVK"
FT   gene            262378..263793
FT                   /locus_tag="BCE_0263"
FT                   /old_locus_tag="BCE0263"
FT   CDS_pept        262378..263793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0263"
FT                   /old_locus_tag="BCE0263"
FT                   /product="amino acid permease"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39199"
FT                   /db_xref="GOA:Q73EU5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EU5"
FT                   /protein_id="AAS39199.1"
FT                   /translation="MKQIFQKKPIAKLMQESKQKTLARXLGALDLTMLGIGAIVGTGIF
FT                   VLTGVVAAKHSGPAIILSFAIAALACAFAAFCYAEFASSVPVSGSVYTYTYATMGEVFA
FT                   FLIGWDLMLEYLLATSAVANGWSAYFQSLLKGFGIHIPTILSSAPGTGKGGIIDLPAVL
FT                   IILVMTVLLSRGVRESARVNNIMVFIKLAVVLIFIFAGFNYVKPENWTPFMPFGLDGVM
FT                   AGAATVFFAFIGFDAVSTAAEEVKRPQRDLPIGIIASLLICTALYIIVSLILTGIVPYG
FT                   QLNISDPVAFALQFIGQDSLAGVISVGAITGITTVMLVMMYGQVRVSYAMSRDGLLPKR
FT                   LAKVHPKFKTPFLNTWTTGIIAALISGLIDLNVLAHLVNMGTLSAFALVAVAVIVMRRT
FT                   HPDLPRAFKAPLVPFLPALTVIFCLYLMLQLSGTAWISFGVWMIIGIAVYFLYSRKHSA
FT                   LNNSKEEDDAANL"
FT   gene            263902..265173
FT                   /locus_tag="BCE_0264"
FT                   /old_locus_tag="BCE0264"
FT   CDS_pept        263902..265173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0264"
FT                   /old_locus_tag="BCE0264"
FT                   /product="major facilitator family transporter"
FT                   /note="identified by match to protein family HMM PF00083"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39200"
FT                   /db_xref="GOA:Q73EU4"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EU4"
FT                   /protein_id="AAS39200.1"
FT                   /translation="MKNTWRELREMDRNVWIRFIGETLNGIAMMMLMPFFALYLKDKVD
FT                   SLLQVGVIMALSPIAASFGSIIGGRIADIYGRKPIMIFSMASNAVFMLGFLFIEGFIPY
FT                   AILSIFLGLSNSLFHPAASAMVADVTAPEKRTEAYGLLRMGHNIGAAIGPIMGASVVML
FT                   SKNLVFIIAASTMLFYALLVFVLIQETMPKSTNKEGDTEKESGAVWKIVLRDKALMIYL
FT                   LAGIIISMGFSQTEGMLPLHFDNEMKDIFGTNNPYPYLMALNGLLVVLFQFQISKWVTD
FT                   KPVGKTMLYGACLFGIGLFFIGWLPKWFGGLDTNATIILITLLFVYAIYTLGEMIMSPV
FT                   QMTFVANLAPEHLRGTYMGAASLQWITGSAFGPLLGGFLLDRLLGHFLFTILAVGCVVA
FT                   GIVYISLDRLVEQRQKSTLTKQSS"
FT   gene            265407..266492
FT                   /locus_tag="BCE_0265"
FT                   /old_locus_tag="BCE0265"
FT   CDS_pept        265407..266492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0265"
FT                   /old_locus_tag="BCE0265"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="identified by match to protein family HMM PF01820;
FT                   match to protein family HMM TIGR01205"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39201"
FT                   /db_xref="GOA:Q73EU3"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EU3"
FT                   /protein_id="AAS39201.1"
FT                   /translation="MTKIKLGLLYGGKSAEHQVSLQTALAAIKALNQDKFEIHPIYITE
FT                   QGQWVRGERIEGEVTDVEVLKMSGAENAISPLSLSTEIIPSTNAEENAIDVIFPLLHGP
FT                   NGEDGTVQGLLELMNIPYVGNGVLASAAGMDKVVMKNIFAEAGLKQAKYASFIRSAWEK
FT                   DRETAYEKVEEVLGYPCFVKPANLGSSVGINKCKNREELENAFEEAFQFDRKIIVEENI
FT                   VGREVEVGVLGNDEPKCSVVGEIVPKKDFYDYKSKYIDGDTALIIPAEMTEEESNVIKR
FT                   DAIVAFQSLDGAGLTRADFFLTKDGEVYINEVNTMPGFTPFSMFPLLWQHTGLPYPELI
FT                   EELIRLAMERHEEKQKIKYTI"
FT   gene            266554..267930
FT                   /gene="murF"
FT                   /locus_tag="BCE_0266"
FT                   /old_locus_tag="BCE0266"
FT   CDS_pept        266554..267930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="BCE_0266"
FT                   /old_locus_tag="BCE0266"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl-D-alanyl ligase"
FT                   /note="identified by match to protein family HMM PF01225;
FT                   match to protein family HMM PF02875; match to protein
FT                   family HMM TIGR01143"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39202"
FT                   /db_xref="GOA:Q73EU2"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EU2"
FT                   /protein_id="AAS39202.1"
FT                   /translation="MINRTLKQVEQMTNGTGLAEQYEGITIQGVSIDTRKIEKGNLYVP
FT                   IQGERFDGHAFVDKAVENGAVATLWMKDVANPPENLPVIFVEDTLSALQMLAKNYRDQL
FT                   DVKVIGVTGSNGKTSTKDIVTSLLATKFKVQKTEGNFNNHIGLPLTILNLEENTEVAVL
FT                   EMGMSSRGEIEFLSKLARPNAAIITNIGEAHLMDLGSREAIAEAKLEIVTGLQEGGVFV
FT                   YNGDEPLLTNRVPEMNLIAETVTFGDARANDYYPTTVTLQATGTHFKMNREENISFYLP
FT                   VLGKHNVYNTLASMAIAKHFGVTWEEMKEGLVTLQMTGMRMEIVKTNSGLTIINDAYNA
FT                   SPTAMEAAFHLMNGLDGFSKKIVVLGDMLELGDQEVQFHYEVGKLIDPAKISYVFTYGK
FT                   LGAQIAEGAKINFPNERVKAYDNKEELVKELQAVVDAKDVVLIKASRGMKLEEVITMLK
FT                   "
FT   gene            268236..269813
FT                   /locus_tag="BCE_0267"
FT                   /old_locus_tag="BCE0267"
FT   CDS_pept        268236..269813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0267"
FT                   /old_locus_tag="BCE0267"
FT                   /product="ATP-dependent RNA helicase, DEAD/DEAH box family"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39203"
FT                   /db_xref="GOA:Q73EU1"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030880"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73EU1"
FT                   /protein_id="AAS39203.1"
FT                   /translation="MTTFRELGLSDSLLQSVESMGFEEATPIQAETIPHALQGKDIIGQ
FT                   AQTGTGKTAAFGLPLLDKVDTHKESVQGIVIAPTRELAIQVGEELYKIGKHKRVRILPI
FT                   YGGQDINRQIRALKKHPHIIVGTPGRILDHINRKTLRLQNVETVVLDEADEMLNMGFIE
FT                   DIEAILTDVPETHQTLLFSATMPDPIRRIAERFMTEPQHIKVKAKEVTMPNIQQFYLEV
FT                   QEKKKFDVLTRLLDIQSPELAIVFGRTKRRVDELSEALNLRGYAAEGIHGDLTQAKRMS
FT                   VLRKFKEGSIEVLVATDVAARGLDISGVTHVYNFDIPQDPESYVHRIGRTGRAGKKGIA
FT                   MLFVTPRESGQLKNIERTTKRKMDRMDAPTLDEALEGQQRLIAEKLQNTIENENLAYYK
FT                   RIAEEMLEENDSVTVVAAALKMMTKEPDTTPIALTSEPPVVARGGGSKKRGGNGGGYRD
FT                   GNRNRSRDGRGGDGRNRDRNRDGRNRDGNRDRNRDGGNRGRRGEGQGRPGSSNGRGERK
FT                   HHSRKPQA"
FT   gene            269909..270871
FT                   /locus_tag="BCE_0268"
FT                   /old_locus_tag="BCE0268"
FT   CDS_pept        269909..270871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0268"
FT                   /old_locus_tag="BCE0268"
FT                   /product="UV-endonuclease, putative"
FT                   /note="identified by match to protein family HMM PF03851"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39204"
FT                   /db_xref="GOA:Q73EU0"
FT                   /db_xref="InterPro:IPR004601"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EU0"
FT                   /protein_id="AAS39204.1"
FT                   /translation="MLVRLGYVAMSVHLKNASPSQTMTYAQFQKIDDREAAIRKLERIA
FT                   NSNLENCLRLLKHNKGHDISFFRLSSKLIPLANHEELLEWNYIRPLKENLKVLGDYAIR
FT                   MNMRIDFHPDHFVVLNSPEENIFKQSVKTLQMHRKLLKGMGIEHKQRCVMHVGGGYKDK
FT                   ELALERFIENWSNVPRGIQEMIMLENDDTTFTLEDTLYLGEKLDIPVVFDLHHHMMNHD
FT                   REDWHEDWARVVHTWESSLLPVKMHISSPREGKDPRAHADFINVDTFLSFLKKIKGSVP
FT                   QIDCMIEAKKKDESLFQLMRDLSEQTDVEIVDGASFYIK"
FT   gene            complement(270864..271436)
FT                   /locus_tag="BCE_0269"
FT                   /old_locus_tag="BCE0269"
FT   CDS_pept        complement(270864..271436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0269"
FT                   /old_locus_tag="BCE0269"
FT                   /product="rhomboid family protein"
FT                   /note="identified by match to protein family HMM PF01694"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39205"
FT                   /db_xref="GOA:Q73ET9"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ET9"
FT                   /protein_id="AAS39205.1"
FT                   /translation="MLIPSVRISLQPITIALLLIQLIMIILGDFPLFPMAASNEYIAKG
FT                   EWWRLLTSLLVHVDLQHFLFNSICLFVLGSSIEKQLGHLSFIIIFFLSGILGNMSSYLI
FT                   MPHEYIHAGASGGIFGLLGAQLFLLYSRYRSSNPRDIAIFSIMICILLLFTFFNPSANP
FT                   ISHLTGLIIGGICTPLLIKKLDGAELI"
FT   gene            271529..271888
FT                   /gene="acpS"
FT                   /locus_tag="BCE_0270"
FT                   /old_locus_tag="BCE0270"
FT   CDS_pept        271529..271888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="BCE_0270"
FT                   /old_locus_tag="BCE0270"
FT                   /product="holo-(acyl-carrier-protein) synthase"
FT                   /EC_number="2.7.8.7"
FT                   /note="identified by match to protein family HMM PF01648;
FT                   match to protein family HMM TIGR00516; match to protein
FT                   family HMM TIGR00556"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39206"
FT                   /db_xref="GOA:Q73ET8"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73ET8"
FT                   /protein_id="AAS39206.1"
FT                   /translation="MIVGIGIDIIELNRIEKMIDGKLKFMERILTESERNVAKGLKGSR
FT                   LTEFVAGRFAAKEAYSKAVGTGIGKEVSFLDIEVRNDDRGKPILITSTEHIVHLSISHS
FT                   KEFAVAQVVLESSSR"
FT   gene            271982..272995
FT                   /locus_tag="BCE_0271"
FT                   /old_locus_tag="BCE0271"
FT   CDS_pept        271982..272995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0271"
FT                   /old_locus_tag="BCE0271"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39207"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ET7"
FT                   /protein_id="AAS39207.1"
FT                   /translation="MKRRLFLVLVGLLTVFVLAGCMEKKQDDVVRDLEAKVKGLKSYQA
FT                   EAKLSIKTGNEPQEYKVEIWHKEPSFYRVNLQNAKKDQSQIILRNEEGVFVLTPALNKS
FT                   FRFQSDWPQNSSQAYLYESLVRDILQDKKNLTFEKTDKYYIFKTKTNYQHQNMLPKQEI
FT                   TLKKSDLTPVSVKLMDNDQNVLVKVDFSKVKFDAKFDKGAFDTKQNMSRAQVDVQTTAK
FT                   EDKPFAILYPRDTPQGMTLKDEKELKTDSGKRAILTYTGSKKSFTLIQEKAKVAEASSA
FT                   ISVSGELVDLGFTIGALTKDSLTWSHNGVEYMLVSKGLEPKELLMVARSVTEKQVK"
FT   gene            273114..274283
FT                   /gene="dal"
FT                   /locus_tag="BCE_0272"
FT                   /old_locus_tag="BCE0272"
FT   CDS_pept        273114..274283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dal"
FT                   /locus_tag="BCE_0272"
FT                   /old_locus_tag="BCE0272"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="identified by match to protein family HMM PF00842;
FT                   match to protein family HMM PF01168; match to protein
FT                   family HMM TIGR00492"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39208"
FT                   /db_xref="GOA:Q73ET6"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ET6"
FT                   /protein_id="AAS39208.1"
FT                   /translation="MEEAPFYRDTWVEVDLDAIYNNVTHIKEFIPSGVEIFAVVKGNAY
FT                   GHDYVPVAKTALEAGATRLAVAFLDEALVLRRAGITAPILVLGPSPPRDINVAAENDVA
FT                   LTVFQKEWVDEAIKLWDGSSTMKYHINFDSGMGRIGIRERKELKGFLKSLEGAPFLELE
FT                   GVYTHFATADEVETSYFDKQYNTFLEQLSWLKEFGVDPKFVHTANSAATLRFQGITFNA
FT                   VRIGIAMYGLSPSVEIRPFLPFKLEPALSLHTKVAHIKQVIKGDGISYNVTYRTKTEEW
FT                   IATVAIGYADGWLRRLQGFEVLVNGKRVPIVGRVTMDQFMIHLPCEVPLGTKVTLIGRQ
FT                   GDEYISATEVAEYSGTINYEIITTISFRVPRIFIRNGKVVEVINYLNDI"
FT   gene            274583..274870
FT                   /locus_tag="BCE_0273"
FT                   /old_locus_tag="BCE0273"
FT   CDS_pept        274583..274870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0273"
FT                   /old_locus_tag="BCE0273"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39209"
FT                   /db_xref="GOA:Q73ET5"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ET5"
FT                   /protein_id="AAS39209.1"
FT                   /translation="MSESSVTTEIVVRLPKQMVTELDGIGKQENKNRHELICQATQLLL
FT                   RQHKTKKRYQHESMRRGYIEMGKINLGIASEAFLAEYEAAHTVERLVSGG"
FT   gene            274875..275225
FT                   /locus_tag="BCE_0274"
FT                   /old_locus_tag="BCE0274"
FT   CDS_pept        274875..275225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0274"
FT                   /old_locus_tag="BCE0274"
FT                   /product="transcriptional regulator, PemK family"
FT                   /note="identified by match to protein family HMM PF02452"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39210"
FT                   /db_xref="GOA:Q73ET4"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ET4"
FT                   /protein_id="AAS39210.1"
FT                   /translation="MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVA
FT                   AITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQIRTIDKQRLTDKITHLDEVMMIRVD
FT                   EALQISLGLIDF"
FT   gene            275293..277461
FT                   /locus_tag="BCE_0275"
FT                   /old_locus_tag="BCE0275"
FT   CDS_pept        275293..277461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0275"
FT                   /old_locus_tag="BCE0275"
FT                   /product="S1 RNA binding domain protein"
FT                   /note="identified by match to protein family HMM PF00575"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39211"
FT                   /db_xref="GOA:Q73ET3"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ET3"
FT                   /protein_id="AAS39211.1"
FT                   /translation="MEMVDNRQALMKMLVEELGFTEKQVRHVIQLTEEGNTVPFIARYR
FT                   KEWTGSLDEVQIRMILERWQYMMQLEDRKEEVLRLIDEKGKLTGELRQQIVKATKLQEV
FT                   EDLYRPYKEKRRTKATIAKEKGLEPLAEWLLLYTKEDPNQKAIEFINAEKEVQSAEEAL
FT                   QGAQDIIAEIVSDEAVYRSWIRNVTFRKGVMSSAVKDEEKDEKNIYEMYYSYEEPLQKV
FT                   VPHRVLAMNRGEKEDILRVSVVPPVDEIVTFLYKKVIRDNDSKSAQYVKLAIEDGYKRL
FT                   IQPSIEREIRKELTETAEEQAIHIFSENLRNLLLQPPMKGKVVLAVDPAYRTGCKLAIV
FT                   DDTGKVLYIDVIYPHPPVRKYEDAKAKVLSIIDKYQVEMIAIGNGTASRESEEFIVDVL
FT                   QNVKREVFYIIVNEAGASVYSASDLAREEFPDLQVEERSAVSIGRRLQDPLAELVKIDP
FT                   KSVGVGQYQHDVSQKRLNESLTFVVETAVNQVGVNVNTASVALLQYVSGLSKTVAKNIV
FT                   AKREEEGKFTKRTDLKKIPRLGAKTYEQCIGFLRILEGANPLDRTGIHPEQYKNVELLL
FT                   KSLGLSKDDVGQPQLQKSLEEVEISKLSQETGVGEPTLVDIIDALISPERDMRDELPKP
FT                   LLKKGILKLEDLKRGMELEGTVRNVVDFGAFVDVGVKQDGLVHISKLSKQYVKHPLDVV
FT                   SVGQIVKVWVDDIDTKKGRVALSMLPIE"
FT   gene            complement(277519..277635)
FT                   /locus_tag="BCE_0276"
FT                   /old_locus_tag="BCE0276"
FT   CDS_pept        complement(277519..277635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0276"
FT                   /old_locus_tag="BCE0276"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39212"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ET2"
FT                   /protein_id="AAS39212.1"
FT                   /translation="MPTWLKKQMQRAYFEKNRYQIKLLNECWFYYSKIHQSS"
FT   gene            277831..278289
FT                   /locus_tag="BCE_0277"
FT                   /old_locus_tag="BCE0277"
FT   CDS_pept        277831..278289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0277"
FT                   /old_locus_tag="BCE0277"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03926"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39213"
FT                   /db_xref="GOA:Q73ET1"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023524"
FT                   /db_xref="InterPro:IPR035240"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73ET1"
FT                   /protein_id="AAS39213.1"
FT                   /translation="MDEQEIQRLVEEVSLQYFGMPFLHKALFNSRLRTTGGRYLLNTHN
FT                   IELNYRYYEMYGKEELVGIVKHELCHYHLHITGRGYKHRDKDFRELLKAVDAPRFCKRM
FT                   MNEEKEKKVYMYECMGCSLQYVRRRQINTKRYVCGKCKGKLILIKKTS"
FT   gene            278404..278478
FT                   /locus_tag="BCE_5656"
FT                   /old_locus_tag="BCE5656"
FT                   /note="tRNA-Asn"
FT   tRNA            278404..278478
FT                   /locus_tag="BCE_5656"
FT                   /old_locus_tag="BCE5656"
FT                   /product="tRNA-Asx"
FT   gene            278482..278572
FT                   /locus_tag="BCE_5657"
FT                   /old_locus_tag="BCE5657"
FT                   /note="tRNA-Ser"
FT   tRNA            278482..278572
FT                   /locus_tag="BCE_5657"
FT                   /old_locus_tag="BCE5657"
FT                   /product="tRNA-Ser"
FT   gene            278581..278655
FT                   /locus_tag="BCE_5658"
FT                   /old_locus_tag="BCE5658"
FT                   /note="tRNA-Glu"
FT   tRNA            278581..278655
FT                   /locus_tag="BCE_5658"
FT                   /old_locus_tag="BCE5658"
FT                   /product="tRNA-Glu"
FT   gene            278660..278735
FT                   /locus_tag="BCE_5659"
FT                   /old_locus_tag="BCE5659"
FT                   /note="tRNA-Val"
FT   tRNA            278660..278735
FT                   /locus_tag="BCE_5659"
FT                   /old_locus_tag="BCE5659"
FT                   /product="tRNA-Val"
FT   gene            278782..278857
FT                   /locus_tag="BCE_5660"
FT                   /old_locus_tag="BCE5660"
FT                   /note="tRNA-Asp"
FT   tRNA            278782..278857
FT                   /locus_tag="BCE_5660"
FT                   /old_locus_tag="BCE5660"
FT                   /product="tRNA-Asp"
FT   gene            278945..279019
FT                   /locus_tag="BCE_5661"
FT                   /old_locus_tag="BCE5661"
FT                   /note="tRNA-Gln"
FT   tRNA            278945..279019
FT                   /locus_tag="BCE_5661"
FT                   /old_locus_tag="BCE5661"
FT                   /product="tRNA-Gln"
FT   gene            279025..279097
FT                   /locus_tag="BCE_5662"
FT                   /old_locus_tag="BCE5662"
FT                   /note="tRNA-Lys"
FT   tRNA            279025..279097
FT                   /locus_tag="BCE_5662"
FT                   /old_locus_tag="BCE5662"
FT                   /product="tRNA-Lys"
FT   gene            279114..279199
FT                   /locus_tag="BCE_5663"
FT                   /old_locus_tag="BCE5663"
FT                   /note="tRNA-Leu"
FT   tRNA            279114..279199
FT                   /locus_tag="BCE_5663"
FT                   /old_locus_tag="BCE5663"
FT                   /product="tRNA-Leu"
FT   gene            279293..279369
FT                   /locus_tag="BCE_5664"
FT                   /old_locus_tag="BCE5664"
FT                   /note="tRNA-Arg"
FT   tRNA            279293..279369
FT                   /locus_tag="BCE_5664"
FT                   /old_locus_tag="BCE5664"
FT                   /product="tRNA-Arg"
FT   gene            279374..279450
FT                   /locus_tag="BCE_5665"
FT                   /old_locus_tag="BCE5665"
FT                   /note="tRNA-Pro"
FT   tRNA            279374..279450
FT                   /locus_tag="BCE_5665"
FT                   /old_locus_tag="BCE5665"
FT                   /product="tRNA-Pro"
FT   gene            279452..279522
FT                   /locus_tag="BCE_5666"
FT                   /old_locus_tag="BCE5666"
FT                   /note="tRNA-Gly"
FT   tRNA            279452..279522
FT                   /locus_tag="BCE_5666"
FT                   /old_locus_tag="BCE5666"
FT                   /product="tRNA-Gly"
FT   gene            279626..281133
FT                   /locus_tag="BCE_5750"
FT                   /old_locus_tag="BCE5750"
FT                   /note="Bc16SE"
FT   rRNA            279626..281133
FT                   /locus_tag="BCE_5750"
FT                   /old_locus_tag="BCE5750"
FT                   /product="16S ribosomal RNA"
FT   gene            281309..284217
FT                   /locus_tag="BCE_5751"
FT                   /old_locus_tag="BCE5751"
FT                   /note="Bc23SE"
FT   rRNA            281309..284217
FT                   /locus_tag="BCE_5751"
FT                   /old_locus_tag="BCE5751"
FT                   /product="23S ribosomal RNA"
FT   gene            284267..284382
FT                   /locus_tag="BCE_5752"
FT                   /old_locus_tag="BCE5752"
FT                   /note="Bc5SE"
FT   rRNA            284267..284382
FT                   /locus_tag="BCE_5752"
FT                   /old_locus_tag="BCE5752"
FT                   /product="5S ribosomal RNA"
FT   gene            284395..284471
FT                   /locus_tag="BCE_5667"
FT                   /old_locus_tag="BCE5667"
FT                   /note="tRNA-Met"
FT   tRNA            284395..284471
FT                   /locus_tag="BCE_5667"
FT                   /old_locus_tag="BCE5667"
FT                   /product="tRNA-Met"
FT   gene            284475..284550
FT                   /locus_tag="BCE_5668"
FT                   /old_locus_tag="BCE5668"
FT                   /note="tRNA-Asp"
FT   tRNA            284475..284550
FT                   /locus_tag="BCE_5668"
FT                   /old_locus_tag="BCE5668"
FT                   /product="tRNA-Asx"
FT   gene            284716..285021
FT                   /locus_tag="BCE_0278"
FT                   /old_locus_tag="BCE0278"
FT   CDS_pept        284716..285021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0278"
FT                   /old_locus_tag="BCE0278"
FT                   /product="conserved hypothetical protein TIGR00150"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39214"
FT                   /db_xref="GOA:Q73ET0"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ET0"
FT                   /protein_id="AAS39214.1"
FT                   /translation="MKSVSKYEITTKSSEETQRLSEKLGELAQAQDVIILEGDLGAGKT
FT                   TFTKGLAKGLGVKRVVNSPTFNIIIAGWSSTVARRAHNPEGRRFKSXSPQPNGPVV"
FT   gene            284925..285003
FT                   /locus_tag="BCE_5669"
FT                   /old_locus_tag="BCE5669"
FT                   /note="tRNA-Met"
FT   tRNA            284925..285003
FT                   /locus_tag="BCE_5669"
FT                   /old_locus_tag="BCE5669"
FT                   /product="tRNA-Met"
FT   gene            285007..285082
FT                   /locus_tag="BCE_5670"
FT                   /old_locus_tag="BCE5670"
FT                   /note="tRNA-Asp"
FT   tRNA            285007..285082
FT                   /locus_tag="BCE_5670"
FT                   /old_locus_tag="BCE5670"
FT                   /product="tRNA-Asx"
FT   gene            285257..285730
FT                   /locus_tag="BCE_0279"
FT                   /old_locus_tag="BCE0279"
FT   CDS_pept        285257..285730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0279"
FT                   /old_locus_tag="BCE0279"
FT                   /product="conserved hypothetical protein TIGR00150"
FT                   /note="identified by match to protein family HMM PF02367;
FT                   match to protein family HMM TIGR00150"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39215"
FT                   /db_xref="GOA:Q73ES9"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ES9"
FT                   /protein_id="AAS39215.1"
FT                   /translation="MSKYEITTKSSEETQRLSEKLGELAQAQDVIILEGDLGAGKTTFT
FT                   KGLAKGLGVKRVVNSPTFNIIKEYKGRLPLYHMDVYRLAESEEDLGFDEYFYGEGITVV
FT                   EWAHLIEAYLPNEKLQISLFHAGDDTRNIVLEPIGDRYIRLCEELLQDESTSN"
FT   gene            285711..286403
FT                   /locus_tag="BCE_0280"
FT                   /old_locus_tag="BCE0280"
FT   CDS_pept        285711..286403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0280"
FT                   /old_locus_tag="BCE0280"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00814"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39216"
FT                   /db_xref="GOA:Q73ES8"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ES8"
FT                   /protein_id="AAS39216.1"
FT                   /translation="MKVLAIDTSNYVMGVSLIEEGNVIGEIITNLTKNHSVRLMPAVEQ
FT                   LLKECGVKPKELTKIVVAAGPGSYTGVRIGVTAAKTLAWSLQIPIVGVSSLEVVAANGA
FT                   NFDGLICPLFDGRRGQIYTGLYTYEGEDLTSIEEDRIILIVDWLQMLKDKGKPVLFIGN
FT                   DVKLHKETIIEHLGNQALFAPFTKNNPRPSELAFLGLQKEEQDVHSFVPSYLRLAEAET
FT                   KWLESQNK"
FT   gene            286417..286860
FT                   /gene="rimI"
FT                   /locus_tag="BCE_0281"
FT                   /old_locus_tag="BCE0281"
FT   CDS_pept        286417..286860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimI"
FT                   /locus_tag="BCE_0281"
FT                   /old_locus_tag="BCE0281"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /note="identified by match to protein family HMM PF00583;
FT                   match to protein family HMM TIGR01575"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39217"
FT                   /db_xref="GOA:Q73ES7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ES7"
FT                   /protein_id="AAS39217.1"
FT                   /translation="MDMIFRKMELDDIAQIVAIEEASFSTPWTADAFHRELTMNEHAHY
FT                   VVLEKDGRVIGYCGLWIIIDESHITNIAILPEYRGQKLGDALLKEVISEAKTLGVKTMT
FT                   LEVRVSNEVAKQLYRKYGFQNGGIRKRYYVDNQEDGLVMWVNI"
FT   gene            286860..287876
FT                   /gene="gcP"
FT                   /locus_tag="BCE_0282"
FT                   /old_locus_tag="BCE0282"
FT   CDS_pept        286860..287876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcP"
FT                   /locus_tag="BCE_0282"
FT                   /old_locus_tag="BCE0282"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="identified by match to protein family HMM PF00814;
FT                   match to protein family HMM TIGR00329"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39218"
FT                   /db_xref="GOA:Q73ES6"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73ES6"
FT                   /protein_id="AAS39218.1"
FT                   /translation="MEKNTIILGIETSCDETAVAVVKNGTEIIANVVASQIESHKRFGG
FT                   VVPEIASRHHVEEITVVLEEALKEANITFDDIDAIAVTEGPGLVGALLIGVNAAKAVAF
FT                   AHDIPLVGVHHIAGHIYANRLVKEVQFPLLSLVVSGGHTELVYMKEHGSFEVIGETRDD
FT                   AAGEAYDKVARTLSMPYPGGPHIDRLAHEGEPTIDLPRAWLEPDSYDFSFSGLKSAVIN
FT                   TVHNAKQRGIEIAPEDLAASFQESVIDVLVTKASRAADAYNVKQVLLAGGVAANKGLRA
FT                   RLEAEFAQKENVELIIPPLSLCTDNAAMIAAAGTIAYEQGKRATLALNANPGLDIEA"
FT   gene            287956..288066
FT                   /locus_tag="BCE_0283"
FT                   /old_locus_tag="BCE0283"
FT   CDS_pept        287956..288066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0283"
FT                   /old_locus_tag="BCE0283"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39219"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ES5"
FT                   /protein_id="AAS39219.1"
FT                   /translation="MLITFLLIVDNVEKLFRCLFYKGGYVYKLVDKTDEV"
FT   gene            complement(288296..290284)
FT                   /locus_tag="BCE_0284"
FT                   /old_locus_tag="BCE0284"
FT   CDS_pept        complement(288296..290284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0284"
FT                   /old_locus_tag="BCE0284"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39220"
FT                   /db_xref="GOA:Q73ES4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ES4"
FT                   /protein_id="AAS39220.1"
FT                   /translation="MIEKYKHGKVKKLFEVKTLILLQVNALSKLYGAETILANIKLEVQ
FT                   TKDRIALVGRNGAGKSTLLKIIAGELSHDDGEIIKPKDVSIGYLAQNTGLETSLTIWDE
FT                   MLTVFTHLQQMETKLRRLEQEMGKEENFSNEATYERLLADYDQLQLDYKDQGGYQYEAD
FT                   IRSILSGLGFPVETHQTTISTLSGGQKTRLALGKLLLTKPDLLILDEPTNHLDIETLTW
FT                   LEQYLQGYPGAILIVSHDRYFLDKLVTQVYEISNKESRRFVGNYSKYLDLKSALYEQEM
FT                   KRYEKQQDEIAKLEDFVQKNIARASTTKRAQSRRKQLDRMELLTRPLGDSKSASFHFDI
FT                   EKQSGNDVLQVKDATIGYDKDPIIEHVTMRLTRGDSVALVGPNGIGKSTLLKSIVNKLP
FT                   LLHGDVSFGSNVSVGYYDQEQANLTSSKRVLNELWDEYPLQPEKEIRTILGNFLFTGDD
FT                   VLKPVSSLSGGQKARLALAKLMMQKSNLLILDEPTNHLDLNSKEILENALIDYPGTLLF
FT                   VSHDRYFINRVTTTVVELSTEGAQEYLGDYDYYVEKKNEMIERAEFEQQEQQENQTPVQ
FT                   KTVAPEKLNYLEEKERKKLERQRTRKIEELEQNIVQFEEEIATLEDQLCLPEIYADYEK
FT                   ASEITTKKQTLQEQLDACMAEWEELHL"
FT   gene            290418..291047
FT                   /locus_tag="BCE_0285"
FT                   /old_locus_tag="BCE0285"
FT   CDS_pept        290418..291047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0285"
FT                   /old_locus_tag="BCE0285"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39221"
FT                   /db_xref="GOA:Q73ES3"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73ES3"
FT                   /protein_id="AAS39221.1"
FT                   /translation="MEQQKIPQATAKRLPLYYRFIQNLSLSGKQRVSSAELSEAVKVDS
FT                   ATIRRDFSYFGALGKKGYGYNVNYLLSFFRETLDQDDITRVALIGVGNLGTAFLHYNFT
FT                   KNNNTKIEMAFDVSEEKVGTEIGGIPVYHLDELEERLSTDIQVAILTVPATVAQSVADR
FT                   LAETNVHGILNFTPARLNVSENIRIHHIDLAVELQTLVYFLKNYPQ"
FT   gene            complement(291077..291268)
FT                   /locus_tag="BCE_0286"
FT                   /old_locus_tag="BCE0286"
FT   CDS_pept        complement(291077..291268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0286"
FT                   /old_locus_tag="BCE0286"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39222"
FT                   /db_xref="GOA:Q73ES2"
FT                   /db_xref="InterPro:IPR025426"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ES2"
FT                   /protein_id="AAS39222.1"
FT                   /translation="MRNSPLFMAALYFLLGCIFTRFAITNVTDTIWNMWTILFAVMATI
FT                   DFNLALRLILVKFTKKKQ"
FT   gene            complement(291265..292014)
FT                   /locus_tag="BCE_0287"
FT                   /old_locus_tag="BCE0287"
FT   CDS_pept        complement(291265..292014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0287"
FT                   /old_locus_tag="BCE0287"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39223"
FT                   /db_xref="GOA:Q73ES1"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ES1"
FT                   /protein_id="AAS39223.1"
FT                   /translation="MKKQYWWVIVTYILMQLSSIAGLPLLLKTGLYDNRGFTREEKFQL
FT                   ITGHWAIISFFIALCIVLWLLRTDIRDRHLDKTRSTVPATIGWIFIGFFLAFFSQSIAG
FT                   MIEMYVLGIKPGSENTARLMDIARTTPWFLIVISIIGPILEEIVFRKILFGTLYKKFNF
FT                   FIAAIISSLVFAAIHFDFTHLLVYTAMGLVFAFLYVKTKRIIVPIAAHVAMNTLVAIAQ
FT                   VLVSNEQIQEMIKEAEKMQGFIGGFLV"
FT   gene            292412..292696
FT                   /gene="groES"
FT                   /locus_tag="BCE_0288"
FT                   /old_locus_tag="BCE0288"
FT   CDS_pept        292412..292696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="BCE_0288"
FT                   /old_locus_tag="BCE0288"
FT                   /product="chaperonin, 10 kDa"
FT                   /note="identified by match to protein family HMM PF00166"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39224"
FT                   /db_xref="GOA:Q73ES0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73ES0"
FT                   /protein_id="AAS39224.1"
FT                   /translation="MLKPLGDRVVIELVQAEEKTASGIVLPDTAKEKPQEGKVIAVGTG
FT                   RVLENGERVALEVAAGDLIIFSKYAGTEVKYEGTDYLILRESDILAVIG"
FT   gene            292735..293856
FT                   /locus_tag="BCE_0289"
FT                   /old_locus_tag="BCE0289"
FT   CDS_pept        292735..293856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0289"
FT                   /old_locus_tag="BCE0289"
FT                   /product="chaperonin family protein"
FT                   /note="identified by match to protein family HMM PF00118"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39225"
FT                   /db_xref="GOA:Q73ER9"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73ER9"
FT                   /protein_id="AAS39225.1"
FT                   /translation="MAKDIKFSEEARRSMLRGVDTLANAVKVTLGPKGRNVVLEKKFGS
FT                   PLITNDGVTIAKEIELEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLK
FT                   NVTAGANPMGLRKGIEKAVVAAVEELKTISKPIEGKSSIAQVAAISAADEEVGQLIAEA
FT                   MERVGNDGVITLEESKGFTTELDVVEGMQFDRGYASPYMITDSDKMEAVLDNPYILITD
FT                   KKISNIQEILPVLEQVVQQGKPLLIIAEDVEGEALATLVVNKLRGTFNVVAVKAPGFGD
FT                   RRKAMLEDIAILTGGEVITEELGRDLKSATVESLGRAGKVVVTKENTTVVEGVGSTEQI
FT                   EARIGQIRAQLEETLLNSIVKNYKSVLQNLQVA"
FT   gene            293985..294368
FT                   /locus_tag="BCE_0290"
FT                   /old_locus_tag="BCE0290"
FT   CDS_pept        293985..294368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0290"
FT                   /old_locus_tag="BCE0290"
FT                   /product="chaperonin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39226"
FT                   /db_xref="GOA:Q73ER9"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73ER9"
FT                   /protein_id="AAS39226.1"
FT                   /translation="MNVYTKVASIVAEGDEATGINIVLRALEEPVRQIAINAGLEGSVV
FT                   VERLKGEKVGVGFNAATGEWVNMLETGIVDPAKVTRSALQNAASVAAMFLTTEAVVADK
FT                   PEPNAPAMPDMGGMGMGGMGGMM"
FT   gene            294775..296313
FT                   /gene="guaA"
FT                   /locus_tag="BCE_0291"
FT                   /old_locus_tag="BCE0291"
FT   CDS_pept        294775..296313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="BCE_0291"
FT                   /old_locus_tag="BCE0291"
FT                   /product="GMP synthase"
FT                   /EC_number="6.3.5.2"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF00958; match to protein
FT                   family HMM TIGR00884; match to protein family HMM
FT                   TIGR00888"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39227"
FT                   /db_xref="GOA:Q73ER7"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73ER7"
FT                   /protein_id="AAS39227.1"
FT                   /translation="MKKQHDTIIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIK
FT                   EINPKGIIFSGGPNSVYGEGALHCDEKIFDLGLPIFGICYGMQLMTQKFGGKVERANHR
FT                   EYGKAVLKVENESKLYANLPEEQVVWMSHGDLVTGLPEGFVVDATSESCPIAGMSNEAK
FT                   NLYGVQFHPEVRHSEHGNDLIKNFVFGVCGCSEGWNMENFIEVELEKIRETVGDKKVLC
FT                   ALSGGVDSSVVAVLIHKAIGDQLTCIFVDHGLLRKGEAEGVMKTFSEGFHMNVIKVDAK
FT                   ERFMNKLKGVEDPEQKRKIIGNEFIYVFDDEASKLEGMDFLAQGTLYTDIVESGTATAQ
FT                   TIKSHHNVGGLPEDMQFKLIEPLNTLFKDEVRVLGSELGIPDEIVWRQPFPGPGLGIRV
FT                   LGEITEEKLEIVRESDAILREEIIKAGLDREIWQYFTALPGMRSVGVMGDERTYDYTVG
FT                   IRAVTSIDGMTADWARIPWDVLEKISVRIVNEVKHVNRIVYDVTSKPPATIEWE"
FT   gene            complement(296522..296674)
FT                   /locus_tag="BCE_0292"
FT                   /old_locus_tag="BCE0292"
FT   CDS_pept        complement(296522..296674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0292"
FT                   /old_locus_tag="BCE0292"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39228"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ER6"
FT                   /protein_id="AAS39228.1"
FT                   /translation="MITRRNPLALFYLLKIKKASIAYTWKRSMNKDKIPLTFIKTPRSQ
FT                   AIYGS"
FT   gene            296694..298019
FT                   /locus_tag="BCE_0293"
FT                   /old_locus_tag="BCE0293"
FT   CDS_pept        296694..298019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0293"
FT                   /old_locus_tag="BCE0293"
FT                   /product="xanthine/uracil permease family protein"
FT                   /note="identified by match to protein family HMM PF00860"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39229"
FT                   /db_xref="GOA:Q73ER5"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ER5"
FT                   /protein_id="AAS39229.1"
FT                   /translation="MKRYFQFDELGTNYKTEFIAGLTTFLSMAYVLFVNPATLSLGNVK
FT                   GLPAGTGMDPGAVFVATALAAAIGSLIMGIFAKYPIALAPGMGINAFFAYTAVLTMGIP
FT                   WQTAIAGTLMSGIIFIILTASGIREKIINAIPSELKFAVAAGIGLFIAFLGFQNAGIIV
FT                   KNDAVLVGLGDLTKGTTLLAIFGVVTTIIFMIKKVNGAVFYGMILTAILGVATGLIDTP
FT                   KAVVGAIPSLEPTFGAALTHFGDIFTVQMGIVIITFFFIDFFDTAGTLVAVANQAGLMK
FT                   NNKLPRAGKALFADAIATVIGAILGTSTTTSYIESSAGVAAGGRSGFTAVVTAGFFLLA
FT                   LFFSPLLSVVTPAVTAPALIIVGILMVSSLGEIDWKKFEIAVPAFFTIISMPLTYSIAT
FT                   GIAIGFIFYPITMVVSGRRKEVHPIMYVMGVLFVLYFIYVRK"
FT   gene            298164..298865
FT                   /locus_tag="BCE_0294"
FT                   /old_locus_tag="BCE0294"
FT   CDS_pept        298164..298865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0294"
FT                   /old_locus_tag="BCE0294"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39230"
FT                   /db_xref="GOA:Q73ER4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ER4"
FT                   /protein_id="AAS39230.1"
FT                   /translation="MANETILVVDDEKEIRNLIKIYLKNEGYKVLQAGDGEEGLRLLEE
FT                   NEVHLVVLDIMMPKVDGIHMCMKVREEKEMPIIMLSAKTQDMDKILGLTTGADDYVTKP
FT                   FNPLELIARIKSQLRRYMKMNGFSIQNEDELEIGEMKINISTHKVIVEGEEVKLTPREF
FT                   SILELLARNPGMVFSAEQIYEKVWNERSFQSDNTVMVHIRKVREKIEENPRKPRYIKTV
FT                   WGVGYKIEKDI"
FT   gene            298849..300354
FT                   /locus_tag="BCE_0295"
FT                   /old_locus_tag="BCE0295"
FT   CDS_pept        298849..300354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0295"
FT                   /old_locus_tag="BCE0295"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39231"
FT                   /db_xref="GOA:Q73ER3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ER3"
FT                   /protein_id="AAS39231.1"
FT                   /translation="MKKIFNPFTYVRKFRELIGKLVKSVKRSVRIQLITAFTACALLGI
FT                   LSAKAAAPFFENANREATIDYRTGMEQINQQAQSVANSSVHENKLEAISSMIEIENQNL
FT                   ERDSRALKVLVTDESGKVLYKTKQAQEEQIDLHNTIRNASSFAINYMNGRKEFESTRKE
FT                   FIAFAPITIEDKNLYMFVSGIPEGEVIYDTQEGPFPFLIGVLVFIFSFFYITKRKMKQI
FT                   EAMAEGVKEIEKGNLAYRIEKKGEDEIASLTENINNMAEELMNNIEKERKLEKQKNELI
FT                   TNVSHDLRTPLTSIMGYLRLLRDSKYENKEQHDEYTRIAFAKSEQLKNLIEDLFEYTKL
FT                   TNEQVILEKQEVCINELLEQLIEELVPQAEEHGLTFVKKFPEERAYAAIDSEKMVRVFD
FT                   NLLMNAIKYSKDDGEIKVSLQRQRRDIQIVIANHSEAFTREELASLFERFYKKDQSRSR
FT                   VTEGSGLGLAIAKSIVELQGGSIRAEYEDGVIQFVVSLPIIER"
FT   gene            complement(300392..300526)
FT                   /locus_tag="BCE_0296"
FT                   /old_locus_tag="BCE0296"
FT   CDS_pept        complement(300392..300526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0296"
FT                   /old_locus_tag="BCE0296"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39232"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ER2"
FT                   /protein_id="AAS39232.1"
FT                   /translation="MSTKFFISFVAFDVVVIGDSYNITPLISNRQYIFLKKYKKAYFF"
FT   gene            300582..300680
FT                   /locus_tag="BCE_0297"
FT                   /old_locus_tag="BCE0297"
FT   CDS_pept        300582..300680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0297"
FT                   /old_locus_tag="BCE0297"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39233"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F54"
FT                   /protein_id="AAS39233.1"
FT                   /translation="MKTERNKQRETSIFILDARQTNFIGEFDPGSG"
FT   gene            300676..302184
FT                   /locus_tag="BCE_5753"
FT                   /old_locus_tag="BCE5753"
FT                   /note="Bc16SF"
FT   rRNA            300676..302184
FT                   /locus_tag="BCE_5753"
FT                   /old_locus_tag="BCE5753"
FT                   /product="16S ribosomal RNA"
FT   gene            302361..305269
FT                   /locus_tag="BCE_5754"
FT                   /old_locus_tag="BCE5754"
FT                   /note="Bc23SF"
FT   rRNA            302361..305269
FT                   /locus_tag="BCE_5754"
FT                   /old_locus_tag="BCE5754"
FT                   /product="23S ribosomal RNA"
FT   gene            305319..305434
FT                   /locus_tag="BCE_5755"
FT                   /old_locus_tag="BCE5755"
FT                   /note="Bc5SF"
FT   rRNA            305319..305434
FT                   /locus_tag="BCE_5755"
FT                   /old_locus_tag="BCE5755"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(305449..306525)
FT                   /locus_tag="BCE_0298"
FT                   /old_locus_tag="BCE0298"
FT   CDS_pept        complement(305449..306525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0298"
FT                   /old_locus_tag="BCE0298"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39234"
FT                   /db_xref="InterPro:IPR032719"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ER0"
FT                   /protein_id="AAS39234.1"
FT                   /translation="MKIIAFYLPQFHQIKENDRWWGKGFTEWTNTKSARPLFSGHYQPR
FT                   EPYQDFYYDLTTPSVRKWQAEIAKAHGIYGFCYYHYWFKGKRLLERPFNEVLQMGEPDF
FT                   PFCLSWANEPWTKTWDGLDSHILMPQNYGELSDWKEHFDYLLQAFQDERYIRINDKPLF
FT                   IIYRPGHIPNCEQMLNYWNTLAQENGLKGIYFTETLNSFPLPNINGFDASIQFEPFYTI
FT                   AHDSSSDINKIIYESGKQINAWDYDKVWMYILKRSPSEKKTFPGAFVDWDNTARRKDLN
FT                   SSIFVGSTPEKFTIYLSKQIQRTYSLYNSEFLFINAWNEWAEGTYLEPDKRHGFAYLEG
FT                   VKQAINRGMKAYKKDESF"
FT   gene            complement(306740..307255)
FT                   /locus_tag="BCE_0299"
FT                   /old_locus_tag="BCE0299"
FT   CDS_pept        complement(306740..307255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0299"
FT                   /old_locus_tag="BCE0299"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39235"
FT                   /db_xref="GOA:Q73EQ9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EQ9"
FT                   /protein_id="AAS39235.1"
FT                   /translation="MINLCNETLGRGRYKIAPPQPPAEFINDNSLDIIFAYSVFSHLSE
FT                   ETAENWIKEFSRILRPGGIFIATTQARYFLDFCQQFKEHPELIQTGWHKTLSQAFPDIN
FT                   RAISDYESGNFVHSPTGAGDVRNSSFYGETVIPRTYIKNHYEKYLKLRDFFDDANRLPQ
FT                   ALFVLQKD"
FT   gene            complement(307264..307611)
FT                   /locus_tag="BCE_0300"
FT                   /old_locus_tag="BCE0300"
FT   CDS_pept        complement(307264..307611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0300"
FT                   /old_locus_tag="BCE0300"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39236"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EQ8"
FT                   /protein_id="AAS39236.1"
FT                   /translation="MDDFKLGSDFDNLVSPLSDVDLLHLFVQSCSQTKINGVPVPMFPP
FT                   EEIQQQFVGASYEHALYEAYLFYRLVKTYAHNLGVPLNKERKILDFGCGWGRIIRFFLK
FT                   MFAIKICLVLM"
FT   gene            complement(307638..308360)
FT                   /locus_tag="BCE_0301"
FT                   /old_locus_tag="BCE0301"
FT   CDS_pept        complement(307638..308360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0301"
FT                   /old_locus_tag="BCE0301"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39237"
FT                   /db_xref="GOA:Q73EQ7"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EQ7"
FT                   /protein_id="AAS39237.1"
FT                   /translation="MEGNLKHNNGYCVICEKEATFIEHNDWLRDHYLCSTCHSIPRQRA
FT                   LIHVLNTFFPKWDSYHIHESSPGGITTQLLIKNCKNYTYSQYFKNYPLGQYFQGIRCEN
FT                   LENMTFQDESFDLFITQDVFEHVMEPNKAFKEIERVLKPGGAHVFTVPWYHTLPKTLQR
FT                   ARINEDGIEYIEEPIYHGNPIDENGSLVTFDWGQDMIEYIYTHANMYTLVYLQKDKSLG
FT                   LDAEFLHVFISRKQENNF"
FT   gene            complement(308563..309357)
FT                   /locus_tag="BCE_0302"
FT                   /old_locus_tag="BCE0302"
FT   CDS_pept        complement(308563..309357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0302"
FT                   /old_locus_tag="BCE0302"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39238"
FT                   /db_xref="GOA:Q73EQ6"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EQ6"
FT                   /protein_id="AAS39238.1"
FT                   /translation="MKNVNQELLNHVILHKDRIPHFHKDFPLILFWSHRSGCTTLANWF
FT                   FFQIGLFNEAKKYHDFIHYYEFWVYKNNTNYIPELQNGLLTAEKAVCKLVRNPYTRAVS
FT                   SFLLLADNPYAIPQWESIRQYLYNDKYSNRGISFKQFLYYVRALGPNSLTMDIHFSQQY
FT                   VPGEENFIQHYIPLEDFNTQITKIEHTYDLVKSNLALLTNSDHHRAHKMMYTGSYAELS
FT                   ITDVAFPRFPTYESFYDEETMALVTEIYAQDFEMYPYTKGIF"
FT   gene            309629..310573
FT                   /locus_tag="BCE_0303"
FT                   /old_locus_tag="BCE0303"
FT   CDS_pept        309629..310573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0303"
FT                   /old_locus_tag="BCE0303"
FT                   /product="UDP-glucose 4-epimerase, putative"
FT                   /note="identified by match to protein family HMM PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39239"
FT                   /db_xref="GOA:Q73EQ5"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EQ5"
FT                   /protein_id="AAS39239.1"
FT                   /translation="MRKNNYLIVGGNSFIGINLALGLLKKGQNVKVFSRHINNFPQNII
FT                   SEVEFIKGDLANVEDIYKALVNVDIIIYLAATSNVTTSIEDVFGDINSSLFFLNFMESA
FT                   KNFPIKKIVLASSGGTVYGEPEYLPIDEEHPLKPLSPYGITKVSLENYLYFYKKKYGMD
FT                   YVVCRYSNPYGKYQNPLKKVGAINCFLYQHLSNEKINIYGNPQEIIRDYIYIDDLVEVT
FT                   IQLSQLNHLKFCVYNIGSGKGLSLKRIIVELEKLTERKVEFICYKQKQENVQKIILNID
FT                   RVRRECNWEPKVDFKSGIRLNKLWIEEFLYSKK"
FT   gene            complement(310614..311390)
FT                   /locus_tag="BCE_0304"
FT                   /old_locus_tag="BCE0304"
FT   CDS_pept        complement(310614..311390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0304"
FT                   /old_locus_tag="BCE0304"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39240"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EQ4"
FT                   /protein_id="AAS39240.1"
FT                   /translation="MKEFIEANKHLISQIAQKYNVSANIHPEDHIFQFLVTNPVFPSKK
FT                   EAIDYYFKDGRKSAETLLDLITSFYPPVDTPIQLLEFASGYGCVTRHLLNQQTNLSITT
FT                   CDIHEEAITFIENTLHTSSLLSHPEPEQVKLASSTYDIVFCLSFFSHMPDTTWFRWLQT
FT                   LYNAVSPDGLFIFTTHGYQSKKHFGFPALNEQGYWFLPSSEQLDLDVHQYGQTIVSPSY
FT                   VCDKIKLLPYNPIIKKYTEGFWWEHQDLWVIKKEIK"
FT   gene            complement(311457..312728)
FT                   /locus_tag="BCE_0305"
FT                   /old_locus_tag="BCE0305"
FT   CDS_pept        complement(311457..312728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0305"
FT                   /old_locus_tag="BCE0305"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39241"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EQ3"
FT                   /protein_id="AAS39241.1"
FT                   /translation="MHTNIHFIWVGKTDVHFFNTISPRYTAHFTLVDPTPDIGLYNAGA
FT                   DLYLLTSREDPFPNVVLEALDTKVPVIGFKNAGGFEDVVTEQTGALVDHLNLPMMLERI
FT                   YELIGNEDLRLQKGTFGQELIERDFNFLDYVYQLLNLLEHNYKKISVIVPNYNYEKYLP
FT                   ERVKSILNQTYPLYELIFLDDASTDNSVSIFEKLLSNENKHHLKVQQIINDKNSGSVFK
FT                   QWIKGVSAATGDYIWIAEADDLCDQTFLEEVIQGFHIDSDVALSYTQSKQIDEQGNILA
FT                   NHYLDYTNDIDKEKWQSSYVRKGIDEIQDTLLIKNTIPNVSSVVFKNIDIKTIAKQLEK
FT                   FKIAGDWFFYVSLLKEGNIYFNPKPLNYHRRHTNSVTRTEDSYSHYSEVVQMQNFIKDT
FT                   FTIDDISKKKMYAYRKYLEAYLKV"
FT   gene            complement(312791..313387)
FT                   /locus_tag="BCE_0306"
FT                   /old_locus_tag="BCE0306"
FT   CDS_pept        complement(312791..313387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0306"
FT                   /old_locus_tag="BCE0306"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39242"
FT                   /db_xref="GOA:Q73EQ2"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EQ2"
FT                   /protein_id="AAS39242.1"
FT                   /translation="MHANKKIIYVSHDAHFHGAQLLSLHTIKALKENFHYSVAIISIGT
FT                   GILIQDFQKYGPVYCLEENYPTEEKVELLIKKLLLKDYTIAICSTVISGDIVALLAKHN
FT                   IKVISLIHELPHLIQQYSAEGKARNIAQSAHKIVFPSQYVYEKFRTITQLDHQKCHILP
FT                   QGLFNHNPYKNNIAKARNELRKKHNLPLDSKIILG"
FT   gene            313793..313891
FT                   /locus_tag="BCE_0307"
FT                   /old_locus_tag="BCE0307"
FT   CDS_pept        313793..313891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0307"
FT                   /old_locus_tag="BCE0307"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39243"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F54"
FT                   /protein_id="AAS39243.1"
FT                   /translation="MKTERNKQRETSIFILDARQTNFIGEFDPGSG"
FT   gene            313887..315394
FT                   /locus_tag="BCE_5756"
FT                   /old_locus_tag="BCE5756"
FT                   /note="Bc16SG"
FT   rRNA            313887..315394
FT                   /locus_tag="BCE_5756"
FT                   /old_locus_tag="BCE5756"
FT                   /product="16S ribosomal RNA"
FT   gene            315570..318477
FT                   /locus_tag="BCE_5757"
FT                   /old_locus_tag="BCE5757"
FT                   /note="Bc23SG"
FT   rRNA            315570..318477
FT                   /locus_tag="BCE_5757"
FT                   /old_locus_tag="BCE5757"
FT                   /product="23S ribosomal RNA"
FT   gene            318527..318642
FT                   /locus_tag="BCE_5758"
FT                   /old_locus_tag="BCE5758"
FT                   /note="Bc5SG"
FT   rRNA            318527..318642
FT                   /locus_tag="BCE_5758"
FT                   /old_locus_tag="BCE5758"
FT                   /product="5S ribosomal RNA"
FT   gene            319555..320259
FT                   /locus_tag="BCE_0308"
FT                   /old_locus_tag="BCE0308"
FT   CDS_pept        319555..320259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0308"
FT                   /old_locus_tag="BCE0308"
FT                   /product="aspartate racemase"
FT                   /EC_number="5.1.1.13"
FT                   /note="identified by similarity to GP:1545809; match to
FT                   protein family HMM PF01177; match to protein family HMM
FT                   TIGR00035"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39244"
FT                   /db_xref="GOA:Q73EQ0"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EQ0"
FT                   /protein_id="AAS39244.1"
FT                   /translation="MQRVVGIIGGMGPLATVDLMNKIISYTPAMKDQDHIHIIADNYSQ
FT                   IPDRTTAILGKGIDPTPYIVQSAQRLQNAGADFLVIACNTAHFFYKAVKRSVNIPILHM
FT                   PLETARFVQENNFRKVGLLATDGTVKAELYQNSCQDYRIDVIDPDKEMQKKVMEGIYAI
FT                   KSGDLKTGCLHLSMVADKLKESGAEAIIAGCTEVPLVLKSSENICVIDPTEIVAKVVIK
FT                   IANKTETELIKV"
FT   gene            320384..321253
FT                   /locus_tag="BCE_0309"
FT                   /old_locus_tag="BCE0309"
FT   CDS_pept        320384..321253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0309"
FT                   /old_locus_tag="BCE0309"
FT                   /product="transcriptional regulator, LysR family protein"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39245"
FT                   /db_xref="GOA:Q73EP9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EP9"
FT                   /protein_id="AAS39245.1"
FT                   /translation="MNIENIEAFIYVCQLGSFNKAAEALYLTQPSVTARIQSLEREINI
FT                   KLFHRNGNKISLTEKGEYFFPHAQKILQSYQEAKYGLQQVTIPYDLVIGSALSISNNIL
FT                   PEILPGFKSEFKDVRIKIVTGHSQDILQKVINKEVDFGIVRTETHXQVESIRLYNDPIG
FT                   LFVPRNHIFLKEEKVTIEHVSKQPLIFFDYGSMDWLMIHRLFSSNDVSPNISLEVDNME
FT                   TAKNLVIQGMGISFLPEHCVKQELENGELIRVEMTPPVKINISIDFIYLKGRPKSVFID
FT                   FLKEKMCK"
FT   gene            321520..321669
FT                   /locus_tag="BCE_0310"
FT                   /old_locus_tag="BCE0310"
FT   CDS_pept        321520..321669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0310"
FT                   /old_locus_tag="BCE0310"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39246"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EP8"
FT                   /protein_id="AAS39246.1"
FT                   /translation="MLWEVIQREEGTNVLCGYVEYTQSIEVRIFNPVYVFKKEILLLGL
FT                   DFGV"
FT   gene            322892..322990
FT                   /locus_tag="BCE_0311"
FT                   /old_locus_tag="BCE0311"
FT   CDS_pept        322892..322990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0311"
FT                   /old_locus_tag="BCE0311"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39247"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F54"
FT                   /protein_id="AAS39247.1"
FT                   /translation="MKTERNKQRETSIFILDARQTNFIGEFDPGSG"
FT   gene            322986..324494
FT                   /locus_tag="BCE_5759"
FT                   /old_locus_tag="BCE5759"
FT                   /note="Bc16SH"
FT   rRNA            322986..324494
FT                   /locus_tag="BCE_5759"
FT                   /old_locus_tag="BCE5759"
FT                   /product="16S ribosomal RNA"
FT   gene            324671..327578
FT                   /locus_tag="BCE_5760"
FT                   /old_locus_tag="BCE5760"
FT                   /note="Bc23SH"
FT   rRNA            324671..327578
FT                   /locus_tag="BCE_5760"
FT                   /old_locus_tag="BCE5760"
FT                   /product="23S ribosomal RNA"
FT   gene            327628..327743
FT                   /locus_tag="BCE_5761"
FT                   /old_locus_tag="BCE5761"
FT                   /note="Bc5SH"
FT   rRNA            327628..327743
FT                   /locus_tag="BCE_5761"
FT                   /old_locus_tag="BCE5761"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(327958..328086)
FT                   /locus_tag="BCE_0312"
FT                   /old_locus_tag="BCE0312"
FT   CDS_pept        complement(327958..328086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0312"
FT                   /old_locus_tag="BCE0312"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39248"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EP6"
FT                   /protein_id="AAS39248.1"
FT                   /translation="MHYTYEMHVSQMKKPSTTTSNALSYDLGVDRLVSYVTNRRVA"
FT   gene            complement(328144..328542)
FT                   /locus_tag="BCE_0313"
FT                   /old_locus_tag="BCE0313"
FT   CDS_pept        complement(328144..328542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0313"
FT                   /old_locus_tag="BCE0313"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39249"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EP5"
FT                   /protein_id="AAS39249.1"
FT                   /translation="MSHSSKALRNVGLYTMKQSYLNNNRMVTVKEVDTAMQADTNYPGV
FT                   QSNSVQAIRRALYAEVKSFFKALEQWKKNPEKFTGHLKFPNYSRSTDKRIIEIYQVPKV
FT                   DNNGHWIVPMNVAFRKNSVPLKYVCRKI"
FT   gene            328673..329593
FT                   /locus_tag="BCE_0314"
FT                   /old_locus_tag="BCE0314"
FT   CDS_pept        328673..329593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0314"
FT                   /old_locus_tag="BCE0314"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39250"
FT                   /db_xref="GOA:Q73EP4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EP4"
FT                   /protein_id="AAS39250.1"
FT                   /translation="MKEICMLLVAVILWGTAIAPTKWALESIQPFTLLFIRLFFAGGIC
FT                   LLFSFKQLKRSVVHKQVPWKRMSLLSFTGVAGYFMFTSYGISLTSGLHVSIIDAALPLV
FT                   TILFSAFFLKEKIKLNYWVGIVLGAIGVLLITIPSSNGDQEVSLIGDTLILLSTFLFAL
FT                   YTVLLKRPKQEQYLSNKVFTTLTLIIGAVILLPFAMVETFYYGFPEIETWKTGFSVMYL
FT                   VIGATILAYWLWNRALETVSASVSGLYLNALPLISIVASIVLLDESVTWKIVIGGSLVL
FT                   IGVGWADKQKISKLLKRNNLNSKEC"
FT   gene            complement(329672..330463)
FT                   /locus_tag="BCE_0315"
FT                   /old_locus_tag="BCE0315"
FT   CDS_pept        complement(329672..330463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0315"
FT                   /old_locus_tag="BCE0315"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39251"
FT                   /db_xref="GOA:Q73EP3"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EP3"
FT                   /protein_id="AAS39251.1"
FT                   /translation="MFDPTLLHIINAHSRNPHYHKKFPIILFWSQKSGCTSLAKWFFYQ
FT                   IDLLQTALNYSPFIHNYEYDIYKNAPAYSLRLGIALREKQKETFKLVRNPYKRAVSSFV
FT                   SLIAPPYIENPEWKPIRKFLYQDENSSKGLSFKQFLYYLLINGAQANSINPHFTQQYIA
FT                   DEEKYVTNYIYLENFNQDMKALEKRFELKTAPINEFSTSWHHQTPSMIYKGNFSESDIT
FT                   DPLFPRLPTFESFYDTECIQLVQTIFQNDFNTYKYSKEYPY"
FT   gene            330710..330808
FT                   /locus_tag="BCE_0316"
FT                   /old_locus_tag="BCE0316"
FT   CDS_pept        330710..330808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0316"
FT                   /old_locus_tag="BCE0316"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39252"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F54"
FT                   /protein_id="AAS39252.1"
FT                   /translation="MKTERNKQRETSIFILDARQTNFIGEFDPGSG"
FT   gene            330804..332312
FT                   /locus_tag="BCE_5762"
FT                   /old_locus_tag="BCE5762"
FT                   /note="Bc16SI"
FT   rRNA            330804..332312
FT                   /locus_tag="BCE_5762"
FT                   /old_locus_tag="BCE5762"
FT                   /product="16S ribosomal RNA"
FT   gene            332489..335396
FT                   /locus_tag="BCE_5763"
FT                   /old_locus_tag="BCE5763"
FT                   /note="Bc23S1"
FT   rRNA            332489..335396
FT                   /locus_tag="BCE_5763"
FT                   /old_locus_tag="BCE5763"
FT                   /product="23S ribosomal RNA"
FT   gene            335446..335561
FT                   /locus_tag="BCE_5764"
FT                   /old_locus_tag="BCE5764"
FT                   /note="Bc5SI"
FT   rRNA            335446..335561
FT                   /locus_tag="BCE_5764"
FT                   /old_locus_tag="BCE5764"
FT                   /product="5S ribosomal RNA"
FT   gene            336406..336891
FT                   /gene="purE"
FT                   /locus_tag="BCE_0317"
FT                   /old_locus_tag="BCE0317"
FT   CDS_pept        336406..336891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="BCE_0317"
FT                   /old_locus_tag="BCE0317"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by match to protein family HMM PF00731;
FT                   match to protein family HMM TIGR01162"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39253"
FT                   /db_xref="GOA:Q73EP1"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EP1"
FT                   /protein_id="AAS39253.1"
FT                   /translation="MKSLVGVIMGSTSDWETMKYACDILDELNIPYEKKVVSAHRTPDY
FT                   MFEYAETARERGLKVIIAGAGGAAHLPGMVAAKTNLPVIGVPVQSKALNGLDSLLSIVQ
FT                   MPGGVPVATVAIGKAGSTNAGLLAAQILGSFHDDIYDALELRREAIEKDVREGSELV"
FT   gene            336888..338039
FT                   /gene="purK"
FT                   /locus_tag="BCE_0318"
FT                   /old_locus_tag="BCE0318"
FT   CDS_pept        336888..338039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="BCE_0318"
FT                   /old_locus_tag="BCE0318"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by match to protein family HMM PF02222;
FT                   match to protein family HMM TIGR01161"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39254"
FT                   /db_xref="GOA:Q73EP0"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EP0"
FT                   /protein_id="AAS39254.1"
FT                   /translation="MTRIILPGKTIGIIGGGQLGRMMALAAKEMGYKIAVLDPTKNSPC
FT                   AQVADIEIVASYDDLKAIQHLAEISDVVTYEFENIDYRCLQWLEKHAYLPQGSQLLSKT
FT                   QNRFTEKNAIEKAGLPVATYRLVQNQGQLTEAIAELSYPSVLKTTTGGYDGKGQVVLRS
FT                   EDDVDTARELANAAECILEKWVPFEKEVSVIVIRSVSGETKVFPVAENIHVNNILHESI
FT                   VPARITEELSQKAIAYAKVLADELELVGTLAVEMFATADGEIYINELAPRPHNSGHYTQ
FT                   DACETSQFGQHIRAICNLPLGETNLLKPVVMVNILGEHIEGVLRQVNRLTGCYLHLYGK
FT                   EEAKAQRKMGHVNILNDNIEVALEKAKSLHIWDHQEQLLEGKR"
FT   gene            338036..339343
FT                   /gene="purB"
FT                   /locus_tag="BCE_0319"
FT                   /old_locus_tag="BCE0319"
FT   CDS_pept        338036..339343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="BCE_0319"
FT                   /old_locus_tag="BCE0319"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /note="identified by match to protein family HMM PF00206;
FT                   match to protein family HMM TIGR00928"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39255"
FT                   /db_xref="GOA:Q73EN9"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EN9"
FT                   /protein_id="AAS39255.1"
FT                   /translation="MISRYTRPEMGAIWTEENKFKAWLEVEILACEAWAELGDIPKEDV
FT                   KKIREHASFDIDRIYEIEKETRHDVVAFTRAVSETPALGEERKWIHYGLTSTDVVDTAL
FT                   SYILKQANEIILKDLENFVSILANKAKEHKYTIMMGRTHGVHAEPTTFGLKLGLWYEEM
FT                   KRNVERFKQAANTVRVGKLSGAVGTYANIDPFVEKYVCENLGLEAAPISTQTLQRDRHA
FT                   HYMSTLALIATSIEKMAVEIRGLQKSETREVEEAFAKGQKGSSAMPHKRNPIGSENMTG
FT                   LARVIRGYMMTAYENVPLWHERDISHSSAERVILPDATIALNYMLNRFGNIVKNLTVYP
FT                   ENMKRNMTRTYGLIYSQRVMLTLIDKGMVREEAYDIVQPKAMEAWETQVQFKELVEADE
FT                   RITSKLTQEEINECFNYEHHMQHVDTIFERLGLNEA"
FT   gene            339432..340151
FT                   /gene="purC"
FT                   /locus_tag="BCE_0320"
FT                   /old_locus_tag="BCE0320"
FT   CDS_pept        339432..340151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="BCE_0320"
FT                   /old_locus_tag="BCE0320"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="identified by match to protein family HMM PF01259;
FT                   match to protein family HMM TIGR00081"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39256"
FT                   /db_xref="GOA:Q73EN8"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73EN8"
FT                   /protein_id="AAS39256.1"
FT                   /translation="MQKLELLYEGKAKRIYRTESADMVWVEYKDSATAFNGEKKETITG
FT                   KGRLNNEITTLLFRKLQEVGIKTHFVEKLSETEQLVKKVSIIPLEVVTRNVIAGSLSKR
FT                   LGMEEGTVLAEPIVEFYFKDDDLGDPLVTEDHIRVLNVASPEQVSVLRDMALQINQVLI
FT                   DHFASCRVRLVDFKLEFGVTDEGEIILADEISPDTCRLWDETSNEKFDKDVFRRDLGNL
FT                   TDAYEEILKRLGGISHV"
FT   gene            340144..340398
FT                   /locus_tag="BCE_0321"
FT                   /old_locus_tag="BCE0321"
FT   CDS_pept        340144..340398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0321"
FT                   /old_locus_tag="BCE0321"
FT                   /product="phosphoribosylformylglycinamidine synthase, PurS
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02700;
FT                   match to protein family HMM TIGR00302"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39257"
FT                   /db_xref="GOA:Q73EN7"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EN7"
FT                   /protein_id="AAS39257.1"
FT                   /translation="MYKVKVYVTLRESVLDPQGTAVKGALHSLSFTEVQDVRIGKYMEL
FT                   TIDKSVTDLDSKVKEMCEKLLANVVMEDFRYEVEEVVAQ"
FT   gene            340395..341078
FT                   /gene="purQ"
FT                   /locus_tag="BCE_0322"
FT                   /old_locus_tag="BCE0322"
FT   CDS_pept        340395..341078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purQ"
FT                   /locus_tag="BCE_0322"
FT                   /old_locus_tag="BCE0322"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /EC_number="6.3.5.3"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM TIGR01737"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39258"
FT                   /db_xref="GOA:Q73EN6"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73EN6"
FT                   /protein_id="AAS39258.1"
FT                   /translation="MKFAVIVFPGSNCDVDMFHAIKDELGEEVDYVWHDTENLDEYDAI
FT                   LLPGGFSYGDYLRCGAISRFANAMKAVQKAAEQGKPILGVCNGFQILVESGLLPGALMR
FT                   NENLKFMCRTVQLRVENNETMFTSQYEKDEVINIPIAHGEGNYYCDEETLKQLEENNQI
FT                   AFRYVENPNGSVSDIAGIVNEKGNVLGMMPHPERAVDELLGGAEGLKVFQSILKQWRET
FT                   YVVNA"
FT   gene            341062..343281
FT                   /gene="purL"
FT                   /locus_tag="BCE_0323"
FT                   /old_locus_tag="BCE0323"
FT   CDS_pept        341062..343281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purL"
FT                   /locus_tag="BCE_0323"
FT                   /old_locus_tag="BCE0323"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /EC_number="6.3.5.3"
FT                   /note="identified by match to protein family HMM PF00586;
FT                   match to protein family HMM PF02769; match to protein
FT                   family HMM TIGR01736"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39259"
FT                   /db_xref="GOA:Q73EN5"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73EN5"
FT                   /protein_id="AAS39259.1"
FT                   /translation="MSLMLEPNPTQIKEERIYAEMGLTDEEFAMVEKILGRLPNYTETG
FT                   LFSVMWSEHCSYKNSKPVLRKFPTTGERVLQGPGEGAGIVDIGDNQAVVFKMESHNHPS
FT                   AIEPYQGAATGVGGIIRDVFSMGARPVALLNSLRFGELQSPRVKYLFEEVVAGIAGYGN
FT                   CIGIPTVGGEVQFDPCYEGNPLVNAMCVGLINHEDIKKGQAHGAGNTVMYVGASTGRDG
FT                   IHGATFASEELSESSEAKRPAVQVGDPFMEKLLIEACLELIQSDALVGIQDMGAAGLTS
FT                   SSAEMASKAGMGIEMYLDDVPQRETGMTPYEMMLSESQERMLIVVKKGREQEIVDLFEK
FT                   YGLAAVTMGKVTEDKMLRLFHKGEMVAEVPADALAEEAPIYHKPSQEAAYFAEFQQMKM
FT                   ETPKVENYKETLFALLQQPTIASKEWVYDQYDYQVRTSTVVTPGSDAAVVRVRGTEKGL
FT                   AMTTDCNSRYIYLDPEMGGKIAVAEAARNIVCSGGEPLAITDCLNFGNPEKPEIFWQIE
FT                   KSVDGMSEACRTLQTPVIGGNVSMYNERSGEAVYPTPTVGMVGLVHDLKHVTTQEFKQA
FT                   GDLVYVIGETKAEFGGSELQKMLHGKIFGQSPSIDLDVELKRQKQVLAAIQAGLVQSAH
FT                   DVAEGGLAVAISESAIGANGLGATVKLDGEATAALFAESQSRFVITVKRENKEAFEKAV
FT                   EAIQVGEVTNTNEVTIHNEENEVLLTANVDEMRKAWKGAIPCLLK"
FT   gene            343266..344681
FT                   /gene="purF"
FT                   /locus_tag="BCE_0324"
FT                   /old_locus_tag="BCE0324"
FT   CDS_pept        343266..344681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="BCE_0324"
FT                   /old_locus_tag="BCE0324"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM PF00310; match to protein
FT                   family HMM TIGR01134"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39260"
FT                   /db_xref="GOA:Q73EN4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EN4"
FT                   /protein_id="AAS39260.1"
FT                   /translation="MLAEIKGLNEECGVFGIWGHENAAQVSYYGLHSLQHRGQEGAGIV
FT                   VNNGEKIVGHKGLGLISEVFSRGELEGLNGKSAIGHVRYATAGGSEVANVQPLLFRFSD
FT                   HSMALAHNGNLINAKMLRRELEAEGSIFQTSSDTEVLLHLIKRSTKGSLIESVKEALNK
FT                   VKGAFAYLLLTGNEMIVALDPNGFRPLSIGKMGDAYVVASETCAFDVVGATYIRDVEPG
FT                   ELLIINDDGIHVDRFTNDVEHAICSMEYIYFARPDSNIAGVNVHAARKNMGKRLAAEAP
FT                   IEADVVTGVPDSSISAAIGYAEATGIPYELGLIKNRYVGRTFIQPSQELREQGVKMKLS
FT                   AVRGVVEGKRVVMIDDSIVRGTTSKRIVRMLREAGATEVHVRIASPPLKYPCFYGIDIQ
FT                   TRKELIAANHTVEEIREMIGADSLTFLSEDGLVDAIGRPYEGKYGGLCMAYFNGDYPTA
FT                   LYDYEQELLESMK"
FT   gene            344784..345824
FT                   /gene="purM"
FT                   /locus_tag="BCE_0325"
FT                   /old_locus_tag="BCE0325"
FT   CDS_pept        344784..345824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="BCE_0325"
FT                   /old_locus_tag="BCE0325"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="identified by match to protein family HMM PF00586;
FT                   match to protein family HMM PF02769; match to protein
FT                   family HMM TIGR00878"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39261"
FT                   /db_xref="GOA:Q73EN3"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73EN3"
FT                   /protein_id="AAS39261.1"
FT                   /translation="MANAYKQAGVDIEAGYEAVSRMKKHVQTTMRKEVLGGLGGFGGMF
FT                   DLSKFALEEPVLVSGTDGVGTKLMLAFMADKHDTIGIDAVAMCVNDIVVQGAEPLFFLD
FT                   YIACGKAEPSKIENIVKGISEGCRQAGCALIGGETAEMPGMYSTEEYDLAGFTVGIVDK
FT                   KKIVTGEKIEAGHVLIGLASSGIHSNGYSLVRKVLLEDGELSLDRIYGRLELPLGEELL
FT                   KPTKIYVKPILELLKKYEVYGMAHITGGGFIENIPRMLPEEIGAEIELGSWEIQPIFSL
FT                   LQEVGKLEEKEMFNIFNMGIGMVVAVKEEDAKDVVRLLEEQGETARIIGRTVQGAGVTF
FT                   NGGTAL"
FT   gene            345821..346408
FT                   /gene="purN"
FT                   /locus_tag="BCE_0326"
FT                   /old_locus_tag="BCE0326"
FT   CDS_pept        345821..346408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="BCE_0326"
FT                   /old_locus_tag="BCE0326"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /note="identified by match to protein family HMM PF00551;
FT                   match to protein family HMM TIGR00639"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39262"
FT                   /db_xref="GOA:Q73EN2"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EN2"
FT                   /protein_id="AAS39262.1"
FT                   /translation="MSRLAVFASGSGSNFQSLVNAVEEKRLGAEISLLVCDKPEARAVG
FT                   RAHYHHIPCFAFSAKAYESKEAFEKEILKKLEEYEIDYVILAGYMRLIGPTLLEAYGGR
FT                   IINIHPSLLPSFPGKDAVGQALEAGVKVTGVTIHYVDAGMDTGPIIAQEAVVVSEGDTR
FT                   ESLQKKIQQVEHKLYVNTVNQIVQSTKEPTVN"
FT   gene            346433..347968
FT                   /gene="purH"
FT                   /locus_tag="BCE_0327"
FT                   /old_locus_tag="BCE0327"
FT   CDS_pept        346433..347968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="BCE_0327"
FT                   /old_locus_tag="BCE0327"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /note="identified by match to protein family HMM PF01808;
FT                   match to protein family HMM PF02142; match to protein
FT                   family HMM TIGR00355"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39263"
FT                   /db_xref="GOA:Q73EN1"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73EN1"
FT                   /protein_id="AAS39263.1"
FT                   /translation="MKKRALVSVSDKTGVVEFVKGLLEQGIEVISTGGTKKLLEENGLQ
FT                   VIGISEVTGFPEIMDGRVKTLHPNIHGGLLAVRDNETHVAQMNELGIEPIDFVIVNLYP
FT                   FKETIAKPDVTFADAIENIDIGGPTMIRSAAKNHKFVSVIVDPVDYDVVLAELEENGEV
FT                   KEETKRKLAAKVFRHTAAYDALISNYLTEQMGEESPETLTVTFEKKQDLRYGENPHQKA
FT                   TFYKAPFAATSSVAYAEQLHGKELSYNNINDADAALSIVKEFTEPAVVAVKHMNPCGVG
FT                   VGTDIHEAYTRAYEADPVSIFGGIIAANREIDKSTAEKLHEIFLEIIIAPSFSKEALEV
FT                   LQNKKNLRLLTVNIEKSTSASKKLTSVQGGLLVQEEDTLSLDESTISIPTKREPSEQEW
FT                   KDLKLAWKVVKHVKSNAIVLAKDDMTIGVGAGQMNRVGSAKIAITQAGEKAQGSALASD
FT                   AFFPMPDTLEEAAKAGITAIIQPGGSIRDEDSIKVADTYGIAMVFTGVRHFKH"
FT   gene            348190..349461
FT                   /gene="purD"
FT                   /locus_tag="BCE_0328"
FT                   /old_locus_tag="BCE0328"
FT   CDS_pept        348190..349461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="BCE_0328"
FT                   /old_locus_tag="BCE0328"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="identified by match to protein family HMM PF01071;
FT                   match to protein family HMM PF02842; match to protein
FT                   family HMM PF02843; match to protein family HMM PF02844;
FT                   match to protein family HMM TIGR00877"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39264"
FT                   /db_xref="GOA:Q73EN0"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EN0"
FT                   /protein_id="AAS39264.1"
FT                   /translation="MNVLVIGRGGREHALAWKFAQSTKVKKVYVAPGNEGMRDIATPVD
FT                   IDENDFDALVLFAKENHVELTFVGPEIPLMNGIVDRFTEEGLRVFGPNKAAAVIEGSKA
FT                   FTKELMKKYDIPTAAYETFTDYEEAVQYIQKVGAPIVIKADGLAAGKGVTVAMTLEEAL
FT                   QAAKEMLQDVKFGEASKKVVIEEFLDGQEFSLMAFVNGTNVHPMVIAQDHKRAFDGDKG
FT                   PNTGGMGAYSPVPQIPESAVQEAIKNVLHPTAKAMIAENRSFTGILYAGLILTNDGPKV
FT                   IEFNARFGDPETEVVLPRLENDLVDVCNAVLDESELTLQWSEEAVIGVVLASKGYPEVY
FT                   KKGDIINGLDALQDVIVFHSGTAMKHGDFVTNGGRVLFVACKANSLQEAKDKVYKEIGK
FT                   IESDALFYRSDIGYRAIGHEMMRS"
FT   gene            complement(349499..349663)
FT                   /locus_tag="BCE_0329"
FT                   /old_locus_tag="BCE0329"
FT   CDS_pept        complement(349499..349663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0329"
FT                   /old_locus_tag="BCE0329"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39265"
FT                   /db_xref="GOA:Q73EM9"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EM9"
FT                   /protein_id="AAS39265.1"
FT                   /translation="MAKKKSFPLRIDPELHAVIEKWANDEFRSVNAHIEYLLREMAKQK
FT                   GKLKKDKDV"
FT   gene            complement(349680..350525)
FT                   /locus_tag="BCE_0330"
FT                   /old_locus_tag="BCE0330"
FT   CDS_pept        complement(349680..350525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0330"
FT                   /old_locus_tag="BCE0330"
FT                   /product="SPFH domain/band 7 family protein"
FT                   /note="identified by match to protein family HMM PF01145"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39266"
FT                   /db_xref="GOA:Q73EM8"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EM8"
FT                   /protein_id="AAS39266.1"
FT                   /translation="MKEKQVFYVNGFLGIIGILILAAIGVFFLVQEIFIGAALTIILAA
FT                   VLATGIGIVQPNQAKVITFFGNYLGTIRQNGLFLTIPFAFRQTVSLRVENFNSKKLKVN
FT                   DVDGNPIEIAAVIVYKVVDSAKAMFGVEHYDRFVEIQSETAIRHVATKYPYDNFQDETC
FT                   ITLRGNTEEISEELKRELEARLEIAGVEVLETRLTHLAYATEIAHAMLQRQQAKAVLAA
FT                   RKEIVEGAVKMAKDSIHMLDEEGVLELDDERKANMVNNLLVAIVSDKGAQPVINTGSLY
FT                   "
FT   gene            complement(350736..351113)
FT                   /locus_tag="BCE_0331"
FT                   /old_locus_tag="BCE0331"
FT   CDS_pept        complement(350736..351113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0331"
FT                   /old_locus_tag="BCE0331"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39267"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EM7"
FT                   /protein_id="AAS39267.1"
FT                   /translation="MKQNIGTINALIRITLGLVLFGCSATKLVRKPWCTWSNILLWIGA
FT                   MKVAEGIVRFCPIVEMWKFGKYMNMGAFKMSSMNFAEKGHTKEEANQTSKHDKPQSNGS
FT                   YDASDKEIESAIEDIILAKPL"
FT   gene            351178..351408
FT                   /locus_tag="BCE_0332"
FT                   /old_locus_tag="BCE0332"
FT   CDS_pept        351178..351408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0332"
FT                   /old_locus_tag="BCE0332"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39268"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EM6"
FT                   /protein_id="AAS39268.1"
FT                   /translation="MIFRICNPTFDVEKDVGLCVCVSSFFCYNERMHKRKFKIKSSRLK
FT                   NVEEGISNLILRFKQIFKVNLKNPNENKLLF"
FT   gene            351386..352138
FT                   /locus_tag="BCE_0333"
FT                   /old_locus_tag="BCE0333"
FT   CDS_pept        351386..352138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0333"
FT                   /old_locus_tag="BCE0333"
FT                   /product="pcrB family protein"
FT                   /note="identified by match to protein family HMM PF01884;
FT                   match to protein family HMM TIGR00265; match to protein
FT                   family HMM TIGR01768"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39269"
FT                   /db_xref="GOA:Q73EM5"
FT                   /db_xref="InterPro:IPR008205"
FT                   /db_xref="InterPro:IPR038597"
FT                   /db_xref="InterPro:IPR039074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73EM5"
FT                   /protein_id="AAS39269.1"
FT                   /translation="MKINCYFKQKYIQLEKRKGVFMYDISGWKHVFKLDPNKELSEEHL
FT                   EMICESGTDAVIVGGSDGVTIDNVLHMLVSIRRYAVPCVLEVSDVEAITPGFDFYYIPS
FT                   VLNSRKVEWVTGVHHEALKEFGDIMDWDEIFMEGYCVLNPEAKVAQLTDAKCDVTEDDV
FT                   IAYARLADKLLRLPIFYLEYSGTYGDVELVKNVKAQLKQAKLYYGGGISNAEQAKEMAQ
FT                   HADTVVVGNIIYDDIKAALKTVKAVKGE"
FT   gene            352151..354394
FT                   /gene="pcrA"
FT                   /locus_tag="BCE_0334"
FT                   /old_locus_tag="BCE0334"
FT   CDS_pept        352151..354394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcrA"
FT                   /locus_tag="BCE_0334"
FT                   /old_locus_tag="BCE0334"
FT                   /product="ATP-dependent DNA helicase PcrA"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00580;
FT                   match to protein family HMM TIGR01073"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39270"
FT                   /db_xref="GOA:Q73EM4"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005751"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EM4"
FT                   /protein_id="AAS39270.1"
FT                   /translation="MSMTDRLLNGLNPQQQKAVQTTNGPLLLMAGAGSGKTRVLTHRIA
FT                   YLLGEKGVAPWNVLAITFTNKAAREMRERIDTLVGPEAEDIWISTFHSMCVRILRRDID
FT                   RIGINRNFTILDSGDQLTVVKKIMKERNIDPKKFEPRSILAGISNAKNELLSADKYAKK
FT                   ITIADPYEKLTSDVYTEYQKRLLKNNSLDFDDLIMTTIQLFERVPEVLEFYQRKFQYIH
FT                   VDEYQDTNKAQYLLVKHLAARFKNLCVVGDSDQSIYRWRGADISNILSFEKDYENAQVI
FT                   LLEQNYRSSQNILNAANAVIERNTNRKPKKLWTDNEVGSKISYYRAATEKDEAYFVAKK
FT                   IRDDIQMGKRKYTDFAVLYRTNAQSRMVEEIFLKSNIPYKIVGGTKFYDRKEIKDILAY
FT                   LRLIGNPDDEISFARIINVPKRGIGATSIDKIINYGVQNGISLTAVFDEIEHVGVSAKV
FT                   TKAVKEFAGLLHNWVNMQEYLSVTELVEEVIEKTGYRDMLKNERTLEAEGRLENLDEFL
FT                   SVTQTFESQSEDKSLVAFLTDLALVADIDRVDEDPTAGEEVILMTMHSAKGLEFPVVFI
FT                   VGLEEGIFPHTRSLMEEDEMQEERRLAYVGITRAEEELYLSNAQMRTLFGRTSMNAASR
FT                   FITEIPTELVESLNETAPKRETSFGAKGRTASSSKMTTTTRSRSAFARPAAKTTGGEQI
FT                   GWAVGDKASHQKWGIGTVVSVKGEGDAKELDIAFPSPIGVKRLLAKFAPVTKQ"
FT   gene            354410..356419
FT                   /gene="ligA"
FT                   /locus_tag="BCE_0335"
FT                   /old_locus_tag="BCE0335"
FT   CDS_pept        354410..356419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligA"
FT                   /locus_tag="BCE_0335"
FT                   /old_locus_tag="BCE0335"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="identified by match to protein family HMM PF00533;
FT                   match to protein family HMM PF00633; match to protein
FT                   family HMM PF01653; match to protein family HMM PF03119;
FT                   match to protein family HMM PF03120; match to protein
FT                   family HMM TIGR00575"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39271"
FT                   /db_xref="GOA:Q73EM3"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73EM3"
FT                   /protein_id="AAS39271.1"
FT                   /translation="MSKEIAKKRIEELRDLLNTFNYQYHVLDNPSVSDAEYDRNMQELI
FT                   KLEAENPEFMSEDSPSVRVGGTVLDIFEKVTHKSPMLSLGNAFNEGDLRDFDRRVRQGI
FT                   DDVNVRYICELKIDGLAVSLHYEKGRFIQGATRGDGVTGEDITQNLKTIKAIPLRLNEE
FT                   VTLEARGEAYMPKRSFVKLNEEKEQNGEDVFANPRNAAAGSIRQLDPKIAAKRNLSMFV
FT                   YGLANVEEKTILSHSESLDFLGELGFKTNPNRRTCETIEEVIAYVEEWQEKRPHLDYEI
FT                   DGIVIKVDDVALQESLGTTAKSPRWAIAYKFPAEEVVTRLTGIELSVGRTGVVTPTAEL
FT                   EPVRVAGTIVRRASLHNEDLIREKDIRIGDYVVVKKAGDIIPEVVNVIFDKRTGEEEEY
FT                   HMPTHCPACESELVRLEEEVALRCINPTCPAQIREGLIHFVSRNAMNIDGLGERVITQL
FT                   FEADYIRTFADLYSLTKEQLLQLERFGEKSATNLVKAIENSKENSLERLLFGLGIRHVG
FT                   AKAARTFAEHFETMDALVKATEEELKAINEIGEKMAQSVVTYFDNEDVLELLQQFKEYG
FT                   VNMTYKGMKIADLQNVESYFAGKTVVLTGKLEVMGRSEAKKKIEALGGKVTGSVSKSTD
FT                   LVVAGEAAGSKLAQAEKHNVEVWNEERFLQELNK"
FT   gene            356436..357629
FT                   /locus_tag="BCE_0336"
FT                   /old_locus_tag="BCE0336"
FT   CDS_pept        356436..357629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0336"
FT                   /old_locus_tag="BCE0336"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39272"
FT                   /db_xref="InterPro:IPR011426"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EM2"
FT                   /protein_id="AAS39272.1"
FT                   /translation="MKKIALAVLSLGLLVSGCSAGADKDEKVVEKSGKAKEQAIVPNYS
FT                   ISDEYYKTTIPFEGGNARGLVVQGVSNRLDIDEFETGLMRIAKESFSTKDNVLKGGKAL
FT                   DTQHIQMLVKRKRTDAEQKELEDTLKKDAVKFPNIGLNPALGTGSESLEVKNKKNPIYI
FT                   SNILEHDYYVNKGEKNERSGIVVGLAMNSVHYYEEEHGYPREAAISNEKMLAEGKKMVP
FT                   EILKVMHQQDPETKNLPITFAIYRQAPKSSLVPGNFVSYANVEKGSETVEDWKQINEKY
FT                   YLFPSEQAKTDNKREDLARVSNFKAKLSDYFQGDYTAVIGTGMYRDDELREIKLDIPVQ
FT                   FNGKAEIIGFTQYVAGLVMEYFPNYMKVQVTIKSVERPEAIIIREAKQDEPYVKILD"
FT   gene            357725..358495
FT                   /locus_tag="BCE_0337"
FT                   /old_locus_tag="BCE0337"
FT   CDS_pept        357725..358495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0337"
FT                   /old_locus_tag="BCE0337"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF01925"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39273"
FT                   /db_xref="GOA:Q73EM1"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EM1"
FT                   /protein_id="AAS39273.1"
FT                   /translation="MDELSFQVIILLIAFGFLAAFIDSVVGGGGLISLPALMFVGLPPA
FT                   SAIATNKLAATMGTFTSAIYFIRSGKVDFKIVGKLIPLTIIGAVAGALVVKFIPPDILR
FT                   PLVLVMLVFIAIYIIAKKDWGSVSTYKKMTKRKTLIFFFVILMIGFYDGFFGPGTGSFL
FT                   IFAFLLIGLDFIQAAASGKLLNFVSNIVSLITFLFLDVIHFEYGIIMGLSMILGAYFGS
FT                   KFAVQKGVGYVRTLFLLVTILLISKNVLEYTHIL"
FT   gene            358649..360196
FT                   /locus_tag="BCE_0338"
FT                   /old_locus_tag="BCE0338"
FT   CDS_pept        358649..360196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0338"
FT                   /old_locus_tag="BCE0338"
FT                   /product="delta-1-pyrroline-5-carboxylate dehydrogenase,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF00171;
FT                   match to protein family HMM TIGR01237"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39274"
FT                   /db_xref="GOA:P62028"
FT                   /db_xref="InterPro:IPR005932"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62028"
FT                   /protein_id="AAS39274.1"
FT                   /translation="MVVAYKHEPFTDFSVEANKLAFEEGLKKVESYLGQDYPLIIGGEK
FT                   ITTEDKIVSVNPANKEELVGRVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRA
FT                   AAIVRRRKHEFSAILVKEAGKPWNEADADTAEAIDFMEYYGRQMLKLKDGIPVESRPIE
FT                   YNRFSYIPLGVGVIISPWNFPFAIMAGMTTAALVSGNTVLLKPASTTPVVAAKFMEVLE
FT                   EAGLPAGVVNFVPGSGSEVGDYLVDHPRTRFISFTGSRDVGIRIYERAAKVNPGQIWLK
FT                   RVIAEMGGKDTIVVDKEADLELAAKSIVASAFGFSGQKCSACSRAVIHEDVYDHVLNRA
FT                   VELTKELTVANPAVLGTNMGPVNDQAAFDKVMSYVAIGKEEGRILAGGEGDDSKGWFIQ
FT                   PTIVADVAEDARLMKEEIFGPVVAFCKAKDFDHALAIANNTEYGLTGAVISNNRDHIEK
FT                   AREDFHVGNLYFNRGCTGAIVGYQPFGGFNMSGTDSKAGGPDYLALHMQAKTTSETL"
FT   gene            360368..360517
FT                   /locus_tag="BCE_0339"
FT                   /old_locus_tag="BCE0339"
FT   CDS_pept        360368..360517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0339"
FT                   /old_locus_tag="BCE0339"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39275"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EL9"
FT                   /protein_id="AAS39275.1"
FT                   /translation="MGKYQLDYKGQVAVAKFHEKQTPVKFDKKQQIEKLRAEYLKKKQK
FT                   QTDK"
FT   gene            complement(360748..361311)
FT                   /locus_tag="BCE_0340"
FT                   /old_locus_tag="BCE0340"
FT   CDS_pept        complement(360748..361311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0340"
FT                   /old_locus_tag="BCE0340"
FT                   /product="isochorismatase family protein"
FT                   /note="identified by match to protein family HMM PF00857"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39276"
FT                   /db_xref="GOA:Q73EL8"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EL8"
FT                   /protein_id="AAS39276.1"
FT                   /translation="MKTALLLIDIQNDYFPHGKMELRNPVEASAYARRLLQLFRKKNEP
FT                   IFHIQHVAIKEDATFFLPNTEGVHIHESVRPLREETVILKHYPNSFRETDLLKQLQRLA
FT                   IEHVVICGMMTHMCIDATVRAAFDFGLQCTVIHDACATKDLSFKNATIPAVYIHNTILA
FT                   SLNGVYANVMSTEEFLATKKHSLQ"
FT   gene            361784..362803
FT                   /locus_tag="BCE_0341"
FT                   /old_locus_tag="BCE0341"
FT   CDS_pept        361784..362803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0341"
FT                   /old_locus_tag="BCE0341"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39277"
FT                   /db_xref="GOA:Q73EL7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73EL7"
FT                   /protein_id="AAS39277.1"
FT                   /translation="MISFNNVSKVYETGGQSVHAVEDVTLSVEKGEIFGIIGFSGAGKS
FT                   TLLRLVNMLERPTAGTISIDDKEITSLSTKELRKLRQRIGMIFQSFNLFNSRTVFGNIA
FT                   YPLKLAKVPKNEIKERVNELLKFVGLEDKANNYPEQLSGGQKQRVGIARALATSPDILI
FT                   CDEATSALDPETTTEILNLLKKVNREYNLTILLITHEMHVVKEICHRVAVMEKGKVIEE
FT                   GKLFDVFTQPKTKTTQNFVRSVINDHLPESVLAKIQNGGQIYRLTFTGEETGQPVLSYI
FT                   AKNYNVDVNVLYGNIIELQNVLFGNLLVELQGEQREIQKALQHLRLQVQLKEVEAHAS"
FT   gene            362793..363458
FT                   /locus_tag="BCE_0342"
FT                   /old_locus_tag="BCE0342"
FT   CDS_pept        362793..363458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0342"
FT                   /old_locus_tag="BCE0342"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39278"
FT                   /db_xref="GOA:Q73EL6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EL6"
FT                   /protein_id="AAS39278.1"
FT                   /translation="MRVDWSIFWPRIVDATGDTLLMVIVTLIFATILGIPLGLLLYVTR
FT                   KGNFLENKWVFSILNIIINTIRPIPFIIFLVALSPLTRSVIGTTIGTAAAIFPMTLVAS
FT                   IGIARMVETNLVSVPKGVIEAAQAMGASPIRIVFEILVPEALAPLILGVTFMTVGLIEF
FT                   SAVAGLVGGGGLGDLAMTYGYQRFDTSVMFVTVVLLIILVQLAQNLGNYFAKVFLRRS"
FT   gene            363479..364333
FT                   /locus_tag="BCE_0343"
FT                   /old_locus_tag="BCE0343"
FT   CDS_pept        363479..364333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0343"
FT                   /old_locus_tag="BCE0343"
FT                   /product="ABC transporter, substrate-binding protein,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF03180"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39279"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EL5"
FT                   /protein_id="AAS39279.1"
FT                   /translation="MKKILAFALSAIVGVSALSGCSSGDTGAGAKEKVVRVGVTGTDGD
FT                   AWEILKRKAEKEGIKVKLVEFSDYTTPNKALADGDIELNSFQHIAFLEQFKKEHKLDIT
FT                   AVGTTQIAPMGLYSEKHKKANEIPDGSEIAIPNDPTNQARALKLLDAAGLLKLKKDFGL
FT                   FGDSSGIAENPKKLKITPVIAQQTPRVLKDAAASVINNGVAGQAGLDPAKDPIFLEDPK
FT                   NENAKPYINIFAARTKDKDDPTLKKVIELYHSKEVTEAIKKETNDGSISVDLSLDELEK
FT                   IVK"
FT   gene            complement(364509..364976)
FT                   /locus_tag="BCE_0344"
FT                   /old_locus_tag="BCE0344"
FT   CDS_pept        complement(364509..364976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0344"
FT                   /old_locus_tag="BCE0344"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39280"
FT                   /db_xref="GOA:Q73EL4"
FT                   /db_xref="InterPro:IPR025671"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EL4"
FT                   /protein_id="AAS39280.1"
FT                   /translation="MFKKHSTIMLWMIPLLFLIHNLEESFQMPQYLANQFSITFITSQQ
FT                   FFIAISVLTLFVLLIVFLYQLNFLSSIYWIIFIQGAIFFNSVQHIILFFIYRSYNPGVI
FT                   SAVFIVIFSIFFFSSQKHLIQKKQFVITLVFSLFSYPIIIWITLLLASCFQ"
FT   gene            complement(365035..365226)
FT                   /locus_tag="BCE_0345"
FT                   /old_locus_tag="BCE0345"
FT   CDS_pept        complement(365035..365226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0345"
FT                   /old_locus_tag="BCE0345"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39281"
FT                   /db_xref="InterPro:IPR025076"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EL3"
FT                   /protein_id="AAS39281.1"
FT                   /translation="MHEELIRKVIRTKIKMGMHILEELPAPIQQSAKQILNILQEELAA
FT                   YPKEQGHHKNNLKNIIIE"
FT   gene            complement(365219..366397)
FT                   /locus_tag="BCE_0346"
FT                   /old_locus_tag="BCE0346"
FT   CDS_pept        complement(365219..366397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0346"
FT                   /old_locus_tag="BCE0346"
FT                   /product="arsenite-activated ATPase (arsA)"
FT                   /note="identified by match to protein family HMM PF02374;
FT                   match to protein family HMM TIGR00345"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39282"
FT                   /db_xref="GOA:Q73EL2"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EL2"
FT                   /protein_id="AAS39282.1"
FT                   /translation="MRIILYTGKGGVGKTSISAATALQSAKQGLKTLVMSTDPAHSLGD
FT                   SFGIKLSSEPLEIRENLWAQEINTIYEMEKGWGKLQKYITLLFTSKAADDITTEELTMF
FT                   PGMEDLISLLRVLDYYKQNTYDVIIIDCAPTGETLAMLSFPDMLGWWMEKLFPIKRKVL
FT                   KVVRPVAQPLLGVPLPTDDIMDELTNTLEQLGEMRDILSNRDVTSIRIVVNPEKMVIKE
FT                   AQRSFTYLNLYDYNVDAIMINRVIPNTVIDPYFQAWKDTQKKYKTLIQNSFDPLPIYEA
FT                   PMFEQEVVGLPMLERVGDALFKEDYCPTEVKFNGRTQYVKKDGDEYIFVLSIPFSNKSE
FT                   LALNQKGDELIIRAGSVKRNITLPKTLTHLSIQGAKFEDDVLNIRFGGVVHA"
FT   gene            complement(366478..366960)
FT                   /locus_tag="BCE_0347"
FT                   /old_locus_tag="BCE0347"
FT   CDS_pept        complement(366478..366960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0347"
FT                   /old_locus_tag="BCE0347"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39283"
FT                   /db_xref="GOA:Q73EL1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EL1"
FT                   /protein_id="AAS39283.1"
FT                   /translation="MLQYEHFLDLLLDNAKKLFYPEEWVSLDLTLSKTEVFCLLWMERN
FT                   TDITMTKIADLLDIPMSTTTGVVNRLVKKGYIERYRDENDRRIVLIRLTENGVMLVQEV
FT                   KQNAAHYFNLVTEALSEEEKAFLLQIFQKIMNHIATSQQKTEEKVSAPKMKNIPIE"
FT   gene            367192..367428
FT                   /locus_tag="BCE_0348"
FT                   /old_locus_tag="BCE0348"
FT   CDS_pept        367192..367428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0348"
FT                   /old_locus_tag="BCE0348"
FT                   /product="conserved hypothetical protein, degenerate"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39284"
FT                   /db_xref="GOA:Q73EL0"
FT                   /db_xref="InterPro:IPR008024"
FT                   /db_xref="InterPro:IPR038972"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EL0"
FT                   /protein_id="AAS39284.1"
FT                   /translation="MRRRNTQAFTFLAWTSFVCALSGMLIGIYTLDETLSVKGYYLLGT
FT                   LFLTMSCFVLQKTIRDNEEDNERFPKNKPLDKE"
FT   gene            367570..367860
FT                   /gene="gatC"
FT                   /locus_tag="BCE_0349"
FT                   /old_locus_tag="BCE0349"
FT   CDS_pept        367570..367860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="BCE_0349"
FT                   /old_locus_tag="BCE0349"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF02686;
FT                   match to protein family HMM TIGR00135"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39285"
FT                   /db_xref="GOA:Q73EK9"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73EK9"
FT                   /protein_id="AAS39285.1"
FT                   /translation="MSRISVENVKHVAHLARLAITDQEAEKFQKQLDAIVTFAEQLNEL
FT                   DTTDVKPTTHVLTMKNVMREDVPEKGLPVEEVLKNAPDHKDNQIRVPAVLE"
FT   gene            367876..369333
FT                   /gene="gatA"
FT                   /locus_tag="BCE_0350"
FT                   /old_locus_tag="BCE0350"
FT   CDS_pept        367876..369333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="BCE_0350"
FT                   /old_locus_tag="BCE0350"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF01425;
FT                   match to protein family HMM TIGR00132"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39286"
FT                   /db_xref="GOA:Q73EK8"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73EK8"
FT                   /protein_id="AAS39286.1"
FT                   /translation="MSLFDHSVSELHKKLNNKEISVTDLVEESYKRIADVEDNVKAFLT
FT                   LDEENARAKAKELDAKIGAEDNGLLFGMPIGVKDNIVTNGLRTTCASKMLANFDPIYDA
FT                   TVVQKLKAADTITIGKLNMDEFAMGSSNENSGFYATKNPWNLDYVPGGSSGGSAAAVAA
FT                   GEVLFSLGSDTGGSIRQPAAYCGVVGLKPTYGRVSRYGLVAFASSLDQIGPITRTVEDN
FT                   AYLLQAISGLDRMDATSANVEVGNYLAGLTGDVKGLRIAVPKEYLGEGVGEEARESVLA
FT                   ALKVLEGMGATWEEVSLPHSKYALATYYLLSSSEASANLSRFDGVRYGVRSDNVNNLMD
FT                   LYKNTRSEGFGDEVKRRIMLGTFALSSGYYDAYYKKAQQVRTLIKNDFENVFANYDVII
FT                   GPTTPTPAFKVGEKVDDPMTMYANDILTIPVNLAGVPAISVPCGFGANNMPLGLQIIGK
FT                   HFDEATIYRVAHAFEQATDHHTKKASL"
FT   gene            369348..370775
FT                   /gene="gatB"
FT                   /locus_tag="BCE_0351"
FT                   /old_locus_tag="BCE0351"
FT   CDS_pept        369348..370775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="BCE_0351"
FT                   /old_locus_tag="BCE0351"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF01162;
FT                   match to protein family HMM PF02637; match to protein
FT                   family HMM PF02934; match to protein family HMM TIGR00133"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39287"
FT                   /db_xref="GOA:Q73EK7"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73EK7"
FT                   /protein_id="AAS39287.1"
FT                   /translation="MNLETIIGLEVHVELKTNSKIFSASPTEFGAEPNTQTSVIDLGYP
FT                   GVLPTLNKEAVNFAMKAAMALNCEIATETKFDRKNYFYPDNPKAYQISQFDKPIGENGW
FT                   IEIEVDGKKKRIGITRLHLEEDAGKSTHTADGSLVDYNRQGMPLIEIVSEPDMRTPEEA
FT                   YAYLEKLKSIIQYTGVSDCKMEEGSLRCDANISLRPVGQEKFGTKAELKNLNSFTYVQK
FT                   GLEFEQARQEKELLSGGIIQQETRRYDEATKKTILMRVKEGSDDYRYFPEPDLVELYID
FT                   DEWKEAVRASIPELPDARKARYVAELGLPAYDAHVLTLTKEMSDFFEATVADGADAKLT
FT                   SNWLMGEVLAYLNKQQKELKDVALTPAGLSKMVQLIEKGTISSKIAKKVFNELIEKGGD
FT                   PEEIVKAKGLVQISDEGTLRKVVTEILDNNEQSIEDFKNGKDRAIGFLVGQIMKATKGQ
FT                   ANPPLVNKILLEEINKR"
FT   gene            371245..372150
FT                   /locus_tag="BCE_0352"
FT                   /old_locus_tag="BCE0352"
FT   CDS_pept        371245..372150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0352"
FT                   /old_locus_tag="BCE0352"
FT                   /product="conserved hypothetical protein TIGR00147"
FT                   /note="identified by match to protein family HMM PF00781;
FT                   match to protein family HMM TIGR00147"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39288"
FT                   /db_xref="GOA:Q73EK6"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EK6"
FT                   /protein_id="AAS39288.1"
FT                   /translation="MMKRARIIYNPTSGRELFKKSLPEVLQKLEQAGYEASCHATTGPG
FT                   DATVAARQAVERKFDVVIAAGGDGTLNEVVNGLVGHEFRPKFGIIPVGTTNDFARAIGV
FT                   PRSIEEAADIICEGKTVPLDLGRANDTYFINIAGGGRITELTYEVPSKLKTVLGQLAYY
FT                   LKGIEMLPSLHPTYVEIEYDGKLLQEEITMFLITNTRSVGGFEKVAPYASINDGLFDLL
FT                   VLKKGSIADLIKAATQAQRGEHINNPKVLYTQANRIKVHSPDKLMINLDGEYGGDAPME
FT                   FENMYHCLELFVPEHQEDAL"
FT   gene            372296..373039
FT                   /locus_tag="BCE_0353"
FT                   /old_locus_tag="BCE0353"
FT   CDS_pept        372296..373039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0353"
FT                   /old_locus_tag="BCE0353"
FT                   /product="haloacid dehalogenase/epoxide hydrolase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01549"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39289"
FT                   /db_xref="GOA:Q73EK5"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EK5"
FT                   /protein_id="AAS39289.1"
FT                   /translation="MEKVKAILFDKDGTLMDFHSIWIKVAEELVAEYIKLYQLPQSMQP
FT                   TLLKEIGVDGVFVHPRSAIAAGTSLDVAKGLCKYITSSKEEEMHEWVSEKLFALMYEHR
FT                   SYMKMTADLPRILQSLKDRGFILGVVTADDFAPTELFLKQYQLETFFDYVVASDTFAAQ
FT                   KPDKRIIESFCERFHLKACEVAVVGDTPTDLYLAKNGDCYAIGVLSGTGNRQTLEPLAD
FT                   LVVQSVGDFISHSGEFVWEKGKSNV"
FT   gene            373152..374558
FT                   /gene="gabT"
FT                   /locus_tag="BCE_0354"
FT                   /old_locus_tag="BCE0354"
FT   CDS_pept        373152..374558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabT"
FT                   /locus_tag="BCE_0354"
FT                   /old_locus_tag="BCE0354"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /EC_number="2.6.1.19"
FT                   /note="identified by match to protein family HMM PF00202;
FT                   match to protein family HMM TIGR00700"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39290"
FT                   /db_xref="GOA:Q73EK4"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EK4"
FT                   /protein_id="AAS39290.1"
FT                   /translation="MKRENNVKKRMGYVMNTKKFAKVNEQIPGPKAASLLERRQNIVPK
FT                   GVSNGIPTFVQSANGALVTDVDGNQYIDFAGAIGTINVGHCHPAVKEALHKQVDQYIHT
FT                   GFNVMMYEPYIELAEKLAALAPGSFDKQVLFLNSGAEAVENAVKIARKYTKRPGIIAFS
FT                   KGFHGRTLMTMTMTSKVKPYKFGFGPFAPEVYKAPFPYEYRRPEGLTEEQYDNFMIEEF
FT                   KNFFISEVAPETIAAVVMEPVQGEGGFIVPSKKFVQEVRNICSEHGILFVADEIQTGFS
FT                   RTGKYFAIDHYDVVPDLITVSKSLGAGVPISGVIGRKEIMNESAPGELGGTYAGSPLGC
FT                   AAALAVLDVIEKENLNDRAIELGKVVINRFEEMKNKYNCIGDVRGLGAMCAFELVQDRK
FT                   TKAPDKTLTANLCAEANKRGLLLLSAGTYGNVIRVLMPLVITDEQLEEGLTIIEESLQV
FT                   CYEKANIARV"
FT   gene            374675..376042
FT                   /locus_tag="BCE_0355"
FT                   /old_locus_tag="BCE0355"
FT   CDS_pept        374675..376042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0355"
FT                   /old_locus_tag="BCE0355"
FT                   /product="sensory box sigma-54 dependent DNA-binding
FT                   response regulator"
FT                   /note="identified by match to protein family HMM PF00158;
FT                   match to protein family HMM PF00785; match to protein
FT                   family HMM TIGR00229; match to protein family HMM
FT                   TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39291"
FT                   /db_xref="GOA:Q73EK3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030828"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EK3"
FT                   /protein_id="AAS39291.1"
FT                   /translation="MVAEKERVLMDLQDVFEYAFDEIFVTDEKGIVVRVNSTCERHYQL
FT                   AAKELVGKHVKELQKDGIFYPSATLEVIEKKRPIELVQTTKSGEYLHVRTRPVFDEEGN
FT                   LRRVISYSRDLTELYQLRQKVEEMDNQLKTYKKELRETYEHEGLIFKSIAMQKIVETIK
FT                   KVSVVDSTVLVLGETGVGKSRLVRHLHEVSNRKNESFYEINCAALPTNLIESELFGYSG
FT                   GSFTGANREGKKGLLESAHKGTLFLDEIGEMPLEIQAKLLQVLQEKTFRPIGGRELKKV
FT                   DVRIVAATNRDLSMMVKQGTFRKDLYYRLNVIPIVIPPLRERTEDILPLIYHYLQHFNE
FT                   KYGRNVKLAPSTLQMFVGYPWEGNNREIENVIERIVITADDIVTIEDLPIAMQESTVEQ
FT                   SGQSLYKMLEEVERNIILKAYKTYGSSYKVAEFLKISQSAATRKIKKLIEEEENIG"
FT   gene            376035..377486
FT                   /gene="gabD"
FT                   /locus_tag="BCE_0356"
FT                   /old_locus_tag="BCE0356"
FT   CDS_pept        376035..377486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="BCE_0356"
FT                   /old_locus_tag="BCE0356"
FT                   /product="succinate-semialdehyde dehydrogenase (NADP+)"
FT                   /EC_number="1.2.1.16"
FT                   /note="identified by match to protein family HMM PF00171;
FT                   match to protein family HMM TIGR01780"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39292"
FT                   /db_xref="GOA:Q73EK2"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EK2"
FT                   /protein_id="AAS39292.1"
FT                   /translation="MDKKATFVNVEKKAMYINGEWITLQEQIEVNNPATKEIFATVPKG
FT                   GVTEAKQAVDAAHEAFKSWSKLTAADRAVKLKKWFTLIDENKEEIAAIMTREQGKPFAE
FT                   ALGEVNYANSFVEWYAEEGKRVYGEMIPASHPNKRILVMKQPVGVMAAITPWNFPAAMI
FT                   TRKVAPALAAGCTAVVKPASQTPLTALKLAELAHEADIPKGVINIVTGSAKAIADTWME
FT                   DGRVRKVSFTGSTEIGKELMASAAQTMKKVSLELGGHAPFIVMNDADLDKVVEAVIGSK
FT                   FRNAGQTCICTNRVFVQEEVYEVFAEKFQKSVGQLKVGDGFGDGTTVGPLIDENAVSKV
FT                   QEHIADAIQKGGTVLYGGQKVAELDGHFMQPTVIGLANDTMLCMNEETFGPVAPVAKFK
FT                   TVEEVIERANNTPYGLAAYIFTKDISQAFQISEALEYGIIGLNDGLPSVAQAPFGGFKE
FT                   SGIGREGGHFGIEEYLEIKYISLGL"
FT   gene            377534..377857
FT                   /locus_tag="BCE_0357"
FT                   /old_locus_tag="BCE0357"
FT   CDS_pept        377534..377857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0357"
FT                   /old_locus_tag="BCE0357"
FT                   /product="multidrug resistance protein, Smr family"
FT                   /note="identified by match to protein family HMM PF00893"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39293"
FT                   /db_xref="GOA:Q73EK1"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EK1"
FT                   /protein_id="AAS39293.1"
FT                   /translation="MVYWLLLLVTIIFEVAGTIAMKLSNGLTKFVPSVLIFVFYGICFS
FT                   VFAIVVKKIHLSIAYAIWSGVGTLLITIISVYFFKEHISLFQAFCILFIVLGVIGLKVS
FT                   SAS"
FT   gene            377990..378481
FT                   /locus_tag="BCE_0358"
FT                   /old_locus_tag="BCE0358"
FT   CDS_pept        377990..378481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0358"
FT                   /old_locus_tag="BCE0358"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39294"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR029051"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EK0"
FT                   /protein_id="AAS39294.1"
FT                   /translation="MLEKVSQIVLIFGIAFSLSACTETKDSNESKQEDVQDKVYKIGET
FT                   VDVDGLQVTIDSVKLGYPDYDEDKKKEEILGIIFKVENNSKKEIPFAFYEFEITDKKGT
FT                   RFKEYNNPDSFISKKLAPEEKIQDIMLFDVAKENTYIATYRPEFTRENRTIKFELKPNK
FT                   "
FT   gene            complement(378527..379756)
FT                   /gene="ampS"
FT                   /locus_tag="BCE_0359"
FT                   /old_locus_tag="BCE0359"
FT   CDS_pept        complement(378527..379756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampS"
FT                   /locus_tag="BCE_0359"
FT                   /old_locus_tag="BCE0359"
FT                   /product="aminopeptidase AmpS"
FT                   /EC_number="3.4.11.-"
FT                   /note="identified by match to protein family HMM PF02073"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39295"
FT                   /db_xref="GOA:Q73EJ9"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EJ9"
FT                   /protein_id="AAS39295.1"
FT                   /translation="MSFEQTLEKYAALAVNVGVNIQPGQTLSISAPLEAVQFVRLVTEK
FT                   AYKSGAKHVYVDWNDETLTRLKFDLAPEEAFAEFPSWKAHAREELAKEGAAFMSIYAEN
FT                   PDLLKGVEPTRIATAHKVAGEAMKVYRDYVQADKVSWCVISVPTKEWAAKVFPDVAPEE
FT                   QEAKLWDAIFKATRADLENPVEAWKEHDKTLHTKVDYLNEKHYKALHYTGPGTDLTIEL
FT                   PEKHVWAGAGSLNEKNVPFMANIPTEEVFTMPLKTGVNGQVSSTKPLAFAGNIIDNFTL
FT                   TFENGRIVDYKAEVGEEALKHLVETDEGSHFLGEVALVPHDSPISNTNILFYNTLFDEN
FT                   ASCHLAIGNAYAFNLVGGKTMSKEELAKNGANASITHEDFMIGSAELDIDGITADGRHE
FT                   PIFRKGNWAF"
FT   gene            complement(379873..380955)
FT                   /locus_tag="BCE_0360"
FT                   /old_locus_tag="BCE0360"
FT   CDS_pept        complement(379873..380955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0360"
FT                   /old_locus_tag="BCE0360"
FT                   /product="polysaccharide deacetylase-like protein"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39296"
FT                   /db_xref="GOA:Q73EJ8"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EJ8"
FT                   /protein_id="AAS39296.1"
FT                   /translation="MRKYAAIALCTSAILAGCNTNNVSQEPKKEKKVQETKKQEETVKE
FT                   QGKISYNQITHESTNTTIHMTDIKDALTEVQYKIWRTADGREHTKSFSSKEKEKQFTLP
FT                   FDIKEFEGKRGEFQIEAIGIKEDGKTIPLTKSAITFEQKVPVLMYHAIDDYHGQGIKDL
FT                   FVSPANFEAQMKYLKDNGYTLLTFERWGDINKVNKPIFVTFDDGMKNNMNAFHVLQKLK
FT                   DDTFKPTATEYMIVDNVDVEGSLSTSEIKEMVDSGIFSVQSHTATHADLPKITNYEEEL
FT                   KGSKEKLEKITGKPVIAVAYPFGHVDDKVVAETKKYYQFATTTKPGKFITKGEPDELLK
FT                   MKRVRIHHTTTVEQFASSIQ"
FT   gene            381022..381123
FT                   /locus_tag="BCE_0361"
FT                   /old_locus_tag="BCE0361"
FT   CDS_pept        381022..381123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0361"
FT                   /old_locus_tag="BCE0361"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39297"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EJ7"
FT                   /protein_id="AAS39297.1"
FT                   /translation="MGIYPCSSYHLNKMDGMRKVTIDKKITLLQRVR"
FT   gene            complement(381130..382326)
FT                   /locus_tag="BCE_0362"
FT                   /old_locus_tag="BCE0362"
FT   CDS_pept        complement(381130..382326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0362"
FT                   /old_locus_tag="BCE0362"
FT                   /product="nucleoside transporter, NupC family"
FT                   /note="identified by match to protein family HMM PF01773"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39298"
FT                   /db_xref="GOA:Q73EJ6"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EJ6"
FT                   /protein_id="AAS39298.1"
FT                   /translation="MQYVMSIIGILVVLGLCFALSNNKSKINFRAIAIMIGFQILIGWF
FT                   MFGTKIGQQIIIFIGKVFNKLIKLGTTGVDFLFNGIQRDFVFFLNVLLIIVFFSALLSI
FT                   FSYLGVLPFIVRVVGGAISKITGLPRVESFHAVNSVFFGSSEALIVIKNDLQHFNKNRM
FT                   FIICCSAMSSVSASVTASYVMMLDAKYVLAALPLNLFSSLIVCSLLTPVDTKKEDEVIQ
FT                   KFDRTLFGDSFIGAMINGALDGLKVAGIVAALMIAFIGVMEVVNYVISAASGAMGHAVT
FT                   LQQIFGYVLAPFAFLMGIPAQDIIPAGGIMGTKIVLNEFVAILDLKGVAATLSPRTVGI
FT                   VTVFLISFASISQIGAIVGTIRALSEKQGSVVSKFGWKMLFASTLASILSATIAGLFI"
FT   gene            382752..384134
FT                   /locus_tag="BCE_0363"
FT                   /old_locus_tag="BCE0363"
FT   CDS_pept        382752..384134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0363"
FT                   /old_locus_tag="BCE0363"
FT                   /product="RNA methyltransferase, TrmA family"
FT                   /note="identified by match to protein family HMM PF01938;
FT                   match to protein family HMM TIGR00479"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39299"
FT                   /db_xref="GOA:Q73EJ5"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73EJ5"
FT                   /protein_id="AAS39299.1"
FT                   /translation="MSTKMTPPVEKNEFIDVVFEDLTHDGAGVAKVKGYPIFVKNGLPG
FT                   EEAQIKIIKVKKNFAFGRLMKLHTESPYRKDAECPVYNQCGGCQLQHLTYEGQLQAKEK
FT                   QVRDVMQRIGGLSDVPVHPVLGMKNPWVYRNKAQVPIGEREGGLVAGFYRQGTHDIINM
FT                   ESCLIQAEENDTLIQEVKRICEKHGISAYNEERNKGTLRHVMARYGQVTGEIMLVFITR
FT                   TAELPNKKAIIEEIATKFPEVKSIVQNVNPKRTNVIFGDKTTVLYGSEYIYDFIGDIKF
FT                   AISARSFYQVNPEQTKVLYDKTLEYAKLDGNETVIDAYCGIGSISLFLAQKAKKVYGVE
FT                   IVPEAIEDAKRNAALNNMTNAEFGVGEAEVVIPKWYKEGVIADTMVVDPPRKGCDEALL
FT                   NTIIDMKPKRVVYVSCNPATLARDLKVLEEGGYKTQEVQPVDMFPHTTHVECVVLMSRV
FT                   EK"
FT   gene            384456..384809
FT                   /locus_tag="BCE_0364"
FT                   /old_locus_tag="BCE0364"
FT   CDS_pept        384456..384809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0364"
FT                   /old_locus_tag="BCE0364"
FT                   /product="phage repressor"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39300"
FT                   /db_xref="GOA:Q73EJ4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EJ4"
FT                   /protein_id="AAS39300.1"
FT                   /translation="MPEIGQMIKSRREAMGLSLKKLAIACGSSDSEIMKIENGTRKNPN
FT                   WATLCEIARALNFHPFEILLAAGYISENDMHPNCQIHGLENLDDEGVAMVQLFIDFLTM
FT                   RNGNKIGISKEGE"
FT   gene            384814..385866
FT                   /locus_tag="BCE_0365"
FT                   /old_locus_tag="BCE0365"
FT   CDS_pept        384814..385866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0365"
FT                   /old_locus_tag="BCE0365"
FT                   /product="DNA-cytosine methyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF00145;
FT                   match to protein family HMM TIGR00675"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39301"
FT                   /db_xref="GOA:Q73EJ3"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EJ3"
FT                   /protein_id="AAS39301.1"
FT                   /translation="MIFRLGELFCGPGGIAWGAMNASIEDPNFAIVHQWANDYDADTCE
FT                   TYRLNICPDTPNTVYHADIRKFDMSKLAPIDALAFGFPCNDYSVVGEQKGMDGVFGPLY
FT                   SYGVKALKLFKPKWFLAENVGGLRNANDGKAFTKILKELREAGYTITPHLYKFEEYGVP
FT                   QARHRLIIVGIRDDIDVEFKVPSTAPYVGIDNTCKNAIENPPIPEDAYNNELTRQSETV
FT                   VRRLQHILPGQNAFTADLPEDLRLNIRGAKISQIYKRLDPTKPSYTVTGSGGGGTHIYH
FT                   WEEPRALTNRERARLQTFPDTYRFVGSKESVRKQIGMAVPCQGAKIIFEAILKCFAGIE
FT                   YESVEPSIKE"
FT   gene            complement(385875..385976)
FT                   /locus_tag="BCE_0366"
FT                   /old_locus_tag="BCE0366"
FT   CDS_pept        complement(385875..385976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0366"
FT                   /old_locus_tag="BCE0366"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39302"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EJ2"
FT                   /protein_id="AAS39302.1"
FT                   /translation="MEEQMLPFTKSTMSSTLWISMYKQSSYFAFSTK"
FT   gene            complement(385909..386865)
FT                   /locus_tag="BCE_0367"
FT                   /old_locus_tag="BCE0367"
FT   CDS_pept        complement(385909..386865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0367"
FT                   /old_locus_tag="BCE0367"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39303"
FT                   /db_xref="InterPro:IPR019065"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EJ1"
FT                   /protein_id="AAS39303.1"
FT                   /translation="MFTNNIAKRILFAPPLQGADTLLILSGYATPNMASWLIKSFQEQN
FT                   MHPLNISLLIGMVPYDGLSVPIHEGFMELHGKTYPKAVDSFSCSYVCENPPVHANLYIW
FT                   LKEESPVQAYTGSADFVQNAFIQSRKEIVVCCDPKEAYKFYEEVEANSIYCNHAEVEDH
FT                   IVLRPTHQILDAENKPLTTLAGEGITSTTLSLLTNKGEVGEKSGLNWGQRKGRNKNEAY
FT                   IHLPAKIARSGFFPLNKQHFTVITDDGHTLLLRVEQQNDKAITTPLSNAQLGEYFRNRL
FT                   GLGNGAFVTKQDLLNYGRTDVTFYKIDDEQYFMDFHV"
FT   gene            complement(386880..388742)
FT                   /locus_tag="BCE_0368"
FT                   /old_locus_tag="BCE0368"
FT   CDS_pept        complement(386880..388742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0368"
FT                   /old_locus_tag="BCE0368"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39304"
FT                   /db_xref="InterPro:IPR018310"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EJ0"
FT                   /protein_id="AAS39304.1"
FT                   /translation="MQYLKKYLQKIKERGNEKLAESISKTAEDIGNQHIRNFSFISHEI
FT                   GLLFGNVQSGKTGQMFGVMCKAADLGFPAFILLTTDNVVLQQQTLDRVRDDLDGFCICG
FT                   ENDSGLFIENSLVKPAIVVLKKNARVLRLWANVFNSTGFMKGNPLFIVDDEADAASLNT
FT                   LINRNSQSSINRYLDSIKNGASSSLYLQVTGTPQAILLQTLASGWHPYFTYYFHPGDGY
FT                   LGGDFFFPTSGKPECIDFLETIKRPTRSVVIRHLAVSAQILASKGKVSNCLLHPSVRQN
FT                   VHQRFADDVAKELDWCMEHINTEFITELQTHYDSLEPNKSEKLSFEVIYKTTKDLLENK
FT                   GIKILVMNGKTDVESPDYATGCNFIVGGNTLGRGVTFPGLQTIYYTRTSKKPQADTMWQ
FT                   HSRMFGYDRDSGMMKIFIDEQLYKLFADINATNNAIIAQVEQGIENIKIYYPIGLNPTR
FT                   RNVIDNKRVNILSGGTNYYPFYPDNNTIDDISKLLEPFSNDDPYYQVNLRLIKKILSHI
FT                   IASPDFKLDAFLSVIDTLLSEQPAGQGILIVRRGRDVAQGTGALLSPNDWKLGGTFHDK
FT                   VVLTMYQVTGTKGWGGKAIWVPNIKLPHDTMYYDVSEDDIEEEA"
FT   gene            complement(388754..389902)
FT                   /locus_tag="BCE_0369"
FT                   /old_locus_tag="BCE0369"
FT   CDS_pept        complement(388754..389902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0369"
FT                   /old_locus_tag="BCE0369"
FT                   /product="restriction endonuclease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39305"
FT                   /db_xref="GOA:Q73EI9"
FT                   /db_xref="InterPro:IPR019065"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EI9"
FT                   /protein_id="AAS39305.1"
FT                   /translation="MKLLYSNILPLGTSEGQQTIINCFNEQIAKSDRVEIAVGYISRVA
FT                   LEELDNLVEEHNISSICLTIGMYFIEGMPEGSYNTALEINKKWTETGIGEIKIVKAFKY
FT                   HGKVYCFYKDGQPFSAIIGSANLGVIKLDANNRRQYEISSVTDDATECKEIAEFLEKLK
FT                   AQNCSDNIANIIGMPIVREVNTSLSGIDTVTQIPQTGVQLYEQHKTDVSFVLPLKVPAY
FT                   DERHMDDGKHFTKSNINVSYAAPRSKRKSRDWYETQLTVSKAITRSEGYPEKNKPFFVV
FT                   TDDGYWFKAHTTSDGNKQFSAVGDELILGRWIKGRLAAAGLVTPVNDTQADTDRKGMIT
FT                   KEMLQAYGCDSLVLSKTDQKALDEDGTELDVWVLSFETITNE"
FT   gene            complement(389907..390137)
FT                   /locus_tag="BCE_0370"
FT                   /old_locus_tag="BCE0370"
FT   CDS_pept        complement(389907..390137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0370"
FT                   /old_locus_tag="BCE0370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39306"
FT                   /db_xref="GOA:Q73EI8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EI8"
FT                   /protein_id="AAS39306.1"
FT                   /translation="MSISYKKLWKLLIDRDMKKKDLREAAGISTASMAKLGKNENVNTD
FT                   ILIKVCKALNCDISDIMEIEKTTETPPKTKE"
FT   gene            390369..392207
FT                   /locus_tag="BCE_0371"
FT                   /old_locus_tag="BCE0371"
FT   CDS_pept        390369..392207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0371"
FT                   /old_locus_tag="BCE0371"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39307"
FT                   /db_xref="GOA:Q73EI7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EI7"
FT                   /protein_id="AAS39307.1"
FT                   /translation="MDGRFYNEIFSAIQTYATDNCEDLDLRLYRVQNIGGIELSDIEVK
FT                   FVSVNDLPDMKIEFDVAVEAEFEVRESNHRYDESENCRQWFMLECSGDLDCNLDDFSIS
FT                   SITEYTSKNKQPKPMSDSLVPIIHKEQLESVATDFLRRHYPEALKTPMAVEPQVLAEKM
FT                   GLTVEMREITKDFSVFGQIYFHDCDAEFYNVDIDEMVQTRVSGRTIIVDPKAYFLRNLG
FT                   SVNNTIVHECVHWDQHRKAFELERLYNSSATRIKCQVVGGIKDNTRDATDWMEWQANAL
FT                   APKIQMPLAMFKTQAFKFIKQFRSELGTSELIDVMEPVIDALATFFSVSRTAAKIRMID
FT                   AGYEEAIGTFTYIDGRYVKPHRFKKGALERNQTFSIGAEDAAIQSITNPEMAALVRDGS
FT                   YIYVDSHFVLNHPKYITQDIFGQTVLSNYARTHMDECCLVFELSVKSGCKERYYTECFL
FT                   NRDKTSNIDFDIKYCNGFEYAAPEKKAQLLAETIAEEMRIYNELPNSYTSSLKIVRKWR
FT                   KVTYNELAEEIMVNERTIRRIVNGEEPGSINSIVLICLGLHLPPKISNHIISNSPFSLN
FT                   FNNNSHIWYDFALTHLYPKSMDEIRTFLQEHGAEPL"
FT   gene            392548..393213
FT                   /locus_tag="BCE_0372"
FT                   /old_locus_tag="BCE0372"
FT   CDS_pept        392548..393213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0372"
FT                   /old_locus_tag="BCE0372"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39308"
FT                   /db_xref="InterPro:IPR011517"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EI6"
FT                   /protein_id="AAS39308.1"
FT                   /translation="MLCVAIKVPYLVALIFRTKGLCTSRHRPIFVSFAANAVRRKGCKM
FT                   KIRIQHENKSIYLEVPDEDFTLMIDADYEDRLSSVEEKETVARRSPQEIMDERFNKPEY
FT                   NNWHKFDRHRGMPKKPFRKDDESEDATDHMDYFPDNTDEVTREKQEEYEYLCEIIRKTL
FT                   KEKQAELLIAIFLDGVSVTEYAEREGVSKSAISHRLDTAKKNFKKVFPESSTFPSCHG"
FT   gene            393260..393478
FT                   /locus_tag="BCE_0373"
FT                   /old_locus_tag="BCE0373"
FT   CDS_pept        393260..393478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0373"
FT                   /old_locus_tag="BCE0373"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39309"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EI5"
FT                   /protein_id="AAS39309.1"
FT                   /translation="MKHNLKISVSKTPQSGGIVSCRNVTIRERFLRFLLGDKQKLTILV
FT                   PGDTVQELAISEIKEGGLNHEQNQTTS"
FT   gene            393453..393776
FT                   /locus_tag="BCE_0374"
FT                   /old_locus_tag="BCE0374"
FT   CDS_pept        393453..393776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0374"
FT                   /old_locus_tag="BCE0374"
FT                   /product="rRNA biogenesis protein rrp5, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39310"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EI4"
FT                   /protein_id="AAS39310.1"
FT                   /translation="MSKIKLLLDVVSDMRSLADSIQAVADAMAGNEPVEAKEPTSPVKE
FT                   PAPKKKEITLEEVRAKLAEKSQAGLTAQVREIIQKYGGSKLSEVDPKHYADMLKDAEVL
FT                   GNE"
FT   gene            393769..394857
FT                   /locus_tag="BCE_0375"
FT                   /old_locus_tag="BCE0375"
FT   CDS_pept        393769..394857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0375"
FT                   /old_locus_tag="BCE0375"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39311"
FT                   /db_xref="InterPro:IPR021229"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EI3"
FT                   /protein_id="AAS39311.1"
FT                   /translation="MSDHAVLSASGSHRWLNCLPSARLELEFENNESNAAAEGTAAHAL
FT                   CEHKLKKALHMRSKRPVSTYNNDEMEEHSDAYVEFVMEQFELAKQSCTDPLILIEQRLD
FT                   FSCYVPQGFGTGDCIIIGDKKLHIIDFKYGMGVLVDAVDNPQMKLYALGALEIYDSLYD
FT                   IEEVSMTIFQPRRENVSTWTIPVKELKDWAENELKPKAKKAYEGEGDYLPGEWCTFCRA
FT                   AVKCRARAEEKLKLAQMEFKLPPLLTDSEIEEVLSKLSDLTKWANEIISYATDAAVNHG
FT                   KEWHGFKVVEGRSIRKYKDEEAVAEAAKANGYKDIYRQSLITLTEMQKLMVSRNFKKSS
FT                   VVSYINHQVSQRWFHFRISGQL"
FT   gene            394909..395457
FT                   /locus_tag="BCE_0376"
FT                   /old_locus_tag="BCE0376"
FT   CDS_pept        394909..395457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0376"
FT                   /old_locus_tag="BCE0376"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39312"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022595"
FT                   /db_xref="PDB:4JG2"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EI2"
FT                   /protein_id="AAS39312.1"
FT                   /translation="MNNQNRTKVVTSVNTRLSYFHGWEPVSINGGAEKYSVSVLIPKTD
FT                   KETINAINAAVDAAIEEGIAKFGGKKPNKAAIKLPLRDGDVERDDEAYKGHYFVNANSK
FT                   TPPQIVDKAVRPILDRNEVYSGCYARVSLNFYAFNSNGNKGVACGLGNIQKIRDGEPLG
FT                   GRTNAADDFTTIEDDDFLA"
FT   gene            395530..397464
FT                   /locus_tag="BCE_0377"
FT                   /old_locus_tag="BCE0377"
FT   CDS_pept        395530..397464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0377"
FT                   /old_locus_tag="BCE0377"
FT                   /product="DNA polymerase I"
FT                   /note="identified by similarity to SP:P06225; match to
FT                   protein family HMM PF00476"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39313"
FT                   /db_xref="GOA:Q73EI1"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EI1"
FT                   /protein_id="AAS39313.1"
FT                   /translation="MNSISIDIETFSGANLQKSGVYRYAESDDFEILLFGYSVDGGEVQ
FT                   VVDLACGEEIPDEIINALLDDSVTKWAFNAMFERVCLSKWLNLTEYLDPASWKCSMIWS
FT                   AYMGLPLSLEGVGAVLGLEKQKLTEGKDLIKYFCTPCSPTKSNGGRVRNLPEHDMDKWE
FT                   RFKAYNLRDVEAEMSIQQRFSKFLVPENIWEEYHLDQEINDRGIAIDMTFVKQAVVMDE
FT                   HSREKLMALMQDITNLENPNSVQQMKDWLADNGLETDTLGKKAVAEMLKTAPEPLGTVL
FT                   ELRQQLAKSSVKKYTAMENAVCNDGRARGMFQFYGANRTGRFSGRLIQLQNLPQNHMPD
FT                   LEQARALVRSGNFDALTLLYDSIPEVLSELIRTAFIPREGMKFIVADFSAIEARVIAWL
FT                   AGEKWRIDVFQNGGDIYCASASQMFNVPVEKHGVNGHLRQKGKIAELALGYGGSVGALK
FT                   SMGALEMGIEEEELQPLVTAWRQSNPNITKLWWDVDRAVKTCVKQKTPTETHGIKFIYQ
FT                   SGMLFIALPSGRRLAYVKPRMGENMFGGESVTYEGVGGTKKWERIESYGPKFVENIVQA
FT                   ISRDILCHAMQTLKNCSIVAHVHDEIIIEADMGTSLSAICEQMAKMPTWANGLLLSADG
FT                   YECQFYQKD"
FT   gene            complement(397749..398348)
FT                   /locus_tag="BCE_0378"
FT                   /old_locus_tag="BCE0378"
FT   CDS_pept        complement(397749..398348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0378"
FT                   /old_locus_tag="BCE0378"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39314"
FT                   /db_xref="GOA:Q73EI0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EI0"
FT                   /protein_id="AAS39314.1"
FT                   /translation="MPKIVDHDEKRKQIAEAAWNIIRKEGVEKASIRRVAAEAGMSSGA
FT                   LRHYFSTQDEMLLFIMNYYLEEGEKRSQNKEWSENPVQAVEEVLLELVPIDEEKKIETS
FT                   VWWILALRSLTSDTIKDKKDEMTDGTYELANSMIEILALKGVLSDSMNAELEKSRLTAL
FT                   IEGLSIHALLRPDVYSPEKVKEVIRYHLETLCNKIN"
FT   gene            398476..399165
FT                   /locus_tag="BCE_0379"
FT                   /old_locus_tag="BCE0379"
FT   CDS_pept        398476..399165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0379"
FT                   /old_locus_tag="BCE0379"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39315"
FT                   /db_xref="GOA:Q73EH9"
FT                   /db_xref="InterPro:IPR021315"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EH9"
FT                   /protein_id="AAS39315.1"
FT                   /translation="MPSSSLDISSALMIISLCALIDILSPGVLTVTAYLLLTQPNQLSS
FT                   RLFVFLFITQLGYFITGLLLYFGGNSLLKRIEQLSQFDFINWFYILLGAVLVLISFSKP
FT                   KETAKKRLISFIPKNTTIKGMIILGIIVFLIEFVTALPYFYSIFLMNHQTIETTPAILI
FT                   IIGYNLVMVLPSLLLLGVNIIFKERLQQFLIKIRSKLNEAPISSLLVATGVIGAVFFNI
FT                   GLRGILN"
FT   gene            399191..399409
FT                   /locus_tag="BCE_0380"
FT                   /old_locus_tag="BCE0380"
FT   CDS_pept        399191..399409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0380"
FT                   /old_locus_tag="BCE0380"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39316"
FT                   /db_xref="GOA:Q73EH8"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EH8"
FT                   /protein_id="AAS39316.1"
FT                   /translation="MKEIISGLSLLFIIQGIGGLINHLTNGGKSWFLVNYIDAFQGFEI
FT                   VLDIVFIAVGGIIALATRKITSSKSNK"
FT   gene            complement(399310..399492)
FT                   /locus_tag="BCE_0381"
FT                   /old_locus_tag="BCE0381"
FT   CDS_pept        complement(399310..399492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0381"
FT                   /old_locus_tag="BCE0381"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39317"
FT                   /db_xref="GOA:Q73EH7"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EH7"
FT                   /protein_id="AAS39317.1"
FT                   /translation="MVEPRGESIKIKNTEREILTLYFLFYIIHLLLLLDVILRVAKAMI
FT                   PPTAINTMSKTISNP"
FT   gene            399794..400546
FT                   /locus_tag="BCE_0382"
FT                   /old_locus_tag="BCE0382"
FT   CDS_pept        399794..400546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0382"
FT                   /old_locus_tag="BCE0382"
FT                   /product="phage antirepressor protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39318"
FT                   /db_xref="GOA:Q73EH6"
FT                   /db_xref="InterPro:IPR005039"
FT                   /db_xref="InterPro:IPR013557"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EH6"
FT                   /protein_id="AAS39318.1"
FT                   /translation="MDELVKINYENQRPTVLGRDLHEALEVKTAYKDWFPRMCEYGFEE
FT                   GSDFSSFLSESTGGRPSIDHQLTIDMAKELCMIQRTPKGKECRQYFLEIERRWNSPEAI
FT                   MARALQIANQQLTQVRKQNKVLEGTIAVQNQQIAEMKPKVSYYDVVLNCKDLISTSAIA
FT                   KDYGKSAIWMNRYLNKKGVQFKQGGIWLLYQKYAEKGYTSTKTHSYLGSNGQQHTKVHT
FT                   YWTQKGRLFIYELMKADGILPQIEMEGV"
FT   gene            400546..400980
FT                   /locus_tag="BCE_0383"
FT                   /old_locus_tag="BCE0383"
FT   CDS_pept        400546..400980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0383"
FT                   /old_locus_tag="BCE0383"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39319"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EH5"
FT                   /protein_id="AAS39319.1"
FT                   /translation="MGINKFNHEGYHDPTPHEALTNIMKKEKAEKKSAFKPLVYICSPY
FT                   SGDVEGNIKKARSFCRFALDQNCIPIAPHLMFPQFMDDENPEERELAIFMDIVLMGKCS
FT                   EVWVLGNTISTGMAREIEVAKKRRQTVRYFSPEHEEVESL"
FT   gene            400977..403343
FT                   /locus_tag="BCE_0384"
FT                   /old_locus_tag="BCE0384"
FT   CDS_pept        400977..403343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0384"
FT                   /old_locus_tag="BCE0384"
FT                   /product="virulence-associated protein E"
FT                   /note="identified by match to protein family HMM PF05272"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39320"
FT                   /db_xref="InterPro:IPR007936"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EH4"
FT                   /protein_id="AAS39320.1"
FT                   /translation="MKIAVGNSRMDRKWKNKDISWEDFCSRVKTTQRTTETVEEYRKLK
FT                   RGQQDDIKDVGGFVGGHLKEGRRKKGNVLCRSLLTLDMDYGRPDIWEQISMLFDFKCCV
FT                   YSTHKHTPENPRLRLIVPLAREISEEEYAAVGRMVAKEIGIDLFDDTTYEAHRLMYWPS
FT                   TSSNGQFVYEEQDGALLDPDIYLSKYENWRDTTTWPVSSRQSEVINRSLKEQADPLLKE
FT                   GVVGTFCRAYSVREAIEKFLGTVYEASAMEGRYDYIPADSSAGVIIYDDKFAYSHHATD
FT                   PASGLLLNAFDLVRIHKFGSLDDRASTTTAPGRMPSFVAMCEFAIKDEAVKAEFAKERK
FT                   AQAEEEFSDEDWQTGLELDKQGRIKDTLDNIVLIIRHDEDLQHIAFNCHRDGIDAKGGL
FT                   PWEQIKCGWNDSDNALLKVYLSGKYGVYSPTKTKDAVLAVAAERAYHPVKEYLDSLPKW
FT                   DGISRVENLLIDYFGATDNSYTKATIRKTMVAAVARIYRPGTKFDSVLILNGPQGIGKS
FT                   TFFAKLAGDWFSDSLTITDMKDKSGAEKLQGYWLLELGELAGMRKTDVEIVKSFISRAD
FT                   DKYRASYGVNVESHPRQCVIVGSTNAESGFLRDITGNRRFWPVRISGNSRKKAWQMTKE
FT                   EVQQIWAEALVLYEKGEKLYLEGDDVTMATSEQADAMETDEREGLVRTYLDTLLPDDWD
FT                   TMSLYERRNFLGGSEFGGGTRVGTVKRTLVCNMEIWCECFGKEASMLKPSDSYAIGAIM
FT                   RKISEWNKYTGNKNGVVTFPVYGKQRAYSRVEEQR"
FT   gene            403562..403843
FT                   /locus_tag="BCE_0385"
FT                   /old_locus_tag="BCE0385"
FT   CDS_pept        403562..403843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0385"
FT                   /old_locus_tag="BCE0385"
FT                   /product="phage protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39321"
FT                   /db_xref="GOA:Q73EH3"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR014883"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EH3"
FT                   /protein_id="AAS39321.1"
FT                   /translation="MLEKYIEKKLVAEVKKMEGIAAKFVSPGLDGMPDRIVLLPHGKMA
FT                   FIELKAPGKKPRPLQIRRIRQLQKLGFTCYVIDDVKQIGGVLGEIQSS"
FT   gene            403824..405185
FT                   /locus_tag="BCE_0386"
FT                   /old_locus_tag="BCE0386"
FT   CDS_pept        403824..405185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0386"
FT                   /old_locus_tag="BCE0386"
FT                   /product="phage-associated helicase"
FT                   /note="identified by match to protein family HMM PF00176"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39322"
FT                   /db_xref="GOA:Q73EH2"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EH2"
FT                   /protein_id="AAS39322.1"
FT                   /translation="MKYNPHKYQTYATNFILEHPIAAVFLEMGLGKSVITLTAIFDLCL
FT                   DSFEIGKVLVIAPLRVARDTWPAEINKWEHLKGLEFSVAIGTKQERLAALRKPASVYLI
FT                   NRENVDWLVNKSGIPFDYDMVVIDELSSFKSYGAKRFKSLLKVRPRAKRIVGLTGTPSS
FT                   NGLMDLWAEFRILDMGKRLGRYITHYRNSFFTPDKRNQQIVFSYKPLPGAEDAIYQLIS
FT                   DITISMESVDFLKMPECMINEVPVYLNDKEQSVYDRFREEMVLEFADEEIDAMNAAVLS
FT                   GKLLQMANGAIYDDDKNTHIIHDRKLDALEDLIEGANGKPVLIAYWYNHDLERIKAKFN
FT                   VREIKTSKDIKDWNNGDISVAVIHPASAGHGLNLQSGGSTLIWFGLTWSLELYQQTNAR
FT                   LWRQGQNETVVIHHIITKGTIDEDVMNALRRKEKTQSDLINAVKANLGKARDAV"
FT   gene            405185..405403
FT                   /locus_tag="BCE_0387"
FT                   /old_locus_tag="BCE0387"
FT   CDS_pept        405185..405403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0387"
FT                   /old_locus_tag="BCE0387"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39323"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EH1"
FT                   /protein_id="AAS39323.1"
FT                   /translation="MDAFEKLANAIILQAVKDYRFALKRLAKHPRNDSALYTKREVECF
FT                   FHSELFNVLTSLNPDMLIQQLQEEVVR"
FT   gene            405400..405813
FT                   /locus_tag="BCE_0388"
FT                   /old_locus_tag="BCE0388"
FT   CDS_pept        405400..405813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0388"
FT                   /old_locus_tag="BCE0388"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39324"
FT                   /db_xref="InterPro:IPR010861"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EH0"
FT                   /protein_id="AAS39324.1"
FT                   /translation="MMTAKEFLKQAYRLNELINSDLEELQNLRELSRSVSSPVLEEKVS
FT                   RTKCTDPPFEKYVIRIVDLEQQIQQEVERLVKLKSDIREAINQMENVDEKLILRYRYIN
FT                   FLNWEEICVNLNVSMRTVHRLHSSALQHLKVPK"
FT   gene            405970..406329
FT                   /locus_tag="BCE_0389"
FT                   /old_locus_tag="BCE0389"
FT   CDS_pept        405970..406329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0389"
FT                   /old_locus_tag="BCE0389"
FT                   /product="HNH endonuclease domain protein"
FT                   /note="identified by match to protein family HMM PF01844"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39325"
FT                   /db_xref="GOA:Q73EG9"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EG9"
FT                   /protein_id="AAS39325.1"
FT                   /translation="MPKKPKRPCSYPGCPELTDRRFCEEHAKKEAARYEKYDRDPATRK
FT                   RYGRAWKRIRDSYIAAHPLCEECKRQGKLTPANEVHHILPLARGGTHDRSNLMALCTPC
FT                   HSAITARDGDRWGTR"
FT   gene            406441..406992
FT                   /locus_tag="BCE_0390"
FT                   /old_locus_tag="BCE0390"
FT   CDS_pept        406441..406992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0390"
FT                   /old_locus_tag="BCE0390"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39326"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EG8"
FT                   /protein_id="AAS39326.1"
FT                   /translation="MAKDGTNRGGARIGSGQKKKPLADKIAEGNPGKRKLEVVEFQNTA
FT                   DLKGQEMPKPMAMLSAVQKDGKTLVASEIYEITWKWLEERGCAHLVLPQLLERYAMSAA
FT                   RWIQCEEAVTEFGFLAKHPTTGNAIQSPYVAMSQNFMSQTNRLWMEIYQIVRENCATEY
FT                   SGLNPQDDVMERLLSARRGK"
FT   gene            406881..408188
FT                   /gene="metK"
FT                   /locus_tag="BCE_0391"
FT                   /old_locus_tag="BCE0391"
FT   CDS_pept        406881..408188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="BCE_0391"
FT                   /old_locus_tag="BCE0391"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="identified by similarity to SP:P54419; match to
FT                   protein family HMM PF00438; match to protein family HMM
FT                   PF02772; match to protein family HMM PF02773; match to
FT                   protein family HMM TIGR01034"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39327"
FT                   /db_xref="GOA:Q73EG7"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EG7"
FT                   /protein_id="AAS39327.1"
FT                   /translation="MDGDISNRSRELCYRVFWFKPTGRRDGTTAICPQRKIKIRRYDVM
FT                   SKRYLTAESVCAGHPDKLCDIIADSILEACLRKDRASRVACEVIATKGKIIVAGEISCS
FT                   GKIDIRCIVRNVLKEIGYNPLKFLIYVYIHSQSVDIAAGVNTALEVRNGINEQYGSIGA
FT                   GDQGTMYGYATKETREMLPLPLVLSHRIVKRLDDCRKGKLIKGILPDGKAQVTVEYEAD
FT                   TPVRIKTIVISVQHDKNKTQEELKADILNNVLWQCFEDFPFDDETEILINPSGQFVLGG
FT                   PAADTGLTGRKIMVDTYGGLASHGGGALCGKDPTKVDRSGAYMARYIAKHIFWCGYAKK
FT                   CEVSISYAIGKANPVAFTVNTLGTGTISDEILTLAAQETFNLRPAAIIEKLRLRNVIYS
FT                   DTAAYGHFNSCLFPWEDVNKYSEFRKAVEKYVDRED"
FT   gene            408169..409410
FT                   /locus_tag="BCE_0392"
FT                   /old_locus_tag="BCE0392"
FT   CDS_pept        408169..409410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0392"
FT                   /old_locus_tag="BCE0392"
FT                   /product="DNA methylase, family protein"
FT                   /note="identified by match to protein family HMM PF01555;
FT                   match to protein family HMM PF02195"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39328"
FT                   /db_xref="GOA:Q73EG6"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR015840"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EG6"
FT                   /protein_id="AAS39328.1"
FT                   /translation="MLIEKIKTKQLIPAEYNPRKDLKPGDSEYEKLKRSLEEFGYVEPV
FT                   IWNKTTGRVIGGHQRLKVLLSMGIDEIECVVVEMDEQKEKALNIALNKISGDWDKDKLA
FT                   LLITDLNASDFDVSLTGFDPGELDDLFKDSLKDNIKEDDFDVDSELKKPAVSHLGDIWL
FT                   LGQHRLVCGDSTKKDTFDVLMDGKAANLVVTDPPYNVNYEGTAGKIKNDNMANEAFYDF
FT                   LLAAFQNTEAAMAKDASIYVFHADTEGLNFRRAFSDAGFYLSGTCIWKKQSLVLGRSPY
FT                   QWQHEPVLFGWKKKGKHLWYSDRKQTTIWEFEKPKKNGDHPTMKPVALVAYPIMNSSLS
FT                   NCIVLDPFGGSGSTLIACEQTDRICYTIELDEKYCDVIVKRYIEQVGNSDGVFLLRDRL
FT                   KFRYCDLPEVNEDE"
FT   gene            409403..411562
FT                   /locus_tag="BCE_0393"
FT                   /old_locus_tag="BCE0393"
FT   CDS_pept        409403..411562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0393"
FT                   /old_locus_tag="BCE0393"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /note="identified by match to protein family HMM PF00145;
FT                   match to protein family HMM TIGR00675"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39329"
FT                   /db_xref="GOA:Q73EG5"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EG5"
FT                   /protein_id="AAS39329.1"
FT                   /translation="MSKLTLGSLFDGSGGFPLGGLLCGIEPLWASEIEPFPIRVTTKRI
FT                   PQMKHYGDINKLNGAELPPVDIITFGSPCTDMSVAGKRAGLDGEQSVLFYEAIRIIKEM
FT                   RCKTNGQYPRYAVWENVPGAFSSNKGEDFKAVLETVISVKEPNTSVPLPEKGRWPYADI
FT                   YMGDGWSVAYRTIDAQYFGVPQRRRRIYLVADFADGCAGEILFESEGLSRDFTPSGSPW
FT                   QRTAGNAKNRSGKTGDSITCLNDQGGRVMSVSKDITATLRAEEHGHQPCVMQSSGFCTE
FT                   HSAKSRSVGYEEERSPTLRTGVVPGAVMSFEPGAASRVGGHTDENLSGSLRANMGDNQT
FT                   AVVIENHPTDSRVKLSEDNKVQTLTSRMGTGGGNVPLIMNTPKTLKIRSGCEGGGKGAL
FT                   IQDDKSATLGCNNDQTVFVPTAYGICSDKSNSMQSSNPHSGIYEADTSRTIDANGGNPG
FT                   CNQGGIAVVALQGSMIGREDKNGPQGSGIDEDVSFTLNTADRHAVAYAMTTGAYAQVEE
FT                   DKAPTLLSRDYKDAPVVTQPSYGIDRAAFNQGQNALYKPTIDEEQQPTLTAKGPGAVAQ
FT                   PASFYPQMKAESQCYRQDGTSNTIINGTNPGYQNGLVEPDYIVRRLTPTECARLQGFPD
FT                   DWCDDLGTENPTEDEISFWTEVWETHRKIIGKSKKPKTRNQIIKWLNNPHSDSAEYKMW
FT                   GNGVALPCVCFVLTGIVLSTQNTAD"
FT   gene            411657..412355
FT                   /locus_tag="BCE_0394"
FT                   /old_locus_tag="BCE0394"
FT   CDS_pept        411657..412355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0394"
FT                   /old_locus_tag="BCE0394"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39330"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EG4"
FT                   /protein_id="AAS39330.1"
FT                   /translation="MKMQINYNVTGPKRKALVNAISQELNAPVKYLGAPTFAYEVADYN
FT                   VNKNGVLSGPDNKELVDDLLRFHDLKAISEEFDTPLPKAEVNEREESINLIIQMPRADF
FT                   TDTAIENLKGLVESKATLIKKALDTDSIPIIEDEEYVTFPWFQGKCASEEVKAYTHFVT
FT                   ALCEMAKKQTRVNSTEKSVENEKYAFRCFLLRLGFIGPEYKMGRKILLSRLSGSSAFKS
FT                   GTFKQEVSEQ"
FT   gene            412352..412579
FT                   /locus_tag="BCE_0395"
FT                   /old_locus_tag="BCE0395"
FT   CDS_pept        412352..412579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0395"
FT                   /old_locus_tag="BCE0395"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39331"
FT                   /db_xref="InterPro:IPR025463"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EG3"
FT                   /protein_id="AAS39331.1"
FT                   /translation="MNIIHPEMLKQLRSYYTPGTRVMLLKMHDPYTKLQTGSKGTVTSV
FT                   DDIGTIHVSWDSGGSLGVAFGEDLCKKIEE"
FT   gene            412658..412846
FT                   /locus_tag="BCE_0396"
FT                   /old_locus_tag="BCE0396"
FT   CDS_pept        412658..412846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0396"
FT                   /old_locus_tag="BCE0396"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39332"
FT                   /db_xref="InterPro:IPR032488"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EG2"
FT                   /protein_id="AAS39332.1"
FT                   /translation="MNEIIKEQILSIRESGVTNMFDVNRVQYEANERGFYELVVYIIDH
FT                   KAEYAHFILTGEVDENK"
FT   gene            412935..414539
FT                   /locus_tag="BCE_0397"
FT                   /old_locus_tag="BCE0397"
FT   CDS_pept        412935..414539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0397"
FT                   /old_locus_tag="BCE0397"
FT                   /product="phage terminase, large subunit, putative"
FT                   /note="identified by match to protein family HMM PF03354"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39333"
FT                   /db_xref="InterPro:IPR005021"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EG1"
FT                   /protein_id="AAS39333.1"
FT                   /translation="MRKLKKYKPTAFIADGSYYDEDAADYAVAFIEALSHTKGLWAGKP
FT                   FELIDWQEQIIRDLFGILKPDGYRQFNTAYVEIPKKMGKSELAAAIALLLTCGDGEERA
FT                   EVYGCAADRQQASIVFEVAADMVRMCPALNKRVKLLASTKRLVYLPTNSFYQVLSAEAY
FT                   SKHGFNIHGVVFDELHTQPNRKLFDVMTKGSGDARTQPLYFLITTAGTDTQSICYETHQ
FT                   KAVDIIEGRKYDPTFYPVIYGAKEEDDWTDPKVWKKANPSLGITVGIDKVRAACESAKQ
FT                   NPAEENSFRQLRLNQWVKQSVRWMPMAKWDACAFPVIPESLEGRVCYGGLDLSSTTDIT
FT                   AFVLVFPPEDETDKYIVLPYFWMPEDNIDLRVRRDHVQYDLWEKQGYILTTEGNVVHYG
FT                   YIERFIEELGEKYNIREIAFDRWGAVQMVQNLEGAGFTVVPFGQGFKDMSPPTKELMKL
FT                   TLEERIAHGGHPVLRWMMDNIFIKTDPAGNVKPDKEKSTEKIDGAVATIMALDRAIRCG
FT                   SGNSGDSVYDERGLIVF"
FT   gene            414584..415828
FT                   /locus_tag="BCE_0398"
FT                   /old_locus_tag="BCE0398"
FT   CDS_pept        414584..415828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0398"
FT                   /old_locus_tag="BCE0398"
FT                   /product="phage portal protein, HK97 family"
FT                   /note="identified by match to protein family HMM PF04860;
FT                   match to protein family HMM TIGR01537"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39334"
FT                   /db_xref="InterPro:IPR006427"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EG0"
FT                   /protein_id="AAS39334.1"
FT                   /translation="MNLIKGLFRSRDKPQNRVGSAFSFLFGGTSSGKMVNERTAMQATA
FT                   VYACVRILAEAIAGLPLHVYRYRSDGGKERIPFHPLYYLLHDEPNPEMTSFVFRETLMS
FT                   HLLLWGNAYAQVVRNGRGQAVALYPLLPNKMEVSRATNGELVYTYYRDTDESGLNPKGG
FT                   YVTLRKDEVLHIPGLGFDGLIGYSPIAMAKNAIGMSLATEEYGAAFFANGANPGGVLEH
FT                   PGVIKDIQRVKDSWNSAYQGTGNAHKIAVLEEGMKFQAIGIPPEQAQFLETRKFQINEI
FT                   ARIFRVPPHMVGDLEKSSFSNIEQQSLEFVKYTLDPWVVRWEQSLQQSLILPSEKTSLF
FT                   IKFNLDGLLRGDYQSRMNGYATGRQNGWMSANDIRELEDMNRIPAEEGGDLYLVNGNMT
FT                   KLADAGAFAKTEGGQ"
FT   gene            415829..416518
FT                   /gene="clpP"
FT                   /locus_tag="BCE_0399"
FT                   /old_locus_tag="BCE0399"
FT   CDS_pept        415829..416518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="BCE_0399"
FT                   /old_locus_tag="BCE0399"
FT                   /product="ClpP protease family protein"
FT                   /EC_number="3.4.21.92"
FT                   /note="identified by match to protein family HMM PF00574"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39335"
FT                   /db_xref="GOA:Q73EF9"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EF9"
FT                   /protein_id="AAS39335.1"
FT                   /translation="MRKFWNWVRDSDEERTLYLNGVISEETWWGDEVTPKIFKDELLAG
FT                   TGDITVWINSPGGDVFAAAQIYNMLMEYTGKVTVKIDGLAASAASVIAMAGGDVYMSPV
FT                   SMLMIHNPSTIAIGDSEEMLRAKALLDEVKESIINAYELKTGLSRTKLSHLMDAESWMN
FT                   ANKAIELGFADKIMFMESEAPDLTDSLIFSRMAVTNSLISKLPKQPKQKTGTPIESLDK
FT                   RLSLILH"
FT   gene            416538..417731
FT                   /locus_tag="BCE_0400"
FT                   /old_locus_tag="BCE0400"
FT   CDS_pept        416538..417731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0400"
FT                   /old_locus_tag="BCE0400"
FT                   /product="phage major capsid protein, HK97 family"
FT                   /note="identified by match to protein family HMM TIGR01554"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39336"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EF8"
FT                   /protein_id="AAS39336.1"
FT                   /translation="MSKILELREKRAKAWDAAKAFLDSKRGGDGLLSAEDTTTYEKMEA
FT                   DVVALGKEIERLERQASIDLELSKATSNPITNEPTRTGEEKTGRASAEYKKAFWNAMRD
FT                   NVSYEVRNALKIGTDSEGGFLVPDEFERTLVEALEEENIFRRLANVITTSSGDRKIPVV
FT                   ASKGSASWIDEEGAIPESDDSFGQVSIGAYKLATMIKVSEELLNDSVFNLESYITREFA
FT                   RRIGNKEEEAFFIGDGTGKPTGILNATGGGQVGVTAASATAITLDEVLDLFYSLKAPYR
FT                   NKAVFVMNDATIKAIRKLKDGNGQYLWQPSVQAGTPDTILNRPLYTSSYVPTIEAGAKT
FT                   MVFGDFSYYWVADRQGRVFKRLNELYAVTGQVGFIATQRVDGKLILPEAVKVLQQKA"
FT   gene            417744..417956
FT                   /locus_tag="BCE_0401"
FT                   /old_locus_tag="BCE0401"
FT   CDS_pept        417744..417956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0401"
FT                   /old_locus_tag="BCE0401"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39337"
FT                   /db_xref="InterPro:IPR022741"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EF7"
FT                   /protein_id="AAS39337.1"
FT                   /translation="MSYNTKNYTEQGGEKTVIGGVLEIKEGASVMGLPVAENQADSTAT
FT                   DVAGLVTDFNALLAKLKAAGLMEAD"
FT   gene            417983..418303
FT                   /locus_tag="BCE_0402"
FT                   /old_locus_tag="BCE0402"
FT   CDS_pept        417983..418303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0402"
FT                   /old_locus_tag="BCE0402"
FT                   /product="uncharacterized phage protein (possible DNA
FT                   packaging)"
FT                   /note="identified by match to protein family HMM TIGR01560"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39338"
FT                   /db_xref="InterPro:IPR021146"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EF6"
FT                   /protein_id="AAS39338.1"
FT                   /translation="MAVADNLLPKVKANLILAHDQDDALLIGFITAAVSYAQSYQHVPE
FT                   NYYETHAMPPTTEQAVIMLSSHFYESRDGSTAGFFADSVQAGQQVWNTVNLLLRLDREW
FT                   GV"
FT   gene            418305..418640
FT                   /locus_tag="BCE_0403"
FT                   /old_locus_tag="BCE0403"
FT   CDS_pept        418305..418640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0403"
FT                   /old_locus_tag="BCE0403"
FT                   /product="phage head-tail adaptor, putative"
FT                   /note="identified by match to protein family HMM TIGR01563"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39339"
FT                   /db_xref="InterPro:IPR008767"
FT                   /db_xref="InterPro:IPR038666"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EF5"
FT                   /protein_id="AAS39339.1"
FT                   /translation="MSFGKMNTFIDIISTVPIKDEAGFATKGDNILASVLAYKEDRHGS
FT                   ERWTNMASFSSATSLFRFRKIYGLKVTNEMVIVCDDGRYQILSVEDVRNRGMYVEVLAE
FT                   KLEPTVR"
FT   gene            418646..419077
FT                   /locus_tag="BCE_0404"
FT                   /old_locus_tag="BCE0404"
FT   CDS_pept        418646..419077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0404"
FT                   /old_locus_tag="BCE0404"
FT                   /product="phage protein, HK97 gp10 family"
FT                   /note="identified by match to protein family HMM TIGR01725"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39340"
FT                   /db_xref="InterPro:IPR010064"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EF4"
FT                   /protein_id="AAS39340.1"
FT                   /translation="MAKTNIKMPEEFLLKVSRLADQTDVILPKVLEVGGEVVLDKVKGN
FT                   LSKVVGKGTKYPSKSTGELLSSLGLSGAKQDRNGNFNVKVGFAEPRSDGESNAKLASII
FT                   EYGKHGQPAKPFLKPARNASRKPCINAMVAKLEEEIDKI"
FT   gene            419074..419415
FT                   /locus_tag="BCE_0405"
FT                   /old_locus_tag="BCE0405"
FT   CDS_pept        419074..419415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0405"
FT                   /old_locus_tag="BCE0405"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39341"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EF3"
FT                   /protein_id="AAS39341.1"
FT                   /translation="MNILEELNTLVTAIPLPVETGVFSGLAPDEYVVILPLSDIFEVHA
FT                   DNRPGFDVQEARISLFSKNNYLERKRQLTTALINADFTVTERRYIGHEDDTGYHHYAID
FT                   VAKNYRLEE"
FT   gene            419419..420009
FT                   /locus_tag="BCE_0406"
FT                   /old_locus_tag="BCE0406"
FT   CDS_pept        419419..420009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0406"
FT                   /old_locus_tag="BCE0406"
FT                   /product="phage major tail protein, phi13 family subfamily"
FT                   /note="identified by match to protein family HMM TIGR01603"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39342"
FT                   /db_xref="InterPro:IPR006490"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EF2"
FT                   /protein_id="AAS39342.1"
FT                   /translation="MATIGLDRLYYSKITEDANGEETYAQPSVLAKAITAELSVELVEA
FT                   ILYADDGAAEVVKDFNSGTLTLGVDDIGPMVAADLTGASTDDNGVLISASENVGTPVAV
FT                   GFRAQRANGTYRYFWLYRVKFGLPATNLQTKADSITFSTPTIEGTVMRRNKLDGLGKHP
FT                   WKAEVTEGDPGVSSTTITGWFTEVYEPVYTPEP"
FT   gene            420021..420407
FT                   /locus_tag="BCE_0407"
FT                   /old_locus_tag="BCE0407"
FT   CDS_pept        420021..420407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0407"
FT                   /old_locus_tag="BCE0407"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39343"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EF1"
FT                   /protein_id="AAS39343.1"
FT                   /translation="MDNDRSATINIGDKEYELVLTTRATKAIAGRYGGLENLGEKLMKS
FT                   ENFEMALDEIVWLITLLANQSILIRNLKNKNAPEELLTEEEVELLTSPLDLAAYKTAIT
FT                   EAMFKGTKRNVESEEETPKNVEVG"
FT   gene            420455..420595
FT                   /locus_tag="BCE_0408"
FT                   /old_locus_tag="BCE0408"
FT   CDS_pept        420455..420595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0408"
FT                   /old_locus_tag="BCE0408"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39344"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EF0"
FT                   /protein_id="AAS39344.1"
FT                   /translation="MGMEAEEFWLLPIGLFFDLWACHKQWHGIEKPKKTQTIDDIIPLG
FT                   I"
FT   gene            420610..423030
FT                   /locus_tag="BCE_0409"
FT                   /old_locus_tag="BCE0409"
FT   CDS_pept        420610..423030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0409"
FT                   /old_locus_tag="BCE0409"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR01369"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39345"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EE9"
FT                   /protein_id="AAS39345.1"
FT                   /translation="MADNFGLKIGVEGEREFKKALSEINQSFKVLGSEMALVTSQFDKN
FT                   DKSIQSITARNAVLNKEIDAQKEKISTLKAALDNASSSFGENDRRTQNWQIQLNRAQAE
FT                   LNLMERELEESTIEADNLGEELEDSGKSAEDAGGRFEKLGGVLKGIGVAMGAVAVAAGA
FT                   AAIKLGKEVVTQFGELEQNLGGSEAVFGAYAASIQKTGEEAYKNLGVSQSEYLATANKM
FT                   GALFQGSGIQQQRSLELTEKAMQRAADMASVMGIDMSSALEAVTGAAKGNFDMMDNLGV
FT                   AMNATNIEAYALAKGLDFTWNTATQAEKAEVAMQMFFENTEQYAGNFAKESTETISGSI
FT                   GLLQAALGSFTAGLGNANADMTNLTENLVDAFEAVVTNIVPVLENIVAALPTATGAILA
FT                   AVADLLPMLLELVTNIFAQVLETILSLLPELIPATVSALMTIVGALIDNLPLLINAAIE
FT                   LVTALVEGIGIALPQLIPAAVSAVMQIVQGLMDNLPLILDAALQLIIGLAQGLVEAIPQ
FT                   LTSALPVIIKAIVDFIIASIPQIIDAGIQLLTSLVTALPTIITAVVEAIPQIIDSIISA
FT                   VIGSIPLIIDAGIRLLISLIQALPQIITTVVGAIPKIVSSLVNAIIGNIDKIILAGVQL
FT                   FVALIANLPRIIVEIVKAVPQIISGLVRAFTGYIGQMAQVGGNLIKGLWKGISDAGAWL
FT                   WGKISGFFGNVVSRIKDFFGIRSPSTLFAGIGHNMGEGIGVGFEDAMTAVSRDMQNAVP
FT                   TSFDFNYRGVSGQGNATGSSITQNISVVTPKALSEKELAREFKNLSRKLALEL"
FT   gene            423044..423895
FT                   /locus_tag="BCE_0410"
FT                   /old_locus_tag="BCE0410"
FT   CDS_pept        423044..423895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0410"
FT                   /old_locus_tag="BCE0410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39346"
FT                   /db_xref="InterPro:IPR008841"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EE8"
FT                   /protein_id="AAS39346.1"
FT                   /translation="MELTYTNRDGESITLKQSRPYFLTKVDGTGNIRQTVNTFKAPDQD
FT                   GAFYISSTLDMRNITIEGTVVADTPDEAYKRRQHFLQIFSPKLLGTLQYRERQISCVVE
FT                   EAGFSVSNRQRIPNFFVSLLCPSPFFETLNEVREELASWIPLFEFELEIPMTGMEFGMR
FT                   QPSQIITVENIGDVSCGCEIVFRALGTVSNPELLNIDTGEYIRLLTTMSAGDELRVYTH
FT                   FAGKRVIQVDGSTVTNAFSLLDTNSVFFQLAAGLNTLRYDASVNMELLEVSIYFRPQFL
FT                   GV"
FT   gene            423898..425835
FT                   /locus_tag="BCE_0411"
FT                   /old_locus_tag="BCE0411"
FT   CDS_pept        423898..425835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0411"
FT                   /old_locus_tag="BCE0411"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39347"
FT                   /db_xref="InterPro:IPR029432"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EE7"
FT                   /protein_id="AAS39347.1"
FT                   /translation="MELYIYNSNRELAGIVESFEYLRWTRRYSQCGSFELKAIATPENT
FT                   ELLKEGNIIWKNDDEEAGIIEHLELSQTEHEIITASGRFATSFLSRRIVWQTEKLSGDI
FT                   SVCVEQLINNNLINPSDTARKISNLSFSAPNLNVPISTQVSYRNLMDAVTGLCVASDIG
FT                   VKTVFTPATGIFTVALYRGTESQAVFSKEFENLTEQIYTISAGDYANTALVGGEGEGTD
FT                   RTFVAITSGSGETRHEIFVDAKDLREEDFGSDYIDTLIFRGQSKLSEQAIRYSFDTSVN
FT                   PHGNLTYKIDFDLGQSVKVISKAWGVSMTTRITEVEETYDADGQSISVVFGKAELTIAQ
FT                   KIRSDLIEVKTAIMAPTGISEIAQALGTVEETLGTVEETLGDLTEVDLEIQGDNVASTF
FT                   NNLYGKLPALEINVGAGTVSIGQYALHQMNPGDAFYFTSWNGNKFSDQPSDDGHVFLVK
FT                   HNGDNTGNGFQRAMGFFISRNTMTFYVISIFVFNNPSGQANWLNINNEPVTTSRIANGA
FT                   VTGLKMADRTITAAKMVSSFSDYSTTEQNTGRLWIDGKTIYRKEINLGSLTDTTPKHVP
FT                   HGIANLSTVVSLTGFVTNGSVFLPLPLARYNNFASQIGLFVNMTDIVVEPGNDRTAYTG
FT                   YVVIEYTKTV"
FT   gene            425853..426356
FT                   /locus_tag="BCE_0412"
FT                   /old_locus_tag="BCE0412"
FT   CDS_pept        425853..426356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0412"
FT                   /old_locus_tag="BCE0412"
FT                   /product="phage structural protein, truncation"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39348"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EE6"
FT                   /protein_id="AAS39348.1"
FT                   /translation="MEKSGFFNSSDGDRIYDATDFAAYFGSLVSNGVFYSTPTNLLVSP
FT                   GIGLAVSIAAGSAWINGYRYENTDVLNKPLATADGSNPRIDRVVVRLSQITRNIQLAIV
FT                   TGTPTASPIAPELTRTSDVYELGIADVLVPSAATSISANNIIDTRLNTSLCGLVNSLVS
FT                   AVYE"
FT   gene            complement(427710..427943)
FT                   /locus_tag="BCE_0413"
FT                   /old_locus_tag="BCE0413"
FT   CDS_pept        complement(427710..427943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0413"
FT                   /old_locus_tag="BCE0413"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39349"
FT                   /db_xref="GOA:Q73EE5"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EE5"
FT                   /protein_id="AAS39349.1"
FT                   /translation="MLEIIVVSATYADQFTPSVDVDCCMTYCLIALVPGTVPLHERFIV
FT                   LASYIGGFAAKIVGGMGSMFLRTVLLEIVQSE"
FT   gene            428804..429244
FT                   /locus_tag="BCE_0414"
FT                   /old_locus_tag="BCE0414"
FT   CDS_pept        428804..429244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0414"
FT                   /old_locus_tag="BCE0414"
FT                   /product="Bacteriophage phi-105 protein-like protein"
FT                   /note="identified by match to protein family HMM PF05105;
FT                   match to protein family HMM TIGR01593; ORF45"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39350"
FT                   /db_xref="GOA:Q73EE4"
FT                   /db_xref="InterPro:IPR006480"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EE4"
FT                   /protein_id="AAS39350.1"
FT                   /translation="MKEIWNWIQLAIAAVGGFLGWFLGGYDGFLYALVAFVIIDYLTGV
FT                   FCAIVNKKLYSEIGAKGIFKKVLIFIMVGIAHIIDTQILVSIGENSGILRTAVIFFYLS
FT                   NEGVSILENAGHIGLPIPENLKSVLQQLHGRDGEPPKPGGGR"
FT   gene            429276..429977
FT                   /locus_tag="BCE_0415"
FT                   /old_locus_tag="BCE0415"
FT   CDS_pept        429276..429977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0415"
FT                   /old_locus_tag="BCE0415"
FT                   /product="N-acetylmuramoyl-L-alanine amidase domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF05036"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39351"
FT                   /db_xref="GOA:Q73EE3"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EE3"
FT                   /protein_id="AAS39351.1"
FT                   /translation="MKLRKLLLTNNACFKAGKTITPKGIMVHSTGANNPWLKRYVGPDD
FT                   GLLGKNQYNNHWNQDKPGGRQVCVHAFIGKLADGSIATYQTLPWNHRGWHAGGAANNTH
FT                   IGFEICEDSLTDASYFSAVYKESVELCVYLCKLYRFSEKDIICHSEGYKRGIASNHGDV
FT                   MHWFPKHGKSMDTFRVDVKKLLSAENKTVELVNKKYYRVQIGAYSDKANAEAQLAKAKK
FT                   AGFTDAFIKYD"
FT   gene            430156..430395
FT                   /locus_tag="BCE_0416"
FT                   /old_locus_tag="BCE0416"
FT   CDS_pept        430156..430395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0416"
FT                   /old_locus_tag="BCE0416"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39352"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EE2"
FT                   /protein_id="AAS39352.1"
FT                   /translation="MNQHEDKKVTKISDEVIDKNTTALKRVSQEQLQREFDYIQAEKLL
FT                   RKMLEKGLITEVEFNKIDALNRQTFSPFLAEIMP"
FT   gene            430457..432019
FT                   /locus_tag="BCE_0417"
FT                   /old_locus_tag="BCE0417"
FT   CDS_pept        430457..432019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0417"
FT                   /old_locus_tag="BCE0417"
FT                   /product="DNA recombinase, putative"
FT                   /note="identified by match to protein family HMM PF00239"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39353"
FT                   /db_xref="GOA:Q73EE1"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EE1"
FT                   /protein_id="AAS39353.1"
FT                   /translation="MKKITKIEGNLANSFIKPKTRVVAYCRVSTDSNEQLVSLQAQKAH
FT                   YETYIKANPEWEYAGLYYDEGISGTKKENRSDLLRMLSDCETGRIDLIITKSISRFARN
FT                   TTDCLEMVRKLIDLGVHIYFEKENINTGSMESELMLSILSGLAESESISISENTKWAIQ
FT                   RRFQNGTFKISYPPYGYQNIDGQMIVNPKQAEVVKYIFAEVLSGKGTQKVANDLNQKGI
FT                   PSKRRGRWTATTIRGILTNEKYTGDVILQKTYTDSHFNRHTNYGEKNMYLVENHHEAII
FT                   SHEDFQAVDAILNQRAKEKSIEKRNSKYLNRYSFSSKIICSECGSTFKRRIHSSGRKYI
FT                   AWCCSKHISNITECSMQFIRDDDIKTAFVTMMNKLIFGQKFILRPLLEGLRNQNNAASF
FT                   HRIEELEIKIENNMEQSQVLTGLMAKGYLEPALYNKEKNSLVQERERLLAEKDQLTRFV
FT                   NGNLAKVEEVNHLLRFATKSKMLTAYEDELFENYVEKIIVFSREEVGFELKCGITLKER
FT                   LVN"
FT   gene            431983..432432
FT                   /locus_tag="BCE_0418"
FT                   /old_locus_tag="BCE0418"
FT   CDS_pept        431983..432432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0418"
FT                   /old_locus_tag="BCE0418"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39354"
FT                   /db_xref="GOA:Q73EE0"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EE0"
FT                   /protein_id="AAS39354.1"
FT                   /translation="MWNHIEGKVGELMGHTPYGYRIEDGKAVVDDIAAEKVRELFSGYL
FT                   AGLSLKGAAKKAGIDCYHATASKMLQNKHYLGDEFYPPIIDEETFEKARVEKRKRAKKL
FT                   GRIWEPKDEPETDYPIKFKAKPLVQKYDDPYKQAEYAYSLIESEV"
FT   gene            432436..434007
FT                   /locus_tag="BCE_0419"
FT                   /old_locus_tag="BCE0419"
FT   CDS_pept        432436..434007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0419"
FT                   /old_locus_tag="BCE0419"
FT                   /product="DNA recombinase, putative"
FT                   /note="identified by match to protein family HMM PF00239"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39355"
FT                   /db_xref="GOA:Q73ED9"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ED9"
FT                   /protein_id="AAS39355.1"
FT                   /translation="MAVSRNVTVIPAIKRIGNNKNSESKPKIRVAAYCRVSTDSEEQAS
FT                   SYDIQIEHYTNYIKKNKEWELAGIFADDGITGTNTKKRDEFNRMIEECMAGNIDMIITK
FT                   SISRFARNTLDCLKYIRQLKDKNIAVFFEKENINTLDSKGEIMLTIMASLAQQESQSLS
FT                   QNVKLGIQYRYQQGEVQVNHKRFLGYTKDENKQLVIDPEGAEVVKRIYREYLEGASLLQ
FT                   IARGLEADGILTAAGKAKWRPETLKKILQNEKYIGDALLQKTYTVDFLSKKRVKNNGIV
FT                   PQYYVENSHEPIIPRDLFMQVQEEMVRRANLRGGKGGKKRVYSSKYALSSIVYCGQCGD
FT                   IYRRVHWNNRGYKSIVWRCVSRLEEKDSECTAPTINEETLQTAVVKAINELLANKEPFL
FT                   STLQKNIATIFNEENDHTTDDIDGKLEELQQQLLIQAKSKNDYEDVADEIYHLRELKQN
FT                   ALVENAEREGKRQRIADMTDFLNEQSCELEEYDEQLVRRLIEKVTIYEDKLTVEFKSGI
FT                   EIGIEI"
FT   gene            434158..434934
FT                   /locus_tag="BCE_0420"
FT                   /old_locus_tag="BCE0420"
FT   CDS_pept        434158..434934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0420"
FT                   /old_locus_tag="BCE0420"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="identified by match to protein family HMM PF00376"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39356"
FT                   /db_xref="GOA:Q73ED8"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="InterPro:IPR036244"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ED8"
FT                   /protein_id="AAS39356.1"
FT                   /translation="MSMKVKEVAELVGVSVRTLHHYDQIGLLTPKETTYSGYRLYSEED
FT                   LEKLQQILFFRELDFSLKEIKTIINSPSFNQQEALILQRKMLIEKRNRVDKMIETIDKT
FT                   IKHTMGEIKMSNEERFEGINFRLNQYEQEARMRWGDQPVDEISAKLRDMAIDEQQDLSQ
FT                   NWDVIFNKLVQLRNYSPNSQEVQKTIKEWYDFLNKNFGKYSLDAFQGLGQLYIEDERFT
FT                   QNIDQYSEGLAKFMSEAMKIFSVNQKKKGGSNANSN"
FT   gene            434918..435814
FT                   /locus_tag="BCE_0421"
FT                   /old_locus_tag="BCE0421"
FT   CDS_pept        434918..435814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0421"
FT                   /old_locus_tag="BCE0421"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39357"
FT                   /db_xref="InterPro:IPR018728"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ED7"
FT                   /protein_id="AAS39357.1"
FT                   /translation="MQIVIEDTIKQYEKLFSMEEEREDFYRYSMMKPFEKMWNIINVPL
FT                   KANQPNGYDVIMATKMLGYLDISNTETGKIALEMLKEIQALQTAYDTLKICVNFIQKNN
FT                   LKINADELKFGMYIADPKKLELQKGYCGFGGIPGFIQVSIYPNSYNIPKIPAVIAHEFH
FT                   HNIRFSYFDWDHGNVTVGDYLIIEGLAESFARELYGDEFLGPWVTSFDKEDLEYSTEII
FT                   KESLDVKGFAEVSSYMFGDTIAKEQGYQPVGLSPFAGYAVGYQAVQSFMKVNNVGIEEA
FT                   TLLDTKEILYNCELFTK"
FT   gene            436254..437090
FT                   /locus_tag="BCE_0422"
FT                   /old_locus_tag="BCE0422"
FT   CDS_pept        436254..437090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0422"
FT                   /old_locus_tag="BCE0422"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39358"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ED6"
FT                   /protein_id="AAS39358.1"
FT                   /translation="MLSIEEYIARRKKEDKLNEFDIDARTQNMRICVDYVFEYFSNYLN
FT                   ITEAEEKTVLHDQKLDKYRKQLREYDPEVREWVVGIYNEYGKQIHKHIGNIMKANEFFF
FT                   LYSTDSEFRNASYDCYSQLIKKLPFLKDQTEMLFIFIKDYHRVESEQRFNFGIPSITEE
FT                   ITDWIDKAWAKYQVNILAFAYGWISSFYDNEDLWPSTHRKKSQYTWRKYDYDYKQKSNL
FT                   FNLDSLYRKMPKKSFTKGRKQEFEILLMYYWLYDIEGDSDYWQEYLEMVLSALKKQ"
FT   gene            437118..438032
FT                   /locus_tag="BCE_0423"
FT                   /old_locus_tag="BCE0423"
FT   CDS_pept        437118..438032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0423"
FT                   /old_locus_tag="BCE0423"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39359"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ED5"
FT                   /protein_id="AAS39359.1"
FT                   /translation="MNDKEIILSKIAEIVSRPGFFIKKNSEFKARLKCLGLNDLYEKYI
FT                   DYLVPYFYNQGYAHKFENNNEEYDVFLGLDSIFSDLYKENRHEDIINLLKEITKSFNVR
FT                   YISEESDEDFEELAKLYEILGLSITIEFDKVKVSACMESDFARVSEMFSVESWIKSNHK
FT                   EVYDAYKSAIDAYTQGHSGACIESCRTSIVSIFSKYKGTENFAKWMRGVFNTSGDSATA
FT                   TVADLDRALKSDLKKEDLADFFNENKDGKLTKTKTIYMIYSMMSDYGTHRNENTIESPT
FT                   IEDALFCLRLTDSILFWVYSKNK"
FT   gene            438060..438638
FT                   /locus_tag="BCE_0424"
FT                   /old_locus_tag="BCE0424"
FT   CDS_pept        438060..438638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0424"
FT                   /old_locus_tag="BCE0424"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39360"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ED4"
FT                   /protein_id="AAS39360.1"
FT                   /translation="MSDVKNAYDQIIDFLNNETEKTLLLRGIADKEKHQALLKALNSQG
FT                   NLKGLINLIHTTKDGMDNFFRWAELYKVNVPKKYGQGMKLSNLTIFFDNLTTKGNSEKY
FT                   DNYEFDFMIIWPIQSVTKNEKEIQMLKEMAERQKTKKIIYLTIKEPWYNPDSLDPIVDR
FT                   VIKLDCENDDPKEYQRILAAYEEDMKRRY"
FT   gene            438739..439233
FT                   /locus_tag="BCE_0425"
FT                   /old_locus_tag="BCE0425"
FT   CDS_pept        438739..439233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0425"
FT                   /old_locus_tag="BCE0425"
FT                   /product="aminoglycoside nucleotidyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39361"
FT                   /db_xref="GOA:Q73ED3"
FT                   /db_xref="InterPro:IPR019646"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ED3"
FT                   /protein_id="AAS39361.1"
FT                   /translation="MVSKTDAIEIITYAEENGINIWIDGGWGVDALLEEETRAHNDIDL
FT                   FVEESNSKKFVEILKEKGFVEVTEAYTTTSHTVWKDTKGRIIDLHIFKFNEQGYIVFEG
FT                   EAYPPKVFSGIGKIGDKMVRCIDAENQVLFHLGYEHDENDMHDVKLLCERFNIPVPSEY
FT                   K"
FT   gene            439519..440508
FT                   /locus_tag="BCE_0426"
FT                   /old_locus_tag="BCE0426"
FT   CDS_pept        439519..440508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0426"
FT                   /old_locus_tag="BCE0426"
FT                   /product="hypothetical conserved protein"
FT                   /note="identified by match to protein family HMM PF01207"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39362"
FT                   /db_xref="GOA:Q73ED2"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ED2"
FT                   /protein_id="AAS39362.1"
FT                   /translation="MIDNFWRDLPRPFFVLAPMEDVTDVVFRHVVSEAGRPDVFFTEFT
FT                   NSDSYCHPEGMKSVRGRLIFTEDEQPMVAHIWGDNPEYFRQMSIGMAELGFKGIDINMG
FT                   CPVPNVASRGKGSGLILRPDVAAELIQAAKAGGLPVSVKTRLGFKELSEWEDWLTHIFK
FT                   QDIANLSIHLRTREEMSQVDAHWELIPEIKKLRDRIAPNTLLTINGDIPDRKTGLELAE
FT                   KYGIDGVMIGRGIFKNPFAFEKEPREHSSKEHLDLLRLQLDLQDQYAEVLPRSITGLHR
FT                   FFKIYVKGFPGAAELRNQLMSTKSTDEVRTLLNQFEASVSETQGSETV"
FT   gene            440730..442760
FT                   /locus_tag="BCE_0427"
FT                   /old_locus_tag="BCE0427"
FT   CDS_pept        440730..442760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0427"
FT                   /old_locus_tag="BCE0427"
FT                   /product="sensor histidine kinase, putative"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF01590; match to protein
FT                   family HMM PF02518; match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39363"
FT                   /db_xref="GOA:Q73ED1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ED1"
FT                   /protein_id="AAS39363.1"
FT                   /translation="MLSDQTRYSRLANITKIINTKLELREVLQRVTMAISEEIVRCDAV
FT                   GIYLPEEDGTFRGFAGKPETINGVTLDTQVIDPGIDLLAKEVIETKKTIYIPDTSKDYR
FT                   PDPRPVDAFKIKSLLALPISFGQELFGLVFLFDYGVPMNLTDSEIQSVEAYVNMAAVAI
FT                   QNAKNLTQKENLIAEKQLLLNVTRDLSVCSSVQEIFDKCFFYLGQILESKNMAAHLLDR
FT                   LDKTTIKTTIKTTKLSADCDWAETDWMEKTYEAKLRKVIQTKNIDSKGLLMLPLVSMGE
FT                   VLGVIVVGKGAKAHNYDASRIQLAKSIVDATAPTFSNLLYMDQLESMVEERTRELAVAN
FT                   EKVTSVIESITDGFLTLNNKWEFTYVNKHQHFPQRKTAKDVLGKNIWEVFPSSIDTVIY
FT                   KELHRVMSERNTVHFEFLSTSDEYWYEVIAYPYDDGICCICKNITEKKQYEQELKRLSN
FT                   IELIGQMAAGISHEIRNPMTTVRGFLQLLKEENNYEKHNNYFNLMVEELDRANSIITEF
FT                   LSIGNTKKSDLQMLDLNSIIRDIIPLIKIDTHNQNKYIQVDTNDVPELLLNRNEIRQLL
FT                   MNLYRNGLEAMSTGKTLTISTYKEGQKCVVLAVRDEGNGIRPEVLEKLGTPFYTTKDNG
FT                   TGLGLGVCYAIAARHNAKIEIQTGSEGTTFFVKFNYENNKN"
FT   gene            complement(442864..443775)
FT                   /locus_tag="BCE_0428"
FT                   /old_locus_tag="BCE0428"
FT   CDS_pept        complement(442864..443775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0428"
FT                   /old_locus_tag="BCE0428"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39364"
FT                   /db_xref="GOA:Q73ED0"
FT                   /db_xref="InterPro:IPR002793"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR041135"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ED0"
FT                   /protein_id="AAS39364.1"
FT                   /translation="MNYLIGYKDAERNFGHEDPMLTEYTYGESGANTDKLQKVQKGDFL
FT                   FFHKTIHNKRYITAYYLVEEVVIVKDIKQNRLIMNKYDNPHLKKEIHQLTPSECIAFGN
FT                   PIQSKVLQVPLEITPELLSKLSRPANLNPNQSLLSAISSALRTWKELNPSDINLLLDLI
FT                   EQNESKGRLTNRVLTAEEVFQILERDIEKFIISNPSILDVNYKIEKSQHIFSDESRLDL
FT                   LLRDTTNNEFIVLEIKKGPIDRNALNQIKHYIKLCKKELKLNTVKGILVGSGIAPSFED
FT                   DINKAKRDGITVRNYGWGFTIN"
FT   gene            complement(443920..444018)
FT                   /locus_tag="BCE_0429"
FT                   /old_locus_tag="BCE0429"
FT   CDS_pept        complement(443920..444018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0429"
FT                   /old_locus_tag="BCE0429"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39365"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EC9"
FT                   /protein_id="AAS39365.1"
FT                   /translation="MLIAIGFPPEMLIIIMLLACVNECRQITTLTL"
FT   gene            444005..444523
FT                   /locus_tag="BCE_0430"
FT                   /old_locus_tag="BCE0430"
FT   CDS_pept        444005..444523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0430"
FT                   /old_locus_tag="BCE0430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39366"
FT                   /db_xref="InterPro:IPR009921"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EC8"
FT                   /protein_id="AAS39366.1"
FT                   /translation="MAMSNNDILKRVRYALDIKDIDMVEIFKLGGMEVTKEDVVDMLTK
FT                   IKRAPQHEPENPDVEEDEYVKTCDMMMLEAFLNGFITLKRGKQDPKPGQPAPVQSKESA
FT                   NNLLLKKMKIALSLTSEDVLDILDSVGVKVTKGELGALLRKKGHKNYKECGDRYARNFI
FT                   KGLAVKYRG"
FT   gene            444619..445326
FT                   /locus_tag="BCE_0431"
FT                   /old_locus_tag="BCE0431"
FT   CDS_pept        444619..445326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0431"
FT                   /old_locus_tag="BCE0431"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01863"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39367"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EC7"
FT                   /protein_id="AAS39367.1"
FT                   /translation="MVHTYLGETINFHITYKKKKSVRFLVDSYGNVEVQAPKGTPVEYL
FT                   VQLLEEKWDWIQTTCKEMEERARGPQEKDYDQGEGFLYLGNTYPIQISQDTNITQDNAV
FT                   FEGDKLHIYVKDLKDEKIQQALKRFYYKQCKTLVEKSIKAHQSNFKTKPRSIRITDSSR
FT                   TWGTCDSNLQLTFNWKLAMAPQRVIDYVVVHEMCHMVHLNHDRSFWRLVGKIMPDYKEM
FT                   ENWLALSSWKMTV"
FT   gene            complement(445490..446185)
FT                   /locus_tag="BCE_0432"
FT                   /old_locus_tag="BCE0432"
FT   CDS_pept        complement(445490..446185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0432"
FT                   /old_locus_tag="BCE0432"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39368"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EC6"
FT                   /protein_id="AAS39368.1"
FT                   /translation="MTVLYKGSLKQNNDPFHVTLLSKEHIEQILFLQNVVVEGLEDKSR
FT                   LQPLSQEEFQYILEGNGMMIGAFIKNELIAFRALLVPPIDDEHLGLDIGLPESELHRVI
FT                   YQEISNVHPNCRGNGMQKILATVIMDELQKENGKYDYVCCTVAPFNIPSLKDKFSQGME
FT                   IAALKEKYGGSMRYVFVKELREDKEKDWTEIKSVPMNNAGGQQALLSEGYRGYEMEKVD
FT                   EDFVVKFGR"
FT   gene            complement(446200..447309)
FT                   /locus_tag="BCE_0433"
FT                   /old_locus_tag="BCE0433"
FT   CDS_pept        complement(446200..447309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0433"
FT                   /old_locus_tag="BCE0433"
FT                   /product="mandelate racemase/muconate lactonizing enzyme
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF01188;
FT                   match to protein family HMM PF02746"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39369"
FT                   /db_xref="GOA:Q73EC5"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034603"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EC5"
FT                   /protein_id="AAS39369.1"
FT                   /translation="MKITAIHLYAIRLPLRDPFVISYGSYSDMPSIIVKMETDEGIIGY
FT                   GEGVADDHVTGESWESTFHTLKHTLAPALIGQNPMNIEKIHDMMDNTIYGVPTAKAAID
FT                   IACFDIMGKKLNQPIYQLIGGRYHEEFPVTHVLSIANPEEMAEEAASMIQKGYQSFKMK
FT                   VGTNVKEDVKRIEAVRERVGNDIAIRVDVNQGWKNSANTLMALRSLGHVNIDWIEQPVI
FT                   ADDIDAMAHIRSKTDLPLMIDEGLKSSREMRQIIKLDAADKVNIKLMKCGGIYPAVKLA
FT                   HQAEMAGIECQVGSMVESSVASSAGFHVAFSKKIITSVELTGPLKFTKDIGNLHYDVPF
FT                   IRLNEKPGLGIEINEDTLQELTVFQDVVR"
FT   gene            447402..448673
FT                   /locus_tag="BCE_0434"
FT                   /old_locus_tag="BCE0434"
FT   CDS_pept        447402..448673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0434"
FT                   /old_locus_tag="BCE0434"
FT                   /product="transcriptional regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39370"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EC4"
FT                   /protein_id="AAS39370.1"
FT                   /translation="MMIKIAVVGSKEFMETLLPIAHKIEEIEIDPYIYLHPAESSELLK
FT                   RLKPCDFIFFSGALPYYMAKEIREQLRIPSTYLQQDETTIASSILSVMYHQGIQPHQIS
FT                   IDLVDRSFIVNVLEDIGIKESPQVFDYENMLWSKDEINRVIDFHVAKYQSGEAHLALTS
FT                   IHAVYDELQKIGIPSERMIDPKQSIIHGLKDAKIKAELARSHSATVGACIISSLELRDV
FT                   LLEQLNVISKELRGSFKTIDEMTFILYTTRGDIESIIKTNMINNLFASIEGTIAIGFGY
FT                   GKTVKEAEQNAKIAQGFAKNNPIDHCFYILTSDKELFGPFPKEQRVQSLKNDNPELMKI
FT                   AKETKLSPANLSKIIQFSQSHPSLKFTAADLSEYLQVTRRSTERLLKKLVDYGYVHICG
FT                   EEMPYQQGRPRAIYELNLPLSLSF"
FT   gene            complement(448662..450083)
FT                   /gene="nhaC"
FT                   /locus_tag="BCE_0435"
FT                   /old_locus_tag="BCE0435"
FT   CDS_pept        complement(448662..450083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaC"
FT                   /locus_tag="BCE_0435"
FT                   /old_locus_tag="BCE0435"
FT                   /product="Na+/H+ antiporter NhaC"
FT                   /note="identified by match to protein family HMM PF03553;
FT                   match to protein family HMM TIGR00931"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39371"
FT                   /db_xref="GOA:Q73EC3"
FT                   /db_xref="InterPro:IPR004770"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EC3"
FT                   /protein_id="AAS39371.1"
FT                   /translation="MKKEIPFGVAMIPIIITVAVMMVTIVVLKQSPHVPLIIGTTVASI
FT                   VAWRYGYKWNDIEEAMYKGIRLALPAIVIIILVGLTIGAWIGGGIVATMIYYGLNLLTP
FT                   SLFLVSITIICSIVALAIGSSWSTMGTIGVAGMGIGLSMGIPAPMVAGAIISGSYFGDK
FT                   MSPLSDTTNLAAGLTNTDLFTHIRHMLFTTIPGLIITLIVYAFLGRSFGANNIDAKSIE
FT                   QTLQVLQQNFVISPFLLIIPVVVMVLVAKKVPAIPAILVGIILGFLSQVFIQGGSVSSA
FT                   VAALQSGFVIDTGNKLVDELFNRGGLSSMMNTVSMTIVAMTFGGVLEHTGILRSIVNQI
FT                   LKLATSAKGLIASTIASCFATNLTCSEQYISIVVPSRMYANAYTEKGLHSKNLSRALED
FT                   GGTLTSVFVPWNTCGVFILATLGVGAFEYAPYAILNFIVPIISIIYGITGLTITKLSDI
FT                   EKAELLKKQKAQLEA"
FT   gene            450386..451501
FT                   /gene="amhX"
FT                   /locus_tag="BCE_0436"
FT                   /old_locus_tag="BCE0436"
FT   CDS_pept        450386..451501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amhX"
FT                   /locus_tag="BCE_0436"
FT                   /old_locus_tag="BCE0436"
FT                   /product="amidohydrolase amhX"
FT                   /EC_number="3.5.1.-"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM TIGR01891"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39372"
FT                   /db_xref="GOA:Q73EC2"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="InterPro:IPR037484"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EC2"
FT                   /protein_id="AAS39372.1"
FT                   /translation="MKTLELQERLTEIFQHLHENPEVSWKEYETTAYITNFLKEEGISY
FT                   KIFDDCPGVIAEIGSGNPVIAIRADMDALWQEVNGEFKANHSCGHDAHMTIVMGLILQL
FT                   KNMRWKSGTVRFIFQPAEEKGNGALKMVEKGAVDDADFLFGVHLRPIEELSLKQAAPSI
FT                   RHGAAGFLEGTIHGEDAHGARPHQGINAIDVISMINIGLKNIWLPPQSSYSVKMTRCQA
FT                   GGDNLNIIPGNGHFSLDVRAESNTLLEELKKKIEHVIEAAASMGSKTSYEWIDLAPGAE
FT                   VSEEAERFMRKGILEVYGEDKCTGPLYTTGSDDFHYYTVKKPHLKAVMLGLGADLQPGL
FT                   HHPYMKFDHSCIMDGVEILKQTVLKVLEDRG"
FT   gene            451674..452282
FT                   /locus_tag="BCE_0437"
FT                   /old_locus_tag="BCE0437"
FT   CDS_pept        451674..452282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0437"
FT                   /old_locus_tag="BCE0437"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39373"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EC1"
FT                   /protein_id="AAS39373.1"
FT                   /translation="MNEQYYDAVLNIKTVGEQKGFNKSMHYHRYEPTPYSGLDELLNQY
FT                   EIRSSDQIVDFGCGKGRLNFYMHHKCGASAIGIEMNEEFYKEALDNLDRYARKVRNSKD
FT                   KIGFECCLAQEYEIDPRDNRFYFFNPFSVQVFMNVVNNILLSVEEMGREVDIILYYPSE
FT                   DYIFFLENQTAFELKREVRLPGAYEKNGNERFLVYRLEC"
FT   gene            452286..453032
FT                   /locus_tag="BCE_0438"
FT                   /old_locus_tag="BCE0438"
FT   CDS_pept        452286..453032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0438"
FT                   /old_locus_tag="BCE0438"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39374"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EC0"
FT                   /protein_id="AAS39374.1"
FT                   /translation="MGAWGVAILSDDIAEDIKLLYKDLLANEYSNEEASRIVIEEYKNE
FT                   LDDEETIAFWLVFASIQWRLGRLQENVKQEALQIIESGTDLARWEEEPKLQKKREVVLN
FT                   KLREQLNSPQPEAKKVPKRFIANTSLKAGDAVSYELVSGNYIILKVIEIVEEWHGDRYP
FT                   LFEMCDWEGKEIPSKEEIDQLELKIKIYEGGKQEVVKIAIYPAGKRDSTLKRIKVVAED
FT                   VKVVLDIGSPYTILCWKDFDDYVDTL"
FT   gene            complement(453084..454610)
FT                   /gene="ahpF"
FT                   /locus_tag="BCE_0439"
FT                   /old_locus_tag="BCE0439"
FT   CDS_pept        complement(453084..454610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpF"
FT                   /locus_tag="BCE_0439"
FT                   /old_locus_tag="BCE0439"
FT                   /product="alkyl hydroperoxide reductase, F subunit"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM TIGR01369"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39375"
FT                   /db_xref="GOA:Q73EB9"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EB9"
FT                   /protein_id="AAS39375.1"
FT                   /translation="MILDADIKTQLSQYLQLMENDILLKVSAGDDDVSKDMLALVDELA
FT                   TMSSKITVEKVELERTPSFSVNRPGEDTGVVFAGIPLGHEFTSLVLALLQVSGRAPKVE
FT                   QKLIDQIKNIQGEYHFESYISLSCHNCPDVVQALNVMSVLNSGITHTMIDGAAFKEEVE
FT                   SKDIMAVPTVFLNGESFGSGRMTLEEILAKMGNGPDASELSDKDPYDVLVVGGGPAGAS
FT                   AAIYAARKGIRTGIVAERFGGQVMDTMGIENFISVKRTEGPKLVASLEEHVKEYDIDVM
FT                   NLQRAKRLEKKELIEVELENGAILKSKSVIVSTGARWRNVGVPGEAEFKNKGVAYCPHC
FT                   DGPLFTGKDVAVIGGGNSGIEAAIDLAGIVNHVTVLEFMPELKADAVLQERLNSLPNVT
FT                   VLKNVQTKEITGTDKVNGISYIDRETEEVHHVELQGVFVQIGLVPNTDWLGETVERVRG
FT                   EIVTDKHGATNVPGVFAAGDCTNNPYKQIIISMGSGANAALGAFDYLIRN"
FT   gene            complement(454625..455188)
FT                   /gene="ahpC"
FT                   /locus_tag="BCE_0440"
FT                   /old_locus_tag="BCE0440"
FT   CDS_pept        complement(454625..455188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="BCE_0440"
FT                   /old_locus_tag="BCE0440"
FT                   /product="alkyl hydroperoxide reductase, subunit C"
FT                   /note="identified by match to protein family HMM PF00578"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39376"
FT                   /db_xref="GOA:Q73EB8"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EB8"
FT                   /protein_id="AAS39376.1"
FT                   /translation="MLLIGTEVKPFKANAYHNGEFIQVTDESLKGKWSVVCFYPADFTF
FT                   VCPTELEDLQNQYATLKELGVEVYSVSTDTHFTHKAWHDSSETIGKIEYIMIGDPTRTI
FT                   TTNFNVLMEEEGLAARGTFIIDPDGVIQSMEINADGIGRDASILVNKIKAAQYVRNNPG
FT                   EVCPAKWQEGSATLKPSLDLVGKI"
FT   gene            455778..455930
FT                   /locus_tag="BCE_0441"
FT                   /old_locus_tag="BCE0441"
FT   CDS_pept        455778..455930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0441"
FT                   /old_locus_tag="BCE0441"
FT                   /product="5-methylthioribose kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39377"
FT                   /db_xref="GOA:Q73EB7"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EB7"
FT                   /protein_id="AAS39377.1"
FT                   /translation="MSKFTKYFLMEANDVIVYVKEKLCKFEHAKGLKCKEIGDGLVTID
FT                   NGRGN"
FT   gene            455890..456252
FT                   /locus_tag="BCE_0442"
FT                   /old_locus_tag="BCE0442"
FT   CDS_pept        455890..456252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0442"
FT                   /old_locus_tag="BCE0442"
FT                   /product="5-methylthioribose kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39378"
FT                   /db_xref="GOA:Q73EB6"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EB6"
FT                   /protein_id="AAS39378.1"
FT                   /translation="MMDWLQSTMVEVIDLFKKKFLDAWDIHVPEIMAKEEGFNEIYLQS
FT                   VLEDIAAVTGLELIRRIVGLAKVKDITCIENEEARARAERICLQVAKKFILRANQYKTG
FT                   TSFVETLKEQSMHYAK"
FT   gene            456291..456470
FT                   /locus_tag="BCE_0443"
FT                   /old_locus_tag="BCE0443"
FT   CDS_pept        456291..456470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0443"
FT                   /old_locus_tag="BCE0443"
FT                   /product="translation initiation factor, putative, aIF-2BI
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39379"
FT                   /protein_id="AAS39379.1"
FT                   /translation="MERDASEVINRFGQYSAPKESKVYNPAFDVTPYENVTAIITEKGI
FT                   VKAPFTENLKKLFQ"
FT   gene            456525..457166
FT                   /gene="fucA"
FT                   /locus_tag="BCE_0444"
FT                   /old_locus_tag="BCE0444"
FT   CDS_pept        456525..457166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fucA"
FT                   /locus_tag="BCE_0444"
FT                   /old_locus_tag="BCE0444"
FT                   /product="L-fuculose phosphate aldolase"
FT                   /EC_number="4.1.2.17"
FT                   /note="identified by match to protein family HMM PF00596"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39380"
FT                   /db_xref="GOA:Q73EB4"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EB4"
FT                   /protein_id="AAS39380.1"
FT                   /translation="MLLQKEREEIVAYGKKMLSSGLTKGTGGNISIFNREQGLVAISPS
FT                   GLDYYETKPEDVVILNLDGDVVEGERKPSSELDMHLIYYRKREDINALVHTHSPYAKTI
FT                   ASLGWELPAVSYLIAFAGPNVRCAPYETFGTKQLAEAAFEGMIDRRAVLLANHGLIAGA
FT                   NHIKMAFTVAEEIEFCAQIYYQTKSVGEPKLLPEDEMENLAKKFEGYGQQ"
FT   gene            complement(457230..457400)
FT                   /locus_tag="BCE_0445"
FT                   /old_locus_tag="BCE0445"
FT   CDS_pept        complement(457230..457400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0445"
FT                   /old_locus_tag="BCE0445"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39381"
FT                   /db_xref="GOA:Q73EB3"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EB3"
FT                   /protein_id="AAS39381.1"
FT                   /translation="MKAIAIILILIGIFGILMGGMMFGDIGIAAIIGSLAALFSGIGFW
FT                   KLDSQLKNISK"
FT   gene            457690..458277
FT                   /locus_tag="BCE_0446"
FT                   /old_locus_tag="BCE0446"
FT   CDS_pept        457690..458277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0446"
FT                   /old_locus_tag="BCE0446"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39382"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EB2"
FT                   /protein_id="AAS39382.1"
FT                   /translation="MLMNQLFQGIQSTNDSLEEKIILPNLTGGYDLKNRSGEVVAAYQP
FT                   SPVEGSGVIMDVHGETIARVQENVYDGTAFDFGDGHTVTSTQNIHGGENFHDNFEGVIG
FT                   YTQPNSSGGLTMNTATGEKLYDVNSNPLGEGMTIDTSPEFISPNIDIGAIDTTHLDALD
FT                   VVNHAVDITDVSSILSASADGLDALDLFGNLF"
FT   gene            458274..459854
FT                   /locus_tag="BCE_0447"
FT                   /old_locus_tag="BCE0447"
FT   CDS_pept        458274..459854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0447"
FT                   /old_locus_tag="BCE0447"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39383"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EB1"
FT                   /protein_id="AAS39383.1"
FT                   /translation="MSYIKEKEQAGDPAELYLETKKQLYEQLTYDVAEEIESFVERVGE
FT                   AFFQKIHDCIEKRNEMLEEEVSKPLRNPDNKEVHSQCITRFFQLTHVGEIRDELKGILD
FT                   FPHLGKGYYDFIEEISKNQHGHLFKKLYFTGNVFEDLKKKMNLSMDTTIKNFQNYYEAY
FT                   AQYTELVRDIQSRLPGKQFVQLVSQIMASLVMGFGGSLLIKGLAKLLDPDALKIVNAQE
FT                   NVRQMWEKYNEQLKVDLEQLKTHYKYVQLSLYGGAFLTVNKQLKMSGIEFQKLYLQDNV
FT                   YKLQLIKEEQGQVITWATETISHIQSLLKKSEINQAIKVSNQFYQHVSEYPVMERTIIK
FT                   SGKSIKYYANLLKFAALMCKSLELYGKEKDTFITFTAELFKQLPMVVHDHDLRHLGLMT
FT                   KTEFIMNFLHHGLKENQKLNLILDYEMSMIKRKDEHDLYPGEELKEFSSSQYLAILLAR
FT                   FMKSKRQKVNSFYRISQNEEVPFAVMISLKRLYKKTQGWDSFYKYLLACTTNERLSNTF
FT                   NKVKGVLQV"
FT   gene            459887..460498
FT                   /locus_tag="BCE_0448"
FT                   /old_locus_tag="BCE0448"
FT   CDS_pept        459887..460498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0448"
FT                   /old_locus_tag="BCE0448"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39384"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EB0"
FT                   /protein_id="AAS39384.1"
FT                   /translation="MVILMLFGISGMYLMKEDNNSAWHGEKIVWRSNGEKSSSQENTTL
FT                   AKESDADKAIPSISVNDSAGSSYNFKVKTKQELKQILEIALMDGKLGPFGLNVIGQETF
FT                   EVKQEFGTPDALQEAECTACDAPTTVTYGDYKLDMFPSKVKRIWLHMNIPVNELKSWLG
FT                   EPYAIEEGIDSDALVYRKEGYAIYFSVADGFVKRVDMYKS"
FT   gene            complement(460549..461556)
FT                   /locus_tag="BCE_0449"
FT                   /old_locus_tag="BCE0449"
FT   CDS_pept        complement(460549..461556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0449"
FT                   /old_locus_tag="BCE0449"
FT                   /product="iron compound ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39385"
FT                   /db_xref="GOA:Q73EA9"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EA9"
FT                   /protein_id="AAS39385.1"
FT                   /translation="MIPSILRKQRLIILALLILTITTIVIGMGLGSASLSYDRLLPTLM
FT                   GQGTFKEEFVLYSLRLPRIVITLLAGMALALSGAILQGLTRNDLAEPGILGINSGAGVA
FT                   VAIFFLYFPIDVGSFLYLLPVVGFIGAFLTAVLIYVFSYSKSTGLQPVRLTLTGIGFAF
FT                   ALSGMMIVLISSADRMKVDFIAKWIAGNIWGDDWIFVLAMLPWLIVFIPFVFYKANRLN
FT                   ILALNEPVAIGVGIEIEKERRYLLVAAVALAAAAVSVTGGISFIGLMAPHIAKSLVGPR
FT                   HQIFMPIALLIGGWLLLLADTIGQNIVEPNGLPAGIVVALIGAPYFMYLLLKKV"
FT   gene            complement(461553..462593)
FT                   /locus_tag="BCE_0450"
FT                   /old_locus_tag="BCE0450"
FT   CDS_pept        complement(461553..462593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0450"
FT                   /old_locus_tag="BCE0450"
FT                   /product="iron compound ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39386"
FT                   /db_xref="GOA:Q73EA8"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EA8"
FT                   /protein_id="AAS39386.1"
FT                   /translation="MKRKDVKRMTKEHDNTRSIAFTYKLILSIIAFFLIFMVAMVLGAA
FT                   DTSIKDVWLALTSSAKGDKISIIREIRLPREVAAIFVGAGLAVSGAIMQGLTRNPLADP
FT                   GLLGLSGGANAALALTLAFNPSISYLYLTFACFIGAAIGAIMVFGIGMMKKGGLSPLRI
FT                   VLAGAAVSAFLLAISEGVGIYFKISQEVSLWTAGGVIGTTWGQLKIIIPVISISIFIAI
FT                   LLAKKLTVLSFSEEVAIGLGQKIIVIKTILFIIIILLAGASVALVGNMAFIGLMVPHMV
FT                   RPIVGPDYRFVIPMSAIAGASFMLLADTIGRTINAPYETPVAAIVAIVGLPFFLFIVRK
FT                   GGKMFS"
FT   gene            complement(462642..463559)
FT                   /locus_tag="BCE_0451"
FT                   /old_locus_tag="BCE0451"
FT   CDS_pept        complement(462642..463559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0451"
FT                   /old_locus_tag="BCE0451"
FT                   /product="iron compound ABC transporter, iron
FT                   compound-binding protein"
FT                   /note="identified by match to protein family HMM PF01497"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39387"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EA7"
FT                   /protein_id="AAS39387.1"
FT                   /translation="MKKLFISLTVLFVLVMSACSNGSTDKKNDAKGSKSETITYQSENG
FT                   KVEVPANPKRVVVLSSFAGNVMSLGVNLVGVDSWSKQNPRFDSKLKDVAEVSDENVEKI
FT                   AELNPDLIIGLENIKNVDKLKKIAPTVTYTYGKVDYLTQHLEIGKLLNKEKEAKTWVDD
FT                   FKKRAQEAGKEIKAKIGEDATVSVVENFNKQLYVYGENWGRGTEILYQEMKLKMPEKVK
FT                   EKALKEGYYALSTEVLPEFAGDYLIVSKNKDTDNSFQETESYKNIPAVKNNRVYEANMM
FT                   EFYFNDPLTLDFQLDFFKKSFLGK"
FT   gene            463891..464940
FT                   /locus_tag="BCE_0452"
FT                   /old_locus_tag="BCE0452"
FT   CDS_pept        463891..464940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0452"
FT                   /old_locus_tag="BCE0452"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF00070"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39388"
FT                   /db_xref="GOA:Q73EA6"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73EA6"
FT                   /protein_id="AAS39388.1"
FT                   /translation="MNREELFDVTVIGGGPAGLYSAFYSGLREMKTKIIEFQPQLGGKI
FT                   HVYPEKMIWDVGGLLPVTGDKLIEQLVQQGLTFQPEVVLNTKVESIIRNKDGTFTLKAN
FT                   DGKEHFSKTVIVATGSGILKPQKLSIEGAERFEVSNLNYTVKSLKRFKDKTIIISGGGN
FT                   SAVDWANELEPIAKKVYVTYRKEELSGHEAQVKQLLNSSAECFFHTSITKLIAGDSHEA
FT                   IEYVELTNHETGEVSHLLIDEVIINHGYERDITLLENSELDVAIIDNFYIAGNANSESS
FT                   VDGLYAAGDILKHEGKLHLIAGAFQDAGNAVNKAKQFIQPDASEYGMVSSHNEVFKKRN
FT                   RELIKQMMK"
FT   gene            complement(465136..465504)
FT                   /locus_tag="BCE_0453"
FT                   /old_locus_tag="BCE0453"
FT   CDS_pept        complement(465136..465504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0453"
FT                   /old_locus_tag="BCE0453"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39389"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EA5"
FT                   /protein_id="AAS39389.1"
FT                   /translation="MATRHIITMLEKTLQIETENTISHLTASLSDRILSQSAAIQENNC
FT                   YHTIGEWYKNHFLFQQDDFLWAKYVFYDAYCEEIKKQGHLTKRVRQILESLARMHGKQY
FT                   IASILNMPFPNERAKGTA"
FT   gene            465686..465925
FT                   /locus_tag="BCE_0454"
FT                   /old_locus_tag="BCE0454"
FT   CDS_pept        465686..465925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0454"
FT                   /old_locus_tag="BCE0454"
FT                   /product="DNA binding domain, excisionase family"
FT                   /note="identified by match to protein family HMM TIGR01764"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39390"
FT                   /db_xref="GOA:Q73EA4"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EA4"
FT                   /protein_id="AAS39390.1"
FT                   /translation="MNELYITVEEAAEYLNLPKSYIEELIQQKKIRALFDGEQYLLNKE
FT                   QFNTHLEQMEKYKQLVEEILNEPIPEDMDVKDED"
FT   gene            465906..466004
FT                   /locus_tag="BCE_0455"
FT                   /old_locus_tag="BCE0455"
FT   CDS_pept        465906..466004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0455"
FT                   /old_locus_tag="BCE0455"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39391"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EA3"
FT                   /protein_id="AAS39391.1"
FT                   /translation="MLKTKIKLWEIPYEDMQKCIFIRDFLFKDIKA"
FT   gene            466160..467127
FT                   /pseudo
FT                   /gene="cotB"
FT                   /locus_tag="BCE_0456"
FT                   /old_locus_tag="BCE0456"
FT                   /note="spore coat protein (outer);identified by similarity
FT                   to SP:P07789, frameshift"
FT   gene            467287..467955
FT                   /locus_tag="BCE_0457"
FT                   /old_locus_tag="BCE0457"
FT   CDS_pept        467287..467955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0457"
FT                   /old_locus_tag="BCE0457"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39392"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EA2"
FT                   /protein_id="AAS39392.1"
FT                   /translation="MNELNKNIGENIYIKLIGEKRFKGVLIDVGNDIVVLYNGQDYVYI
FT                   SLYHVQHYKILRPHDEEVAKPDVDSVIKRESPSISLRKVLSTSKGIFTEIYVAGNAPIH
FT                   GYVTSVMNDYIVFYSPVYKTVYISLKHLKWLIPYKENQVPYALNKNELPVNPLNITLAR
FT                   TFEEQLIKMAGKIMVFDLGEESNKIGKMAKIDEGHIEILKARDAKMYVNIQHVKSVHCP
FT                   "
FT   gene            468193..469458
FT                   /locus_tag="BCE_0458"
FT                   /old_locus_tag="BCE0458"
FT   CDS_pept        468193..469458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0458"
FT                   /old_locus_tag="BCE0458"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39393"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EA1"
FT                   /protein_id="AAS39393.1"
FT                   /translation="MEQFPNSLSITLLGSAGGAAKAVLAILNQAIVNEKDPIYEVIKNV
FT                   TFYLVDIKQKDRTYYDELFPNLKDQLFLSEIDLQDVVTFKKHLKESSTSVVIDVSGADT
FT                   IRVLSCCNELGICYINSALENEAVDQDDSLIGFQLTERYTRFEKEKDKFTNTKAIIGSG
FT                   MNPGVVQWMIVELMKERPNEKPRACYIVEHDTSFLNDTALIKPHTLYASWAVERFLDEA
FT                   IWSYPMYMSHRRPLYFYEDVYASEYKVKLGEKEFYGCLMPHEEVLILGKNFNMEVGFLY
FT                   RINEYTTNIIRQNLDKVEDLWNWNRKVFNPAEEEIAGEDLVGVLLVYENSETYMYNVMN
FT                   SSQVFHKYKTNATYFQVGCGIYAGLCSLLFDNFKQGAYYVEELLLNTESKYGEYLNLYM
FT                   NDFVVGGNDFTDGLLHDRVRWI"
FT   gene            complement(469538..469717)
FT                   /locus_tag="BCE_0459"
FT                   /old_locus_tag="BCE0459"
FT   CDS_pept        complement(469538..469717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0459"
FT                   /old_locus_tag="BCE0459"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39394"
FT                   /db_xref="UniProtKB/TrEMBL:Q73EA0"
FT                   /protein_id="AAS39394.1"
FT                   /translation="MFIFTQQEHFSEKYFLLAHYAIGKKSPLSFLALRYFESQYFLATP
FT                   HDQYKNSTYYLIKL"
FT   gene            469886..470266
FT                   /locus_tag="BCE_0460"
FT                   /old_locus_tag="BCE0460"
FT   CDS_pept        469886..470266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0460"
FT                   /old_locus_tag="BCE0460"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39395"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E99"
FT                   /protein_id="AAS39395.1"
FT                   /translation="MELTLNSTVCLHTIQFRKEQKNYIVKDTITGEKYEMPPLWIDALA
FT                   MMRDGFLLGEIEEKLKEEYPEEEINMLAFTRQLLELELVGMVDGEEIACTKKKEKDYLA
FT                   WLRPRVEQFFLSLNKRNRSKGQ"
FT   gene            complement(470294..470926)
FT                   /locus_tag="BCE_0461"
FT                   /old_locus_tag="BCE0461"
FT   CDS_pept        complement(470294..470926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0461"
FT                   /old_locus_tag="BCE0461"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04199"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39396"
FT                   /db_xref="GOA:Q73E98"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E98"
FT                   /protein_id="AAS39396.1"
FT                   /translation="MKVIDLSQTFENNMSQFPGTPKINLEAITSVEETGYQVTDFHSVV
FT                   HVGTHCDAPAHFISGATTIDQLPLDQFVGEAVLIDVTHVQKRKLPKEVLHNADIKEGDI
FT                   VIFHSNLSNKWNTEAYEQEAFYLSEELAEELVQLKVKSVGLDFISPDEVTTETSPIHHI
FT                   LLGNNIYLIENLTNLDAINAKRFFFSAAPLKIKNSDGAFARAFAVIF"
FT   gene            471275..472384
FT                   /locus_tag="BCE_0462"
FT                   /old_locus_tag="BCE0462"
FT   CDS_pept        471275..472384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0462"
FT                   /old_locus_tag="BCE0462"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39397"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E97"
FT                   /protein_id="AAS39397.1"
FT                   /translation="MTGNVLNYYAGGNTARGFHNLYEENLKGLNRLFILKGGPGTGKSS
FT                   LIKAIGREWVEKGYDIEFLHCSSDNKSVDGVIIPKLKVGIVDGTSPHVIEPKMPGVVEE
FT                   YINLGIAWDSDKLRKQKVEIERFVSEASKAFQAAYARFNEALVIHDEWEKIYISNIDFN
FT                   KANELTEQLIQKLFTDKVGKQSLVKHRFLGAATPKGAVDFVPNLTEGLPHRYFIKGRPG
FT                   SGKSTMLKKLAKVAEEKGFEVEVYHCGFDPNSLDMVIVRELGFAIFDSTAPHEYFPSRE
FT                   GDEIIDMYALIVTPGTDEKYAEEIRDVSIQYKAKMNEAMSFLAKAKSVRDKLERIYIAA
FT                   MDFSKVDAYKEEIQKEFERIAVSVTEKNK"
FT   gene            472506..473288
FT                   /locus_tag="BCE_0463"
FT                   /old_locus_tag="BCE0463"
FT   CDS_pept        472506..473288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0463"
FT                   /old_locus_tag="BCE0463"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39398"
FT                   /db_xref="InterPro:IPR018775"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E96"
FT                   /protein_id="AAS39398.1"
FT                   /translation="MREKIKLELERIEKENDVKILFAVESGSRVWGFPSKDSDYDVRFV
FT                   YMHPVEWYLSIHDKRDVIEYPISDDLDISGWDIKKALQLFAKSNPALLEWIRSPIFYSK
FT                   NSNFPEQLQQMSEKNFDPKATIYHYLHMASKNYREFLQGENVKLKKYFYVLRPILACKW
FT                   LEEKTTLPPVEFDRLITELSIERSVLDEIEQLLIKKKAGTELDVGLKIEVLNQFLEEQI
FT                   HYYQQYVKGIEKGSGIDIESLNTLFRDMLFAVYEKEHK"
FT   gene            complement(473302..474603)
FT                   /locus_tag="BCE_0464"
FT                   /old_locus_tag="BCE0464"
FT   CDS_pept        complement(473302..474603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0464"
FT                   /old_locus_tag="BCE0464"
FT                   /product="benzoate transport protein, putative"
FT                   /note="identified by match to protein family HMM PF00083"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39399"
FT                   /db_xref="GOA:Q73E95"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E95"
FT                   /protein_id="AAS39399.1"
FT                   /translation="MQPSAPPHLESTETIFSSSITKLVVFICWLAILADGYDLGIYGAV
FT                   LPKLLEDKSWALSPAHAGTIASYALFGMFIGAILVGTITDLIGRKWTLICCLALFSITM
FT                   GLAALAPSPELFGLSRFIGGIGLGGVIPTASALTVEYSPKKRQSFIYALMFTGYPLGIV
FT                   LGAILSMFMLEGFGWRTMFGIGMIPLLLIPFIIRYLPESIQFLLSRNRQKEVDQILNRF
FT                   EIEFYVKDETHQPSSNMRKRNGFLTLFSKEYRKATLLFWITYIMGMFLIYGLNTWLPQM
FT                   MRQAGYPLGSSLSFLLMLNITAAIGALFAGAIADRIGAKIVISISYLMAAICIGLLTIK
FT                   PSVTIIYLLIGLAGIGSVGITQILNAYVTQYFPSHIRATSLGWGLGLGRVGAITGPILV
FT                   GIIMTMQYDLAWNFYLFSFAGLLAAISVFFIPTK"
FT   gene            complement(474747..476273)
FT                   /locus_tag="BCE_0465"
FT                   /old_locus_tag="BCE0465"
FT   CDS_pept        complement(474747..476273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0465"
FT                   /old_locus_tag="BCE0465"
FT                   /product="Rieske 2Fe-2S iron-sulfur protein, putative"
FT                   /note="identified by match to protein family HMM PF00355"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39400"
FT                   /db_xref="GOA:Q73E94"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="InterPro:IPR038010"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E94"
FT                   /protein_id="AAS39400.1"
FT                   /translation="MTSDTFPQFPSSYWIESTQIPTFPPLSENIKTKVAVIGAGITGIT
FT                   TAYLLAKEGIDVVLLDSGLILNGTTGHTTAKITAQHDLIYDELINHFGMEKAGLYYESN
FT                   NHALQFINETVQTYKIDCNFSNEDSYLYTTTDKGLRSLSKEYEAYQKLNIPCDYVQSLS
FT                   IPIPVQSALVMKNQAQFHPLLYLKTLLEKFVEMGGKVYEQTTAMDVEKGDSPQVITKGG
FT                   HRITCEYVVSCSHFPFYDANSFFFTRMYAERSYALAIKAKTDYPGGMYLSIDDPKRSLR
FT                   YTTSNGEKLILIGGESHKTGQGINTMLHYEALYSFAEATFGIDEVPYRWSAQDLITLDK
FT                   LPYIGHINESNPNIFVATGYRKWGMTTGTAAAHLLKDSILKVDSPYKELYAPSRFHANP
FT                   DIKTFFSQNLDVAKHLIEGKIETALRKPEDLEVGEGSVVHVNGKRAGAYKDKDGKLHIV
FT                   DTTCTHLGCEVEWNNGDCTWDCPCHGSRFSIEGDVIEGPADQPLKRVDNE"
FT   gene            476855..477940
FT                   /locus_tag="BCE_0466"
FT                   /old_locus_tag="BCE0466"
FT   CDS_pept        476855..477940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0466"
FT                   /old_locus_tag="BCE0466"
FT                   /product="fatty acid desaturase"
FT                   /note="identified by match to protein family HMM PF00487"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39401"
FT                   /db_xref="GOA:Q73E93"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E93"
FT                   /protein_id="AAS39401.1"
FT                   /translation="MKELHTFGWYAARVSPHLPKKAFKPVPTRLFGGLAYLLVALAGLI
FT                   SIGVFELNVWANLGIAIVLGLCFASLGFLGHEILHGTVVRKAWLRDFLGAIAFMPLSTG
FT                   PKLWRKWHNATHHVHTQHEENDPDAWPTLEKLKKSKFLSWVYRMPLHVRSFFSFLSLTI
FT                   QFTLHSTRMFFHFIKEFKSSNQKSVWLQLLLPWTVWISLLFIMGPGKWLFAYVIPLLIA
FT                   NFIVMAYIATNHRLNPIVPVNDPLANCLSVTVPRWIDVLHFNFSYHTEHHLFPAMSSKY
FT                   YPLVKEKIKEMWPERYHEMPMTKALAALWNTPRVYYQGSELVDPHREHFYGSLGNGLDP
FT                   HNISYREEHIEEEESIKKVNQ"
FT   gene            complement(477993..478865)
FT                   /locus_tag="BCE_0467"
FT                   /old_locus_tag="BCE0467"
FT   CDS_pept        complement(477993..478865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0467"
FT                   /old_locus_tag="BCE0467"
FT                   /product="amino acid ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39402"
FT                   /db_xref="GOA:Q73E92"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E92"
FT                   /protein_id="AAS39402.1"
FT                   /translation="MKLLKMVRMKKSVKNGLAVIFLVKRKKRSNLALQSFHKSCPTLCG
FT                   AFHSLLKSIQYEVKRMFEIFISTYPTLLKATIVTLQLTLTSLLLGSLIGLLFAFFRISN
FT                   NKVLNSIAHVYIAIIRGTPLIVQIAILYFGITSVVVFTPFWAGAIALAIHNGAYITEIF
FT                   RGSIQSVDRGQMEAARSLGMPYPLAMRRIVLPQAFRQSIPPLGNQFIIGLKDSSLVAYV
FT                   GLSELWGSGLSIAAGNFQQLDTYIIVGLYYLVLVLLFTYLVNLLEKRLQRKETNSVQFH
FT                   TKNKKEVSL"
FT   gene            complement(478777..479571)
FT                   /locus_tag="BCE_0468"
FT                   /old_locus_tag="BCE0468"
FT   CDS_pept        complement(478777..479571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0468"
FT                   /old_locus_tag="BCE0468"
FT                   /product="amino acid ABC transporter, amino acid-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39403"
FT                   /db_xref="GOA:Q73E91"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E91"
FT                   /protein_id="AAS39403.1"
FT                   /translation="MKRKLLTIVASITLCTSFILGACSKESATTSSNGEKEFRYAMSGL
FT                   YKPFNYKENDGKLVGFDVELGEALAKKMNMKPTPITNPWETLIQGLKAKKYDVILGSMA
FT                   ITEERLKAVNFSNPYYRSGAQIFVAKKNTSISSPEDLKGKKIGVVKASTFKDLVAKYTD
FT                   QITEYDSDITALMDLEPGRIDAVITDQMVGLRMIKEGKSNIKEAGKPLNLDEMGIAIRK
FT                   NDKEMVEKVNKALDEIIKDGTYEKISKKWFGRNILGEEEKTK"
FT   gene            complement(479693..480415)
FT                   /locus_tag="BCE_0469"
FT                   /old_locus_tag="BCE0469"
FT   CDS_pept        complement(479693..480415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0469"
FT                   /old_locus_tag="BCE0469"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39404"
FT                   /db_xref="GOA:Q73E90"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E90"
FT                   /protein_id="AAS39404.1"
FT                   /translation="MIQVRNLVKSFGSLDVLKGIDLEVQEKEVVVLIGASGSGKSTLLR
FT                   CLNFLEMYDEGEIHLQGERIDPKHSNLNKVRENVGMVFQHFNLFPHMTSLENIIEAPIH
FT                   VKKLEAANAKEIGNQLLQKVGLQDKADVTPHLLSGGQKQRIAIARALAMNPKIMLFDEP
FT                   TSALDPELVGEVLQVMKELAEEGMTMVIVTHEMNFARDVADRVIFMDDGKIVEDAPPAQ
FT                   FFSAPSHERAKQFLRNVL"
FT   gene            480626..481918
FT                   /locus_tag="BCE_0470"
FT                   /old_locus_tag="BCE0470"
FT   CDS_pept        480626..481918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0470"
FT                   /old_locus_tag="BCE0470"
FT                   /product="methyl-accepting chemotaxis protein, putative"
FT                   /note="identified by similarity to SP:P54576; match to
FT                   protein family HMM PF00015; match to protein family HMM
FT                   PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39405"
FT                   /db_xref="GOA:Q73E89"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E89"
FT                   /protein_id="AAS39405.1"
FT                   /translation="MEKERKTFSFGLRTQLMLFTTVLALITYSTSIFFIYVIYDYFQSY
FT                   VSQTAYNIIVMLLGVVWSGILAYGAAIFLIKPLRKLEEAARKAAEGDIREDVPLPKTDD
FT                   EIKSLSVAFNMMLGNLRGMVKNIDTTFSYTNNQVQQIRKQTGEATKQAQGVSETLAEIS
FT                   SGAEQSAASIQAIVSAVDTTTSIASEVEEKAKQSDELSSEMVQALGHSTRVFTSLIQGI
FT                   QTLAKENEDSMQNVQKLEERMKQVEHIVSVVSEIASQTNLLALNASIEAARAGEHGRGF
FT                   AVVAEEVRKLADESDHSARNISQLLRNMQEEVQQVATKMTEQVKIAKEEAKRGEATELI
FT                   LKEMSSSVMEVADATKQISGYMNEQVNHIHQTGAQTKAVAAIAEETSAGSQEVARVTLQ
FT                   QSKNMIAIDQLLKDLEKQATELKQTIKRFSM"
FT   gene            482072..482521
FT                   /gene="argR"
FT                   /locus_tag="BCE_0471"
FT                   /old_locus_tag="BCE0471"
FT   CDS_pept        482072..482521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argR"
FT                   /locus_tag="BCE_0471"
FT                   /old_locus_tag="BCE0471"
FT                   /product="arginine repressor"
FT                   /note="identified by match to protein family HMM PF01316;
FT                   match to protein family HMM PF02863; match to protein
FT                   family HMM TIGR01529"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39406"
FT                   /db_xref="GOA:Q73E88"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73E88"
FT                   /protein_id="AAS39406.1"
FT                   /translation="MKKEKRQRLIKQFVKEYEIEKQERLVELLAKKDVLVTQATVSRDI
FT                   RELNVTKVPSQEGLMIYKIFSEEHLQTDIKLKKKLREVVVKIDCVDQLMVIKTLPGNAH
FT                   VIGVLFDELDWKEKIGCICGNDTCLIISQSKSDREILEERLNLII"
FT   gene            482790..484022
FT                   /gene="arcA"
FT                   /locus_tag="BCE_0472"
FT                   /old_locus_tag="BCE0472"
FT   CDS_pept        482790..484022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcA"
FT                   /locus_tag="BCE_0472"
FT                   /old_locus_tag="BCE0472"
FT                   /product="arginine deiminase"
FT                   /EC_number="3.5.3.6"
FT                   /note="identified by match to protein family HMM PF02274;
FT                   match to protein family HMM TIGR01078"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39407"
FT                   /db_xref="GOA:Q73E87"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73E87"
FT                   /protein_id="AAS39407.1"
FT                   /translation="MKHPIHVTSEIGELQTVLLKRPGKEVENLTPDYLQQLLFDDIPYL
FT                   PIIQKEHDYFAQTLRNRGVEVLYLEKLAAEALVDKKLREEFVDRILKEGQADVNVAHQT
FT                   LKEYLLSFSNEELIQKIMGGVRKNEIETSKKTHLYELMEDHYPFYLDPMPNLYFTRDPA
FT                   ASVGDGLTINKMREPARRRESLFMEYIIKYHPRFEKHNVPIWLDRDYKFPIEGGDELIL
FT                   NEETIAIGVSARTSAKAIERLAKNLFSRQNKIKKVLAIEIPKCRAFMHLDTVFTMVDYD
FT                   KFTIHPAIQGPKGNMNIYILEKGSDEETLKITHRTSLMEALKEVLGLSELVLIPCGGGD
FT                   VIASAREQWNDGSNTLAIAPGVVVTYDRNYVSNTLLREHGIEVIEVLSSELSRGRGGPR
FT                   CMSMPIVRKDI"
FT   gene            484053..485051
FT                   /gene="argF"
FT                   /locus_tag="BCE_0473"
FT                   /old_locus_tag="BCE0473"
FT   CDS_pept        484053..485051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argF"
FT                   /locus_tag="BCE_0473"
FT                   /old_locus_tag="BCE0473"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="identified by match to protein family HMM PF00185;
FT                   match to protein family HMM PF02729; match to protein
FT                   family HMM TIGR00658"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39408"
FT                   /db_xref="GOA:Q73E86"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73E86"
FT                   /protein_id="AAS39408.1"
FT                   /translation="MLMTRPNLKGRSFLAEKDFTQEELLYFLDLAAELKEKKKNGIPHH
FT                   YLEGKNVALLFEKTSTRTRCAFTVACTDLGANPEYLGKSDIQLGKKESVEDTAKVLGRM
FT                   FDGIEFRGFNHETVESLAQNSGVPVWNGLTDMWHPTQTLADLLTIREHVGKLKNVKLVY
FT                   VGDGRNNVANSLLVGGAIVGMDVRICTPETLWPAQEVIDLAKKYNEQVMITSNVEEAVA
FT                   NADVIYTDVWVSMGEEEKFAERVKLLKPYQVNMKMIKETGNENVIFLHCLPAFHDVETM
FT                   YGEEVYEKYGLKEMEVTDEVFRSKHSKVFDQAENRMHTIKAVMAATLGNME"
FT   gene            485151..486566
FT                   /gene="arcD"
FT                   /locus_tag="BCE_0474"
FT                   /old_locus_tag="BCE0474"
FT   CDS_pept        485151..486566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcD"
FT                   /locus_tag="BCE_0474"
FT                   /old_locus_tag="BCE0474"
FT                   /product="arginine/ornithine antiporter"
FT                   /note="identified by similarity to SP:P18275; match to
FT                   protein family HMM PF00324; match to protein family HMM
FT                   TIGR00905"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39409"
FT                   /db_xref="GOA:Q73E85"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="InterPro:IPR022461"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E85"
FT                   /protein_id="AAS39409.1"
FT                   /translation="MGEDKKLGLFTLTALVVGSMIGGGAFNLASDMAKGAGAGAIIIGW
FT                   VITGIGMIALGLSFQNLTVKRPDLDGGIFSYAKAGFGNFMGFNSAWGYWLSAWLGNVAY
FT                   GTLLFSSLGYFFPIFEGGQNVASIVGASVLLWCVHMLILRGVQSAALVNLVTTIAKLVP
FT                   VFVFIVIGIFAFHIDTFLDGFWGQTGSFSWGAVGSQVKSTMLVTLWVFIGVEGAVVLSS
FT                   RAKNRSDVGKATVIGLIGTLIIYILITLLSLGLMQQADIAGLKNPAMAYLFESVVGKWG
FT                   AIFINLGLVISVLGAWLGWTLLASEIPYLAAKDGVFPKWFAKENKNKAPVNSLWITNGL
FT                   IQMFLLTFVVSDQAYNFAFSLASSAILIPYAFSAFYQLKHSLKSEEVDRNKNIVIGLIA
FT                   SIYGVWLVYAAGLEYLLLTMTLYAPGIFIFYNVQKQKSSKQIFTRVELASSVAIGALAF
FT                   FAIYGLITGSITL"
FT   gene            486604..487566
FT                   /gene="arcC"
FT                   /locus_tag="BCE_0475"
FT                   /old_locus_tag="BCE0475"
FT   CDS_pept        486604..487566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcC"
FT                   /locus_tag="BCE_0475"
FT                   /old_locus_tag="BCE0475"
FT                   /product="carbamate kinase"
FT                   /EC_number="2.7.2.2"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM TIGR00746"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39410"
FT                   /db_xref="GOA:Q73E84"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E84"
FT                   /protein_id="AAS39410.1"
FT                   /translation="MARRKIVVALGGNAIQSGKATAGAQQEALEKTAEQLVKIMENDVD
FT                   IVIAHGNGPQVGNILLQQKAAETEKTPAMPLDTCGAMSQGMIGYWMENAIEKALKKRNI
FT                   KKDVATVITRVVVDKKDEAFKNPTKPIGPFYTEEEARRLMDETKAVFKEDAGRGWRRVV
FT                   PSPKPVSIHEHKVINSLVEDGNIVIAVGGGGIPVIDSEEGLKGTEAVIDKDFAAQKLAE
FT                   LVDADTLVILTAVDHVYVNYNQPNQKKLEHVTVNQLEEYIEEQQFAAGSMLPKIEAAIN
FT                   FVNTNPKRKTIITSLEKVYEALEEKAGTIISKQNVCMYV"
FT   gene            487547..487660
FT                   /locus_tag="BCE_0476"
FT                   /old_locus_tag="BCE0476"
FT   CDS_pept        487547..487660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0476"
FT                   /old_locus_tag="BCE0476"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39411"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E83"
FT                   /protein_id="AAS39411.1"
FT                   /translation="MYACMFKSLCTLLIIEKRMKLVTSFFLLIHIFCTYCS"
FT   gene            487768..488457
FT                   /locus_tag="BCE_0477"
FT                   /old_locus_tag="BCE0477"
FT   CDS_pept        487768..488457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0477"
FT                   /old_locus_tag="BCE0477"
FT                   /product="transcriptional regulator, Crp family"
FT                   /note="identified by similarity to SP:P29283; match to
FT                   protein family HMM PF00027"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39412"
FT                   /db_xref="GOA:Q73E82"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E82"
FT                   /protein_id="AAS39412.1"
FT                   /translation="MNRRNVVKDLKQFELFAHLTEKKLKGLTEFVYWRTYKKGQFLFLE
FT                   GDSRERIYFMLDGFVKLERVNQSGNLLYDDYVKRYSIFPYGGMFTDRGYNYTAEAMTDV
FT                   EVYYIPTVIFEDMVKSSRTQLMYVVQQLSSILKLNENRVQNITIPNAQDRVIQTLNYLM
FT                   QDLGEQSGETIVISCPLTTIEISKISGTSRETVSSVLKQLKNDSIVTILDKKITIHNPT
FT                   YFEEISM"
FT   gene            488614..489279
FT                   /locus_tag="BCE_0478"
FT                   /old_locus_tag="BCE0478"
FT   CDS_pept        488614..489279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0478"
FT                   /old_locus_tag="BCE0478"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39413"
FT                   /db_xref="GOA:Q73E81"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E81"
FT                   /protein_id="AAS39413.1"
FT                   /translation="MIRIEYDRLVAIFYSIGVLLLLKIPNDNELIGEELFNFYKVPIHT
FT                   DIYMNYKVSNILIVSFVLHVIAFILFLKWLGKKESSTFRKMNKIKVVGISILILMMPFI
FT                   LNNILQTLNKTWYYAGKTGVEAIEYKKDDSQCRMEKNGEDIERKCIVTLKNYRNHSQAL
FT                   KVVLYEDSKSYPVPNPIYLQKHETKRVEFQIPVVYSSGIEKDEVPNIKIHSLHEDDTK"
FT   gene            complement(489408..490394)
FT                   /locus_tag="BCE_0479"
FT                   /old_locus_tag="BCE0479"
FT   CDS_pept        complement(489408..490394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0479"
FT                   /old_locus_tag="BCE0479"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39414"
FT                   /db_xref="GOA:Q73E80"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E80"
FT                   /protein_id="AAS39414.1"
FT                   /translation="MTIPAGTSASVGIVGLTLGGGIGMLSRLFGLTCDQLIEVEMVQAC
FT                   GKFGAKIIRASEHENHNLFWACRGGGGGNFGIITSLTFRVHPIKNVSIFSITWEWKDFI
FT                   AAFQAWQNWAPYVDERLTSSIELFTKQQNKIEAQGEFVGSPSELHSLLSPLLETGTPSL
FT                   FIDEVPYIKAVEFFNSGNIPENFKRSGSYVYKPIPLKGIQIMQYFLSHAPNKDASIWHQ
FT                   SLVGAVENIPPTETAYFHRKAIIAQEYITSWKCDDEENRNIRWVKDLREILDPYTLGDY
FT                   VNWPDIDIKNWQTSYYGPNFQRLRKVKTIYDPCNVFRFQQSIPPFHT"
FT   gene            complement(490404..490742)
FT                   /locus_tag="BCE_0480"
FT                   /old_locus_tag="BCE0480"
FT   CDS_pept        complement(490404..490742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0480"
FT                   /old_locus_tag="BCE0480"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39415"
FT                   /db_xref="GOA:Q73E79"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E79"
FT                   /protein_id="AAS39415.1"
FT                   /translation="MKQTKLTGRIVVPSDPDYDIARMNLNLSIPKLPCIIVFCQNKTDV
FT                   CNALKWARERHVPFRLRSGRHNYENFSLLNRGLIIDVSEMHRITVHTDTLTATIEAGAN
FT                   LGTVYKEL"
FT   gene            490987..492651
FT                   /locus_tag="BCE_0481"
FT                   /old_locus_tag="BCE0481"
FT   CDS_pept        490987..492651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0481"
FT                   /old_locus_tag="BCE0481"
FT                   /product="glycosyl hydrolase family protein"
FT                   /note="identified by match to protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39416"
FT                   /db_xref="GOA:Q73E78"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E78"
FT                   /protein_id="AAS39416.1"
FT                   /translation="MNKTWWKEAVAYQIYPRSFMDSNGDGIGDLQGIIAKLDYLKDLGI
FT                   DVIWICPMYKSPNDDNGYDISDYQDIMDEFGTMEDFDALLDEVHKRDMKLIIDLVINHT
FT                   SDEHPWFIESRSSKDNPKRDWYIWHDGKDGAEPNNWESIFNGSAWEYDEVTGQYYLHLF
FT                   SRKQPDLNWENKEVREVLYDTVNWWLDKGIDGFRVDAISHIKKEDGFKDMPNPKELKYV
FT                   PSFDKHMNVDGIQPLLEELKENTFSKYDIMTVGEANGVKIEDAELWVGEEQGKFNMVFQ
FT                   FEHLSLWDAEKKKDLDVVGLKKVLTKWQKGLENKGWNALYIENHDKPRIVSTWGDDKQY
FT                   WRESATALGAMYFFMHGTPFIYQGQEIGMTNVQFPNIEDYDDVAIKNLYREKIAEGVSH
FT                   QDMMEIIWASCRDNSRTPMQWNDEMNAGFTTGAPWFGMNPNYKEINVEKQKSEENSIFN
FT                   FYKKMIALKKEHDVLNYGTYDLLLEDDPQIYAYTRTLSDEKIVVISNISKEEAVYNEGS
FT                   FAIERKRLLLNNYEVAEHEQVTTITLKPYETRVYRIS"
FT   gene            492859..494496
FT                   /locus_tag="BCE_0482"
FT                   /old_locus_tag="BCE0482"
FT   CDS_pept        492859..494496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0482"
FT                   /old_locus_tag="BCE0482"
FT                   /product="PTS system, IIBC component"
FT                   /note="identified by match to protein family HMM PF00367;
FT                   match to protein family HMM PF02378; match to protein
FT                   family HMM TIGR00826"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39417"
FT                   /db_xref="GOA:Q73E77"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011300"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E77"
FT                   /protein_id="AAS39417.1"
FT                   /translation="MKITSFDFWQKFGKALLVVVAVMPAAGLMISIGKLIGMSAGDINA
FT                   VHTIARVMEDIGWAIITNLHILFAVAIGGSWAKDRAGGAFAALLAFVLTNRITGAIFGV
FT                   NAEMLADSKAKVSSVLAGDLIVKDYFTSVLGAPALNMGVFVGIITGFLGATLYNKYYNY
FT                   NKLPQALAFFNGKRFVPFVVIVWSTVTAIVLSLLWPFIQSGLNEFGRWIAASKDSAPIV
FT                   APFVYGTLERLLLPFGLHHMLTIPMNYTELGGTYTMLTGSKVGQVVAGQDPLWLAWITD
FT                   LNNLLANGDTKAYNDLLNNVVPARFKAGQVIGSTAALMGIAFAMFRNVDKEKRSKYKPM
FT                   FLSAALAVFLTGVTEPIEFMFMFIAPVLYVVYAITTGLAFALADLINLRVHAFGFIELI
FT                   TRTPMMVNAGLTRDLINFVIVSLVFFGLNFTLFNFLIKKFNLPTPGRAGNYIDNEDESS
FT                   EGTGNVQDGSLATKVIDLLGGKENIADVDACMTRLRVTVKDLDVVAPEAQWKQNGALGL
FT                   IVKDKGVQAVYGPKADVLKSDIQDMLGA"
FT   gene            494501..495292
FT                   /locus_tag="BCE_0483"
FT                   /old_locus_tag="BCE0483"
FT   CDS_pept        494501..495292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0483"
FT                   /old_locus_tag="BCE0483"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03372"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39418"
FT                   /db_xref="GOA:Q73E76"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E76"
FT                   /protein_id="AAS39418.1"
FT                   /translation="MKLLTLNCHSWQEENQIEKIKYLAKVIQEEEYDVIALQEVSQSIG
FT                   AKNVCGNKKEDNFGLLLLEELKALYVKDYNITWDFSHIGYDVYEEGLAIITKHNVVKED
FT                   TFFISENKDTTYWKTRKIVSATIAYNGKNITFYSCHLGWWNDEEESFKDQVNRLMERVD
FT                   SNELSFLMGDFNNNARLQGEGYEYMMQKGLYDTYELAIEKDEGTTVQGEIAGWDENKHN
FT                   LRIDLILCNRSEKVRSSKVIFNGTNRNVISDHFGVEVQVDI"
FT   gene            495598..498459
FT                   /locus_tag="BCE_0484"
FT                   /old_locus_tag="BCE0484"
FT   CDS_pept        495598..498459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0484"
FT                   /old_locus_tag="BCE0484"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39419"
FT                   /db_xref="GOA:Q73E75"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E75"
FT                   /protein_id="AAS39419.1"
FT                   /translation="MKQIWRIYKTDLRNVAKHWAAIVIVVGLMILPSLYAWFNIKASWD
FT                   PYGNTKEVPIAVSNQDAGSNLRGKDINIGDEIVDSLKKNKNLGWKFVDEKQAIYGVERG
FT                   DYYASITIPKDFSEKIATVLDENPQKPELDYYVNEKVNAIAPKITAKGASGITEEISKN
FT                   FVKTANGEIFKIFNDLGIDLETNLPSIEKVKDLVFKLEAQFPEMNTLMDKALDDATRAE
FT                   DVVKVAQKELPVVESVINDGQEALGNLDKFFARQDQTLKNAPGTIRNDLVAAKGVMDSA
FT                   AAFTDFLMNPGVELNIPDLSGMNGLPEFPARPDLSKLNSDGYKSIAQSINQTVNNVLSS
FT                   SRAGTAYAQSVMDGLQNGSVDPEIAKKNISTISNNLQTHIDNLSYVIDVMARLEQGAQT
FT                   EFGQNFFKTRKEHLTDIKNGQQDLNNRFKRLNDLISTGQEVKQDVRDGINQKLNETNAL
FT                   IDRAEKDYNETFVADYKKAVSAVDQAKADANQIYDNAKADYDKAKNSLEGAKADLQKAK
FT                   EDVQNRGINGLDSTKVALNSLNGQFQSGIGLIDDMIPVLESTNKVLADVNSDKNLNNGI
FT                   AKLNKAKSSLQKGVDATNKGITLLNNGQKPTKDVIESINNAAKGGSAQLTDVLSTYDSE
FT                   IVPNFNTAIARTKEMSKNTTQILNEADKKLPDVKKLLEDSSKGLVDGKKKLTDIKADMP
FT                   ETEKKIKDLANKIRDFESEEDIKDIIRLLKNDVEKQSDYFANPVNLKENKLFAMPNYGS
FT                   AMSPFYTVLALWVGALLMVSLLTVEVHEEGANYKSHEIYFGRLLTFLTIGLSQAFIVSM
FT                   GDIFLLGTYVVDKFWFVLFSLFIGGVFVCIVYSLVSIFGNVGKSMAIILLVLQVAGSGG
FT                   TFPIQMTPAFFQAIYPFLPFTYAISAIRETVGGMLWDIVTRDLLVLSAFVVVMIVAALL
FT                   LKTPINKSSEKFVENAKGSKIIH"
FT   gene            complement(498500..500689)
FT                   /gene="topB"
FT                   /locus_tag="BCE_0485"
FT                   /old_locus_tag="BCE0485"
FT   CDS_pept        complement(498500..500689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topB"
FT                   /locus_tag="BCE_0485"
FT                   /old_locus_tag="BCE0485"
FT                   /product="DNA topoisomerase III"
FT                   /EC_number="5.99.1.2"
FT                   /note="identified by match to protein family HMM PF01131;
FT                   match to protein family HMM PF01751; match to protein
FT                   family HMM TIGR01056"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39420"
FT                   /db_xref="GOA:Q73E74"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73E74"
FT                   /protein_id="AAS39420.1"
FT                   /translation="MSKSVVIAEKPSVARDIARVLKCDKKGNGYLEGSKYIVTWALGHL
FT                   VTLADPESYDVKYKKWNLEDLPMLPERLKLTVIKQTGKQFNAVKSQLLRKDVNEIIVAT
FT                   DAGREGELVARWIIDKVRINKPIKRLWISSVTDKAIKDGFANLKPGRAYDNLYASAVAR
FT                   SEADWYIGLNATRALTTRFNAQLNCGRVQTPTVAMIANREDEIKNFKAQTYYGIEAQTT
FT                   NQLKLTWQDANGNSRSFNKEKIDGIVKGLDKHNATVMEIDKKQKKSFSPGLYDLTELQR
FT                   DANKKFGYSAKETLNIMQKLYEQHKVLTYPRTDSRYISSDIVGTLPERLKACGVGEYRP
FT                   LAHKVLQKPIKANKSFVDDSKVSDHHAIIPTEGYVNFSAFTDKERKIYDLVVKRFLAVL
FT                   FPAFEYEQLTLRTKVGNETFIARGKTILHAGWKEVYENRFEDDDVTDDVKEQLLPRIEK
FT                   GDTLTVKLIMQTSGQTKAPARFNEATLLSAMENPTKYMDTQNKQLADTLKSTGGLGTVA
FT                   TRADIIDKLFNSFLIEKRGKDIHITSKGRQLLDLVPEELKSPTLTGEWEQKLEAIAKGK
FT                   LKKEVFISEMKNYTKEIVSEIKSSDKKYKHDNISTKSCPDCGKPMLEVNGKKGKMLVCQ
FT                   DRECGHRKNVSRTTNARCPQCKKKLELRGEGAGQIFACKCGYREKLSKFQERRKKESGN
FT                   KADKRDVQKYMKQQKKEEEPLNNPFAEALKKLKFD"
FT   gene            501093..501899
FT                   /gene="thiM"
FT                   /locus_tag="BCE_0486"
FT                   /old_locus_tag="BCE0486"
FT   CDS_pept        501093..501899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiM"
FT                   /locus_tag="BCE_0486"
FT                   /old_locus_tag="BCE0486"
FT                   /product="hydroxyethylthiazole kinase"
FT                   /EC_number="2.7.1.50"
FT                   /note="identified by match to protein family HMM PF02110;
FT                   match to protein family HMM TIGR00694"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39421"
FT                   /db_xref="GOA:Q73E73"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73E73"
FT                   /protein_id="AAS39421.1"
FT                   /translation="MNMKEISKVVDLVRESNPLVHNITNVVVTNFTANGLLALGASPVM
FT                   AYAKEEVAEMASIAGALVLNMGTLRPEEVEAMLLAGKSANVNNVPVLFDPVGAGATSYR
FT                   TEVARHIPAEIELAIIRGNAAEIANVINERWEIKGVDAGAGNGNVVSIAKQAADELNTV
FT                   AVITGEEDVVTDGERTIVIQNGHSILTKVTGTGCLLTSVIGAFVAVEKDYVKAAIAALT
FT                   FYGVAAELAAAKTVEKGPGSFQIEFLNQLANTTSGDIEKYGKIEVI"
FT   gene            501916..502590
FT                   /gene="thiE"
FT                   /locus_tag="BCE_0487"
FT                   /old_locus_tag="BCE0487"
FT   CDS_pept        501916..502590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="BCE_0487"
FT                   /old_locus_tag="BCE0487"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="identified by match to protein family HMM PF02581;
FT                   match to protein family HMM TIGR00693"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39422"
FT                   /db_xref="GOA:P61410"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:P61410"
FT                   /protein_id="AAS39422.1"
FT                   /translation="MSRISKAEMSRLLSVYFIMGSNNCTKDPLQILKDALEGGITIFQF
FT                   REKGEGALTGEERICFAKELQAICKEYGVPFIVNDDVELALELDADGVHVGQEDEGITS
FT                   VREKMGDKIIGVSTHTIEEARWAIENGADYLGVGPIFPTSTKKDTKAVQGTKGLAHFRE
FT                   QGITIPIVGIGGISIENTASVIEAGADGVSVISAISLAESAYESTKQLVEEVSKKGTSH
FT                   KY"
FT   gene            complement(502687..504000)
FT                   /locus_tag="BCE_0488"
FT                   /old_locus_tag="BCE0488"
FT   CDS_pept        complement(502687..504000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0488"
FT                   /old_locus_tag="BCE0488"
FT                   /product="anaerobic C4-dicarboxylate membrane transporter"
FT                   /note="identified by similarity to SP:P04539; match to
FT                   protein family HMM PF03605; match to protein family HMM
FT                   TIGR00770"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39423"
FT                   /db_xref="GOA:Q73E72"
FT                   /db_xref="InterPro:IPR004668"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E72"
FT                   /protein_id="AAS39423.1"
FT                   /translation="MFWLQFLTLLLCIFIGARLGGVGLGVMGGVGMAILVFVFHLQPTA
FT                   PPIDVMLMILAVITAAGALQAAGGMDYLVHLAEKALRKNPKRITFFAPIVTYLFTLCAG
FT                   TGHVAYSVLPVIAEVSRESGIRPERPMSIAVIASQQAITASPISAATVALLAMLADYKI
FT                   TLLDILKVSIPSTFIACMVAAFVASKMGKELNEDPEYLKRLKEGMIPKIEEKKEFVGVK
FT                   GAKLSVILFLVGTFLVVLLGSFEALRPGWIVDGKLARLSMPNTIEMVMLTIAALIIIFC
FT                   KPNVESIVSGNVFKAGATAVVAIFGIAWMGDTFFNGNLNMIQGSIQHLVTSAPWLFAIA
FT                   LFILSILLYSQAATVRALMPLGLSLGIPPALLIAMFPAVNGYFFIPNYGTIVAAINFDR
FT                   TGTTGIGKYVLNHSFMIPGLIATFTSIGIGMLLISIMF"
FT   gene            504511..506250
FT                   /locus_tag="BCE_0489"
FT                   /old_locus_tag="BCE0489"
FT   CDS_pept        504511..506250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0489"
FT                   /old_locus_tag="BCE0489"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39424"
FT                   /db_xref="GOA:Q73E71"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E71"
FT                   /protein_id="AAS39424.1"
FT                   /translation="MKKYWHKLSFLQKNVLLTVLVILTLVGTMGALSFNMFQNSMMSIF
FT                   ERHSFETGDTVLHKLDEQIVRDVTKDPVAQREKREKLTEKLDEAKEELNSVGQIYIVGA
FT                   KENEKGELLIVDLSTELANVVEVRPGEYYKQPDLWMKAYDKVMSTKKANMTVVYEDLLG
FT                   SWVTILEPIKDGDGNIVAIVAADVDASIVPITKEKFIIQGLMFICISVLIATVIQFLIV
FT                   RNALAPLRDLREGLRRVGEGDLSIKLEERPDDIGIINAYFNNTIEKFKGIIDKVKQTAE
FT                   QVSSSSQELSVSTKENSMAVKGIVSSIVELRAGVQLQEKSVPKYLDIVYEMEDRMEEIT
FT                   NIAKQMTKESEGTKHHSEKGNGIIEQTMNQMNIIQNAVQDLSSIIYSLEVRSKEISDIV
FT                   TVITSISNQANSLALHATIEASRAEETGEGFAVVADEVRKLAEQTEASAKDIAKLIGET
FT                   QAGTEEAVVSMQKTSKEVESGMKLVESSGAFFEKISKSAQTVTNQVGVVSSNSNNILQN
FT                   SQNIVRVVNELSLIANKYANSSSNVEESMKEQEMSVQDIAELASSLSWLSQELQELIGE
FT                   FKS"
FT   gene            506514..506834
FT                   /locus_tag="BCE_0490"
FT                   /old_locus_tag="BCE0490"
FT   CDS_pept        506514..506834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0490"
FT                   /old_locus_tag="BCE0490"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01910"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39425"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E70"
FT                   /protein_id="AAS39425.1"
FT                   /translation="MSQQVTISFSVVPQAKNKDVYSVVDKAIEVVQQSGVRYEVGAMET
FT                   TLEGELDVLLDIIKRAQQACVDAGAEEVITSIKIHYRPSTGVTIDEKVWKYRDEYAKPE
FT                   AI"
FT   gene            506806..507579
FT                   /locus_tag="BCE_0491"
FT                   /old_locus_tag="BCE0491"
FT   CDS_pept        506806..507579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0491"
FT                   /old_locus_tag="BCE0491"
FT                   /product="ABC transporter, permease protein, putative"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39426"
FT                   /db_xref="GOA:Q73E69"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E69"
FT                   /protein_id="AAS39426.1"
FT                   /translation="MNMQNQKQSKIITAIWLILLIAIWEGSVSLFKIEPWILPKPSAIV
FT                   QELIGMKDLLLPNTMQTLQEVIIGLFFAILIGTSIAILMDVIPLFRILINPLLVISQTI
FT                   PIVVLAPLFIIWFGYGMLPKVMVVILVCFFPIALSILEGFQTVDKNMLKLLQTMKATKW
FT                   QVYQKVKFPAVLPYFFSGLKIAVTYSVMGAIIGEWLGASEGLGVMLTRATKSFLTARVF
FT                   GVAAIIVMVTLCLYFIVEFMARITAPWIYRKDGRK"
FT   gene            507576..508574
FT                   /locus_tag="BCE_0492"
FT                   /old_locus_tag="BCE0492"
FT   CDS_pept        507576..508574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0492"
FT                   /old_locus_tag="BCE0492"
FT                   /product="ABC transporter, substrate-binding protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39427"
FT                   /db_xref="GOA:Q73E68"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E68"
FT                   /protein_id="AAS39427.1"
FT                   /translation="MKKGLKVMLATLLAVGVAGCNPAKKEESASKDQKVKVVLDWFPNT
FT                   NHTGLYVAKAKDYYKKQGLDVEIIQPGDNVTAEQMIASGKADFAISAQENVTLARVEGI
FT                   PVVSVGAIIQHNTSAFASLKKDNMTSPKDFEGKRYGGWGGPAEEATLKTIMEKNQADFN
FT                   KVEKIILGQTDFFKSIGRDADFEWIYYGWDGIEAKRQGKELNTIMVKDLDPALDFYSPV
FT                   IITSEKHTKQDKDFVKKFMSATTEGYNFAIKEPKEAADILIKAVPDVNKELVQESQKWL
FT                   STKYQDDAKAWGVQKEEVWTNYMNFLYDNKVIKKKIDVKDAFTNEFLPSEK"
FT   gene            508571..509320
FT                   /locus_tag="BCE_0493"
FT                   /old_locus_tag="BCE0493"
FT   CDS_pept        508571..509320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0493"
FT                   /old_locus_tag="BCE0493"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39428"
FT                   /db_xref="GOA:Q73E67"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E67"
FT                   /protein_id="AAS39428.1"
FT                   /translation="MSGLQIKDIVKSFDGKNVLANISASIREGEFVSFVGPSGCGKSTL
FT                   LNMIANVENPTSGSLTYNDKQMQEQDVVSYMPQQDLLLPWRSALQNIVLPLEIEGKPKK
FT                   QRLTEGMEALKQFELDEYADHYPDELSGGMRQRISFLRTYLCEKPIMLLDEPFGKLDAF
FT                   TKMEVHSWLLNSWHQEKQTIVMVTHDLDEAILLSDRVFILSQRPASIVGEVQVKLPRPR
FT                   TMDMLTSLELKKDKEEILRVLAPYMKK"
FT   gene            509387..510139
FT                   /locus_tag="BCE_0494"
FT                   /old_locus_tag="BCE0494"
FT   CDS_pept        509387..510139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0494"
FT                   /old_locus_tag="BCE0494"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39429"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E66"
FT                   /protein_id="AAS39429.1"
FT                   /translation="MKSIEQIVDELTADNLEEGKSLLKNHILLMKYGMEHHELNEEEMT
FT                   EILKWVQGRDQLRKDVPELRDLHLIKKFQAVLDEFIHSIILNGYVEDAVEILESVLKSM
FT                   GAVAHIVKIMFIGKRKVNRNSLEMVEELKRECYNLMEQRAAVGLHAQIFHVLGFIHSVQ
FT                   FDLEERSQEHGRSVIGFLTDFKTNELKSVQQFQTEDHIPEVKNIVSKEYGIELQRRIYM
FT                   WKSLTIIFTSPYALEKMYKEIYAENDKT"
FT   gene            510466..512010
FT                   /locus_tag="BCE_0495"
FT                   /old_locus_tag="BCE0495"
FT   CDS_pept        510466..512010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0495"
FT                   /old_locus_tag="BCE0495"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39430"
FT                   /db_xref="GOA:Q73E65"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E65"
FT                   /protein_id="AAS39430.1"
FT                   /translation="MSILTVENVSHSYGEKTILYNACFRLLKGEHVGLVGQNGIGKSTL
FT                   LKILTGELIHDEGNIEWFPHVKVGFLQQHIDLQEGITIEGYLQSAFADLYVIECEMLKI
FT                   AEEMNGAGEVEKLLVKYGELQTILESSNFYHIHTEVEEVAIGLGLFEIGLKKDVSKLSG
FT                   GQRTKLLLGKLLLEKADVLLLDEPTNYLDTAHIEWLQSYLRLYEKAYVIISHDELFLNS
FT                   ITNVIFHLEGGKVKRYVGNYEKFVQSYQVQKKQLQSAYVKQQKEISQLETFIQKNKIRK
FT                   AKQAKSREKVLEKMQRIEKIHPVPRSRFDFNVYEEPVSRILQAEKLRIGYSDPLCPELN
FT                   LQVKKGEKIAIIGHNGIGKTTMLKTLLGQIKPLSGSISVGERVNPAYFAQEEFASETTP
FT                   LEKVWAERPDMTKKEVRQALAKCGLKEEHVLKPIRLLSGGEQTKVRLCELIVKKSNVLI
FT                   LDEPTNHLDIETKKALQEALQRYRGTVLLVSHEPSFYEAWITKVWNIEEWNAEQYE"
FT   gene            512088..512180
FT                   /locus_tag="BCE_0496"
FT                   /old_locus_tag="BCE0496"
FT   CDS_pept        512088..512180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0496"
FT                   /old_locus_tag="BCE0496"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39431"
FT                   /db_xref="GOA:Q73E64"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E64"
FT                   /protein_id="AAS39431.1"
FT                   /translation="MYEEALLWCAYKRAFSFVMFIFIIILDAFP"
FT   gene            complement(512470..514494)
FT                   /locus_tag="BCE_0497"
FT                   /old_locus_tag="BCE0497"
FT   CDS_pept        complement(512470..514494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0497"
FT                   /old_locus_tag="BCE0497"
FT                   /product="chitinase B"
FT                   /note="identified by match to protein family HMM PF00041;
FT                   match to protein family HMM PF00553; match to protein
FT                   family HMM PF00704"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39432"
FT                   /db_xref="GOA:Q73E63"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E63"
FT                   /protein_id="AAS39432.1"
FT                   /translation="MKSKKFTLLLLSLLLFLPLFLTNFITPNFALAESPKQGQKVVGYF
FT                   PSWGIYGRNYQVADIDASKLTHLNYAFADICWNGKHGNPSTHPDNPNKQTWDCKESGVP
FT                   LQNKEVPNGTLVLGEPWADVTKSYPGSGTTWEDCDKYARCGNFGELKRLKAKYPHLKTI
FT                   ISVGGWTWSNRFSDMAADEKTRKVFAESTVDFLREYGFDGVDLDWEYPGVETIPGGSYR
FT                   PEDKQNFTLLLQEVRNALTKAGAEDGKQYLLTIASGASQRYADHTELKKISQILDWINI
FT                   MTYDFHGGWEATSNHNAALYKDPNDPAADTKFYVDGAIDIYTNEGVPADKLVLGVPFYG
FT                   RGWKSCGKENNGQYQPCKPGSDGKLASKGTWDDYSTGDTGVYDYGDLAANYVNKNGFVR
FT                   GWNDIAKVPYLYNATTGTFISYDDNESMKYKTDYIKTKGLSGAMFWELSGDCRTSPKYS
FT                   CSGPKLLDTLVKELLGGPITQKDTEPPTNVKNIVVTNKNSSSVQLNWNASTDNVGVTEY
FT                   EITAGEEKWSTTTNNITIKNLKSNTEYKFSIIAKDAAGNKSQPTSIIVKTDDASTTPPG
FT                   GNNNATFSVTSNWGSGYNFSIVIKNSGTTPIKNWKLEFDYNGNLTQVWDSKISSKINNH
FT                   YVITNAGWNGQIPPGGSITIGGAGTGTPAELVNASISEN"
FT   gene            514849..515220
FT                   /locus_tag="BCE_0498"
FT                   /old_locus_tag="BCE0498"
FT   CDS_pept        514849..515220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0498"
FT                   /old_locus_tag="BCE0498"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39433"
FT                   /db_xref="InterPro:IPR018961"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E62"
FT                   /protein_id="AAS39433.1"
FT                   /translation="MDVFLNIAEEKIRQAIRNGDLDHIPGKGKPLQLEDLSMVPPELRM
FT                   SYKILKNAGMIPPEMELQKDILKIEDLIACCYDEVERIKLQEELTAKTLRFQQVMEKRK
FT                   IKDSSAFRMYQDKVFRKLR"
FT   gene            515231..515545
FT                   /locus_tag="BCE_0499"
FT                   /old_locus_tag="BCE0499"
FT   CDS_pept        515231..515545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0499"
FT                   /old_locus_tag="BCE0499"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39434"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="PDB:4EUY"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E61"
FT                   /protein_id="AAS39434.1"
FT                   /translation="MNTFKTIEELATYIEEQQLVLLFIKTENCGVCDVMLRKVNYVLEN
FT                   YNYVEKIEILLQDMQEIAGRYAVFTGPTVLLFYNGKEILRESRFISLENLERTIQLFEE
FT                   "
FT   gene            515559..515810
FT                   /locus_tag="BCE_0500"
FT                   /old_locus_tag="BCE0500"
FT   CDS_pept        515559..515810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0500"
FT                   /old_locus_tag="BCE0500"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39435"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E60"
FT                   /protein_id="AAS39435.1"
FT                   /translation="MEFIIFILLFVVVGTILTAVRSNKKKVNLTKQNNIHNSSNNSSPL
FT                   FFFAGSDNDSSHGGSHDCGGSFGGDSGGSCDGGGGGGD"
FT   gene            515701..515847
FT                   /locus_tag="BCE_0501"
FT                   /old_locus_tag="BCE0501"
FT   CDS_pept        515701..515847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0501"
FT                   /old_locus_tag="BCE0501"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39436"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E59"
FT                   /protein_id="AAS39436.1"
FT                   /translation="MRDLIMIARMEVHMIVEDLSVEIAEAAAMVAEVAVIDENTPYKGR
FT                   ISF"
FT   gene            515938..516081
FT                   /locus_tag="BCE_0502"
FT                   /old_locus_tag="BCE0502"
FT   CDS_pept        515938..516081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0502"
FT                   /old_locus_tag="BCE0502"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39437"
FT                   /db_xref="GOA:Q73E58"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E58"
FT                   /protein_id="AAS39437.1"
FT                   /translation="MEREPKVKNKGKVMLFLVAAGGIFLVKLGFKIGIIHMIRTWFEST
FT                   FF"
FT   gene            516163..516744
FT                   /locus_tag="BCE_0503"
FT                   /old_locus_tag="BCE0503"
FT   CDS_pept        516163..516744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0503"
FT                   /old_locus_tag="BCE0503"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39438"
FT                   /db_xref="GOA:Q73E57"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013571"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E57"
FT                   /protein_id="AAS39438.1"
FT                   /translation="MRRSAEEIKKEIAYKAESLFSQKGYAATSMEEICEITERSKGSIY
FT                   YHFKSKEELFLFVVKQHTYDWLEKWNEKEKSYSTNTEKLYGLAEYHVEDIQQPISNAIE
FT                   EFSMSQVVSKEILDELLALTRESYVMFEKLIEAGIQSGEFREDNTRDLMYIVNGLLSGL
FT                   GVLYYELDYKELKRIYKKAIDVLLKGMAAE"
FT   gene            516810..518042
FT                   /locus_tag="BCE_0504"
FT                   /old_locus_tag="BCE0504"
FT   CDS_pept        516810..518042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0504"
FT                   /old_locus_tag="BCE0504"
FT                   /product="major facilitator family transporter"
FT                   /note="identified by match to protein family HMM PF00083"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39439"
FT                   /db_xref="GOA:Q73E56"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E56"
FT                   /protein_id="AAS39439.1"
FT                   /translation="MNALFKNRAFMLVMASDILQQFAIWIRNMALLYFIMERTNNDPVS
FT                   VSLLSVMEYAPIFIFSFIGGALADRWNPKRTMVAGDVLSVMSIIGIVLLLKLDYWEAIF
FT                   FATLISAIVGQFSQPSSSRIFKRYVKEEQIANAIAFNQTLQSLFLIFGPVVGSLVYTQL
FT                   GLFTSLYSLIILFLLSAIALSFLPKWVEQEQVARDSLKNDIKEGWKYVLHTKNLRMITI
FT                   TFTIMGLAVGLTNPLEVFLVIERLGMEKEAVQYLAAADGIGMLIGGIVAAIFASKVNPK
FT                   KMFVFGMGILAISFLVEGLSTSFWITSFMRFGTGICLACVNIVVGTLMIQLVPENMIGR
FT                   VNGTILPLFMGAMLIGTSIAGGLKEMTSLVTVFCIAMALILFAIGPVLRMQINKGDVAN
FT                   KEELTNSLASK"
FT   gene            518099..518350
FT                   /locus_tag="BCE_0505"
FT                   /old_locus_tag="BCE0505"
FT   CDS_pept        518099..518350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0505"
FT                   /old_locus_tag="BCE0505"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39440"
FT                   /db_xref="GOA:Q73E55"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E55"
FT                   /protein_id="AAS39440.1"
FT                   /translation="MYRLYTNVVKTILHVRRKDVKNQIYELRTENNISQGALADKCKVS
FT                   RQTINAIENNKYDPSLALAFRLAEVLGTTVDKLFLYKQ"
FT   gene            518363..518755
FT                   /locus_tag="BCE_0506"
FT                   /old_locus_tag="BCE0506"
FT   CDS_pept        518363..518755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0506"
FT                   /old_locus_tag="BCE0506"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39441"
FT                   /db_xref="GOA:Q73E54"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E54"
FT                   /protein_id="AAS39441.1"
FT                   /translation="MGKEKISLFVTVLVAIGTLVFALYYWLTELQVNWYALFICSIALH
FT                   YLFKSLASHSVEGDTGEKEDLEKHVLKTSANVTYYVLIVLIFGLFFASVGFNRWIDFHN
FT                   IPLLFALCAAIVVKPAVEFLIVRRYR"
FT   gene            complement(518792..520075)
FT                   /locus_tag="BCE_0507"
FT                   /old_locus_tag="BCE0507"
FT   CDS_pept        complement(518792..520075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0507"
FT                   /old_locus_tag="BCE0507"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39442"
FT                   /db_xref="GOA:Q73E53"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E53"
FT                   /protein_id="AAS39442.1"
FT                   /translation="MKKMSRQEKSWILYDWANSVYSLVITTALFPIYFKAAAKEAGLSG
FT                   ATSTAYWGYANSFATLLISILAPILGTVADYKGFKKRFFTFFFGLGIVFTSMLAVVPTS
FT                   QWYLLLGCYMLALVGFAGANIFYDAFLVDVTSEDRMDRISTRGFALGYIGSTIPFIGCI
FT                   TLIILAQKGTIPLSVGIASQISFAITALWWGLFTIPMLKNVEQTHYIERHPRPITMSFK
FT                   RLADTFKNIKEYKTVFMFLIAYFFYIDGVDTIITMSTAYGTDLGISATNLLIILFVTQI
FT                   VACPFALLYGKLSETFTGKKMLYVGIIIYIIICTYAYFLKTTLDFWILAMLVATSQGGI
FT                   QALSRSYFAKLVPKESANEFFGFYNIFGKFAAIMGPVLVGVTTQLTGKTNAGVLSIIVL
FT                   FIIGGFLLTKVPENNTSVTPPSPKTKML"
FT   gene            complement(520184..521497)
FT                   /locus_tag="BCE_0508"
FT                   /old_locus_tag="BCE0508"
FT   CDS_pept        complement(520184..521497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0508"
FT                   /old_locus_tag="BCE0508"
FT                   /product="type I phosphodiesterase/nucleotide
FT                   pyrophosphatase family protein"
FT                   /note="identified by match to protein family HMM PF01663"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39443"
FT                   /db_xref="GOA:Q73E52"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E52"
FT                   /protein_id="AAS39443.1"
FT                   /translation="MDKALTNRVIILSFDCLSALDFPILQKLPHFQSLIKKGTVVEKVE
FT                   PIYPSVTYPSHSTIVTGNYPNKHGVVSNTLLQPGRESPDWHWYRKSIQGTTLYDEAHKA
FT                   NLTTAALLWPVTGRANIDYNLPEIFPNRPWQNQVLVSLFSGSPLYQLDLNRRFGHIRNG
FT                   LSQPELDDFVLASAVHTIQTKKPNVMFVHFTDLDTQRHYHGFESKETIAAIHRHDERLG
FT                   KIIQALKDSGLYEESTIIALGDHSALSESKAIQLNVLFHQKGLISINSKGKLVDWNAYC
FT                   QSCDGSAYVYVKDKNDTDTIREVQLLLEELLQNKQNGIEFILHDEDAKECGADGNCLFM
FT                   LEAREGYYFTENYIGDFIKEITEKDVTPSKKYTFGTHGYSPTKPNYETIFIAAGKGIKS
FT                   GITIPHMRLIDEGPTIARLLGLHLGETDGSIVEDLLQL"
FT   gene            521634..521945
FT                   /locus_tag="BCE_0509"
FT                   /old_locus_tag="BCE0509"
FT   CDS_pept        521634..521945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0509"
FT                   /old_locus_tag="BCE0509"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39444"
FT                   /db_xref="GOA:Q73E51"
FT                   /db_xref="InterPro:IPR025434"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E51"
FT                   /protein_id="AAS39444.1"
FT                   /translation="MKGGNNVDLLDGFSIFYIIGGITIILVFAISYLLKKRFPDKQFDI
FT                   IFALSLILLCLASFPVTMMVIGGWEGMGYGFIGFFVLLGTLIGMIAHQLVKITRKSYV"
FT   gene            522294..523724
FT                   /gene="proS"
FT                   /locus_tag="BCE_0510"
FT                   /old_locus_tag="BCE0510"
FT   CDS_pept        522294..523724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="BCE_0510"
FT                   /old_locus_tag="BCE0510"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF03129; match to protein
FT                   family HMM TIGR00408"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39445"
FT                   /db_xref="GOA:Q73E50"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73E50"
FT                   /protein_id="AAS39445.1"
FT                   /translation="MAKEQVQAITKMEEDFAQWYTDIVKKAELVDYSSVKGCMILRPYG
FT                   YALWENMQKVMDEKLKATGHENVYMPMFIPESLLQKEKDHVEGFAPEVAWVTHGGDEKL
FT                   AERLCIRPTSETLFCEHFSKIVQSYNDLPKLYNQWCSVVRWEKTTRPFLRTTEFLWQEG
FT                   HTIHETAEESQAETLNILNLYASFCEDYLAIPVIKGQKTEKEKFAGAKATYTIESLMHD
FT                   GKALQTGTSHNFGTNFSEAFDIKFLDRNGKWQYVHQTSWGVSARMIGGLIMVHSDNNGL
FT                   VMPPKVAPVQVVIVPIAQHKEGVLAKATELQEHIQKVARVKIDASNKTPGWKFNEYEMK
FT                   GIPIRLEVGPKDIEKNQVVLVRRDTKEKEFIAMEQLEERIPALLEEIHNSLFNKAKVFR
FT                   DENTYSVTKFEEMKKVADEKQGFIKAMWCGELACEEKLKEEVGVSSRCMPFEQEHLANE
FT                   CICCGKEAKQMVYWGKAY"
FT   gene            complement(523842..524696)
FT                   /locus_tag="BCE_0511"
FT                   /old_locus_tag="BCE0511"
FT   CDS_pept        complement(523842..524696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0511"
FT                   /old_locus_tag="BCE0511"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39446"
FT                   /db_xref="GOA:Q73E49"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E49"
FT                   /protein_id="AAS39446.1"
FT                   /translation="MTKIFILASTLSLSFFSGLNIGNAATENFSPVTNAIVQNNDHFAE
FT                   GNSKDNNKPPGNDGSQDDSDSGGNGSDGSGSGDNGSGGNGSGGNGSGDNGSGGNGSGGN
FT                   GSGGNGSGGNGSGGNGSGGNGSGGNGSSGNGSDGSGSGGNGSGGNDSGGNGSGGNGSGG
FT                   SGSDGNGSGGSDSGGSGSSGNGSGGSGSDGNGSGGSGSGGNRGKGDSSSQGGNDSHGGN
FT                   RGKGDSSSQGGNGSQGGNVKDNAKKQGDKLPNTATHYPASILMGLSTFLIGMLLFIRRK
FT                   NAK"
FT   gene            524899..525777
FT                   /locus_tag="BCE_0512"
FT                   /old_locus_tag="BCE0512"
FT   CDS_pept        524899..525777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0512"
FT                   /old_locus_tag="BCE0512"
FT                   /product="ROK family protein"
FT                   /note="identified by match to protein family HMM PF00480"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39447"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E48"
FT                   /protein_id="AAS39447.1"
FT                   /translation="MKEYIAFDIGGTQIKYGIVSETGTVLKHKTVPTEIHLGGEQIIQK
FT                   LILLSKNLMGKHTISGIGISTAGIVDVNKGIVTGGADHIPGYSTIPIINRLQEVLKVPV
FT                   SIDNDVNCAAFGEKWNGSAREKENFIMLTLGTGIGGAIFIDGELYRGHLFSAGEWGNML
FT                   IEGKPFEEIASISGLIRLVRKYKDESDWNGKKIFELYDKGDREVTQAVEVFFKHLAIGI
FT                   SNLAYIFNPEVIVIGGGITDRGNEFLKEVKEEVSKYLNKEIYSNCEIELAQNGNCAGMV
FT                   GAIYHFLHHHK"
FT   gene            525906..526502
FT                   /locus_tag="BCE_0513"
FT                   /old_locus_tag="BCE0513"
FT   CDS_pept        525906..526502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0513"
FT                   /old_locus_tag="BCE0513"
FT                   /product="tellurium resistance protein, putative"
FT                   /note="identified by match to protein family HMM PF02342"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39448"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E47"
FT                   /protein_id="AAS39448.1"
FT                   /translation="MPIILEKGQKIDLTKGQPKVAKLQVGLGWDPIGQSGGFLSSLFGS
FT                   KPNVDCDASVVMLEGDRFVNKNDLVYFGNKLSTCGSIIHSGDNLTGEGEGDDETIFVEL
FT                   HKVPSRINRLVFVVNIYDCVNRRQDFGMIRNAYIRIQNPHTGEELARYNLSENYASKTT
FT                   LIAGEMYRYENEWKFSAVGEGTQDKNLSEIVSRYQ"
FT   gene            526526..527110
FT                   /locus_tag="BCE_0514"
FT                   /old_locus_tag="BCE0514"
FT   CDS_pept        526526..527110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0514"
FT                   /old_locus_tag="BCE0514"
FT                   /product="tellurium resistance protein"
FT                   /note="identified by match to protein family HMM PF02342"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39449"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E46"
FT                   /protein_id="AAS39449.1"
FT                   /translation="MASISLKKGQKVDLTKTNPGLSKVLVGLGWDTNRYDGQADFDLDV
FT                   SIFLVGANGKVSGAEDFVFYNNPKGANGAVEHLGDNRTGEGEGDDEAIKVDLKNVPAHI
FT                   ERICFTITIYDGEGRSQNFGQVSNSFVRIVDEEKNAELIRYDLGEDFSIETAVVVGELY
FT                   RHAGDWKFNAIGSGFQGGLASLCNNFGLDVE"
FT   gene            527190..527768
FT                   /locus_tag="BCE_0515"
FT                   /old_locus_tag="BCE0515"
FT   CDS_pept        527190..527768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0515"
FT                   /old_locus_tag="BCE0515"
FT                   /product="tellurium resistance protein"
FT                   /note="identified by match to protein family HMM PF02342"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39450"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E45"
FT                   /protein_id="AAS39450.1"
FT                   /translation="MAIQLQKGQKIDLGKTSPGLTKAVIGLGWDIKSYDGGADFDLDAS
FT                   AFLLDMNGKCTKETDFIFYNNLQSPCGSVLHTGDNRTGEGEGDDEQLVVDLKKVPADVH
FT                   KIAITVTIYDAEGRSQNFGQVGNAFVRLANEETNEEVLRFDLGEDFSIETAVVFCELYR
FT                   HNGQWKFNAVGSGFQGGLGALVRAYGLDA"
FT   gene            527841..528632
FT                   /locus_tag="BCE_0516"
FT                   /old_locus_tag="BCE0516"
FT   CDS_pept        527841..528632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0516"
FT                   /old_locus_tag="BCE0516"
FT                   /product="tellurium resistance protein, putative"
FT                   /note="identified by match to protein family HMM PF03741"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39451"
FT                   /db_xref="GOA:Q73E44"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022493"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E44"
FT                   /protein_id="AAS39451.1"
FT                   /translation="MSILQGILDTYAQFFDLDMWIKVLQDPVSWGLIGTLVVLEGLLSA
FT                   DNALVLAVMVKHLPEEKRKKALFYGLIGAYLFRFIAIGIGMFLIKLAWVKVLGALYLAW
FT                   LSIKYFIDKRKGNAEEEEAHGMNQNSILFRMFGVFWGTVAMVELMDIAFSVDSVLAAFG
FT                   VSNEVWILLLGGMLGILMMRGIAGVFLKLLERIPELETTAYILILIIATKMLLSVIHIE
FT                   ISHTLFFVILVVAFGATFVLHYVKNSGQAKEEVAATKEDNK"
FT   gene            528740..530371
FT                   /locus_tag="BCE_0517"
FT                   /old_locus_tag="BCE0517"
FT   CDS_pept        528740..530371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0517"
FT                   /old_locus_tag="BCE0517"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39452"
FT                   /db_xref="InterPro:IPR025647"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E43"
FT                   /protein_id="AAS39452.1"
FT                   /translation="MFSRFTLQPYALKDESDVKQFETLLEKRPQYELTENEMKFSYIAC
FT                   RILGVPNDVDEYFNELFDYSEAKGIEVLHEQNLNKVIDSEKLRHIQEVFGLHQEAPNGL
FT                   TVNRLVAHLSGKQLLPKVDNPDLQHYIHTTFISVLKLYEKQHNQSLKTEGFRRFLIDMI
FT                   KLSENYVAKWFSTINYKKQMPRIVWYGDAQESRIYFLYFLIMLGCDVLYYHPEGKDGFE
FT                   NVDEEGRSFIVSHPSRISLEPFPDRRRERVATVAYQASKEIEQVLHHDNSLLYKPWQFR
FT                   SYTPVARTLKTTYDELFLITKEKAFVRPTFFVENKHIYIPSLFAKISGVSKNDKEYFQR
FT                   LKAVTSFDNSLLINTFPFTKEQKANFQYHYRDALDRGGKLHPDLIMNSHWWPHKRLPEG
FT                   LQHGIAEAIIHTCESEMCKPIAKETKQDVALYVFAQLSQIPPNILEQLEKFDYSQDVPK
FT                   IVIFNNEKSGELTRSDAVLLLFLNQIGVDVFHFNPTGRNDIEPYIEAGAFDSHWLEEVN
FT                   FDLEFHGSSAYKNLSQTIKGLFRPFL"
FT   gene            530390..531472
FT                   /locus_tag="BCE_0518"
FT                   /old_locus_tag="BCE0518"
FT   CDS_pept        530390..531472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0518"
FT                   /old_locus_tag="BCE0518"
FT                   /product="tellurite resistance protein, putative"
FT                   /note="identified by match to protein family HMM PF05816"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39453"
FT                   /db_xref="InterPro:IPR008863"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E42"
FT                   /protein_id="AAS39453.1"
FT                   /translation="MNNPVVLDSKTELNEQTAQDVRLQLRQDADVQRIYNAVDIKDQLE
FT                   LIELGKEPSMEISRFADQILHTMSLSKIEDSGELLKQLGKIMDRFDSKDFAEEKSGFFS
FT                   RMFKKADKMIEQIFSKYQTMGREIDKVYVEITKYQDEMKKSIGTLDGLYEQNLKYYLDL
FT                   EKYVVAGEMLLERLNTELVPMYEERVRNNDQLAGIELESLKNSVEILEQRIDDLEKARM
FT                   VALLTAPQIRMIQRGNNKLIGKINTAFITTIPIFKNGIIQAVNAKRQKLVADSMAELDR
FT                   RTNELLKKNAQNIATQSVEVARLSGSSSIKMETLEETWNIISRGMQETQQIEEQNKRER
FT                   EESRKRMATLTENIKKELQG"
FT   gene            complement(531508..534174)
FT                   /locus_tag="BCE_0519"
FT                   /old_locus_tag="BCE0519"
FT   CDS_pept        complement(531508..534174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0519"
FT                   /old_locus_tag="BCE0519"
FT                   /product="cation-transporting ATPase, E1-E2 family"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00689; match to protein
FT                   family HMM PF00690; match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01494"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39454"
FT                   /db_xref="GOA:Q73E41"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73E41"
FT                   /protein_id="AAS39454.1"
FT                   /translation="MSNWYSKTKDQTLIDLETNEQHGLTEEIASERLKQYGSNELATKQ
FT                   KRTLWQRIFAQINDVLVYVLIIAALISAFVGEWADASIIALVVVLNAVIGVVQESKAEQ
FT                   ALEALKKMATPKAIVKRDGELKEIPSEHVVPGDIVMLDAGRYIPCDLRLIETANLKVEE
FT                   SALTGESVPVDKDAIYHPSMQSDEQVPLGDQKNMAFMSTLVTYGRGVGVAVETGMNSQI
FT                   GKIATLLHEADDDMTPLQKSLAQVGKYLGFVAVAICIVMFLIGFLQRRDTLEMFMTAIS
FT                   LAVAAIPEGLPAIVSIVLAIGVQRMIKQNVIIRKLPAVEALGSVTIICSDKTGTLTQNK
FT                   MTVTHFYSDNTYDQLENLNVNNDVQRLLLENMVLCNDASYNNESQTGDPTEIALLVAGS
FT                   TFNMQKDYLEKIHERINELPFDSDRKMMSTVHTYDESYYSMTKGAIDKLLPRCTHILKN
FT                   GKIEVLTEADKNQILEAARAMSREALRVLSFAFKQYNSSNVDIDHLEENLIFIGLVGMI
FT                   DPPRTEVKDSITECKKAGIRTVMITGDHKDTAFAIAKELGIAEDICEIMIGTELDNISD
FT                   TELASKIDHLHVFARVSPEHKVKIVKALRAKGNIVSMTGDGVNDAPSLKQADVGVAMGI
FT                   TGTDVAKGAADVVLTDDNFSSIVKAVEEGRNIYRNIKKSILFLLSCNFGEIITLFLAIL
FT                   LGWATPLRPIHILWVNLITDTLPALSLGVDPEDPDVMKEKPRHAKESLFSGSVPFLIFN
FT                   GVVIGLLTLIAFIAGAKFYTGDTNLFPLFPERIDEDALLHAQTMAFVVLSFSQLVHSFN
FT                   LRSRTKSIFSIGIFTNKYLVFSLLIGVLMQVCIISIPPLANIFGVHALTLRDWGFVLLL
FT                   SIIPLVVNEIIKLAKKN"
FT   gene            complement(534364..534588)
FT                   /locus_tag="BCE_0520"
FT                   /old_locus_tag="BCE0520"
FT   CDS_pept        complement(534364..534588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0520"
FT                   /old_locus_tag="BCE0520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39455"
FT                   /db_xref="InterPro:IPR009507"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73E40"
FT                   /protein_id="AAS39455.1"
FT                   /translation="MDLSVKSEENVEYMVEAIKEKLRMVNAGAMRAASFNEEMYEDLRD
FT                   IYEHVMKRETFSISEMQAITEELGTLIKK"
FT   gene            534763..535227
FT                   /locus_tag="BCE_0521"
FT                   /old_locus_tag="BCE0521"
FT   CDS_pept        534763..535227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0521"
FT                   /old_locus_tag="BCE0521"
FT                   /product="low molecular weight phosphotyrosine protein
FT                   phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF01451"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39456"
FT                   /db_xref="GOA:Q73E39"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E39"
FT                   /protein_id="AAS39456.1"
FT                   /translation="MVQVLFVCLGNICRSPMAEAIFRDLVVKKGLEEKIVIDSAGTGDW
FT                   HVGHPPHKGTQKILKENAVTFEGIKARQVEKEDLTKFDYIIAMDNKNIADLKSLGKTGG
FT                   YIGRLSDFVPDGGWTDVPDPYYTGNFQEVYDLVTEGCAKLLAFIRKEQGI"
FT   gene            535281..535796
FT                   /locus_tag="BCE_0522"
FT                   /old_locus_tag="BCE0522"
FT   CDS_pept        535281..535796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0522"
FT                   /old_locus_tag="BCE0522"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39457"
FT                   /db_xref="InterPro:IPR025276"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E38"
FT                   /protein_id="AAS39457.1"
FT                   /translation="MAKKNNIARNIAIGVAAGVAVSMLKKENREKVKNTAEKAKTKMIE
FT                   IGENAKIKEKVQTVTDKGRELADLNVVKAKVAEIKKLTPSVVETLKETKEIFSKKKVEP
FT                   AEKPETIEIQAVSPKVDELKAEEEPVVAEDGGMKEARELFMKDSNVEEKKTEAYIELKQ
FT                   DKEEKKSV"
FT   gene            535803..536672
FT                   /locus_tag="BCE_0523"
FT                   /old_locus_tag="BCE0523"
FT   CDS_pept        535803..536672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0523"
FT                   /old_locus_tag="BCE0523"
FT                   /product="ribonuclease BN, putative"
FT                   /note="identified by match to protein family HMM PF03631;
FT                   match to protein family HMM TIGR00765"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39458"
FT                   /db_xref="GOA:Q73E37"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E37"
FT                   /protein_id="AAS39458.1"
FT                   /translation="MRKILEKVRRNRTYSFGKDLYDRTMRDDVAGLAAQLAYFFLLAIF
FT                   PGLVFLITLLGFIDLQTESVLNLLEPYVPEDAMSLIEVNVDKVVNEQNGGLLSFGLLSM
FT                   LWFASNGVNAVMNAFNRAYDVTETRSFIKTRALSIVFTLAIIFMIVFALIVPVFGQVIG
FT                   AAVFKAIGLSDSFSYVWSITRLVASFFVLFALFSFLYTFAPDRKLKRREVISGATFATV
FT                   GWIVVSYSFAYYVDKFANYANTYGGLGGIIILMLWFYLTGWVILLGGEINGLLHHYRTG
FT                   DNNSRNEK"
FT   gene            complement(536857..538782)
FT                   /locus_tag="BCE_0524"
FT                   /old_locus_tag="BCE0524"
FT   CDS_pept        complement(536857..538782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0524"
FT                   /old_locus_tag="BCE0524"
FT                   /product="heavy metal-transporting ATPase"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00702; match to protein
FT                   family HMM TIGR01494; match to protein family HMM
FT                   TIGR01512; match to protein family HMM TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39459"
FT                   /db_xref="GOA:Q73E36"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E36"
FT                   /protein_id="AAS39459.1"
FT                   /translation="MNSEVKTLQVQKSISHPSLWDTLKKHYELIFAIASGIFILAGWLF
FT                   TKNDVMNVGITCYILAYIVGGYAKAKEGIEDTIEEKELNVEMLMLFAAIGAAIIGYWAE
FT                   GAILIFIFALSGAMESYTLSKSQKEISALLDLQPEEALRISNGTEERVPVGRLQINDII
FT                   LIKPGERVPADGTIHSGETNIDEAAITGEPIPNEKKYGDEVFAGTVNLRGAIEVTITKP
FT                   SDQTLFQKIIRLVQSAQSEKSPSQLFIEKFEGTYVKGVLLVVALMMFVPHFLLDWSWNE
FT                   TFYRAMILLVVASPCALVAAITPATLSAISNGARNGILFKGGIHLERLASVKAIAFDKT
FT                   GTLTEGKPTVTDVYVRENMTEKEVLSITAAIESHSTHPLAESIVKYAKHAYDITLKKPE
FT                   NVEDVTGFGLKGIFENKAYKIGKADFIGEETKTFHNGISASLEKEGKTVVYISDEDGIL
FT                   GLIALKDTLRQETIAAIRELQSIGVEAIMITGDNEETAKAIASESNIKEYYASCLPETK
FT                   VETIKKLKEKYGTVAMVGDGINDAPALATASIGVAMGEGTDVALETADVVLMKNELSRL
FT                   SQAIRLSKRMNRIVKQNVIFSLAVIAMLICSNFLQFLALPFGVIGHEGSTILVILNGLR
FT                   LLKGNK"
FT   gene            539053..540003
FT                   /locus_tag="BCE_0525"
FT                   /old_locus_tag="BCE0525"
FT   CDS_pept        539053..540003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0525"
FT                   /old_locus_tag="BCE0525"
FT                   /product="transporter, EamA family"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39460"
FT                   /db_xref="GOA:Q73E35"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E35"
FT                   /protein_id="AAS39460.1"
FT                   /translation="MKTEKFFTHPIGVFIAAIVATFLWGSAFPFIKLSYAELGIQPQEV
FT                   GEQILFAGYRFFLSGVMLLFFFKALGKDMSFKKGTGKQLVQIGLFQTFLQYICFYIGMS
FT                   YSSGIEGAIISGTSSFFQILLAHFLYKDDALNMRKIIGVSIGFCGVVLVNVPSDGSLSF
FT                   HFGIGSLLLLSAAMLYSYGNILAKEGSKTLDVGYMTAYQMIFGSIGLLCIGALQVGVMP
FT                   FTFSVHAILMLIYLSFLSAAGFCIWNTIMKYNKVGKVSMYMFFIPVFGVLLSSMILGEA
FT                   IHSFVLFGLACVAAGIIVVNRTPAKQKIEQEKQVA"
FT   gene            540124..540804
FT                   /locus_tag="BCE_0526"
FT                   /old_locus_tag="BCE0526"
FT   CDS_pept        540124..540804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0526"
FT                   /old_locus_tag="BCE0526"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39461"
FT                   /db_xref="GOA:Q73E34"
FT                   /db_xref="InterPro:IPR012506"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E34"
FT                   /protein_id="AAS39461.1"
FT                   /translation="MNLLYMVLIGQIILFLIGAMYAIGQTKKTRNNMPLPLAVRLILSF
FT                   SLTASAIWIWLQDPSVDYSTWVALGMTLSTVGDLFMAGLIPIGHRLIGGMITFALAHCF
FT                   YVKAFLQTGISWNGFWIGLLVYGLFLIIGWFFFIRNEKQDKLFTIGALIYGLWVGGMAC
FT                   FAFALYYENTGIWWIPAFGGLLFVISDFIIGVTDIGGRKLKYEPLWIWFTYVAAQMCIV
FT                   YVGI"
FT   gene            complement(540858..541142)
FT                   /locus_tag="BCE_0527"
FT                   /old_locus_tag="BCE0527"
FT   CDS_pept        complement(540858..541142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0527"
FT                   /old_locus_tag="BCE0527"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39462"
FT                   /db_xref="GOA:Q73E33"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E33"
FT                   /protein_id="AAS39462.1"
FT                   /translation="MKVMLKNENTGQIKQAKIGFSWTVFFFGFFPAIFRGDWKWFLIIL
FT                   VASMFTFGFSNLVFCFIYNKLYINDLLSQGYKAADEYSLSALQQKNIVA"
FT   gene            541329..541865
FT                   /gene="SpaseI"
FT                   /locus_tag="BCE_0528"
FT                   /old_locus_tag="BCE0528"
FT   CDS_pept        541329..541865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="SpaseI"
FT                   /locus_tag="BCE_0528"
FT                   /old_locus_tag="BCE0528"
FT                   /product="signal peptidase I S"
FT                   /EC_number="3.4.21.89"
FT                   /note="identified by similarity to SP:P28628; match to
FT                   protein family HMM PF00461"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39463"
FT                   /db_xref="GOA:Q73E32"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E32"
FT                   /protein_id="AAS39463.1"
FT                   /translation="MMQKKKRLREFFGTIAIACLLVFLVKIFVFFPTTVKGASMKPTLQ
FT                   DGDKVIVNKLAKQFESYGREDIIVVKTDNFYVKRVIGLPGDVIEVRNDQLYVNHEVIEE
FT                   AYLYSNKKQAEKKLMNLTEDFGPITVPKNKIFVMGDNRLISRDSRNGLGLIDKADVLGE
FT                   LAAIYYPFEHMKIMN"
FT   gene            complement(542055..544817)
FT                   /locus_tag="BCE_0529"
FT                   /old_locus_tag="BCE0529"
FT   CDS_pept        complement(542055..544817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0529"
FT                   /old_locus_tag="BCE0529"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39464"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E31"
FT                   /protein_id="AAS39464.1"
FT                   /translation="MTIENQFIQKVYYKTFLTEETSTPVSEVLGEAYINESTNEFSNIS
FT                   NIRFAQGELYYQNKDFEAAIFKWEKVNNELALWATKNIADAYFELGFLPKAEEMYQSIQ
FT                   TEDTTLTMEVSLQLLSLYIEQDRLGLAFKTISEAVAFQPDYPNITSIARSFYEKQEDWN
FT                   NAIELAVQEGIRTKSLHWFDTLINYVNQGFTKQIKPEYFYESLKALYAIDQVQFKELVI
FT                   ALWNSYQNEKSHLPWIQTINHLFLHIETDNNDDWHEIVERYQDTYFELITGEHFMHEMQ
FT                   GLVPDLLTNWFSLTRAKDALFVSAAVLAWNEVSPTTLESLLVKSAGALLSNSTAETNIN
FT                   METVSHLFETIAVWAEKNDVDLSHQFTLLVHELCDLNVTKLLIAGTSDHDKLSFVNSIL
FT                   GENILTETITTPILFKDDSQTEITEFTALDVHNIPNFDEFHQIMATPEQSELENKCIEI
FT                   KLPSRFLRKNKFAFLVTPSVQGQVDKNSSYFEYLQAADSLIYVLNSASSLHGEELDILL
FT                   YLREQVPNLQIHFVLHTNSADTNEKLMSKMKVHFPNAQFFPYSPSQEGSQQLGDVTESI
FT                   LSNLAERDIEQERIEKLIWFTQKTIAYLVNERVELENTLVKSVRWNKHISVKLNGFINN
FT                   LTALEKDKIRSITESYLLTKEEITRDIHSQIPELLQSCSDLVQEDSDFKLVHEELNTAM
FT                   NERIQKHVQQVLLPKFTGFIQEWIETAHNEFIQAQSYLDEMSETFNKLYKEERMKLPCD
FT                   FKLLDDWHRDVVRMTNRITVSNINILLRFTPTQFFLKSAGKLFGNMQKNQSMLANKYKQ
FT                   YIETEDYTEIAQTISKQFFLQFEVFEGALERDIMMFFKDPLSILKQNVEAAQLEIQEDE
FT                   QTLATLRSNPETYHDPLAFFKLQLLQHKFVLSTNKNNEDVYEFNESPTI"
FT   gene            545280..545876
FT                   /locus_tag="BCE_0530"
FT                   /old_locus_tag="BCE0530"
FT   CDS_pept        545280..545876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0530"
FT                   /old_locus_tag="BCE0530"
FT                   /product="dedA family protein"
FT                   /note="identified by match to protein family HMM PF00597"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39465"
FT                   /db_xref="GOA:Q73E30"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E30"
FT                   /protein_id="AAS39465.1"
FT                   /translation="MEQHIGELIAHYGYFGIIIALAGGIVGLPIPDEFLLTFVGYNVSK
FT                   GVMSGAAAFLSGMAGAMLGITLSYILGLKLGLPVLKKYGPKIRIKEHHIEKTHILFEKY
FT                   GPFLLIVGYFIPGVRHLTAYFAGMSNLTLWRFCLYAYGGAFIWISVFIGLGWKLGEKWR
FT                   FVEYSLHHYGIWILSISVVVTCVVWFYIKKKKNRE"
FT   gene            complement(545885..546313)
FT                   /locus_tag="BCE_0531"
FT                   /old_locus_tag="BCE0531"
FT   CDS_pept        complement(545885..546313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0531"
FT                   /old_locus_tag="BCE0531"
FT                   /product="transporter, EamA family"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39466"
FT                   /db_xref="GOA:Q73E29"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E29"
FT                   /protein_id="AAS39466.1"
FT                   /translation="MSSWLLFALLSAIAAALVSIFGKIGLDGIDANVATTVRSIIMALF
FT                   MVGVIIIQGKFQNIGDVLLNKKALLFITLSGVAGASSWLFYFLALKTGKVSQVAPVDKL
FT                   SVVFSIILAMIILGEKLNFMTGIGVVFITAGVLFIAFS"
FT   gene            complement(546459..546608)
FT                   /locus_tag="BCE_0532"
FT                   /old_locus_tag="BCE0532"
FT   CDS_pept        complement(546459..546608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0532"
FT                   /old_locus_tag="BCE0532"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39467"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E28"
FT                   /protein_id="AAS39467.1"
FT                   /translation="MMKREERKNMIEFIEKKKGIERDELLFMTDDEVEHIYNVTYFLYE
FT                   EIAE"
FT   gene            complement(546761..547177)
FT                   /locus_tag="BCE_0533"
FT                   /old_locus_tag="BCE0533"
FT   CDS_pept        complement(546761..547177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0533"
FT                   /old_locus_tag="BCE0533"
FT                   /product="general stress protein 26"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39468"
FT                   /db_xref="GOA:Q73E27"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR038725"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E27"
FT                   /protein_id="AAS39468.1"
FT                   /translation="MHLKEKIATIIQGQRTGVLSTVRNEKPHSAFMMFFHEDFVLYVAT
FT                   DRQSKKITDIENNPNVHILLGREGKKLDEDYIEVEGLASIEEDSTLKNKFWNNSLKRWL
FT                   LGPEDPNYVLIKINPDTIYYIDGAGTTEPQFLRL"
FT   gene            complement(547230..547358)
FT                   /locus_tag="BCE_0534"
FT                   /old_locus_tag="BCE0534"
FT   CDS_pept        complement(547230..547358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0534"
FT                   /old_locus_tag="BCE0534"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39469"
FT                   /db_xref="GOA:Q73E26"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E26"
FT                   /protein_id="AAS39469.1"
FT                   /translation="MLFILPSYVFLLDIIIILLLTCPISSQLRLKNRIEENSMKDI"
FT   gene            547348..548412
FT                   /gene="cax"
FT                   /locus_tag="BCE_0535"
FT                   /old_locus_tag="BCE0535"
FT   CDS_pept        547348..548412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cax"
FT                   /locus_tag="BCE_0535"
FT                   /old_locus_tag="BCE0535"
FT                   /product="calcium/proton exchanger"
FT                   /note="identified by match to protein family HMM PF01699;
FT                   match to protein family HMM TIGR00378; match to protein
FT                   family HMM TIGR00846"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39470"
FT                   /db_xref="GOA:Q73E25"
FT                   /db_xref="InterPro:IPR004713"
FT                   /db_xref="InterPro:IPR004798"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E25"
FT                   /protein_id="AAS39470.1"
FT                   /translation="MKSMFNKIFLIVALIGVPLSVLGKTLHWPQTIMFAVYCITIIALA
FT                   GFMGRATESLAIVSGPRIGGLLNATFGNAVELIISIFALQAGLIEVVLASLTGSVLGNL
FT                   LLVGGLSFFVGGLKYKRQSFNVYDARHNSALLIFAVVVAFVIPEIFSMKMDAGKTYQLS
FT                   IGVSIIMIIMYLAALLFKLVTHRGVYQHKSDEVAHEEEPEWSKGKALLILAIATIAVAY
FT                   VSEALVHTFETVAKSFGWSELFIGVIIVAIVGNAAEHASAIIMAYKNKVNIAVEIAIGS
FT                   TLQIAMFVAPVLVLLSMFFTQRMPLVFTIPELVSMITAVFLTIAISNDGDTNWFEGGTL
FT                   LAAYVIMGIGFYLL"
FT   gene            548527..549291
FT                   /locus_tag="BCE_0536"
FT                   /old_locus_tag="BCE0536"
FT   CDS_pept        548527..549291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0536"
FT                   /old_locus_tag="BCE0536"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39471"
FT                   /db_xref="InterPro:IPR025548"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E24"
FT                   /protein_id="AAS39471.1"
FT                   /translation="MVSFILLFPNMSFAKTTVETKMPSSVLNISKDNTFPNDAQDLPRL
FT                   QPSKFAQELLKTANIKIENPDLIRMFNETTISNAPLAVGYRAKIYLGQWALHYESVDTS
FT                   INWEYKQVNRNVYDNRGGDRLYPLRYKQETQKTVEGDLTADMKDAADVKKMMLLKALEK
FT                   VQLPLSFKTTIGYGTGHERVYNISPSQLGYLYAYTPAVNEKGKVTFGEVYLVLKGNQKR
FT                   LVVKNITSQGIGAAIPIHDHLYFKFISSSHSQ"
FT   gene            complement(549327..550454)
FT                   /locus_tag="BCE_0537"
FT                   /old_locus_tag="BCE0537"
FT   CDS_pept        complement(549327..550454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0537"
FT                   /old_locus_tag="BCE0537"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39472"
FT                   /db_xref="GOA:Q73E23"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014866"
FT                   /db_xref="InterPro:IPR031004"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E23"
FT                   /protein_id="AAS39472.1"
FT                   /translation="MTISQKMKPITPSYDPWEAYMDLEEYGKLLLTNVEFTTTTLCNMR
FT                   CEHCAVGYTLQPKDPNPLPMDLLLKRLDEIPHLRSLSITGGEPMLSKKSVDNYVTPLLK
FT                   YAHERGVRTQINSNLTIDLARYEQIIPYLDVLHISHNWGTIDDFVEGGFAMMERKPTYE
FT                   QRAKLFERMITNSKALSDAGVLVSAETMLNKRTLPHIEHIHRQIVDEMGCKRHEVHPMY
FT                   PSDFASNLEILTKAEIRDAIEHLLEIRDENVWMLFGTLPFYACSDDERDIATFKKLQKS
FT                   KNVTVRNDPDGRSRLNVNIFDGNIIVTDFGDVPLLGNIQTNTLQEAYEKWSASKTAKSL
FT                   SCHCPAVKCLGPNVLVKNSYYPTEDFLSKTANITL"
FT   gene            550668..550850
FT                   /locus_tag="BCE_0538"
FT                   /old_locus_tag="BCE0538"
FT   CDS_pept        550668..550850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0538"
FT                   /old_locus_tag="BCE0538"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39473"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E22"
FT                   /protein_id="AAS39473.1"
FT                   /translation="MGKAIQDKDTQLVYLKERLNMFIEVIDTIEPEEVELEDVDRLLAM
FT                   LDELELKCEQFKKDE"
FT   gene            551057..552577
FT                   /gene="fumA"
FT                   /locus_tag="BCE_0539"
FT                   /old_locus_tag="BCE0539"
FT   CDS_pept        551057..552577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fumA"
FT                   /locus_tag="BCE_0539"
FT                   /old_locus_tag="BCE0539"
FT                   /product="fumarate hydratase, class I"
FT                   /EC_number="4.2.1.2"
FT                   /note="identified by match to protein family HMM PF05681;
FT                   match to protein family HMM PF05683; match to protein
FT                   family HMM TIGR00722; match to protein family HMM
FT                   TIGR00723"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39474"
FT                   /db_xref="GOA:Q73E21"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR011167"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E21"
FT                   /protein_id="AAS39474.1"
FT                   /translation="MEKLQESMYQLIVETSTNLPKDVRRAIQQAKERENAGTRSAMALG
FT                   TITNNIKMADDNISPICQDTGMPTFKIYTPVGVNQLKLKEAIYNALERATKDGKLRPNS
FT                   VDSLFGDNSGNNLGPGTPVIKFEQWEKDYIDARLILKGGGCENKNIQYSLPCELEGLGR
FT                   AGRDLEGIRKCLLHAVYQAQGQGCSAGVIGVGIGGDRTSGYELAKNQLFRTLDDVNPIP
FT                   ELQQLEEYVLENANKLGIGTMGFGGETTLLGCKIGVYNRLPASFYVSVAYNCWAYRRLG
FT                   VTIHPETGEIMDWLYQEGEDTLEQEVQEKTEQREIVLQAPITEEQIRELRVGDVVTING
FT                   MMYTGRDAIHKHLMDNDCPVDLNGQIIYHCGPVVVKDENDNWQIKAAGPTTSIREEPYQ
FT                   GDIMKKFGIRAVIGKGGMGAKTLAALEEHGGVYLNAIGGAAQYYAECIKEVKDVDFLQF
FT                   GIPEAMWHLRIDGFKAVVTMDSHGNSLHADVDKTSLEKLASFKEPVFK"
FT   gene            552704..553486
FT                   /locus_tag="BCE_0540"
FT                   /old_locus_tag="BCE0540"
FT   CDS_pept        552704..553486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0540"
FT                   /old_locus_tag="BCE0540"
FT                   /product="polysaccharide deacetylase, putative"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39475"
FT                   /db_xref="GOA:Q73E20"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR014235"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E20"
FT                   /protein_id="AAS39475.1"
FT                   /translation="MKHKWLYIGLIFSIMMALVPVSALAYTNTPHNWGIPRPKNETVPD
FT                   AGKLYTDLLQKNGGFYLGDTKKKDIYLTFDNGYENGYTGKILDVLKEKKVPATFFVTGH
FT                   YIKTQKDLLLRMKNEGHIIGNHSWSHPDFTAVNDEKLREELTSVTEEIKKVTGQKEVKY
FT                   VRPPRGVFSERTLALTKEMGYYNVFWSLAFLDWKVDQQRGWQYAHNNVMTMIHPGSILL
FT                   LHAISKDNAEALAKIIDDLREKGYHFKSLDDLVKSNQP"
FT   gene            553546..554409
FT                   /locus_tag="BCE_0541"
FT                   /old_locus_tag="BCE0541"
FT   CDS_pept        553546..554409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0541"
FT                   /old_locus_tag="BCE0541"
FT                   /product="HhH-GPD superfamily base excision DNA repair
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00730"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39476"
FT                   /db_xref="GOA:Q73E19"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E19"
FT                   /protein_id="AAS39476.1"
FT                   /translation="MWSEHVTLEYPYHFEEVLKRLSFDPLNVIQLDEKVIYVPLCIDEE
FT                   QIVVRLQGIGTVQNPQFWISSQTGDSEKVMKRMRAIFHWNEPFQDIQNHFLNTSLRPLF
FT                   ETYAYTPIILEFDYFACLLRCIIHQQINLKFATVLTEQFVKRYGTEKNGVFFFPTPEIV
FT                   ANISIEELREQKFSQRKAEYMVGLAKCIIGGKLDLTRIENETEEGVAAQLLPIRGIGAW
FT                   TVQNFLMFGLGRKNMFPKADIGIQRAVQGVFQLDDKPDDAFLENVKQECEPYCSYAALY
FT                   LWKSIE"
FT   gene            554420..555799
FT                   /locus_tag="BCE_0542"
FT                   /old_locus_tag="BCE0542"
FT   CDS_pept        554420..555799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0542"
FT                   /old_locus_tag="BCE0542"
FT                   /product="RNA methyltransferase, TrmA family"
FT                   /note="identified by match to protein family HMM PF01938;
FT                   match to protein family HMM TIGR00479"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39477"
FT                   /db_xref="GOA:Q73E18"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73E18"
FT                   /protein_id="AAS39477.1"
FT                   /translation="MIQKQHESKLEVGQTFPVTIKRLGINGEGVGYFKRQVVFIPGALP
FT                   GEEVVAETTKIQRGFAEAKVKKVRKASPHRVKAPCPVYEECGGCQLQHLDYKEQLNQKR
FT                   DIVVQAFQKYMNNGLEEKIRPTLGMENPWHYRNKSQLQVGRKDEKVITGLYKQNSHQLI
FT                   DIAHCMIQHKATNEATKVVRRILEKLNVSIYNEKKQKGLVRTIVTRTAVQTGEVQVTLI
FT                   TTKEELPNKEQFIAEVQKQMPAVKSIMQNVNWRKTSVIFGDKTFKLAGKEVIQETLGDL
FT                   SFELSARAFFQLNPEQTVVLYNEAKKAAALTGNEKIVDAYCGVGTIGLWLANDAAEVRG
FT                   MDVIPEAIADARKNAKRHGFTNTKYEAGKAEQWLPKWVKEGWRPDVIVVDPPRTGCDDK
FT                   LLETILKVKPKQVVYVSCNPSSLARDVQALMKSYEVEYVQPVDMFPHTAHVENVVKLVR
FT                   K"
FT   gene            555856..556593
FT                   /gene="truA"
FT                   /locus_tag="BCE_0543"
FT                   /old_locus_tag="BCE0543"
FT   CDS_pept        555856..556593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="BCE_0543"
FT                   /old_locus_tag="BCE0543"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="4.2.1.70"
FT                   /note="identified by match to protein family HMM PF01416;
FT                   match to protein family HMM TIGR00071"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39478"
FT                   /db_xref="GOA:Q73E17"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73E17"
FT                   /protein_id="AAS39478.1"
FT                   /translation="MHNYKLTIQYDGARFKGWQRLGNNDNTIQGKIESVISEMVGKETE
FT                   IIGCSRTDAGVHALNQVANFQSDEKLVEHKVKKYLNQYLPNDISITNVEEVHDRFHARY
FT                   NSKAKTYLYKIWNEEHTNPFMRKYSMHVNKKLNVKSMKEAAKHLVGSHDFTAFSNAKSK
FT                   KKSMVREVYTLEVMEEAGFVQIRVSGNGFLHNMVRKIVGALIEVGLGQLDAEAIPQILE
FT                   AKQRNQINCLAEASGLYLENVEF"
FT   gene            complement(556644..556841)
FT                   /locus_tag="BCE_0544"
FT                   /old_locus_tag="BCE0544"
FT   CDS_pept        complement(556644..556841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0544"
FT                   /old_locus_tag="BCE0544"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39479"
FT                   /db_xref="GOA:Q73E16"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E16"
FT                   /protein_id="AAS39479.1"
FT                   /translation="MSNDNKLKLLQYLAFFPTIVCMMLLVDINAYPYAKLLATISGSFA
FT                   AIMLAAFWNLKIRMKKEKSS"
FT   gene            complement(557003..558406)
FT                   /gene="rocR"
FT                   /locus_tag="BCE_0545"
FT                   /old_locus_tag="BCE0545"
FT   CDS_pept        complement(557003..558406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocR"
FT                   /locus_tag="BCE_0545"
FT                   /old_locus_tag="BCE0545"
FT                   /product="arginine utilization regulatory protein RocR"
FT                   /note="identified by match to protein family HMM PF00158;
FT                   match to protein family HMM PF02954; match to protein
FT                   family HMM TIGR00229; match to protein family HMM
FT                   TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39480"
FT                   /db_xref="GOA:Q73E15"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E15"
FT                   /protein_id="AAS39480.1"
FT                   /translation="MRTEEINLKQIIEMNMLYETLLNELDIGIHIINEEGKTIIYNRKM
FT                   MEIESMERSDVLYKSPLEVFAFEENKNSTLIEALKLGKTNKNIKQTYFNNKGQEITTIN
FT                   DTFPIIENGKIKGAIEISKEMNHLKQTIKMDSSRKQNTKFTFDHIIGDSEAIQSTIAEG
FT                   KRVIRTSSSILLVGETGTGKELFAQSIHNESQRSGKPFISQNCAAIPDTLMESLLFGTN
FT                   RGAFTGAIDKAGLFEEANGGTLLLDEINSLSPALQAKLLRAIQEKTIRRIGGTQEKEID
FT                   VRIIATINEDPLEAMKHNRLREDLYYRLSVVTLCLPPLRERKEDIPALVQHFIEKYNIQ
FT                   FGLGVTDVDIHVREFLYAYDWPGNVRELEHVIEGSMNLVEDENIITAFHLPTRFRERIK
FT                   KEFNMQPLLTNNDTDAPKTLKHTIEAMEKNYITQILKEYHGNISQAAKFLGLSRQNLQY
FT                   RIKKLHLHI"
FT   gene            558681..558935
FT                   /locus_tag="BCE_0546"
FT                   /old_locus_tag="BCE0546"
FT   CDS_pept        558681..558935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0546"
FT                   /old_locus_tag="BCE0546"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39481"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E14"
FT                   /protein_id="AAS39481.1"
FT                   /translation="MKTVIEGVYSPCYGKVEKLFVTENSYVYEWEKLALIETIDKQKVE
FT                   IKVGISGYIESLEVVEGQAIANKKLLITVRDDLLITGSD"
FT   gene            559036..560457
FT                   /locus_tag="BCE_0547"
FT                   /old_locus_tag="BCE0547"
FT   CDS_pept        559036..560457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0547"
FT                   /old_locus_tag="BCE0547"
FT                   /product="amino acid permease family protein"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39482"
FT                   /db_xref="GOA:Q73E13"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E13"
FT                   /protein_id="AAS39482.1"
FT                   /translation="MMDQNQGLKRELKSRHIFMIALGGVIGTGLFLGSGYTIHEAGPGG
FT                   AIVAYLVGGFVMYLTMLCLGELAVAMPDAGSYQTYATKHISPAAGYVVGWMSWLNWSAT
FT                   IGIELIAVSILMKRWFPDVPSWIWCVVFAVLLFAINALSSRSFAEVEFWFASIKVITII
FT                   AFIILGGAAMFGFLDMKGNEPAPMFSSFTDYGGLFPNGLSAILITMIAVNFSFQGTELV
FT                   GIAAGESENPEKTIPKAINNTVWRILVFFVLSIFILAGLFPWQQAGVIESPFVVVFDKI
FT                   GIPYAADIINFVIITAVLSVANSGLYATSRMLWSMSNQGMISPIFSKLSKSGVPIYALI
FT                   VSTIVGCLSLLSGIYAEDTVYLWLLSIAGFGAILVWASIALSNLLARRAYIKQGGDVKD
FT                   LKFKTPLYPFVPLLALVLNVTVIVAMAFIPEQRMALYCGIPFMIVCLLFYRATRNKGSN
FT                   LEHIEKTKTTEIESL"
FT   gene            560554..561828
FT                   /locus_tag="BCE_0548"
FT                   /old_locus_tag="BCE0548"
FT   CDS_pept        560554..561828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0548"
FT                   /old_locus_tag="BCE0548"
FT                   /product="acetylornitine deacetylase, putative"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM TIGR01910"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39483"
FT                   /db_xref="GOA:Q73E12"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E12"
FT                   /protein_id="AAS39483.1"
FT                   /translation="MNEEVAQLLEQIDLRKNELLELTKTLIRFETPAPPARNTNEAQEF
FT                   VAQFLRKRNFCVDKWDVYPNDPNVVGVKKGIESDTHKSLIINGHMDVAEISADEAWETS
FT                   PFEPFIRDGWLVGRGAADMKGGLAGALFAIQLLQEAGIELPGDLIFQSVIGEEVGEAGT
FT                   LQCCKRGYDADFAVVVDTSDLHMQGQGGVITGWITVKSPQTFHDATRRQMIHAGGRLFG
FT                   ASAIEKMMKIVQSLQELERHWAVMKTYEGYPSGTTTINPAVIEGGRHAAFIADECRLWI
FT                   TVHFYPNETHEQIIKEIEEYIGKVAAADPWLSENPPQFKWGGESMIVDRGEIFPSLEID
FT                   SEHAAVKTLSSVHESTLSKNAILDMSATVTDGGWFSEFHIPAVIYGPGTLEEAHSINEK
FT                   VEVEQLIEFTKVITAFIYEWCHTKK"
FT   gene            complement(561927..562580)
FT                   /locus_tag="BCE_0549"
FT                   /old_locus_tag="BCE0549"
FT   CDS_pept        complement(561927..562580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0549"
FT                   /old_locus_tag="BCE0549"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39484"
FT                   /db_xref="GOA:Q73E11"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E11"
FT                   /protein_id="AAS39484.1"
FT                   /translation="MPKENPNERLSTLIKKLLKERALSMRQLGMLTNIDPATISRIMNG
FT                   KQPPKQKHLQKFAECLQVPPQLLFDEMYPDSPHINKEKTDMYTSLDTIQQTLQSSNLFD
FT                   FDYTTTRVKQELENYERYAQTTEGEKRIHDSFASKLEQIDSAGPFIEQLTDMYQQFCNE
FT                   TIPKEERAVLGGALLYFILSTDIIPDYLFPIGYLDDAIAVELAKEKLIELKRKT"
FT   gene            562711..563322
FT                   /locus_tag="BCE_0550"
FT                   /old_locus_tag="BCE0550"
FT   CDS_pept        562711..563322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0550"
FT                   /old_locus_tag="BCE0550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39485"
FT                   /db_xref="GOA:Q73E10"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR014205"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E10"
FT                   /protein_id="AAS39485.1"
FT                   /translation="MSTAGLFSIFLIGIASNLDNAGVGIAYGIRKIRISWFNNFIIAFF
FT                   GFLFTLLAGFFGSWIALFISEFTANLIGAIVLGIIGVFILCQPFLSKKETVDSKDDSVL
FT                   MGILRDPEKADFDGSKTISFSEAIVLGVALSINNIAGGFDAGVTNLNLWLTAIISGVFS
FT                   FICISGFAYVGKRYLAEYLGKWATVIAGVLLILIGIDQLL"
FT   gene            563300..563596
FT                   /locus_tag="BCE_0551"
FT                   /old_locus_tag="BCE0551"
FT   CDS_pept        563300..563596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0551"
FT                   /old_locus_tag="BCE0551"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39486"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E09"
FT                   /protein_id="AAS39486.1"
FT                   /translation="MGLISCCKENKKQRSSISLEIWQRIAYIDVLFSILIRISFKERGI
FT                   RMGRGKAFDHKKKGHDHQPPKGAFIHKDVNEHTLEEEELPVNIETYKNSLKKH"
FT   gene            complement(563619..563960)
FT                   /locus_tag="BCE_0552"
FT                   /old_locus_tag="BCE0552"
FT   CDS_pept        complement(563619..563960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0552"
FT                   /old_locus_tag="BCE0552"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39487"
FT                   /db_xref="InterPro:IPR025083"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E08"
FT                   /protein_id="AAS39487.1"
FT                   /translation="MKLIFQMGKQPVLEKTILLFILSIVESLKLKVVSLDEAHRYIFNL
FT                   EVLELLMDRNIDDQVLELIHFGMGLEDVHHVLPEEFEHTIEELKWLCIQVLSEYSMHEE
FT                   SEQLIEDIR"
FT   gene            complement(564133..565062)
FT                   /gene="glsA"
FT                   /locus_tag="BCE_0553"
FT                   /old_locus_tag="BCE0553"
FT   CDS_pept        complement(564133..565062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glsA"
FT                   /locus_tag="BCE_0553"
FT                   /old_locus_tag="BCE0553"
FT                   /product="glutaminase A"
FT                   /EC_number="3.5.1.2"
FT                   /note="identified by match to protein family HMM PF04960"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39488"
FT                   /db_xref="GOA:Q73E07"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73E07"
FT                   /protein_id="AAS39488.1"
FT                   /translation="MQCIETNNLQQLLEQVKPYTKKGKLATYIPELGNANPDDLGIAIF
FT                   HKETEYIHAGNSQTLFTLQSISKVITLALALLDRGEEYVFSKVGMEPTGDPFNSIIKLE
FT                   TTSPSKPLNPMINAGALAITSMLAGKDNEEKMERILHFVREITDNPTINYSSKVANSEL
FT                   ETAYLNRSLCYYMKQNGIIDCDIEELMDLYTRQCAVEVNCIDLARIGLIFAMDGYDPYK
FT                   KKQIIPKHITKICKTFMVTCGMYNESGEFAIRVGIPAKSGVAGGIFGCVKGEMGIGIFG
FT                   PALDANGNSIAGFKILELLSAQEGWSIF"
FT   gene            565387..566880
FT                   /locus_tag="BCE_0554"
FT                   /old_locus_tag="BCE0554"
FT   CDS_pept        565387..566880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0554"
FT                   /old_locus_tag="BCE0554"
FT                   /product="PTS system, N-acetylglucosamine-specific IIBC
FT                   component, putative"
FT                   /note="identified by match to protein family HMM PF00367;
FT                   match to protein family HMM PF02378; match to protein
FT                   family HMM TIGR00826"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39489"
FT                   /db_xref="GOA:Q73E06"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010974"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E06"
FT                   /protein_id="AAS39489.1"
FT                   /translation="MLQFLQRIGKALMLPIAVLPAAGLLLRLGQEDVFNIPVMAQAGAA
FT                   IFDNLALIFAIGVAIGLSVDGSGAAGLAGAIGYLVLQNTTNALSKTYSAAELNDKLKSV
FT                   QDLVGSVDPTKLADTMTKVSKAAALTPKINMAILGGIIAGVVAGLLYNKFHKIKLPEWL
FT                   GFFAGKRFVPIITSIVMLLLGLVFGQIWPTIQSGIDAVAHGIVNLGSIGAGLFGLLNRL
FT                   LIPIGLHHVMNTYFWFVLGDFTNAAGDIVHGDIARFFAKDPSAGMFMTGFFPIMMFGLP
FT                   AACFAMIAAAKPEKRKMVTGMLGGLALTSFLTGITEPIEFSFMFLSPVLYGIHAVLTGL
FT                   SLFITTTLGIHDGFSFSAGAIDYFLNFGIATKPVLLAGIGLIYAAIYFVVFYFLIKKFD
FT                   LKTPGREDEEEVAEGEEAPVAGSIGETYVAALGGKENLTVIDNCATRLRLQVKDAGQVN
FT                   EAALKRAGAKGVMKLSNTSVQVIVGTNVESVADDMKKHV"
FT   gene            567145..568386
FT                   /locus_tag="BCE_0555"
FT                   /old_locus_tag="BCE0555"
FT   CDS_pept        567145..568386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0555"
FT                   /old_locus_tag="BCE0555"
FT                   /product="penicillin-binding protein, putative"
FT                   /note="identified by match to protein family HMM PF00144"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39490"
FT                   /db_xref="GOA:Q73E05"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E05"
FT                   /protein_id="AAS39490.1"
FT                   /translation="MDHEKNNANGKSRRPIVYIKRTIILVLLFSLVYFMYTKIVAHNKK
FT                   EETLKAAAEMKKQEELKKKEEKKKQEAKKQKEQEEQVKQAQAVEKPAEGPPQEINENAQ
FT                   LDQYLQKTGFSGTAVIVKNGKVLLNKGYGMANKEKQVPNNSETTFYIGSISKAFVATTI
FT                   MQLRDQNKLHVEDTIAKYIPDFPQGNGIQLKHLLTHTSGIPEYEQGTEDISHEELIKRI
FT                   GKQKRIGSPGEKWKYSDSNYSILAYIAEKVSGQPLEEYIKQHIFATAGMKHSGFGRELE
FT                   QTRFPSTGYKIVNNNMTTPNIPSMSQLYGCGDIYTSAHDLYLFNEALFSGKLISKESYD
FT                   QMFTGGKKDYGFGWYVDPGSYSNHGVMPGWNCLNGFSKNGSVYVVLLSNIQNNIKSFGK
FT                   VNNDIYTMLRNIEV"
FT   gene            568762..569442
FT                   /locus_tag="BCE_0556"
FT                   /old_locus_tag="BCE0556"
FT   CDS_pept        568762..569442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0556"
FT                   /old_locus_tag="BCE0556"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39491"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E04"
FT                   /protein_id="AAS39491.1"
FT                   /translation="MKLISVVIPAFGLLIYSFIEKRRSKMLKQENYNIETSELLEQQKF
FT                   VVRKEVGVFQVITYFGLDGSAVGFLKEEYDFVIQSIWQAVLSFLFKGLHKQQFYLYNHS
FT                   GERLLRVQKKMGVRNFYIFSNVDGKKIGELKQVLSLTKWEWIFLGVDGKECGKVTGDLS
FT                   ATMQKIDWRDGTHIDVKEDGIPLEAVKYFSASGGSLVTAYISEQAALPRAVYYSVSAIV
FT                   TIKN"
FT   gene            569608..570009
FT                   /locus_tag="BCE_0557"
FT                   /old_locus_tag="BCE0557"
FT   CDS_pept        569608..570009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0557"
FT                   /old_locus_tag="BCE0557"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39492"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E03"
FT                   /protein_id="AAS39492.1"
FT                   /translation="MCLFGNYWKRLSRLFNRQLDYFLDNKLLPAVERLLFSQNFARFIQ
FT                   RNSKQATEEFIESSRFQSIICNILKECNTSPFKEIAEQYLGKNVEITVTVGQLTGVIVA
FT                   IGDDFLTLQEGIGTEVLLPFTSIISIKEA"
FT   gene            570026..570220
FT                   /locus_tag="BCE_0558"
FT                   /old_locus_tag="BCE0558"
FT   CDS_pept        570026..570220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0558"
FT                   /old_locus_tag="BCE0558"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39493"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E02"
FT                   /protein_id="AAS39493.1"
FT                   /translation="MLFTEELRNHVGELVQVVTAAEIVAGILLSVTDGAVSVRTSPSYG
FT                   PPEDVVVRIPIISYVRLEG"
FT   gene            570234..571781
FT                   /locus_tag="BCE_0559"
FT                   /old_locus_tag="BCE0559"
FT   CDS_pept        570234..571781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0559"
FT                   /old_locus_tag="BCE0559"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39494"
FT                   /db_xref="GOA:Q73E01"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E01"
FT                   /protein_id="AAS39494.1"
FT                   /translation="MRVSVIIPAHNEASTLSQVLVEVEKLKPYEIIVVDNGSTDGTKEI
FT                   ALQHHCHVIYYKYSLGNDVGRAIGAREAKGDIVLFLDGDIVIDNKELQRFIKGIQQGHQ
FT                   IVVNNLTWSVYLKMRPHYTTVGKFMLNRYLNKKELVVGSLIAIPHAMSREVIQKFGWWN
FT                   LADPALFQAIAMSRGVDIVDMASVDVIHTNKVRPVHTGTSPGSPYPKATSRIMGDHLRA
FT                   LQYVIEIYGKRGGFSEGNRDRAFIGKYKPVLLQKKKAKYSAIIPVSEEKTTIRSVIQEV
FT                   KKSGVDEIIVVANGADVETIKQAKLENVIVIEFEEALGHNVARAIGAMHATADICLFVD
FT                   GDFVIPGKKLIPFLHAIEDGNDVALNDLQCLLDMFHPADPISMGKYFVNLVAKRPDLWN
FT                   NSLTAVPHAMHKKVIEKIGYDSLIIPPLAQMKAILEGFSITAVEFVDVIKTNRVRPEQH
FT                   GFVNGRIPAFDRIFGDQLEAIAYLLQSTDERGSFTDGERDRNIIQQLRKEEENTDEC"
FT   gene            571771..573015
FT                   /locus_tag="BCE_0560"
FT                   /old_locus_tag="BCE0560"
FT   CDS_pept        571771..573015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0560"
FT                   /old_locus_tag="BCE0560"
FT                   /product="UDP-glucose/GDP-mannose dehydrogenase family"
FT                   /note="identified by match to protein family HMM PF00984;
FT                   match to protein family HMM PF03720; match to protein
FT                   family HMM PF03721"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39495"
FT                   /db_xref="GOA:Q73E00"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q73E00"
FT                   /protein_id="AAS39495.1"
FT                   /translation="MNVSSTVAIIGLGYVGLPLAVHFAERGHTVLGLDKDTRKIESIIQ
FT                   GESYIPDVSSKLLQSLLTRKKLIVNTPDQGIADFQNSDYVIVTVPTPINEQREPDLSAL
FT                   ISASHYIQQNLQKGQTFIFESSTYPGTLEEVIIPIISQTGKKVGEDFYIGYSPERIDPA
FT                   NSQYSVQTIPKVISGQTEMCKQKVQALYSTIFDVVVPVSSPKVAEMCKLFENIQRLVNI
FT                   SLVNELNILCESLGIDFYEALEAASTKPFGFTPYWPGPGIGGHCIPVDPLYFQWRIKKN
FT                   GAMSRLIEAAHVINEEMPEKMVRKVKGVVQSPATVLIVGIAYKKDVNDLRESPALPIIE
FT                   LLIKEGYEIEYHDPYISSAKFGDKVYQSVSLDEQVVKQADCILILTDHSNIDWKIFKGI
FT                   KQVVDTRGIIKKVSV"
FT   gene            573012..573977
FT                   /locus_tag="BCE_0561"
FT                   /old_locus_tag="BCE0561"
FT   CDS_pept        573012..573977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0561"
FT                   /old_locus_tag="BCE0561"
FT                   /product="NAD-dependent epimerase/dehydratase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39496"
FT                   /db_xref="GOA:Q73DZ9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q73DZ9"
FT                   /protein_id="AAS39496.1"
FT                   /translation="MSKKCLITGGAGFIGSHLAEELVKRGYDVTIVDNFYKGKNKYHDE
FT                   LMKEIRVIPISVLDRNSIYELVNQHDVVFHLAAILGVKTTMEKSIELIETNFDGTRNIL
FT                   QAALKGKKKVVFASTSEVYGKAKPPFSEVGDRLYGATSKIRWSYAVCKTLEETLCLGYG
FT                   LEGLPVTIVRYFNIYGPRAKDGPYAGVIPRFIRAALQGEDILVYGDGKQTRCFTYVSDA
FT                   VEATIRAMDEKVNGEIINIGSENEKSIKEVAEVIKKLTKSSSKIVQVPFEEVYPHGFEE
FT                   IPNRRPDVTKLRELVQFQAKVTWEQGLKETIKWFREENNG"
FT   gene            573958..575532
FT                   /locus_tag="BCE_0562"
FT                   /old_locus_tag="BCE0562"
FT   CDS_pept        573958..575532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0562"
FT                   /old_locus_tag="BCE0562"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39497"
FT                   /db_xref="GOA:Q73DZ8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:Q73DZ8"
FT                   /protein_id="AAS39497.1"
FT                   /translation="MKKTMAKSLSIIIPVCNEADTISDVIQSAKGLNPVEIIVVANGCN
FT                   DGTEEVADRLGCKVIKYTELLGNDVGRAVGAKHAIGDVLLFIDGDFAIQTSKLQLFLNP
FT                   ILHDQADIVLNNLDALFLKKQKPHSVTVWRQILNAMLEREELKIDSLLSVPHALTKEVV
FT                   QSIGYECFVNPIVAHLRLIQSKWRISRHCAIDVITPNKFRPTEHAAYGTGLSHSEKRMI
FT                   GDHIEAVAERIVGSDERGGYYDGNRKRDSVYHTLDFKDFYQGWGVTSNLYKGKQLSVII
FT                   PVQDEEKTIGNVIEELRKIEPFEIIVVVNGSSDQTATIAKEKGATTIVYKEALGNDVGR
FT                   SLGTYFAKGEIVLFIDGDFVIPASELYPFAKAIADGTDVALNDLNHYLDLRVPLHLVTA
FT                   FKYALNLACDRKDLGVGSLIAVPNAFSRKCLKEIGYRSLLAPCVAQVKAILSGFEVACV
FT                   SRVEVDKMNRIRPSEHFAKIGHPPAVLRIIGDHIEGLEQLIVLTGSRGGFHDGNRKRDI
FT                   LSDFNGQ"
FT   gene            575900..578149
FT                   /gene="pfl"
FT                   /locus_tag="BCE_0563"
FT                   /old_locus_tag="BCE0563"
FT   CDS_pept        575900..578149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfl"
FT                   /locus_tag="BCE_0563"
FT                   /old_locus_tag="BCE0563"
FT                   /product="formate acetyltransferase"
FT                   /EC_number="2.3.1.54"
FT                   /note="identified by match to protein family HMM PF01228;
FT                   match to protein family HMM PF02901; match to protein
FT                   family HMM TIGR01255"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39498"
FT                   /db_xref="GOA:Q73DZ7"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:Q73DZ7"
FT                   /protein_id="AAS39498.1"
FT                   /translation="MTQVLENVKNAWENFKGEKWKAEIDVRDFILNNVNVYEGDESFLA
FT                   GATEATKQLWDQVMDLTTKERENGGVLDMDTKIVSSITSHEPGYLNKETEKVVGFQTDK
FT                   PFKRSLQPYGGIRMAEQACESYGYEMDKELSRIFRDWRKTHNQGVFDAYTPEMRAARKS
FT                   GVITGLPDAYGRGRIIGDYRRVALYGVDHLIEAKKVDLNLTGGVMSEDIMRLREELSEQ
FT                   IRALQELKQMAASHGFDISKPATTAQEAFQWLYFAYLAAIKEQNGAAMSLGRTSTFLDI
FT                   YIERDLANGTLTEEDVQEIVDHFIMKLRLVKFARTPDYNELFSGDPTWVTESIGGMALD
FT                   GRPLVTKNSFRFLHTLDNLGPAPEPNLTVLWSKQLPQNFKNYCAKMSIKTSAIQYENDD
FT                   IMRADYGDDYGIACCVSAMRIGKQMQFFGARANLAKALLYAINGGKDEKSKAQVGPEYA
FT                   PITSEVLDYEEVMHKFDMTMEWLAGLYLNTLNVIHYMHDKYSYERIEMALHDTNVLRTM
FT                   ATGIAGLSVVADSLSAIKYAKVKPIRDENGIAVDFEIEGDFPKYGNNDDRVDEIAVNLV
FT                   KTFMNKLRKHKTYRNSVHTMSILTITSNVVYGKKTGNTPDGRRTGEPFAPGANPMHGRD
FT                   TKGALASLLSVAKLPYEDAQDGISNTFSIIPKALGKEDEVQVRNLVSMLDGYAVKEGHH
FT                   LNINVFNRETLMDAMEHPEKYPQLTIRVSGYAVNFIKLTREQQIDVINRTMHESM"
FT   gene            578219..578950
FT                   /gene="pflA"
FT                   /locus_tag="BCE_0564"
FT                   /old_locus_tag="BCE0564"
FT   CDS_pept        578219..578950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pflA"
FT                   /locus_tag="BCE_0564"
FT                   /old_locus_tag="BCE0564"
FT                   /product="pyruvate formate-lyase-activating enzyme"
FT                   /EC_number="1.97.1.4"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39499"
FT                   /db_xref="GOA:Q73DZ6"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012838"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="InterPro:IPR034465"
FT                   /db_xref="UniProtKB/TrEMBL:Q73DZ6"
FT                   /protein_id="AAS39499.1"
FT                   /translation="MVKGRIHSVESCGTVDGPGIRYVIFTQGCLLRCQYCHNADTWEIG
FT                   KGKEITVEEVMQDVTCYLPFIEASGGGITVSGGEPLLQLDFLIELFKKCKEIGIHTTID
FT                   SSGGCYSEEPEFQNKLDILMEYTDLVLLDLKHIDSKKHRKLTGKPNEHILQFARYLSDK
FT                   NKPIWVRHVLVPGITDNEEDLQKLSSFIQSLSNVQKVEVLPYHKLGVYKWEALGHKYPL
FT                   ANVEPPTEKNVEEARHILQAV"
FT   gene            579363..580529
FT                   /locus_tag="BCE_0565"
FT                   /old_locus_tag="BCE0565"
FT   CDS_pept        579363..580529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0565"
FT                   /old_locus_tag="BCE0565"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39500"
FT                   /db_xref="GOA:Q73DZ5"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="InterPro:IPR009695"
FT                   /db_xref="InterPro:IPR023589"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73DZ5"
FT                   /protein_id="AAS39500.1"
FT                   /translation="MIKNPKVLILTAHYGNGHVQVAKTLEQTFRQKGIKDVIVCDLFGE
FT                   SHPVITDITKYLYLKSYTIGKELYRLFYYGVEKIYDKKIASWYANFGRKRLKLLLQAEK
FT                   PDIVINTFPIIAVPELKKQTGISIPVYNVLTDFCVHKIWIHREVDRYFVATDHVKKVMV
FT                   DIGVPAEQIVETGIPIRSSFELKINSDIIYNKYQLCKNKKILLIVAGAHGVLGSVKELC
FT                   QSFMSVPDLQVVVVCGKNEALKQDLLGLQEKNPDALKVFGYVENIDELFRVTSCMITKP
FT                   GGITLSEAAALQVPVILYKPVPGQENENAMYFERKGAAVVIRDDSEVFAKTEALLQDDM
FT                   KLLQMKEAMKSIYRPEPADHIVDTILAENHVEPNHIPIKSPALAQSFT"
FT   gene            580597..580737
FT                   /locus_tag="BCE_0566"
FT                   /old_locus_tag="BCE0566"
FT   CDS_pept        580597..580737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0566"
FT                   /old_locus_tag="BCE0566"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39501"
FT                   /db_xref="UniProtKB/TrEMBL:Q73DZ4"
FT                   /protein_id="AAS39501.1"
FT                   /translation="MKSALSLNSKVGILTTISTLSTIFRKISTILTFDVRYNIQTCEGF
FT                   L"
FT   gene            complement(580893..581012)
FT                   /locus_tag="BCE_0567"
FT                   /old_locus_tag="BCE0567"
FT   CDS_pept        complement(580893..581012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0567"
FT                   /old_locus_tag="BCE0567"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39502"
FT                   /db_xref="InterPro:IPR025437"
FT                   /db_xref="UniProtKB/TrEMBL:Q73DZ3"
FT                   /protein_id="AAS39502.1"
FT                   /translation="MDKKKRDKAKNALSSTQEVLYQREFRKADRAAGYRSKSI"
FT   gene            complement(581123..581680)
FT                   /locus_tag="BCE_0568"
FT                   /old_locus_tag="BCE0568"
FT   CDS_pept        complement(581123..581680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0568"
FT                   /old_locus_tag="BCE0568"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39503"
FT                   /db_xref="GOA:Q73DZ2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q73DZ2"
FT                   /protein_id="AAS39503.1"
FT                   /translation="MLKKRDLHDSHVLYELMVDPAVFPFVRQKAYSYEEYLFLTKQTIE
FT                   AEERGELISRTILDEWGNPIGTITLFDVQEKAGFLGTWLGKPYHGKGYNKLAKDSFFSE
FT                   LFYELDIETIFMRIRKINIRSIKAAEKLQYVNLANETRKSVYDEINANEEVYNLYEIPK
FT                   DQYTLATMRDTTFQDSHHLKEA"
FT   gene            complement(581922..583043)
FT                   /locus_tag="BCE_0569"
FT                   /old_locus_tag="BCE0569"
FT   CDS_pept        complement(581922..583043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0569"
FT                   /old_locus_tag="BCE0569"
FT                   /product="chlorohydrolase family protein"
FT                   /note="identified by match to protein family HMM PF01979"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39504"
FT                   /db_xref="GOA:Q73DZ1"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q73DZ1"
FT                   /protein_id="AAS39504.1"
FT                   /translation="MLKQAIVYPITSQKFQGDVLVIGEKIAEVKPSIQPTQDMTVIDAR
FT                   ALHLLPGFIDVHTHLGLYDEGTGWAGNDANETSEVSTPHIRSLDGIHPFDIAFQDAVQN
FT                   GITTVHVMPGSQNIIGGTTCVIKTAGTCIDHMIIQEPAGLKIAFGENPKKVHSNGTKES
FT                   ITRMGIMGLLRESFYEAQHYGHEADFRMLPILKALRREIPVRIHAHRADDISSALRFAT
FT                   EFNLDLRIEHCTEGHFIVEELSKHNLKVSVGPTLTRRSKIELKNKTWDTYHILSKNGVE
FT                   VSITTDHPYTPIQYLNVCAAVAVREGLDEKTALEGITIFPARNLRLEDRIGSIETGKDA
FT                   DLVLWTHHPFHYLAKPVLTMIDGKIIYKKNKKN"
FT   gene            complement(583193..584098)
FT                   /locus_tag="BCE_0570"
FT                   /old_locus_tag="BCE0570"
FT   CDS_pept        complement(583193..584098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0570"
FT                   /old_locus_tag="BCE0570"
FT                   /product="cell division inhibitor-like protein"
FT                   /note="identified by match to protein family HMM TIGR01777"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39505"
FT                   /db_xref="GOA:Q73DZ0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q73DZ0"
FT                   /protein_id="AAS39505.1"
FT                   /translation="MKIAISGGTGFIGKYLSTFFIQKGYTVYILSRKKTAETSDPNLQY
FT                   VQWTPDLQTFPLSSIDVVINLAGESINSRWTKKQKKVILNSRIQTTKGLIKQLQALPTK
FT                   PHTFINASAIGYYGTSETESFTEQHATPGNDFLANTVYSWEQEASKARSLGIRTIYARF
FT                   GVVLGPDGGALPKMLLPYQFYIGGTVGSGNQWLSWIHINDVACMIDFIIHKEEIDGPLN
FT                   ITAPEPIRMKEFGEIIATIIKKPHWLPVPSFMLHALLGEMSILVLEGQHVLPSKAIEHG
FT                   YQYTFPSIDHALQNILSHTM"
FT   gene            584180..584992
FT                   /locus_tag="BCE_0571"
FT                   /old_locus_tag="BCE0571"
FT   CDS_pept        584180..584992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0571"
FT                   /old_locus_tag="BCE0571"
FT                   /product="recX domain protein"
FT                   /note="identified by match to protein family HMM PF02631"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39506"
FT                   /db_xref="GOA:Q73DY9"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73DY9"
FT                   /protein_id="AAS39506.1"
FT                   /translation="MAVITKIEVQKRSKERFNIYIDKGQGEEYGFSVNEVILIKHGLQK
FT                   GLEIDEIALGNILYNEEVQKAYLQAISYLSYQMRTKLEIEDFLRKKEVGQAIISEVVSK
FT                   LLHDRYINDKEYAILYTRTQSNVNRKGPTVIKRELLNKGVQDLIITHSLQEYPKEKQIE
FT                   NALILIEKKKKSYQKHSFLQMKLKLDEMLVRKGYSRDVIQICLEELKDEKDDEKQQEAL
FT                   HYHGNKYYEKYKKYDGWTFENKMKQALYRKGFSIDEIEIFLQMKREEG"
FT   gene            585002..585319
FT                   /locus_tag="BCE_0572"
FT                   /old_locus_tag="BCE0572"
FT   CDS_pept        585002..585319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0572"
FT                   /old_locus_tag="BCE0572"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39507"
FT                   /db_xref="InterPro:IPR014938"
FT                   /db_xref="InterPro:IPR036289"
FT                   /db_xref="UniProtKB/TrEMBL:Q73DY8"
FT                   /protein_id="AAS39507.1"
FT                   /translation="MNMPKRYSEMTPYELREEIGVLKEQAIKAEQLGIVNEFDVLMRKI
FT                   AMARAYMTDINKFHIGETYELVEEPGILFEITYFNGVFAWGHKQNDNEEIGIPISLLQE
FT                   K"
FT   gene            complement(585384..585536)
FT                   /locus_tag="BCE_0573"
FT                   /old_locus_tag="BCE0573"
FT   CDS_pept        complement(585384..585536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0573"
FT                   /old_locus_tag="BCE0573"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39508"
FT                   /db_xref="InterPro:IPR025413"
FT                   /db_xref="UniProtKB/TrEMBL:Q73DY7"
FT                   /protein_id="AAS39508.1"
FT                   /translation="MSYRDRLDSRSELFNHTWTRPKHAKAQVNGQTQQTQSLIILANEC
FT                   KKRQF"
FT   gene            complement(585575..585733)
FT                   /locus_tag="BCE_0574"
FT                   /old_locus_tag="BCE0574"
FT   CDS_pept        complement(585575..585733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0574"
FT                   /old_locus_tag="BCE0574"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39509"
FT                   /db_xref="GOA:Q73DY6"
FT                   /db_xref="InterPro:IPR012611"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73DY6"
FT                   /protein_id="AAS39509.1"
FT                   /translation="MGKQAEFWSESKNNSKIDGQPKAKSRFASKRPNGTINTHPQERMR
FT                   AANQQEE"
FT   gene            585855..586121
FT                   /locus_tag="BCE_0575"
FT                   /old_locus_tag="BCE0575"
FT   CDS_pept        585855..586121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0575"
FT                   /old_locus_tag="BCE0575"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39510"
FT                   /db_xref="InterPro:IPR026952"
FT                   /db_xref="UniProtKB/TrEMBL:Q73DY5"
FT                   /protein_id="AAS39510.1"
FT                   /translation="MNDIYEALTKELLDKNDKLSYAQARAWVELLWEDFQTTYAKSGRY
FT                   QGEEMTEQVVRSWINNHGGRLHEMRTNNPKYSHLINQEDHLKH"
FT   gene            complement(586146..587126)
FT                   /locus_tag="BCE_0576"
FT                   /old_locus_tag="BCE0576"
FT   CDS_pept        complement(586146..587126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0576"
FT                   /old_locus_tag="BCE0576"
FT                   /product="yfhP protein"
FT                   /note="identified by match to protein family HMM PF04307"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39511"
FT                   /db_xref="GOA:Q73DY4"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:Q73DY4"
FT                   /protein_id="AAS39511.1"
FT                   /translation="MDTATHLVMGVTLGSLATLDPAIAQSDIGPQAVMLATIAGSNIPD
FT                   IDTVLKLRNNAKYIRNHRGITHSIPAVILWSFLISGISFAFFSDAPYLHLLLWSFIAVF
FT                   LHVFVDIFNAYGTQALRPFTKKWVALGIINTFDTVIFFIHILAIACMLVGSHKGYTALA
FT                   AYILMIVYYIGRIMMHRNIRSVVQKRFKNVEKIIISPSYRFYHYHLAVVTTDYYYVARW
FT                   HRGNIMIYDKFDRVPFPDNAIMHAAKQDENISAFLSFSPVYRWDIFDYDHYYEVRFIDL
FT                   RYRSKDYYPFVAIVQLDHNLNIISSYTGWIFSEEKLRKKLELLPH"
FT   gene            587276..588373
FT                   /gene="mutY"
FT                   /locus_tag="BCE_0577"
FT                   /old_locus_tag="BCE0577"
FT   CDS_pept        587276..588373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="BCE_0577"
FT                   /old_locus_tag="BCE0577"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="identified by match to protein family HMM PF00633;
FT                   match to protein family HMM PF00730; match to protein
FT                   family HMM TIGR01084"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39512"
FT                   /db_xref="GOA:Q73DY3"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:Q73DY3"
FT                   /protein_id="AAS39512.1"
FT                   /translation="MTLEILNNFNIEQFQNDLIGWFEKEQRDLPWRKNKDPYRVWVSEI
FT                   MLQQTRVEAVKPYYANFMGKFPTLEALANADDEEVLKAWEGLGYYSRARNLHAAVKEVK
FT                   EVYGGIVPSDVKKIEKLKGVGPYTKGAILSIAYGIPEPAVDGNVMRVLSRILSVWDDIA
FT                   KPKTRKVFEEIVREIISAENPSYFNQGLMELGALICIPKNPACLLCPVREHCRGYAEGV
FT                   QKELPVKSKAKAPTMVPIVAGVLQTEDGRYVINKRPSTGLLANMWEFPNIELGEGIRNQ
FT                   KEQLIDYMKEKFELSISIEEYAMNVQHTFTHRTWDIFVFYGKVTGDIVETDTLKIVSKE
FT                   AFEQLPFSKSHRTIYESCVEKITMQ"
FT   gene            complement(588561..588824)
FT                   /locus_tag="BCE_0578"
FT                   /old_locus_tag="BCE0578"
FT   CDS_pept        complement(588561..588824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0578"
FT                   /old_locus_tag="BCE0578"
FT                   /product="yfhS protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39513"
FT                   /db_xref="UniProtKB/TrEMBL:Q73DY2"
FT                   /protein_id="AAS39513.1"
FT                   /translation="MSLIQTIENGGGNMYIGRDMTELTMISKNEWKEDELAYFHHSLQQ
FT                   ILPYLNTEGQSIYKEIVIEIESRGGLQEGDASWTHGTKISYD"
FT   gene            588910..589191
FT                   /locus_tag="BCE_0579"
FT                   /old_locus_tag="BCE0579"
FT   CDS_pept        588910..589191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0579"
FT                   /old_locus_tag="BCE0579"
FT                   /product="small acid-soluble spore protein, gamma-type"
FT                   /note="identified by match to protein family HMM PF04259;
FT                   match to protein family HMM TIGR01442"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39514"
FT                   /db_xref="GOA:Q73DY1"
FT                   /db_xref="InterPro:IPR006341"
FT                   /db_xref="UniProtKB/TrEMBL:Q73DY1"
FT                   /protein_id="AAS39514.1"
FT                   /translation="MSKKQQGYNKATSGASIQSTNASYGTEFSTETDVQAVKQANAQSE
FT                   AKKAQASGAQSANASYGTEFATETDVHAVKKQNAQSAAKQSQSSSSNQ"
FT   gene            589191..589319
FT                   /locus_tag="BCE_0580"
FT                   /old_locus_tag="BCE0580"
FT   CDS_pept        589191..589319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0580"
FT                   /old_locus_tag="BCE0580"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39515"
FT                   /db_xref="UniProtKB/TrEMBL:Q73DY0"
FT                   /protein_id="AAS39515.1"
FT                   /translation="MKEKHFSNSGEVFSLCFGHGNENKTNDITSNKSTNVVKGEGS"
FT   gene            589381..589641
FT                   /locus_tag="BCE_0581"
FT                   /old_locus_tag="BCE0581"
FT   CDS_pept        589381..589641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0581"
FT                   /old_locus_tag="BCE0581"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39516"
FT                   /db_xref="InterPro:IPR025572"
FT                   /db_xref="UniProtKB/TrEMBL:Q73DX9"
FT                   /protein_id="AAS39516.1"
FT                   /translation="MNDFDKLVGEQLETMDELLKLQAHLEKYQQIEMSEKDMCDKKELH
FT                   FIRQEIYRTELALKLLHEKFEEQTNSVIQSFETEKMISNLG"
FT   gene            589925..590455
FT                   /locus_tag="BCE_0582"
FT                   /old_locus_tag="BCE0582"
FT   CDS_pept        589925..590455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0582"
FT                   /old_locus_tag="BCE0582"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04167"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39517"
FT                   /db_xref="InterPro:IPR007295"
FT                   /db_xref="InterPro:IPR016882"
FT                   /db_xref="InterPro:IPR035930"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73DX8"
FT                   /protein_id="AAS39517.1"
FT                   /translation="MGFPKEGEKVQIHSYKHNGSIHRMWEETTILKGTQSLVIGANDRT
FT                   VVTESDGRTWITREPAICYFHANYWFNVIGMLREEGVYYYCNLSSPFAYDSEALKYIDY
FT                   DLDIKVYPDMTYTLLDEDEYEKHSQIMQYPPVIDTILKRNVAQLTQWIHQRKGPFAPDF
FT                   VDMWYERYLMYRN"
FT   gene            590510..592270
FT                   /locus_tag="BCE_0583"
FT                   /old_locus_tag="BCE0583"
FT   CDS_pept        590510..592270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0583"
FT                   /old_locus_tag="BCE0583"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39518"
FT                   /db_xref="GOA:Q73DX7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q73DX7"
FT                   /protein_id="AAS39518.1"
FT                   /translation="MQGIKRYLQFVKPYRWLIAITIMIGLVKFGIPLIMPWLLKYIIDD
FT                   VIQGGGSFQDKTSQLVTAIGIAFFIFAVLRPPIEYYRQYFAQRIANTILYDLRKHIFGH
FT                   LQKLSLRYYSNTKTGEIISRVIHDVEQTKDFVITGLMNVWLDTATIAIAIIVMFSMNIK
FT                   LTFVALLILPIYVVAVKYFFGRLRKLTKERSQALATMQGYLHERIQGMQVTRSFALEEY
FT                   EGKQFEKRNNEFLTKALTHTSWTARTFSAVNTLTDLGPLLVIGFAAYEVIQGQLTLGTM
FT                   VAFVGYMDSLYSPLRRLVNSSTTLTQSFASMDRVFELLDEKYDIVNVPGAVQTKKLNGE
FT                   VIFDNVSFRYNSDEKEVLHNLSLTMLPGEKVALVGASGGGKSSLASLIPRFYDVSSGAV
FT                   YVDGIDVRKYDMRNLRSHIGIVLQDNLLFSDTIGANILYGNPKATEEEVIAAAKAAQIH
FT                   DFIIELPDGYDTVVGERGVKLSGGQRQRVAIARVFLKNPSLLILDEATSALDLENERYI
FT                   QEALQTLAADRTTIIIAHRLATITHVDTIIYIEDGEIKETGSHEELMKKRGFYYNLYQL
FT                   QHITETAPLA"
FT   gene            complement(592284..593429)
FT                   /locus_tag="BCE_0584"
FT                   /old_locus_tag="BCE0584"
FT   CDS_pept        complement(592284..593429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0584"
FT                   /old_locus_tag="BCE0584"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39519"
FT                   /db_xref="GOA:Q73DX6"
FT                   /db_xref="InterPro:IPR010343"
FT                   /db_xref="UniProtKB/TrEMBL:Q73DX6"
FT                   /protein_id="AAS39519.1"
FT                   /translation="MYSIMLYIHYDKRKDLIKGMKLGARILKTGIAITLALFACILLNL
FT                   PSPVFAGISAIFAVQPSVYRSYLTALEQIQANVIGAVFAIAFATAFGHNPFIIGLTCIL
FT                   VIALTLQLRLENTISIALVTVIAIMEYQGEDFFSFALLRFATIMVGIIAASLVNLVFMP
FT                   PKYETKLYHRIVDNTEEIVKWIRMNSRQASDFTTLKTDIDRMKEKMIKLNHYYLLYKEE
FT                   RSYTKKVKFAKIRKLVLFRQMLATTSRALSTLKSLHRTENELRYMPEEFQESIQNELDS
FT                   LTHYHEQVLLKFIGKAKKQQSVEMLDEVETGKQELIDIFMEYQNKDDEEAYKTWLHLFP
FT                   LISAIINYSEEVEHLDLLVDSFYTYHKPEAELKIDDKKEDE"
FT   gene            complement(593633..598069)
FT                   /locus_tag="BCE_0585"
FT                   /old_locus_tag="BCE0585"
FT   CDS_pept        complement(593633..598069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0585"
FT                   /old_locus_tag="BCE0585"
FT                   /product="glutamate synthase, large subunit, putative"
FT                   /note="identified by match to protein family HMM PF01493;
FT                   match to protein family HMM PF01645; match to protein
FT                   family HMM PF04897; match to protein family HMM TIGR01612"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39520"
FT                   /db_xref="GOA:Q73DX5"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:Q73DX5"
FT                   /protein_id="AAS39520.1"
FT                   /translation="MLNKTNTWTPSLFRDYKNAEHDACGIVSVMEKRKIPTKENIDLCI
FT                   QSLVKMNHRAGFINGEGDGIGIHIDVPKALWNEKLKSSGYNPTIVDHPHFIVGHFFLNK
FT                   NENIVNLKNHIRTQLNNENFAILFESDDVINSDALGPLGKQEEPLFWQVALIAENEVTN
FT                   IEQTLFTVTIKIEENEAIHVASLSRDHVVYKVLGAGDTLVAYYNDLQHPLIASTMTLGH
FT                   NRYSTNTLSNFFRVQPFSILGHNGEINTIAKLRDQAEMIHVPLTAGGSDSQDLNRTLET
FT                   LLVQYNYSLFEAMDILFPPIINEIKLYEPHLQDLYTYIREAWGHFAQGPAGIISRYKDE
FT                   AVFSVDSLGLRPVWKVETESSYIFSSEPGVVSPTEYVAEPKPLAPGEKVGLKWNEQDEL
FT                   VLYAYDKYQAQVYDRFKKRVDTKDYHLNLSTPETKEIQGLCDSMQVETKQYVAFGWDRE
FT                   HIQLLEQMATKGVEPIRSLGHDSPLAALDTDRRNIADFIKESVAVVTNPAIDRDREVEH
FT                   FSTRTILGKRPSLLAGAKQPFVVEMLSPIILEGSVAQSIVEELHTITYEQLIQLFNTHS
FT                   SIATISATFSQAETLQCALSRISSEAITAVNDGASLLLIDDADAHLNGRLWIDPHLVTA
FT                   KVHQVLSENKLRRNCSLVIRSGALRSLHDIVTLYGLGADSINPYLLFATVNDGTKTPIT
FT                   NLYHALNKGLEKVISTIGIHELRGYGRLYSSIGLHEEIANILQITNFLGSNDLAFSLES
FT                   LAEDAQMRANDYNNPKVRMRKSFHIFPRIWKAIGDVAKGNSYDDYREKLSELEENNPIA
FT                   IRHLVQTKETKHVVPAEEVSISIQNHDLPFIISSMSFGSQNEIAFRAYAEAADQLNMIS
FT                   LNGEGGEIKDMIGKYPHTRGQQIASGRFGVNAELLNSSNLIEIKIGQGAKPGEGGHLPG
FT                   SKVTAKIAEARNATIGSDLISPSNNHDIYSIEDLAQMITEIKTANQLAKVAVKVPVVPN
FT                   IGTIAVGIAKAGADFINISGFDGGTGAARIHALQHVGLPVEIGVKAAHNALLEANMRHK
FT                   VEIWADGGIRSVNDALKIMLLGANRIGFGTLSMIAIGCTTCRGCHLDTCHVGIATQIES
FT                   EAQAKEHGLRRFVPRELESAVAGLLHLFTTFGEELKRLTGNLGYTNLQEIVGRSDLLKQ
FT                   VRGKNLLNLCNLLQTIEHPSSTKTEHVLEKQFETIHSPHSKELVGVGVEQRVMGGLESC
FT                   YRVRSKLYEDTKLEPLTLKYTNGSIPGNGLGAYNSENLFIHVNGGAQDGIGKTSFGGGI
FT                   YITKAKGKDGLYYNGSVGKGFGYGAQKGALYVQGNADARAGIRLSGADMIIGGRMIKPL
FT                   REKEQGNIGAYSNIKGFAFEYMTNGRALVLGDPGPWICAGMTGGVVYLRHDSSLGLTEQ
FT                   ALKRRIAKGANVTLQPLSKNGVQDVTELLLDYIRVLNEHEQYEEVALLTPLLDDMPQQF
FT                   FEIIPKKEQADPSISTE"
FT   gene            complement(598268..599572)
FT                   /gene="hemL"
FT                   /locus_tag="BCE_0586"
FT                   /old_locus_tag="BCE0586"
FT   CDS_pept        complement(598268..599572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="BCE_0586"
FT                   /old_locus_tag="BCE0586"
FT                   /product="glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /EC_number="5.4.3.8"
FT                   /note="identified by match to protein family HMM PF00202;
FT                   match to protein family HMM TIGR00713"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0586"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39521"
FT                   /db_xref="GOA:Q73DX4"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73DX4"
FT                   /protein_id="AAS39521.1"
FT                   /translation="MVVKFTKSEALHKEALEHIVGGVNSPSRSFKAVGGGAPVAMERGK
FT                   GAYFWDVDGNKYIDYLAAYGPIITGHAHPHITKAITTAAENGVLYGTPTALEVKFAKML
FT                   KEAMPALDKVRFVNSGTEAVMTTIRVARAYTGRTKIMKFAGCYHGHSDLVLVAAGSGPS
FT                   TLGTPDSAGVPQSIAQEVITVPFNNVETLKEALDKWGHEVAAILVEPIVGNFGIVEPKT
FT                   GFLEKVNELVHEAGALVIYDEVITAFRFMYGGAQDLLGVTPDLTALGKVIGGGLPIGAY
FT                   GGKKEIMEQVAPLGPAYQAGTMAGNPASMASGIACLEVLQQEGLYEKLDELGAMLEKGI
FT                   LEQAEKHNIDITLNRLKGALTVYFTTNTIEDYDAAQDTDGEMFGKFFKLMLQEGINLAP
FT                   SKYEAWFLTTEHTKEDIEYTIEAVGRAFAALANNK"
FT   gene            599694..600707
FT                   /locus_tag="BCE_0587"
FT                   /old_locus_tag="BCE0587"
FT   CDS_pept        599694..600707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0587"
FT                   /old_locus_tag="BCE0587"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39522"
FT                   /db_xref="GOA:Q73DX3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q73DX3"
FT                   /protein_id="AAS39522.1"
FT                   /translation="MKSVIEVQGLRKEFTAYSSRPGLKGAFRDLLNRNYKIVPAVNDVS
FT                   FTVKQGEMVGYIGENGAGKSTTIKMLTGILTPTSGDILVNGMNPHKQREEFVRTIGVVF
FT                   GQRSQLWWDIAVQESFRLLKKVYGVSDAQYKEHMEHVIETLDIGPLLDKPVRKLSLGQR
FT                   MRCELAAALIHNPPLLFLDEPTIGLDVLVKLKIREFLKEMNERYKTTILLTTHDITDIE
FT                   ALCERVIMLDEGNIMYDGSLNNLRTQWGAEKEIHFQFVAPVSYQALSMVMPDSHVVWSK
FT                   AKEENAWIAKIPNEEVIISMLISKVVQAFQIKDLKINEVSTEEIIRNIYEEGIKHG"
FT   gene            600700..601491
FT                   /locus_tag="BCE_0588"
FT                   /old_locus_tag="BCE0588"
FT   CDS_pept        600700..601491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0588"
FT                   /old_locus_tag="BCE0588"
FT                   /product="ABC transporter, permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0588"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39523"
FT                   /db_xref="GOA:Q73DX2"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:Q73DX2"
FT                   /protein_id="AAS39523.1"
FT                   /translation="MGKYIEMIRIRFLMMLAYRTNYYSGILIYTINIGAYYFLWQAIYS
FT                   GKENIESLSISQMTTYIAIAWMARAFYFNNIDREIAMEIQEGRVAVELIRPYNYLGMKV
FT                   MQGLGEGIFRFAFFSIPGMVIVTLLFSLQITTNFQTWLYFFLSLIFSFIINTQINLMTG
FT                   MLTFFLFNNSGIMYAKRVVIDLFSGLLLPISFYPLWAQKAMMFLPFQAISYIPSMIFSE
FT                   GIQGSKLYEALLFQVIWAIVLIIPIVLMWRTARKRLIVQGG"
FT   gene            601496..602281
FT                   /locus_tag="BCE_0589"
FT                   /old_locus_tag="BCE0589"
FT   CDS_pept        601496..602281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0589"
FT                   /old_locus_tag="BCE0589"
FT                   /product="ABC transporter, permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39524"
FT                   /db_xref="GOA:Q73DX1"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:Q73DX1"
FT                   /protein_id="AAS39524.1"
FT                   /translation="MIYIKLFLQYASQYIKTKLEYRGDFIVGLLSDLSLQAVNLIFILV
FT                   VFGHTQALKGWSREEVIFIYGFFLVPFAIFSAFFNIWDFNDRYIIKGEMDRILTRPIHS
FT                   LFQIILERMELESLIGAITGMIVMGYAAVELQLSFYWYDIFLFLLMVGGGALVYGGIFV
FT                   TLASLGFWSDAKSSIMPLMYNIGNYGRYPVNIYNRVIRFILTFVLPFAFVGVYPAAYFL
FT                   RKTEWNSYAFATPLVGVICFTIAITLWNQGVKRYRGAGN"
FT   gene            602354..602758
FT                   /locus_tag="BCE_0590"
FT                   /old_locus_tag="BCE0590"
FT   CDS_pept        602354..602758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0590"
FT                   /old_locus_tag="BCE0590"
FT                   /product="potassium channel protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0590"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39525"
FT                   /db_xref="GOA:Q73DX0"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:Q73DX0"
FT                   /protein_id="AAS39525.1"
FT                   /translation="MLWGFILLIAAIAILRSVQLLWSSYSDSTRFFSLYNLATLFLIYT
FT                   TVLIAFGLSYVVLEEMGFAVLKEDGESLNAHSFQLVEICLYFSAVTLLSVGYGDISPIG
FT                   IGRWIAIGEALIGYTLPFAFVMRSVIDNEK"
FT   gene            602803..603258
FT                   /gene="bcP"
FT                   /locus_tag="BCE_0591"
FT                   /old_locus_tag="BCE0591"
FT   CDS_pept        602803..603258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcP"
FT                   /locus_tag="BCE_0591"
FT                   /old_locus_tag="BCE0591"
FT                   /product="bacterioferritin comigratory protein"
FT                   /note="identified by match to protein family HMM PF00578"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0591"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39526"
FT                   /db_xref="GOA:Q73DW9"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q73DW9"
FT                   /protein_id="AAS39526.1"
FT                   /translation="MITVGEMAPEFTLEGSNGEQVRLADFRGKNVVLYFYPKDMTPGCT
FT                   TEACDFRDAYGLFQEKDTVILGVSPDSANRHLKFVEKHELPFVLLVDEDHKVAELYDVW
FT                   KLKKNFGKEYMGIERSTFLINKDGELVKEWRKVKVKGHVEDVLSYIK"
FT   gene            603558..603986
FT                   /locus_tag="BCE_0592"
FT                   /old_locus_tag="BCE0592"
FT   CDS_pept        603558..603986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0592"
FT                   /old_locus_tag="BCE0592"
FT                   /product="transcriptional regulator, Fur family"
FT                   /note="identified by match to protein family HMM PF01475"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39527"
FT                   /db_xref="GOA:Q73DW8"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q73DW8"
FT                   /protein_id="AAS39527.1"
FT                   /translation="MVKEELKEALEMLKNTGVRITPQRHAILEYLVESMTHPTADEIYK
FT                   ALEGKFPNMSVATVYNNLRVFKEVGLVKELTYGDASSRFDYVTSQHYHVICEKCGKIVD
FT                   FPYGGLEQLEEEAAKTTGFVINSHRLEIYGVCPECHKA"
FT   gene            complement(604183..604539)
FT                   /locus_tag="BCE_0593"
FT                   /old_locus_tag="BCE0593"
FT   CDS_pept        complement(604183..604539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0593"
FT                   /old_locus_tag="BCE0593"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39528"
FT                   /db_xref="GOA:Q73DW7"
FT                   /db_xref="InterPro:IPR020912"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73DW7"
FT                   /protein_id="AAS39528.1"
FT                   /translation="MGIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMM
FT                   VGFLAVIASTVVYFWIGMLSTKTVQIICPSCDKPTKMLGRVDACMHCNQPLTMDRNLEG
FT                   KEFDEKYNKKSYKS"
FT   gene            604864..604962
FT                   /locus_tag="BCE_0594"
FT                   /old_locus_tag="BCE0594"
FT   CDS_pept        604864..604962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0594"
FT                   /old_locus_tag="BCE0594"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39529"
FT                   /db_xref="UniProtKB/TrEMBL:Q73F54"
FT                   /protein_id="AAS39529.1"
FT                   /translation="MKTERNKQRETSIFILDARQTNFIGEFDPGSG"
FT   gene            604958..606465
FT                   /locus_tag="BCE_5765"
FT                   /old_locus_tag="BCE5765"
FT                   /note="Bc16SJ"
FT   rRNA            604958..606465
FT                   /locus_tag="BCE_5765"
FT                   /old_locus_tag="BCE5765"
FT                   /product="16S ribosomal RNA"
FT   gene            606642..609549
FT                   /locus_tag="BCE_5766"
FT                   /old_locus_tag="BCE5766"
FT                   /note="Bc23SJ"
FT   rRNA            606642..609549
FT                   /locus_tag="BCE_5766"
FT                   /old_locus_tag="BCE5766"
FT                   /product="23S ribosomal RNA"
FT   gene            609653..609763
FT                   /locus_tag="BCE_5767"
FT                   /old_locus_tag="BCE5767"
FT                   /note="Bc5SJ"
FT   rRNA            609653..609763
FT                   /locus_tag="BCE_5767"
FT                   /old_locus_tag="BCE5767"
FT                   /product="5S ribosomal RNA"
FT   gene            609775..609849
FT                   /locus_tag="BCE_5671"
FT                   /old_locus_tag="BCE5671"
FT                   /note="tRNA-Asn"
FT   tRNA            609775..609849
FT                   /locus_tag="BCE_5671"
FT                   /old_locus_tag="BCE5671"
FT                   /product="tRNA-Asx"
FT   gene            609852..609943
FT                   /locus_tag="BCE_5672"
FT                   /old_locus_tag="BCE5672"
FT                   /note="tRNA-Ser"
FT   tRNA            609852..609943
FT                   /locus_tag="BCE_5672"
FT                   /old_locus_tag="BCE5672"
FT                   /product="tRNA-Ser"
FT   gene            609961..610035
FT                   /locus_tag="BCE_5673"
FT                   /old_locus_tag="BCE5673"
FT                   /note="tRNA-Glu"
FT   tRNA            609961..610035
FT                   /locus_tag="BCE_5673"
FT                   /old_locus_tag="BCE5673"
FT                   /product="tRNA-Glu"
FT   gene            610040..610115
FT                   /locus_tag="BCE_5674"
FT                   /old_locus_tag="BCE5674"
FT                   /note="tRNA-Val"
FT   tRNA            610040..610115
FT                   /locus_tag="BCE_5674"
FT                   /old_locus_tag="BCE5674"
FT                   /product="tRNA-Val"
FT   gene            610140..610216
FT                   /locus_tag="BCE_5675"
FT                   /old_locus_tag="BCE5675"
FT                   /note="tRNA-Met"
FT   tRNA            610140..610216
FT                   /locus_tag="BCE_5675"
FT                   /old_locus_tag="BCE5675"
FT                   /product="tRNA-Met"
FT   gene            610220..610295
FT                   /locus_tag="BCE_5676"
FT                   /old_locus_tag="BCE5676"
FT                   /note="tRNA-Asp"
FT   tRNA            610220..610295
FT                   /locus_tag="BCE_5676"
FT                   /old_locus_tag="BCE5676"
FT                   /product="tRNA-Asx"
FT   gene            610305..610380
FT                   /locus_tag="BCE_5677"
FT                   /old_locus_tag="BCE5677"
FT                   /note="tRNA-Phe"
FT   tRNA            610305..610380
FT                   /locus_tag="BCE_5677"
FT                   /old_locus_tag="BCE5677"
FT                   /product="tRNA-Phe"
FT   gene            610399..610474
FT                   /locus_tag="BCE_5678"
FT                   /old_locus_tag="BCE5678"
FT                   /note="tRNA-Thr"
FT   tRNA            610399..610474
FT                   /locus_tag="BCE_5678"
FT                   /old_locus_tag="BCE5678"
FT                   /product="tRNA-Thr"
FT   gene            610485..610568
FT                   /locus_tag="BCE_5679"
FT                   /old_locus_tag="BCE5679"
FT                   /note="tRNA-Tyr"
FT   tRNA            610485..610568
FT                   /locus_tag="BCE_5679"
FT                   /old_locus_tag="BCE5679"
FT                   /product="tRNA-Tyr"
FT   gene            610576..610649
FT                   /locus_tag="BCE_5680"
FT                   /old_locus_tag="BCE5680"
FT                   /note="tRNA-Trp"
FT   tRNA            610576..610649
FT                   /locus_tag="BCE_5680"
FT                   /old_locus_tag="BCE5680"
FT                   /product="tRNA-Trp"
FT   gene            610669..610744
FT                   /locus_tag="BCE_5681"
FT                   /old_locus_tag="BCE5681"
FT                   /note="tRNA-His"
FT   tRNA            610669..610744
FT                   /locus_tag="BCE_5681"
FT                   /old_locus_tag="BCE5681"
FT                   /product="tRNA-His"
FT   gene            610808..610882
FT                   /locus_tag="BCE_5682"
FT                   /old_locus_tag="BCE5682"
FT                   /note="tRNA-Gln"
FT   tRNA            610808..610882
FT                   /locus_tag="BCE_5682"
FT                   /old_locus_tag="BCE5682"
FT                   /product="tRNA-Gln"
FT   gene            610888..610962
FT                   /locus_tag="BCE_5683"
FT                   /old_locus_tag="BCE5683"
FT                   /note="tRNA-Gly"
FT   tRNA            610888..610962
FT                   /locus_tag="BCE_5683"
FT                   /old_locus_tag="BCE5683"
FT                   /product="tRNA-Gly"
FT   gene            610977..611047
FT                   /locus_tag="BCE_5684"
FT                   /old_locus_tag="BCE5684"
FT                   /note="tRNA-Cys"
FT   tRNA            610977..611047
FT                   /locus_tag="BCE_5684"
FT                   /old_locus_tag="BCE5684"
FT                   /product="tRNA-Cys"
FT   gene            611058..611142
FT                   /locus_tag="BCE_5685"
FT                   /old_locus_tag="BCE5685"
FT                   /note="tRNA-Leu"
FT   tRNA            611058..611142
FT                   /locus_tag="BCE_5685"
FT                   /old_locus_tag="BCE5685"
FT                   /product="tRNA-Leu"
FT   gene            611630..612349
FT                   /locus_tag="BCE_0595"
FT                   /old_locus_tag="BCE0595"
FT   CDS_pept        611630..612349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0595"
FT                   /old_locus_tag="BCE0595"
FT                   /product="conserved hypothetical protein TIGR01033"
FT                   /note="identified by match to protein family HMM PF01709;
FT                   match to protein family HMM TIGR01033"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0595"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39530"
FT                   /db_xref="GOA:P62032"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026562"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62032"
FT                   /protein_id="AAS39530.1"
FT                   /translation="MGRKWNNIKDKKASKDANTSRIYAKFGREIYVAAKQGEPDPESNQ
FT                   ALRVVLERAKTYNVPRTIIDRAVEKAKGGSEENYDELRYEGFGPNGAMVIVDTLTNNVN
FT                   RTAADVRAAFSKNGGNMGVNGSVAYMFDATAVIGLEGKTSDEVLEILMEADVDARDILE
FT                   EEDAVIVYAEPDQFHAVQSALKDAGVEEFTVAELTMLAQNDVTLPEDAQAQFEKMVDAL
FT                   EDLEDVQQVYHNVDLGE"
FT   gene            612498..612959
FT                   /locus_tag="BCE_0596"
FT                   /old_locus_tag="BCE0596"
FT   CDS_pept        612498..612959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0596"
FT                   /old_locus_tag="BCE0596"
FT                   /product="mutT/nudix family protein"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39531"
FT                   /db_xref="GOA:Q73DW4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q73DW4"
FT                   /protein_id="AAS39531.1"
FT                   /translation="MEHKTPKHIVAVAGYLTNEKDEVLLAKVHWRSDTWELPGGQVEEG
FT                   EALDQAICREIKEETGLTVKPIGITGVYYNASMHILAVVFKVAYVSGEIQIQPEEIQEA
FT                   KFVALNEENIDEYITRPHMKSRTLDAMRATHCIPYETWEVQPYNLIGRL"
FT   gene            613446..614222
FT                   /locus_tag="BCE_0597"
FT                   /old_locus_tag="BCE0597"
FT   CDS_pept        613446..614222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0597"
FT                   /old_locus_tag="BCE0597"
FT                   /product="penicillin-binding domain protein"
FT                   /note="identified by match to protein family HMM PF00912"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0597"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39532"
FT                   /db_xref="GOA:Q73DW3"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q73DW3"
FT                   /protein_id="AAS39532.1"
FT                   /translation="MKERVLSRVNYHQKVALNPMTKFLYKAIILLLLLSFALLFIGNVM
FT                   IEKSDISKLHVPAKLEVPESLTHAFIATEDKRFYHHNGLDYIAIIRASVENIKAGGVVQ
FT                   GGSTITQQLSKNAFLTNERTFSRKWKEIFYTKKIERTFTKDEILKLYVSNIYYGEGAWG
FT                   IEKAANLYFGKKVSQLTLAESAMMAAVVKAPAYYSPVQNYDKAVERRNVVLRLMEKEGY
FT                   INHDEYVQAVSEKLVIRHDIKTEQSMLNSAREKAVS"
FT   gene            614411..615064
FT                   /locus_tag="BCE_0598"
FT                   /old_locus_tag="BCE0598"
FT   CDS_pept        614411..615064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0598"
FT                   /old_locus_tag="BCE0598"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01323"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39533"
FT                   /db_xref="GOA:Q73DW2"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q73DW2"
FT                   /protein_id="AAS39533.1"
FT                   /translation="MKSSNKLMALGIVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYST
FT                   QQSLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDS
FT                   DLGAAAGEAIYKQDKDSFWTFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKVDVDQFK
FT                   KDLHSKEIKEKVRKDSDRAQKLKVQGAPSVYINGNLANPDFDSMKKAIDKELKK"
FT   gene            615179..615252
FT                   /locus_tag="BCE_5686"
FT                   /old_locus_tag="BCE5686"
FT                   /note="tRNA-Gly"
FT   tRNA            615179..615252
FT                   /locus_tag="BCE_5686"
FT                   /old_locus_tag="BCE5686"
FT                   /product="tRNA-Gly"
FT   gene            615281..615400
FT                   /locus_tag="BCE_0599"
FT                   /old_locus_tag="BCE0599"
FT   CDS_pept        615281..615400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0599"
FT                   /old_locus_tag="BCE0599"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39534"
FT                   /db_xref="UniProtKB/TrEMBL:Q73DW1"
FT                   /protein_id="AAS39534.1"
FT                   /translation="MINAVFRFRDKRGIAFFNVWKTVFYAKIEVKNSIPKVNC"
FT   gene            615451..616593
FT                   /locus_tag="BCE_0600"
FT                   /old_locus_tag="BCE0600"
FT   CDS_pept        615451..616593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0600"
FT                   /old_locus_tag="BCE0600"
FT                   /product="iron-sulfur cluster-binding protein, putative"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF03130; match to protein
FT                   family HMM TIGR00276"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39535"
FT                   /db_xref="GOA:Q73DW0"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q73DW0"
FT                   /protein_id="AAS39535.1"
FT                   /translation="MDFEQLKQDVIAYSKTIGIDKIGFASASPFEELKQRLIQQQQLNY
FT                   QSGFEEPDIEKRTNPQLLLPGAKSIIAIALAYPSKLKNAPLSKRGERRGIFCRASWGQD
FT                   YHLVLRDRLQKLEAYLIEKLPDIEVKSMVDTGELSDRAVSERAGIGWSGKNCSIITPEF
FT                   GSYVYLGEMITNVPFPPDQPIEDQCGSCTKCIDICPTGALIQGGQLDSKKCIAFLTQTK
FT                   GFLPEEYRDKIGNRIYGCDTCQTVCPKNKGMDFHNHPEMEPDPELVKPLLTPLLTISNR
FT                   DFKEKYGIMSGSWRGKKPLQRNAILALAHFKEASAIPDLIGVMKDDPRPVLRGTAAWAL
FT                   GKIGGDGVGEAIEKAMQREKDEEVLHEMNRGLELLAQKKE"
FT   gene            616638..617525
FT                   /locus_tag="BCE_0601"
FT                   /old_locus_tag="BCE0601"
FT   CDS_pept        616638..617525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0601"
FT                   /old_locus_tag="BCE0601"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39536"
FT                   /db_xref="InterPro:IPR024301"
FT                   /db_xref="UniProtKB/TrEMBL:Q73DV9"
FT                   /protein_id="AAS39536.1"
FT                   /translation="MVVKINIEKQVQHFLAYITEKRTNVDGIAEDLLQIAKRKKQLFQK
FT                   RNAEIVKATADVSFMRQFNNSNHQEIDYQIHFKYLIKHKELFYIEEEQLKRRVCLNNSR
FT                   IIGDYAIEVPEAVGMSETLEREVTKEKYGSYQYNRLEAVKYAERWWDDRNPAYRNFPDN
FT                   CTNFISQCLHTGEVPMNGYPNIRKGWWQRENQWSWSWAVAHSFYWYLSGATSGLRAEAV
FT                   ERPEDLILGDVIAYDFEDDGRWNHTTIVVAKDADGMPLVNAHSANSRRRYWNYEDSSKY
FT                   TPQMKYKFFHIING"
FT   gene            617584..618072
FT                   /locus_tag="BCE_0602"
FT                   /old_locus_tag="BCE0602"
FT   CDS_pept        617584..618072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0602"
FT                   /old_locus_tag="BCE0602"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /note="identified by match to protein family HMM PF00588;
FT                   match to protein family HMM TIGR00185"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0602"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39537"
FT                   /db_xref="GOA:Q73DV8"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q73DV8"
FT                   /protein_id="AAS39537.1"
FT                   /translation="MGVHVVLYQPEIPANTGNIARTCAATGTELHLIRPLGFSTDDKML
FT                   KRAGLDYWQHVKITYYDSIEEFYEKNKDGEFFYLTKYGEKAHTAFDYSKREKDYYFVFG
FT                   RETNGLPANVIEENFDHCLRIPMTDKVRSLNLSNTAAILIYEAFRQQNYPGLDLEIVY"
FT   gene            618202..620310
FT                   /locus_tag="BCE_0603"
FT                   /old_locus_tag="BCE0603"
FT   CDS_pept        618202..620310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0603"
FT                   /old_locus_tag="BCE0603"
FT                   /product="sensory box/GGDEF family protein"
FT                   /note="identified by match to protein family HMM PF00563;
FT                   match to protein family HMM PF00785; match to protein
FT                   family HMM PF00989; match to protein family HMM PF00990;
FT                   match to protein family HMM TIGR00229; match to protein
FT                   family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0603"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39538"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q73DV7"
FT                   /protein_id="AAS39538.1"
FT                   /translation="MKEQYRNQNTFLSMIDMDLIRRGLLHAIQDLVFIVKVMDDETFTY
FT                   IYVNKIGMDYAKLSEECYGKTFSEVLPKDTAEILQVQYAKVASEVKAHTFCDVVSLPTG
FT                   NLHYESSLNPVFDEEGVCQFIICITRDITAQIEEKIEIEEKQMLFKSLLEYNNDSIISI
FT                   DSIGRITYANPATYEIFGYRYEELNNKFIFEFINKEYEKDFQSIFKGSMQGKAKQIVSK
FT                   KYIHKEGYELYISLRTIPIIVNGEIVGVYIVTRDVTRQVLNEMRTEYLAYYDQLTGLMN
FT                   RISCANKLNTLLNDNIEFALVFIDLDEFHLINDTFGHKEGDKVLQKVTECLSSFEIAGM
FT                   HLFREHDDQFVMLIENITKERVEGVAKNILKRISEHFVIEEEDVYLSASIGIVMAPTDG
FT                   EDEKILFQRVDAALEKAKEKGKGHYALEKAKEKGKGHYHFYCSGLDCEREQRFIIENQL
FT                   HRAIEKNEFFLYYQPQINIETKKIASMEALIRWENKELGFVSPNQFIPLAERTGFIIKL
FT                   DEWVVNEVCRQIREWLNKGYEVVPIAVNISARHFRSITLIEMITRALHKYNVPAHLLAI
FT                   EVTEGALIHKDISKRVLLQLKEQNLKIHLDDFGTGYSSLSYLKTYPIDTLKIDRSFMEG
FT                   IHVDERDTNITAAIIHLAHTLELNVIAEGVEKAEQIQFLKEKNVKFVQGYYYSRPLSKY
FT                   DVENVYYK"
FT   gene            complement(620343..620438)
FT                   /locus_tag="BCE_0604"
FT                   /old_locus_tag="BCE0604"
FT   CDS_pept        complement(620343..620438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0604"
FT                   /old_locus_tag="BCE0604"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39539"
FT                   /db_xref="UniProtKB/TrEMBL:Q73DV6"
FT                   /protein_id="AAS39539.1"
FT                   /translation="MKLLLILGVSLTFLTAIFTSGYNDKPGTHKK"
FT   gene            620703..622598
FT                   /locus_tag="BCE_0605"
FT                   /old_locus_tag="BCE0605"
FT   CDS_pept        620703..622598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0605"
FT                   /old_locus_tag="BCE0605"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0605"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39540"
FT                   /db_xref="GOA:Q73DV5"
FT                   /db_xref="InterPro:IPR010650"
FT                   /db_xref="InterPro:IPR013153"
FT                   /db_xref="InterPro:IPR016230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q73DV5"
FT                   /protein_id="AAS39540.1"
FT                   /translation="MDILKKIEQHREAEERLQWEGTFAEYLELVKERPWVAQTAHSRIY
FT                   NMIKDAGIEEVDGRRKYNFFSNQLFGLEDALERLVEEYFHPSAKRLDVRKRILLLMGPV
FT                   SGGKSTLVTMLKRGLETYSRTDRGAIFAIKGCPMHEDPLHLIPHHLRDDFFDEYGVRIE
FT                   GNLSPLNVMRLEQEYGSRIEDVVVERIFFSEDRRTGIGTFSPSDPKSQDIADLTGSLDF
FT                   STIAEYGSESDPRAYRFDGELNKANRGMMEFQEMLKCDEKFLWHLLSLTQEGNFKAGRF
FT                   ALISADELIVAHTNETEYRSFIANKKNEALHSRIIVMPVPYNLRVSEEEHIYEKMIRES
FT                   DVSNVHIAPHTLRVAAMFTILTRLKDPKRPDIDLIKKMRLYDGETVEGYNAIDVEELQR
FT                   EYQDEGMSGIDPRYVINRISSTIIRKEVPSINALDVLRSLKDGLDQHPSISNEDRERYM
FT                   NFISLARKEYDEIAKKEVQKAFVYSYEESAKTLMDNYLDNVEAYCNKSKLRDPLTGEEM
FT                   SPDEKLMRSIEEQIGISENAKKAFREEILIRISAYARKGKRFDYNSHERLREAIQKKLF
FT                   ADLKDIVKITTSTKTPDENQLKKINDVVARLIDEHGYNSSSANELLRYVGSLLNR"
FT   gene            623046..624221
FT                   /locus_tag="BCE_0606"
FT                   /old_locus_tag="BCE0606"
FT   CDS_pept        623046..624221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0606"
FT                   /old_locus_tag="BCE0606"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04285"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39541"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="InterPro:IPR014230"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73DV4"
FT                   /protein_id="AAS39541.1"
FT                   /translation="MGEENQPNYTISQENWSLHRKGYDDQQRHQEKVQEAIKNNLPDLV
FT                   TEESIVMSNGKDVVKIPIRSLDEYKIRYNYDKNKHVGQGNGDSKVGDVVARDGSGGQKQ
FT                   KGPGKGQGAGDAAGEDYYEAEVSILELEQAFFKELELPNLKRKEMDENRIEHVEFNDIR
FT                   KTGLWGNIDKKRTMISAYKRNAMRGKASFHPIHQEDLKFRTWNEVLKPDSKAVVLAMMD
FT                   TSGSMGIWEKYMARSFFFWMTRFLRTKYETVDIEFIAHHTEAKVVPEEEFFSKGESGGT
FT                   ICSSVYKKALELIDNKYSPDRYNIYPFHFSDGDNLTSDNARCVKLVEELMKKCNMFGYG
FT                   EVNQYNRHSTLMSAYKNIKDENFRYYILKQKADVFHAMKSFFREESGEKMA"
FT   gene            624479..627745
FT                   /locus_tag="BCE_0607"
FT                   /old_locus_tag="BCE0607"
FT   CDS_pept        624479..627745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCE_0607"
FT                   /old_locus_tag="BCE0607"
FT                   /product="internalin, putative"
FT                   /note="identified by match to protein family HMM PF00560;
FT                   match to protein family HMM PF00746; match to protein
FT                   family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:BCE_0607"
FT                   /db_xref="EnsemblGenomes-Tr:AAS39542"
FT                   /db_xref="GOA:Q73DV3"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR006635"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR037250"
FT                   /db_xref="UniProtKB/TrEMBL:Q73DV3"
FT                   /protein_id="AAS39542.1"
FT                   /translation="MKNNKRKHINAMLIAATLSLPFATYSTPALAAVVSEVNKAGHILK
FT                   DGTYDVVLKAYNEKTNEESRATTYIKEPKVTIENGKKIVTATLNDSDFFQYLKVEDSQN
FT                   PGTLHDVKVLSEDKRKNGTKVIQFEIGELGKRYKMQMHIFIPSMGYDEKYQVQFEVNTV
FT                   HSENNTIEESKEKKEEQQQVKNIISDNKLQQYINKSVLQRADINAPITEEDAAQIKELK
FT                   VYLGKGIESLEGLQYMENLEAFELHESNVKDISPISSLKKLKTMKLYLNPIENIAPISQ
FT                   LEKLQFLTLRDNKISDLTPLSQLKKVKVLDLIGNEITDIKPLFSMDSVTKLYLSNNKIS
FT                   DLTDIEKLDDLRLLWIGNNYIDNLTEIGKLKNLVELEVANAEIRDLTPLAKMQQLQSLD
FT                   LEQNYISDISPISKLNNLYALNLIANEIRDIRPVKELGKRVPIKLQRQKIFLSDGVVNE
FT                   DIKIPIYDSNGEIVQNIKWQGEEGTLNNGSVKWNSTGEKVYEFKLETDSAESQILFNGT
FT                   VYQNIVEKH