(data stored in ACNUC7421 zone)

EMBL: AE017196

ID   AE017196; SV 1; circular; genomic DNA; STD; PRO; 1267782 BP.
XX
AC   AE017196; AE017256-AE017260;
XX
PR   Project:PRJNA272;
XX
DT   22-DEC-2005 (Rel. 86, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Wolbachia endosymbiont of Drosophila melanogaster, complete genome.
XX
KW   .
XX
OS   Wolbachia endosymbiont of Drosophila melanogaster
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales;
OC   Anaplasmataceae; Wolbachieae; Wolbachia.
XX
RN   [1]
RP   1-1267782
RX   DOI; 10.1371/journal.pbio.0020069.
RX   PUBMED; 15024419.
RA   Wu M., Sun L.V., Vamathevan J., Riegler M., Deboy R., Brownlie J.C.,
RA   McGraw E.A., Martin W., Esser C., Ahmadinejad N., Wiegand C., Madupu R.,
RA   Beanan M.J., Brinkac L.M., Daugherty S.C., Durkin A.S., Kolonay J.F.,
RA   Nelson W.C., Mohamoud Y., Lee P., Berry K., Young M.B., Utterback T.,
RA   Weidman J., Nierman W.C., Paulsen I.T., Nelson K.E., Tettelin H.,
RA   O'Neill S.L., Eisen J.A.;
RT   "Phylogenomics of the reproductive parasite Wolbachia pipientis wMel: a
RT   streamlined genome overrun by mobile genetic elements";
RL   PLoS Biol. 2(3):E69-E69(2004).
XX
RN   [2]
RP   1-1267782
RA   Wu M., Sun L., Vamathevan J., Riegler M., DeBoy R.T., Brownlie J.,
RA   McGraw E., Mohamoud Y., Lee C., Berry K., Khouri H.M., Paulsen I.T.,
RA   Nelson K.E., Martin W., Esser C., Ahmadinejad N., Wiegand C., Durkin A.S.,
RA   Nelson W.C., Beanan M.J., Brinkac L.M., Daugherty S.C., Dodson R.J.,
RA   Gwinn M., Kolonay J.F., Madupu R., Craven M.B., Utterback T.R., Weidman J.,
RA   Nierman W.C., Van Aken S., Tettelin H., O'Neill S., Eisen J.A.;
RT   ;
RL   Submitted (17-NOV-2003) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
DR   MD5; 601428ffeccf9f76afb97cdc9f74bf03.
DR   BioSample; SAMN02604000.
DR   EnsemblGenomes-Gn; EBG00001176134.
DR   EnsemblGenomes-Gn; EBG00001176136.
DR   EnsemblGenomes-Gn; EBG00001176137.
DR   EnsemblGenomes-Gn; EBG00001176139.
DR   EnsemblGenomes-Gn; EBG00001176141.
DR   EnsemblGenomes-Gn; EBG00001176142.
DR   EnsemblGenomes-Gn; EBG00001176144.
DR   EnsemblGenomes-Gn; EBG00001176145.
DR   EnsemblGenomes-Gn; EBG00001176147.
DR   EnsemblGenomes-Gn; EBG00001176150.
DR   EnsemblGenomes-Gn; EBG00001176151.
DR   EnsemblGenomes-Gn; EBG00001176153.
DR   EnsemblGenomes-Gn; EBG00001176155.
DR   EnsemblGenomes-Gn; EBG00001176157.
DR   EnsemblGenomes-Gn; EBG00001176158.
DR   EnsemblGenomes-Gn; EBG00001176160.
DR   EnsemblGenomes-Gn; EBG00001176162.
DR   EnsemblGenomes-Gn; EBG00001176163.
DR   EnsemblGenomes-Gn; EBG00001176165.
DR   EnsemblGenomes-Gn; EBG00001176166.
DR   EnsemblGenomes-Gn; EBG00001176168.
DR   EnsemblGenomes-Gn; EBG00001176170.
DR   EnsemblGenomes-Gn; EBG00001176172.
DR   EnsemblGenomes-Gn; EBG00001176173.
DR   EnsemblGenomes-Gn; EBG00001176175.
DR   EnsemblGenomes-Gn; EBG00001176178.
DR   EnsemblGenomes-Gn; EBG00001176180.
DR   EnsemblGenomes-Gn; EBG00001176182.
DR   EnsemblGenomes-Gn; EBG00001176183.
DR   EnsemblGenomes-Gn; EBG00001176184.
DR   EnsemblGenomes-Gn; EBG00001176185.
DR   EnsemblGenomes-Gn; EBG00001176186.
DR   EnsemblGenomes-Gn; EBG00001176187.
DR   EnsemblGenomes-Gn; EBG00001176188.
DR   EnsemblGenomes-Gn; EBG00001176189.
DR   EnsemblGenomes-Gn; EBG00001176190.
DR   EnsemblGenomes-Gn; EBG00001176191.
DR   EnsemblGenomes-Gn; EBG00001176192.
DR   EnsemblGenomes-Gn; EBG00001176193.
DR   EnsemblGenomes-Gn; EBG00001176194.
DR   EnsemblGenomes-Gn; EBG00001176195.
DR   EnsemblGenomes-Gn; EBG00001176196.
DR   EnsemblGenomes-Gn; WD_Wp16SA.
DR   EnsemblGenomes-Gn; WD_Wp23SB.
DR   EnsemblGenomes-Gn; WD_Wp5SC.
DR   EnsemblGenomes-Gn; WD_tRNA-Ala-1.
DR   EnsemblGenomes-Gn; WD_tRNA-Arg-1.
DR   EnsemblGenomes-Gn; WD_tRNA-Arg-2.
DR   EnsemblGenomes-Gn; WD_tRNA-Arg-3.
DR   EnsemblGenomes-Gn; WD_tRNA-Arg-4.
DR   EnsemblGenomes-Gn; WD_tRNA-Asn-1.
DR   EnsemblGenomes-Gn; WD_tRNA-Asp-1.
DR   EnsemblGenomes-Gn; WD_tRNA-Cys-1.
DR   EnsemblGenomes-Gn; WD_tRNA-Gln-1.
DR   EnsemblGenomes-Gn; WD_tRNA-Glu-1.
DR   EnsemblGenomes-Gn; WD_tRNA-Gly-1.
DR   EnsemblGenomes-Gn; WD_tRNA-Gly-2.
DR   EnsemblGenomes-Gn; WD_tRNA-His-1.
DR   EnsemblGenomes-Gn; WD_tRNA-Ile-1.
DR   EnsemblGenomes-Gn; WD_tRNA-Leu-1.
DR   EnsemblGenomes-Gn; WD_tRNA-Leu-2.
DR   EnsemblGenomes-Gn; WD_tRNA-Leu-3.
DR   EnsemblGenomes-Gn; WD_tRNA-Leu-4.
DR   EnsemblGenomes-Gn; WD_tRNA-Leu-5.
DR   EnsemblGenomes-Gn; WD_tRNA-Lys-1.
DR   EnsemblGenomes-Gn; WD_tRNA-Met-1.
DR   EnsemblGenomes-Gn; WD_tRNA-Met-2.
DR   EnsemblGenomes-Gn; WD_tRNA-Met-3.
DR   EnsemblGenomes-Gn; WD_tRNA-Phe-1.
DR   EnsemblGenomes-Gn; WD_tRNA-Pro-1.
DR   EnsemblGenomes-Gn; WD_tRNA-Ser-1.
DR   EnsemblGenomes-Gn; WD_tRNA-Ser-2.
DR   EnsemblGenomes-Gn; WD_tRNA-Ser-3.
DR   EnsemblGenomes-Gn; WD_tRNA-Thr-1.
DR   EnsemblGenomes-Gn; WD_tRNA-Thr-2.
DR   EnsemblGenomes-Gn; WD_tRNA-Trp-1.
DR   EnsemblGenomes-Gn; WD_tRNA-Tyr-1.
DR   EnsemblGenomes-Gn; WD_tRNA-Val-1.
DR   EnsemblGenomes-Gn; WD_tRNA-Val-2.
DR   EnsemblGenomes-Tr; EBT00001754315.
DR   EnsemblGenomes-Tr; EBT00001754317.
DR   EnsemblGenomes-Tr; EBT00001754318.
DR   EnsemblGenomes-Tr; EBT00001754321.
DR   EnsemblGenomes-Tr; EBT00001754325.
DR   EnsemblGenomes-Tr; EBT00001754327.
DR   EnsemblGenomes-Tr; EBT00001754330.
DR   EnsemblGenomes-Tr; EBT00001754333.
DR   EnsemblGenomes-Tr; EBT00001754336.
DR   EnsemblGenomes-Tr; EBT00001754341.
DR   EnsemblGenomes-Tr; EBT00001754343.
DR   EnsemblGenomes-Tr; EBT00001754345.
DR   EnsemblGenomes-Tr; EBT00001754349.
DR   EnsemblGenomes-Tr; EBT00001754352.
DR   EnsemblGenomes-Tr; EBT00001754354.
DR   EnsemblGenomes-Tr; EBT00001754357.
DR   EnsemblGenomes-Tr; EBT00001754362.
DR   EnsemblGenomes-Tr; EBT00001754363.
DR   EnsemblGenomes-Tr; EBT00001754368.
DR   EnsemblGenomes-Tr; EBT00001754371.
DR   EnsemblGenomes-Tr; EBT00001754374.
DR   EnsemblGenomes-Tr; EBT00001754376.
DR   EnsemblGenomes-Tr; EBT00001754379.
DR   EnsemblGenomes-Tr; EBT00001754384.
DR   EnsemblGenomes-Tr; EBT00001754388.
DR   EnsemblGenomes-Tr; EBT00001754391.
DR   EnsemblGenomes-Tr; EBT00001754394.
DR   EnsemblGenomes-Tr; EBT00001754402.
DR   EnsemblGenomes-Tr; EBT00001754406.
DR   EnsemblGenomes-Tr; EBT00001754408.
DR   EnsemblGenomes-Tr; EBT00001754410.
DR   EnsemblGenomes-Tr; EBT00001754412.
DR   EnsemblGenomes-Tr; EBT00001754414.
DR   EnsemblGenomes-Tr; EBT00001754416.
DR   EnsemblGenomes-Tr; EBT00001754418.
DR   EnsemblGenomes-Tr; EBT00001754419.
DR   EnsemblGenomes-Tr; EBT00001754421.
DR   EnsemblGenomes-Tr; EBT00001754424.
DR   EnsemblGenomes-Tr; EBT00001754426.
DR   EnsemblGenomes-Tr; EBT00001754428.
DR   EnsemblGenomes-Tr; EBT00001754429.
DR   EnsemblGenomes-Tr; EBT00001754431.
DR   EnsemblGenomes-Tr; WD_Wp16SA-1.
DR   EnsemblGenomes-Tr; WD_Wp23SB-1.
DR   EnsemblGenomes-Tr; WD_Wp5SC-1.
DR   EnsemblGenomes-Tr; WD_tRNA-Ala-1-1.
DR   EnsemblGenomes-Tr; WD_tRNA-Arg-1-1.
DR   EnsemblGenomes-Tr; WD_tRNA-Arg-2-1.
DR   EnsemblGenomes-Tr; WD_tRNA-Arg-3-1.
DR   EnsemblGenomes-Tr; WD_tRNA-Arg-4-1.
DR   EnsemblGenomes-Tr; WD_tRNA-Asn-1-1.
DR   EnsemblGenomes-Tr; WD_tRNA-Asp-1-1.
DR   EnsemblGenomes-Tr; WD_tRNA-Cys-1-1.
DR   EnsemblGenomes-Tr; WD_tRNA-Gln-1-1.
DR   EnsemblGenomes-Tr; WD_tRNA-Glu-1-1.
DR   EnsemblGenomes-Tr; WD_tRNA-Gly-1-1.
DR   EnsemblGenomes-Tr; WD_tRNA-Gly-2-1.
DR   EnsemblGenomes-Tr; WD_tRNA-His-1-1.
DR   EnsemblGenomes-Tr; WD_tRNA-Ile-1-1.
DR   EnsemblGenomes-Tr; WD_tRNA-Leu-1-1.
DR   EnsemblGenomes-Tr; WD_tRNA-Leu-2-1.
DR   EnsemblGenomes-Tr; WD_tRNA-Leu-3-1.
DR   EnsemblGenomes-Tr; WD_tRNA-Leu-4-1.
DR   EnsemblGenomes-Tr; WD_tRNA-Leu-5-1.
DR   EnsemblGenomes-Tr; WD_tRNA-Lys-1-1.
DR   EnsemblGenomes-Tr; WD_tRNA-Met-1-1.
DR   EnsemblGenomes-Tr; WD_tRNA-Met-2-1.
DR   EnsemblGenomes-Tr; WD_tRNA-Met-3-1.
DR   EnsemblGenomes-Tr; WD_tRNA-Phe-1-1.
DR   EnsemblGenomes-Tr; WD_tRNA-Pro-1-1.
DR   EnsemblGenomes-Tr; WD_tRNA-Ser-1-1.
DR   EnsemblGenomes-Tr; WD_tRNA-Ser-2-1.
DR   EnsemblGenomes-Tr; WD_tRNA-Ser-3-1.
DR   EnsemblGenomes-Tr; WD_tRNA-Thr-1-1.
DR   EnsemblGenomes-Tr; WD_tRNA-Thr-2-1.
DR   EnsemblGenomes-Tr; WD_tRNA-Trp-1-1.
DR   EnsemblGenomes-Tr; WD_tRNA-Tyr-1-1.
DR   EnsemblGenomes-Tr; WD_tRNA-Val-1-1.
DR   EnsemblGenomes-Tr; WD_tRNA-Val-2-1.
DR   EuropePMC; PMC1428390; 16547041.
DR   EuropePMC; PMC1574309; 16869956.
DR   EuropePMC; PMC2234260; 17900339.
DR   EuropePMC; PMC2374166; 18259058.
DR   EuropePMC; PMC2447017; 18502862.
DR   EuropePMC; PMC2786583; 19946141.
DR   EuropePMC; PMC2825951; 20065028.
DR   EuropePMC; PMC3214167; 22024028.
DR   EuropePMC; PMC3287510; 22375894.
DR   EuropePMC; PMC3490692; 22586066.
DR   EuropePMC; PMC3527207; 23284297.
DR   EuropePMC; PMC3584025; 23460918.
DR   EuropePMC; PMC3589621; 23482460.
DR   EuropePMC; PMC368164; 15024419.
DR   EuropePMC; PMC3839904; 24282596.
DR   EuropePMC; PMC3840789; 24302569.
DR   EuropePMC; PMC3861217; 24348259.
DR   EuropePMC; PMC3998919; 24763283.
DR   EuropePMC; PMC4005148; 24118111.
DR   EuropePMC; PMC4201733; 25311369.
DR   EuropePMC; PMC4224334; 25230723.
DR   EuropePMC; PMC4331666; 25717372.
DR   EuropePMC; PMC4526672; 26244782.
DR   EuropePMC; PMC4675112; 26664808.
DR   EuropePMC; PMC4916391; 27329757.
DR   EuropePMC; PMC4958246; 27381293.
DR   EuropePMC; PMC5062602; 27727237.
DR   EuropePMC; PMC5100849; 27613752.
DR   EuropePMC; PMC5114691; 27895897.
DR   EuropePMC; PMC5487579; 28446677.
DR   EuropePMC; PMC5742604; 28702705.
DR   EuropePMC; PMC5793819; 29351633.
DR   EuropePMC; PMC6045589; 30006543.
DR   EuropePMC; PMC6083246; 30051873.
DR   EuropePMC; PMC6258568; 30422992.
DR   EuropePMC; PMC6293665; 30545384.
DR   EuropePMC; PMC6391860; 30813886.
DR   EuropePMC; PMC6450060; 30950399.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02005; group-II-D1D4-6.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   SILVA-LSU; AE017196.
DR   SILVA-SSU; AE017196.
XX
CC   On or before Dec 20, 2005 this sequence version replaced
CC   gi:42409657, gi:42409902, gi:42410136, gi:42410393, gi:42410633.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1267782
FT                   /organism="Wolbachia endosymbiont of Drosophila
FT                   melanogaster"
FT                   /host="Drosophila melanogaster"
FT                   /strain="wMel"
FT                   /mol_type="genomic DNA"
FT                   /note="Wolbachia pipientis wMel"
FT                   /db_xref="taxon:163164"
FT   gene            153..1535
FT                   /gene="dnaA"
FT                   /locus_tag="WD_0001"
FT                   /old_locus_tag="WD0001"
FT   CDS_pept        153..1535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="WD_0001"
FT                   /old_locus_tag="WD0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="Identified by similarity to GP:5702042; match to
FT                   PF00308 protein family HMM PF00308; match to TIGR00362
FT                   protein family HMM TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13770"
FT                   /db_xref="GOA:Q73IZ0"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73IZ0"
FT                   /protein_id="AAS13770.1"
FT                   /translation="MNLTSPKVSTMFFDQIITVTDHNVTWEKIQNCLYNLYGEATYNSW
FT                   LSSLKFVSSRNGEVLLSVSTRFIKEWITVHYMKKILSLWQSEDKSIRSIDIQVIEERNS
FT                   NFNVILKNREESNHNLGSPLDPRFTFDNFVVGKPNELAFTAAKRVAESIDPILGSNPLF
FT                   LYGGVGLGKTHLMHAIAWHIVNSPSAKRKVVYLSAEKFMYQYITALRSKDIMLFKEQFR
FT                   SVDVLMVDDVQFISGKDSTQEEFFHTFNALIDQNKQLVISADRSPSDLDGVEERIKSRL
FT                   GWGLVADINETTFELRLGILQAKVEQMNMYVPKDVLEFLARNIKSNIRELEGALNKVTH
FT                   TSLIGRSMTVESASETLIDLLRSNHRSVTIEEIQKKVAEFFNIKVADMQSNRRLRSLAR
FT                   PRQIAMYFAKKFTQKSLPDIGRNFGGRDHATVIHAVKQVENFIKTDSKFADEINRLKKM
FT                   FK"
FT   gene            complement(1563..2837)
FT                   /pseudo
FT                   /locus_tag="WD_0002"
FT                   /old_locus_tag="WD0002"
FT                   /note="Ser/Thr protein phosphatase family protein,
FT                   authentic frameshift; This gene contains a frame shift
FT                   which is not the result of sequencing error.Identified by
FT                   similarity to GB:CAB52257.1; match to PF00149 protein
FT                   family HMM PF00149"
FT   gene            3028..3115
FT                   /locus_tag="WD_tRNA-Leu-1"
FT                   /old_locus_tag="tRNA-Leu-1"
FT   tRNA            3028..3115
FT                   /locus_tag="WD_tRNA-Leu-1"
FT                   /old_locus_tag="tRNA-Leu-1"
FT                   /product="tRNA-Leu"
FT   gene            3145..4227
FT                   /gene="ribA"
FT                   /locus_tag="WD_0003"
FT                   /old_locus_tag="WD0003"
FT   CDS_pept        3145..4227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribA"
FT                   /locus_tag="WD_0003"
FT                   /old_locus_tag="WD0003"
FT                   /product="GTP cyclohydrolase II"
FT                   /note="Identified by similarity to GP:5702044; match to
FT                   PF00925 protein family HMM PF00925"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13771"
FT                   /db_xref="GOA:Q73IY9"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IY9"
FT                   /protein_id="AAS13771.1"
FT                   /translation="MFIGNQSSNKVERAISEIRRGRPIVIYDESNYLLFAAAEALERDL
FT                   FNQYKLTSSNVYVTLTSSKVKYISQNKEHNSKRLLVNNFDELLYLINCSKEDCIKELQC
FT                   SKTIDECAIALLKFSELLPYALVADMTFENNHEMRNWCEKNDVIALDTSFINNFQENQD
FT                   VYEVCKTSLFLKQTQEVNIISYRTESGGREHHAIIIGNPDKDDEPLVRIHSSCYTGDLL
FT                   DSLSCDCRSQLHQAIQMIADSGSGIILYLMQDGRGIGLTNKLRAYSMQRGHNLDTVDAN
FT                   RILGFEDDERSFAVAAKMLKKLNINKIQLLTNNDRKLSELESSGIGVTKCLPLIVERNK
FT                   YNDSYMETKFGKLGHRLRVF"
FT   gene            4300..4980
FT                   /locus_tag="WD_0004"
FT                   /old_locus_tag="WD0004"
FT   CDS_pept        4300..4980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0004"
FT                   /old_locus_tag="WD0004"
FT                   /product="type IV secretion system protein VirB8"
FT                   /note="Identified by similarity to GP:8885497; match to
FT                   PF04335 protein family HMM PF04335"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13772"
FT                   /db_xref="GOA:Q73IY8"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR026264"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IY8"
FT                   /protein_id="AAS13772.1"
FT                   /translation="MLRFFKREKNTESLDKDINWNSNRYSTVIAQRNILLLFALILLAT
FT                   ISISILVIFKISTSSTIEPFVIEIDKKSGIVQLVDPVTVKQYSADEALNDYFISEYIKA
FT                   REVFDPYHYNYNYYTKVRLFSSPDVYNEFRNYVGSQNMDDLFNLYSDTKSEFKIRSIQK
FT                   LGNDALQVRFFVEFTRKDGSSTRKNKIVIMSYRYASLEMDNQQRYINPLGFQVISYRVD
FT                   DEYV"
FT   gene            4973..5767
FT                   /locus_tag="WD_0005"
FT                   /old_locus_tag="WD0005"
FT   CDS_pept        4973..5767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0005"
FT                   /old_locus_tag="WD0005"
FT                   /product="type IV secretion system protein VirB9"
FT                   /note="Identified by similarity to GP:8885498; match to
FT                   PF03524 protein family HMM PF03524"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13773"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR014148"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="InterPro:IPR038161"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IY7"
FT                   /protein_id="AAS13773.1"
FT                   /translation="MYRILLVLALLVSGNLNASINYNEPISIDSRIKTFVYSPNEVFTV
FT                   VFSQGYYSYIEFAEGEKVKNIAVGDASSWKINPYDNKLLIMPFEVSSRTNMIITTTKKR
FT                   NYIFDLISRPNYDKYPDTDAKKVDHDYSAEKDISYVVRFYYPQEEGEFDVDLDEVSLPT
FT                   QMQYTTDKLEKIIQENDTKYNYTYIDEGGNADIVPIELFDDGYLTYLKFRNNNKIPQVF
FT                   VEGEDKPCKRLLFGDYVIIKGVHKKLFMRYEDGEVEIINRSL"
FT   gene            5784..7244
FT                   /locus_tag="WD_0006"
FT                   /old_locus_tag="WD0006"
FT   CDS_pept        5784..7244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0006"
FT                   /old_locus_tag="WD0006"
FT                   /product="type IV secretion system protein VirB10"
FT                   /note="Identified by similarity to GP:8885499; match to
FT                   PF03743 protein family HMM PF03743"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13774"
FT                   /db_xref="GOA:Q73IY6"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IY6"
FT                   /protein_id="AAS13774.1"
FT                   /translation="MNKERRNNSEDESEIENKVVTVGSNQGHRALMVIILVLLAGGVYY
FT                   LYFSPSPKEGSEVIKKEETKQNVQELKGKLEQVPDNVMVPERIITDPLPPLPPLPTPLI
FT                   IPEIKQIRKEEVMKKEEEKPKETPVSNIPILPKQNFPSSNVMGNLPTSFPTIGGGGYPR
FT                   DRRSAQMLTISGGSGENKAADAILSDTSAQSSKATRVGKLGLMITQGKIIDAVLETAIN
FT                   SDLQGMLRAMVSRDVYAETGDTVLIPKGSRLIGSYSFDSNVAKSRVNINWNRVILPHGI
FT                   DIAISSLSTDELGRAGIAGIVDNKIVSALFSSVTLAGVSIGSAVIGQKASNLVDTLTVR
FT                   DAVKSITATEIDFSSLQLIIDPEKKISSDKWKLGLGAIGRIRSAKSRQDLLKIMKEEIA
FT                   KALGIEEDEVNISLEIVNQLLEQIQRKSKSVYDEAIGKSIEDFSKDMRDVVGRYTDKKP
FT                   TIYVDQGTALKVFVNQDIVFPPQAILNQ"
FT   gene            7246..8238
FT                   /locus_tag="WD_0007"
FT                   /old_locus_tag="WD0007"
FT   CDS_pept        7246..8238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0007"
FT                   /old_locus_tag="WD0007"
FT                   /product="type IV secretion system protein VirB11"
FT                   /note="Identified by similarity to GP:8885500; match to
FT                   PF00437 protein family HMM PF00437"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13775"
FT                   /db_xref="GOA:Q73IY5"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014155"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IY5"
FT                   /protein_id="AAS13775.1"
FT                   /translation="MNYAALDTYLEPLQGIFQEEGVNEISINKPKEVWIENRGEIRCEK
FT                   LEVFDLNHLKSLGRLIAQATEQKLSEEAPLLSATLPNGYRIQIVFPPACEPDKVVMSIR
FT                   KPSSMQLALDDYEKMGAFSETVTEATDNPVDRHLDLLLRQKKIKEFLEYAVISKKNIII
FT                   SGGTSTGKTTFTNATLRAIPDEERIITVEDAREIVLNDHPNKVHLIASKGGQGRAKVTT
FT                   QDLIEACLRLRPDRIIVGELRGAEAFSFLRAINTGHPGSISTLHADSPTMALEQIKLMV
FT                   MQANLGIPPDQIIPYIRNVIDIVIQLKRTGGGKRSISEILFTRSASENA"
FT   gene            8269..10215
FT                   /locus_tag="WD_0008"
FT                   /old_locus_tag="WD0008"
FT   CDS_pept        8269..10215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0008"
FT                   /old_locus_tag="WD0008"
FT                   /product="type IV secretion system protein VirD4"
FT                   /note="Identified by similarity to GP:8885501; match to
FT                   PF02534 protein family HMM PF02534"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13776"
FT                   /db_xref="GOA:Q73IY4"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IY4"
FT                   /protein_id="AAS13776.1"
FT                   /translation="MSNRNHLRNILIGGVVAFSVLEFCFYLSGILFVLFADGPDAVDFK
FT                   AINPSLTPFPQALWPTIFNHIQYCWHHPELYSLELKITLIISSALPIIVLMIILWNLRE
FT                   RIIEWRPFKKKESLHGDSQWASEKDIRKAGLRSKKGLLLGKDKRGYFISDRFQHALLFA
FT                   PTGSGKGVGFVIPNLLFWTDSVIVHDIKLENYEITSGWRERQGQKVYVWNPAQPDGISH
FT                   CYNPLQWISEKPGQMVDDVQKIANLIMPEQDFWQNEARSLFVGVVLYLLAAPEKVKSFG
FT                   EVVRTMRSDDVVYNLAVALDTMGKILHPVAYMNIAAFLQKADKERSGVVSTMNSSLELW
FT                   VNPLIDTATASSDFNILDFKKKKITVYVGLTPDNLTRLRPLMQVFYQQATEFLCRKLPS
FT                   DDEPYGVLFLMDEFPTLGKMEQFQTGIAYFRGYRVRLFLIVQDTEQLKGIYEEAGMNSF
FT                   LSNSTYRITFAANNIETANLISQLIGNKTVQQESLNKPKFLDLNPASRSLHISEIQRAL
FT                   LLPQEVIMLPRDDQIILIESTYPIKSKKILYYSDTTFTRRLLKQTRVPTQEPYDPNKVL
FT                   SAAASKDKVNNEGNNVLEGPNSVDYPAETKTEDAVYDESDEFADEDIDDEDIDDKFEDD
FT                   DEEDEDKLKNDEK"
FT   gene            10337..11185
FT                   /locus_tag="WD_0009"
FT                   /old_locus_tag="WD0009"
FT   CDS_pept        10337..11185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0009"
FT                   /old_locus_tag="WD0009"
FT                   /product="surface antigen Wsp paralog"
FT                   /note="Identified by similarity to GP:8885502; match to
FT                   PF01617 protein family HMM PF01617"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13777"
FT                   /db_xref="InterPro:IPR002566"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IY3"
FT                   /protein_id="AAS13777.1"
FT                   /translation="MISKKTLAVTAFALLLSQQSFASETEGFYFGSGYYGQYLNNTSVL
FT                   KTSTTGIKNLSINDRGAQNTEGQSLSEYKGDYNPPFAANVAFGYTGELGNNSYRAELEG
FT                   MYSSVKVDNIGLTSSQITVSYLKETGEDPDKETYLYSAAVSHDQIENISVMANVYHHWK
FT                   SDRFSFSPYVGIGIGATRMTMFEKPSIRPAGQLKAGFDYRINEDVNMHIGYRGFGAIGS
FT                   DIKLTAKRLGQVVDDPNNDKKKKLNPSSGSKVTEEINIGNQLFHTHGIEAGLTFHFASK
FT                   A"
FT   gene            complement(11350..12189)
FT                   /locus_tag="WD_0010"
FT                   /old_locus_tag="WD0010"
FT   CDS_pept        complement(11350..12189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0010"
FT                   /old_locus_tag="WD0010"
FT                   /product="modification methylase, HemK family"
FT                   /note="Identified by match to TIGR00536 protein family HMM
FT                   TIGR00536"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13778"
FT                   /db_xref="GOA:Q73IY2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IY2"
FT                   /protein_id="AAS13778.1"
FT                   /translation="MKTISTLIQEGSELLSSHKVESPHLDCEIIMQHVLGVERSFIIVN
FT                   HADQVPMEKELLFWKLTKKRAERYPISQIIGNREFWSKNFIVNQHVLDPRPDSETIILA
FT                   VLKYYPNKKQKLKIADFGTGTGCLLISVLSEYEYAVGVGFEKSLEAYKVAYQNTKKHDL
FT                   LSRAKIFPSSWTECRGSFDLIISNPPYIKRSKLKDLQAEVQKEPRIALDGGIDGLSCYL
FT                   SIFPILRKCLKKNGFAILEIGEDQSNIDKIIPSYELAFQEYVYDLAGMKRCIVVKRT"
FT   gene            complement(12529..12663)
FT                   /locus_tag="WD_0012"
FT                   /old_locus_tag="WD0012"
FT   CDS_pept        complement(12529..12663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0012"
FT                   /old_locus_tag="WD0012"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13779"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IY1"
FT                   /protein_id="AAS13779.1"
FT                   /translation="MSFQCLTLESNFPYNLIENVVTTFCASLLAYKQTFLDLSVWALG"
FT   gene            12642..12776
FT                   /locus_tag="WD_0013"
FT                   /old_locus_tag="WD0013"
FT   CDS_pept        12642..12776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0013"
FT                   /old_locus_tag="WD0013"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13780"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IY0"
FT                   /protein_id="AAS13780.1"
FT                   /translation="MSSTGMTPSCPVHVAINIKKFTKQKKGKRSPSHCLFSVLAFFKS"
FT   gene            13302..13676
FT                   /gene="rpsL"
FT                   /locus_tag="WD_0014"
FT                   /old_locus_tag="WD0014"
FT   CDS_pept        13302..13676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="WD_0014"
FT                   /old_locus_tag="WD0014"
FT                   /product="ribosomal protein S12"
FT                   /note="Identified by similarity to EGAD:9001; match to
FT                   TIGR00981 protein family HMM TIGR00981; match to PF00164
FT                   protein family HMM PF00164"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13781"
FT                   /db_xref="GOA:Q73IX9"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73IX9"
FT                   /protein_id="AAS13781.1"
FT                   /translation="MPTINQLIRKGRLGLTHKKKVPALGESNPQRRGVCTKVYTTTPRK
FT                   PNSALRKVARVKISGYGEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALD
FT                   LRGVQNRKKARSKYGVKKSG"
FT   gene            13682..14161
FT                   /gene="rpsG"
FT                   /locus_tag="WD_0015"
FT                   /old_locus_tag="WD0015"
FT   CDS_pept        13682..14161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="WD_0015"
FT                   /old_locus_tag="WD0015"
FT                   /product="ribosomal protein S7"
FT                   /note="Identified by similarity to EGAD:10025; match to
FT                   TIGR01029 protein family HMM TIGR01029; match to PF00177
FT                   protein family HMM PF00177"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13782"
FT                   /db_xref="GOA:Q73IX8"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73IX8"
FT                   /protein_id="AAS13782.1"
FT                   /translation="MARRNKAKKREISPDSRYGSVLLMRFINTIMKCGKKSTAEKIIYD
FT                   ALSLAEKKIGEGGLSIFETAVGNVTPSIEVRSRRIGGATYQVPVEVRQDRAVSLALRWI
FT                   AKATSAARKKSGKTTVDCLQSEILDAYNKRGGAFKMCEEKYKMAEANKAFSHLRF"
FT   gene            14183..16258
FT                   /gene="fusA"
FT                   /locus_tag="WD_0016"
FT                   /old_locus_tag="WD0016"
FT   CDS_pept        14183..16258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="WD_0016"
FT                   /old_locus_tag="WD0016"
FT                   /product="translation elongation factor G"
FT                   /note="Identified by similarity to EGAD:20973; match to
FT                   TIGR00484 protein family HMM TIGR00484; match to PF00009
FT                   protein family HMM PF00009; match to PF03764 protein family
FT                   HMM PF03764; match to PF00679 protein family HMM PF00679;
FT                   match to TIGR00231 protein family HMM TIGR00231; match to
FT                   PF03144 protein family HMM PF03144"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13783"
FT                   /db_xref="GOA:Q73IX7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73IX7"
FT                   /protein_id="AAS13783.1"
FT                   /translation="MEIGISKYRNIGIMAHIDAGKTTTTERILFYTGKQNRIGEVHDGA
FT                   ASMDWMEQEKERGITITSAATTCFWNDHRVNIIDTPGHVDFTIEVERSLRVLDGAVAVF
FT                   DGVAGVEPQSETVWRQADKYSVPRICFVNKMDRIGANFYRCVDMIKTKLGAAPLVIHLP
FT                   IGSEKDFKGIIDLISMKAIIWQEETLGAKFSYEDIPSDLLDKAQEYRNLLLDAAAEMDD
FT                   EAMNTYFESNDLPVDLLKKCVRNGTIKGKFVPVLCGSAFKNKGVQPLLDGVVDFLPSPI
FT                   DVDVIVGIDPKDSEKKIEVKPSEKEKFVALAFKVMTDKFVGSLTFIRIYSGKLKSKSTV
FT                   SNALKNETEGIGRMLLMHANNREDITEARAGDIVALVGLKKTTTGDTLCSVDFPILLER
FT                   MEFPEPVIEIAVEPKTTSDQEKLGIALNRLVAEDPSLRMSVNAESGQTILKGMGELHLE
FT                   IIVDRMKREFNVEANVGAPQVAYRETITKSVEIDYTHKKQSGGAGQFAKVKIKFEPLEP
FT                   GSGFQFESKIVGGAIPKEYIPGVENGLELIKEGGIISGFPLIDFKATLLDGAFHEVDSS
FT                   PLAFELAAKGAFKEMANKAGPKMLEPIMKVEIITPEEYMGDVMGDINSRRGNVADMLDL
FT                   GNNSKIITASVPLANMFGYINVLRSMSQGRAQYSMHFSCYEQVPQYVVDELKLEYN"
FT   gene            16270..17442
FT                   /gene="tuf"
FT                   /locus_tag="WD_0017"
FT                   /old_locus_tag="WD0017"
FT   CDS_pept        16270..17442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="WD_0017"
FT                   /old_locus_tag="WD0017"
FT                   /product="translation elongation factor Tu"
FT                   /note="Identified by similarity to EGAD:30857; match to
FT                   TIGR00485 protein family HMM TIGR00485; match to PF00009
FT                   protein family HMM PF00009; match to PF03143 protein family
FT                   HMM PF03143; match to PF03144 protein family HMM PF03144;
FT                   match to TIGR00231 protein family HMM TIGR00231"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13784"
FT                   /db_xref="GOA:Q73IX6"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73IX6"
FT                   /protein_id="AAS13784.1"
FT                   /translation="MTAVVEAFGKPHVNVGTIGHVDHGKTTLTAAITKHYGNFVAYDQI
FT                   DKAPEERKRGITIATAHVEYQTEKRHYAHVDCPGHADYVKNMIVGAAQMDAAILVVSGV
FT                   DGPMPQTREHILLAKQVGVGYIVVYINKADVADADMIDLVEMEVRELLSKYGFPGDEVP
FT                   VVVGSALKALEDDSSEYGKKSIDKLMEKLDEYVAVPPRPVDLPFLLPIEDVFSISGRGT
FT                   VVTGRIEKGEIKTGEEIEIIGLKATQKTICTGVEMFKKLLDKGSAGLNVGILLRGTKRE
FT                   EVERGQVLAKPGTITPHRKFKAEVYILKKEEGGRHTPFFANYQPQFYLRTTDVTGSIKL
FT                   LDGKEMVMPGDNVSVEVELQVPIAMDKGLRFAIREGGRTVGSGVVSEILE"
FT   gene            17456..17528
FT                   /locus_tag="WD_tRNA-Trp-1"
FT                   /old_locus_tag="tRNA-Trp-1"
FT   tRNA            17456..17528
FT                   /locus_tag="WD_tRNA-Trp-1"
FT                   /old_locus_tag="tRNA-Trp-1"
FT                   /product="tRNA-Trp"
FT   gene            17539..17748
FT                   /locus_tag="WD_0018"
FT                   /old_locus_tag="WD0018"
FT   CDS_pept        17539..17748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0018"
FT                   /old_locus_tag="WD0018"
FT                   /product="protein translocase subunit SecE"
FT                   /note="Identified by similarity to EGAD:43379; match to
FT                   PF00584 protein family HMM PF00584"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13785"
FT                   /db_xref="GOA:Q73IX5"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IX5"
FT                   /protein_id="AAS13785.1"
FT                   /translation="MVEMLKSLCGFFCDIKQEIRRIAWVKKQEVLSSLFVVMIVILCFS
FT                   IFFCFVDFMSLYVIKALFGIIYGM"
FT   gene            17984..18574
FT                   /locus_tag="WD_0019"
FT                   /old_locus_tag="WD0019"
FT   CDS_pept        17984..18574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0019"
FT                   /old_locus_tag="WD0019"
FT                   /product="transcription antitermination protein NusG,
FT                   putative"
FT                   /note="Identified by similarity to EGAD:9614; match to
FT                   TIGR00922 protein family HMM TIGR00922; match to PF02357
FT                   protein family HMM PF02357; match to PF00467 protein family
FT                   HMM PF00467"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13786"
FT                   /db_xref="GOA:Q73IX4"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IX4"
FT                   /protein_id="AAS13786.1"
FT                   /translation="MISDDEISLKCKEFNRYKWYILRVASNCEEKVRQHILENSMRLGV
FT                   NDYFKEVFIPYEELSEVELKSKKIATRRKCFPGYVFLYVNLCDEVLNFINNIPKSLKVY
FT                   GFLKNGNIPKVILDDEIHSMCNALYNAQETRKLGYGYEKGEKVKINDGLFQNFTGKVNM
FT                   VNDEKKIINVEVSILGKPTIIELDLAQVEKIED"
FT   gene            18577..19017
FT                   /gene="rplK"
FT                   /locus_tag="WD_0020"
FT                   /old_locus_tag="WD0020"
FT   CDS_pept        18577..19017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="WD_0020"
FT                   /old_locus_tag="WD0020"
FT                   /product="ribosomal protein L11"
FT                   /note="Identified by similarity to SP:P29395; match to
FT                   PF00298 protein family HMM PF00298; match to PF03946
FT                   protein family HMM PF03946"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13787"
FT                   /db_xref="GOA:P62444"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62444"
FT                   /protein_id="AAS13787.1"
FT                   /translation="MSVIVAKINLLMEAGKAVPGPKIASVLGPRGIPVPKFCEAFNKVT
FT                   SAANANYKVGDLVTVRISIKDDRSHDFTVSGPPVAYLLKQEAKLSKSSGNPGKELVAKL
FT                   PMSAIIKVAKCKMVDMKVDNEDSAVKMVVGTAKSMGIEVVEG"
FT   gene            19022..19675
FT                   /gene="rplA"
FT                   /locus_tag="WD_0021"
FT                   /old_locus_tag="WD0021"
FT   CDS_pept        19022..19675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="WD_0021"
FT                   /old_locus_tag="WD0021"
FT                   /product="ribosomal protein L1"
FT                   /note="Identified by similarity to EGAD:13176; match to
FT                   PF00687 protein family HMM PF00687; match to TIGR01169
FT                   protein family HMM TIGR01169"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13788"
FT                   /db_xref="GOA:Q73IX2"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73IX2"
FT                   /protein_id="AAS13788.1"
FT                   /translation="MNTYNDNPKQCLKKIVESASAKFNESVDIAVNLGVDSRKSEEQVR
FT                   GTVVLPKGIGKNIKVAVFAQDKHLLEAEKAGADIAGGEDLVEEIKKGRKLDVDWCITTP
FT                   DFMAKITPIAKVLGVKGLMPNPKFGTVTSNIAEAIKTIKSGQVKFGTDKNGVIHGKLGN
FT                   IKFDIDDLLENLKAFLKVIKDNKPISAKGIYFKGVFLNSTMGKAYKIGKVEDII"
FT   gene            19688..20206
FT                   /gene="rplJ"
FT                   /locus_tag="WD_0022"
FT                   /old_locus_tag="WD0022"
FT   CDS_pept        19688..20206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="WD_0022"
FT                   /old_locus_tag="WD0022"
FT                   /product="ribosomal protein L10"
FT                   /note="Identified by similarity to SP:P42923; match to
FT                   PF00466 protein family HMM PF00466"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13789"
FT                   /db_xref="GOA:Q73IX1"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IX1"
FT                   /protein_id="AAS13789.1"
FT                   /translation="MKRKDKDEFIQSTINVFVNNDFLILVNFKSINANDSLTLRNSLKS
FT                   IAGGVLVVKNTLARLALERTGKFSYLSGKFSGPVAIIYSSGIVEAAKLIVDFTNANKEK
FT                   MSVICAAHLNELLTVEDVNKLAKLPSLDELRVKIMRLISYDIPARLALSINSSSMRLMR
FT                   VLDYYSSKK"
FT   gene            20233..20634
FT                   /gene="rplL"
FT                   /locus_tag="WD_0023"
FT                   /old_locus_tag="WD0023"
FT   CDS_pept        20233..20634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="WD_0023"
FT                   /old_locus_tag="WD0023"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="Identified by similarity to SP:P23349; match to
FT                   TIGR00855 protein family HMM TIGR00855; match to PF00542
FT                   protein family HMM PF00542"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13790"
FT                   /db_xref="GOA:Q73IX0"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IX0"
FT                   /protein_id="AAS13790.1"
FT                   /translation="MSNVTSDLVDKILSLNLLEASELVKVLEEKIGLPAGSFLGGAVGA
FT                   GAPIGDNAAAPAAQEKAEYKVVIKEIDASKKIGVIKAVREVNSTLGLKEAKELVESLPK
FT                   DLTANVPKDEAEKIKQKLIEAGATKVELE"
FT   gene            20693..29206
FT                   /gene="rpoBC"
FT                   /locus_tag="WD_0024"
FT                   /old_locus_tag="WD0024"
FT   CDS_pept        20693..29206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoBC"
FT                   /locus_tag="WD_0024"
FT                   /old_locus_tag="WD0024"
FT                   /product="DNA-directed RNA polymerase, beta/beta' subunits"
FT                   /EC_number="2.7.7.6"
FT                   /note="Identified by similarity to SP:Q9RH40; match to
FT                   PF00562 protein family HMM PF00562; match to PF04997
FT                   protein family HMM PF04997; match to PF00623 protein family
FT                   HMM PF00623; match to PF04998 protein family HMM PF04998;
FT                   match to PF04565 protein family HMM PF04565; match to
FT                   PF04560 protein family HMM PF04560; match to PF05000
FT                   protein family HMM PF05000; match to PF04983 protein family
FT                   HMM PF04983; match to PF04561 protein family HMM PF04561;
FT                   match to TIGR01612 protein family HMM TIGR01612"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13791"
FT                   /db_xref="GOA:Q73IW9"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73IW9"
FT                   /protein_id="AAS13791.1"
FT                   /translation="MVDSSYMYASGAFVPRVSYSRSIDLKDSLLDLVKVQKESYDSFTP
FT                   KNKGNERLEVIFHTIFPINDPLRRATIEFISCRVDDPKYDESECIKRGVTFSAQVIASI
FT                   RLVVMQDGISLDEYKSIKESGDHSKLATVVKSIEEQKVHFCGLPMMTDKGTFIINGVEK
FT                   VIVSQMHRSPGVFFDSDKGKTYNSGKLIYSARIIPYRGSWLDIEFDVKDHLYFRVDRKR
FT                   KLPISVLLKALGLSNNDILDRFYEKIKYVKHKDGWKVPFVPDKFKGVRLPFDLMDIEGN
FT                   VLLKANVRITSRLAKKLYDNELKEYLVPFNSICGLFLAEDLMDSASSTKILSAGESIKL
FT                   EDIKKLELLSVDEISVLNIDNLFVGPYILNTLFLDENMSYQDALYEIYRVLRPGEVPVL
FT                   EIVEEFFRNLFFSPEYYDLSNIGRLKLNSYLGLNYDEDLTVLTHEDIIEIVKKIVLLRD
FT                   GQGSVDDIDHLGNRRVRSVGEFIENQFRTGLLKLERAIVDSMSTSSLDKVSPSDFINPK
FT                   VLTNVLRDFFNSSQLSQFMDQTNPLSEITHKRRLSALGPGGLTRERAGFEVRDVHPTHY
FT                   GRICPIETPEGQNIGLINSLAIYARINKYGFIESPYRKVVNRVVTDQIEYLSAIDEGSH
FT                   HIADTSVKLDENNCFVDDMLYCRYAGSFVMVSSDQVSYIDVSPKQVISVAASLIPFLEN
FT                   DDANRALMGSNMQRQAVPLLKPTAPLVATGMESFVASGSGAVVLAKRDGIVDSSDSNSI
FT                   VIRAFDKERVNYLDVDIYHLRKFQRSNHNTCINQRPLVCVGDYVKKGDVIADGPAINSG
FT                   ELALGKNLLVAFMSWQGYNFEDSIIISSEVVKKDLFTSIHIEEFDCVVHDTPLGSEKIT
FT                   RAIPGVNEENLYHLDDSGIVKIGTRVGPGYILVGKVTPKPSLSLPPETKLLMTIFGEKS
FT                   FDCADSSLYTSPDVEGTVIDVQVFTRRGVEENERALLIKQKEINDFEEERDYIINVTSE
FT                   YFYDELKKLLINSGSQDREKFDSIEREQWWGIGLKNQSISEQVKSLKKDFDEKVSHAIA
FT                   QFKRKVEKLHEGYDLPQGVSMSVKVFIAVKHSLQPGDKMAGRHGNKGVISRVVPVEDMP
FT                   YLEDGTPVDIILNPLGVPSRMNVGQILETHVGWACRKLGEKVSNILDEINKIKSAFCKG
FT                   IRSLNDDNFTQFAVAYLDNKKIENIDDDEITASVLNTPNKNALNDELNELVENYLNSCK
FT                   SSYSNLRNFLIEVYSYGSNVSICNDIRNISDNNLIEFARKLRDGVPVAAPVFEGPKDEQ
FT                   IAKLFELAGLDNSGQAVLYDGCSGEKFDRKVTVGYMYMLKLHHLVDGKIHARSVGPYSL
FT                   VTQQPLGGKSHFGGQRFGEMECWALQAYGAAYTLQEMLTVKSDDINGRVKIYESIIKGD
FT                   SNFECGIPESFNVMIKELRSLCLNVDLKQNDVVIEDISHTNIAQPFNEVSISIASPESI
FT                   KRISCGEIEDVLTANYRTFKVEKGGLFCPKVFGPVNDDECLCGKYKKRRHRGRICEKCG
FT                   VEVTSSKVRRERMGHIELASPVAHIWFLKSLPSRIGALLDMSLRDIENILYSDNYIVID
FT                   PLVSPFEKGEIISEKAYNEAKDSYGIDSFVAMQGVEAIRELLTRLDLHEIRKDLRLELE
FT                   SVASEIRRKKIIKRLRIVENFIKSGNRPEWMILTTIPILPPDLRPLVSLESGRPAVSDL
FT                   NHHYRTIINRNNRLRKLLSLNPPEIMIRNEKRMLQEAVDSLFDNSRRNTLVNKAGAVGY
FT                   KKSISDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPTLKLNQCGLPKRMALELFKPFVY
FT                   SKLKMYGMAPTIKFASKLIRAEKPEVWDMLEEVIKEHPVLLNRAPTLHRLGIQAFEPIL
FT                   IEGKAIQLHPLVCTAFNADFDGDQMAVHVPISLEAQLEARVLMMSTNNVLSPSNGRPII
FT                   VPSKDIVLGIYYLTLQEPKEDNLPSFGAFCEVEHSLSDGILHIHSSIKYRMEYINSSGE
FT                   THYKTVCTTPGRLILWQIFPKHENLGFDLINQILTVKEITGIVDLVYRNCGQSATVAFS
FT                   DKLMVLGFEYATFSGVSFGRCDMVIPETKATHVDHARGEIKKFSMQYQDGLITRSERYN
FT                   KVIDEWSKCTDMIANDMLKAISIYDGNSKYNSVYMMVNSGARGSTSQMKQLAGMRGLMT
FT                   KPSGEIIETPIISNFREGLNVFEYFNSTHGARKGLADTALKTANSGYLTRRLVDVSQNC
FT                   IVAKHDCKTKNGLVVRATVEGSTIVASLESVVLGRTAANDIYNPVTKELLVKAGELIDE
FT                   DKVKQISIAGLDVVKIRSPLTCEISPGVCSLCYGRDLATGKIVSIGEAVGVIAAQSVGE
FT                   PGTQLTMRTFHIGGVMTRGVESSNIIASINAKIKLNNSNIIIDRNGNKIVISRSCEVVL
FT                   IDSLGSEKLKHSVPYGAKLYVDESGSVKIGDKVAEWDPYTLPIITEKTGTVSYQDLKDG
FT                   ISITEVMDESTGISSKVVKDWKLHSGGANLRPRIVLLDDNGKVMTLASGVEACYFIPIG
FT                   AVLNVQDGQKVHAGDVITRTPRESVKTRDITGGLPRVIELFEARRPKEHAIVSEIDGYV
FT                   AFSEKDRRGKRSILIKPVDEQISPVEYLVSRSKHVIVNESDFVRKGDLLMDGDPDLHDI
FT                   LRVLGLEALAHYMISEIQQVYRLQGVRIDNKHLEVILKQMLQKVEITDPGDTMYLVGES
FT                   IDKLEVDRENDAMSNSGKRPTHYLPILQGITRASLETSSFISAASFQETTKVLTEAAFC
FT                   GKSDPLSGLKENVIVGRLIPAGTGLIMNKIRALSLCDNVDKYEKYFDIETYDEEWLMDN
FT                   GCHLHSDEEESVVAYDQSN"
FT   gene            complement(29213..30175)
FT                   /locus_tag="WD_0025"
FT                   /old_locus_tag="WD0025"
FT   CDS_pept        complement(29213..30175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0025"
FT                   /old_locus_tag="WD0025"
FT                   /product="NifR3 family protein"
FT                   /note="Identified by similarity to EGAD:162952; match to
FT                   TIGR00737 protein family HMM TIGR00737; match to PF01207
FT                   protein family HMM PF01207"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13792"
FT                   /db_xref="GOA:Q73IW8"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IW8"
FT                   /protein_id="AAS13792.1"
FT                   /translation="MPLQIGNLTIDSPVILAPMSGVTDYPFRSIVKKLGASLLVSEMIA
FT                   SRAMIMQTRQSLQKAKVDALTAVQLAGCEPDVMAEAAKLNEDMGAKIIDINFGCPVKKV
FT                   VNGYAGSALMRDEKKAAEIIEAVVKAVNMPVTVKMRTGWNDENRNAPRLAKIAEDLGAK
FT                   MITVHGRTRAQLYNGQADWKFVRNVKEQVKIPVIVNGDIKNLNDIQNALKESGADGVMI
FT                   GRGAYGKPWLINQAMNFLSGSETSEPTASERLSIILEHYDNILEYYGNDTGIKMARKHI
FT                   GWYSSGLQGSSEFRVRVNNMTDSTEVKENIIGFFGQETH"
FT   gene            complement(30201..30677)
FT                   /locus_tag="WD_0026"
FT                   /old_locus_tag="WD0026"
FT   CDS_pept        complement(30201..30677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0026"
FT                   /old_locus_tag="WD0026"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13793"
FT                   /db_xref="GOA:Q73IW7"
FT                   /db_xref="InterPro:IPR003653"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IW7"
FT                   /protein_id="AAS13793.1"
FT                   /translation="MIFTSVLHINNNHWVTLVIKPDAGDKKFRAYYCDSFGNQLPDNVL
FT                   NIVKRELQKEEWVLDIRISPTKQQSDGYNCGIFALENAHKIKQMLNEDKSFDEIDKKLS
FT                   EYKFDLNEKREEFTRALMEDEKCKEDLRNRKRPPRTKTSQSSISRENASLCCIM"
FT   gene            complement(30692..31168)
FT                   /locus_tag="WD_0027"
FT                   /old_locus_tag="WD0027"
FT   CDS_pept        complement(30692..31168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0027"
FT                   /old_locus_tag="WD0027"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13794"
FT                   /db_xref="GOA:Q73IW6"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IW6"
FT                   /protein_id="AAS13794.1"
FT                   /translation="MLISNPVVWVLMGTILTVAYKMVVEPLFYLAKGYINGKRASQGEQ
FT                   KTPDEDSGIFPGPDNEDGSTVSENSSRRSSIASKDSGLGGKEFHENLDTLVHQTNRGNY
FT                   AYWLCDDDITHIARVVYGYSQSEHSNNNVYFLAPSYSNGWDELTKNFFRIIEVN"
FT   gene            31467..32744
FT                   /gene="serS"
FT                   /locus_tag="WD_0028"
FT                   /old_locus_tag="WD0028"
FT   CDS_pept        31467..32744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="WD_0028"
FT                   /old_locus_tag="WD0028"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="Identified by similarity to EGAD:17518; match to
FT                   TIGR00414 protein family HMM TIGR00414; match to PF00587
FT                   protein family HMM PF00587; match to PF02403 protein family
FT                   HMM PF02403"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13795"
FT                   /db_xref="GOA:Q73IW5"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73IW5"
FT                   /protein_id="AAS13795.1"
FT                   /translation="MHDIEYIRKNPEGFEKAMKSRGIRESTAEEILEIDHEKRSLTTKL
FT                   QDLNRQRNEITEEIKKLKMSKSPCEEQIELSKSITNEIEAISLKEQAEKDKLVNVLSNL
FT                   PNIPAQDVPIGADENSNLEVRRYGGKRQFDFVPESHYELGEKLGLMDFEQAARISGSRF
FT                   TILKGQLAKLGRALINCMLEMHVNEFGYTEVYHPALVKNEAMYNVGQLPKFSDDSYLTT
FT                   DELRLIPTSEVFLTNLVADKIMEEKELPIRFTAYSECFRKEAGSAGRDTRGMIRQHQFG
FT                   KVELVSITTEDQSNDELERMTSVAEEILKKLELPYRVMLLCSGDMGFAAQRTYDIEVWL
FT                   PGQNKYREISSCSNCGAFQARRMNTKYSSETDKKMKKYIHTLNGSALAIGRTIIAIMEN
FT                   YQNSDGSIAIPNVLQKYMSNDTVISK"
FT   gene            32779..34050
FT                   /gene="purD"
FT                   /locus_tag="WD_0029"
FT                   /old_locus_tag="WD0029"
FT   CDS_pept        32779..34050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="WD_0029"
FT                   /old_locus_tag="WD0029"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="Identified by similarity to EGAD:7937; match to
FT                   TIGR00877 protein family HMM TIGR00877; match to PF01071
FT                   protein family HMM PF01071; match to PF02844 protein family
FT                   HMM PF02844; match to PF02842 protein family HMM PF02842;
FT                   match to PF02843 protein family HMM PF02843"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13796"
FT                   /db_xref="GOA:Q73IW4"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IW4"
FT                   /protein_id="AAS13796.1"
FT                   /translation="MKVLVIGSGGREHALLWALKKSPILTELYVTPGRQAMKDLGALVD
FT                   VNIQNSVDVTQFCKRENIELVVIAPEQPIIDGLADDLVAEGINVFAPSQATAKLEGSKS
FT                   FTKGLCKRYGIPTAKYECFVDEGLAKDFVRSNKIKFPLVVKANGIAAGKGVVICNTESE
FT                   AFSAINSMLVEKKFGESGEEIIIEEFLVGEEVSFFALIDGLKVVTLGCAKDYKRVDESN
FT                   ESQNTGGMGSYSSPSIISKDMEQKIIQKIIYPTAQALVNMGTSYKGVLFAGLMICKDSP
FT                   KLLEYNVRFGDPETQSILPRFDSNCDLLKLMLSVAEGKLNVKMVELNNKSTVCVVVASK
FT                   GYPGDYQKGEVIKGLDKIESIPGVLVFHAGTKFDESGNLVSDGGRVLNIVAEGSTIEEA
FT                   KSKVYSALNFLEWPGGFFRYDIGS"
FT   gene            complement(34458..34565)
FT                   /locus_tag="WD_0031"
FT                   /old_locus_tag="WD0031"
FT   CDS_pept        complement(34458..34565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0031"
FT                   /old_locus_tag="WD0031"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13797"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IW3"
FT                   /protein_id="AAS13797.1"
FT                   /translation="MSFSHKYLRNLPNEKKGKRSPGVIICFKILAFFMF"
FT   gene            complement(34679..34954)
FT                   /locus_tag="WD_0032"
FT                   /old_locus_tag="WD0032"
FT   CDS_pept        complement(34679..34954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0032"
FT                   /old_locus_tag="WD0032"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13798"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IW2"
FT                   /protein_id="AAS13798.1"
FT                   /translation="MLQHSSGIENEINHTAVRNDVRGVKPLIESRVNVKVQNINAVIAT
FT                   SVTFKMIATSVTLELVASKITCVLSKPTTKLEEVAITYFQGLALYL"
FT   gene            complement(35323..36585)
FT                   /locus_tag="WD_0033"
FT                   /old_locus_tag="WD0033"
FT   CDS_pept        complement(35323..36585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0033"
FT                   /old_locus_tag="WD0033"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13799"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IW1"
FT                   /protein_id="AAS13799.1"
FT                   /translation="MFWKDSKAIKEILVAAEENSILKDILNTTTTMKYLDREVTYTPLA
FT                   YVILRRDSIAVEKVLRVAKENGILRDILDTTITIKHLDSREVTYTPLAHAMFWEDGKII
FT                   KEILVAAEENSILKDILDATTTIKYLDGQEEIYTPLTYAISCKNSKTIEEILKVSKEND
FT                   ILKDILDATTTIKYLDGQKEIYTPLTYAISCKNSKTIEEILKISKENGILKDILDATTT
FT                   IKCPDGHEETCAPLTYAILRKDSIAVEKMLRVAKENDILKDILDATTTIKHSDSREVTY
FT                   TLLAYAILRENSIAIEEILKISKENSILKDILNATITIKCLDGRRVTVTPLAYAILRKD
FT                   SMAVEKMLRVAKENGILKDILDATTTIKYPDGQEETCTPLAYAILRKDSIAVEKMLRVA
FT                   KENGILKDILNTTITIKIIKK"
FT   gene            complement(36604..37257)
FT                   /locus_tag="WD_0034"
FT                   /old_locus_tag="WD0034"
FT   CDS_pept        complement(36604..37257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0034"
FT                   /old_locus_tag="WD0034"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13800"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IW0"
FT                   /protein_id="AAS13800.1"
FT                   /translation="MLSLIRKTLRKKMTHQVNDSKLKEKDEKSILKLASKIEGKKSSIA
FT                   EELEKISEKEKQRILTTEVSKHRGKESTIISLAYAILRKDSIAVEKMLRVAKENGILKD
FT                   ILDATTTIKYPGGQEETCTPLTYAILCKNSKTIEETLKVSKENGILKDILNATTTIKYP
FT                   DGRRATVTPLAYAILYEDSIAIEEILKVSKENGILKDILNTTATIRYPDNKEVT"
FT   gene            37671..38537
FT                   /locus_tag="WD_0035"
FT                   /old_locus_tag="WD0035"
FT   CDS_pept        37671..38537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0035"
FT                   /old_locus_tag="WD0035"
FT                   /product="ankyrin repeat domain protein"
FT                   /note="Identified by match to PF00023 protein family HMM
FT                   PF00023; match to PF00023 protein family HMM PF00023; match
FT                   to PF00023 protein family HMM PF00023; match to PF00023
FT                   protein family HMM PF00023; match to PF00023 protein family
FT                   HMM PF00023; match to PF00023 protein family HMM PF00023"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13801"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IV9"
FT                   /protein_id="AAS13801.1"
FT                   /translation="MTEETKDGYASLYVAIQEGNIEAAELLIKCGTNVNDHYERNRTPL
FT                   HIAIGRKQLEIAKLLIKNGANVNAKTQNHGKDDLTPMHFAVFANTPEFIELLASHGALI
FT                   NERESTEGYTPLHFAALYGNKNIIQALIDKGQDIEDVDNNGRTALFLAARQCTEAEDDS
FT                   RIEIIKYLIDKLKADVTKKDNNNNAVLFPAANNCPGKVVEFIIEQYIKIFELENFINHK
FT                   NNDGMDALDIALNSGNEKAIEVLRSYGADIKNKVDGSIQKITAEKPSSTLDRAESAEVA
FT                   PPIKQRV"
FT   gene            38841..39767
FT                   /gene="prsA"
FT                   /locus_tag="WD_0036"
FT                   /old_locus_tag="WD0036"
FT   CDS_pept        38841..39767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prsA"
FT                   /locus_tag="WD_0036"
FT                   /old_locus_tag="WD0036"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="Identified by similarity to EGAD:24493; match to
FT                   TIGR01251 protein family HMM TIGR01251; match to PF00156
FT                   protein family HMM PF00156"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13802"
FT                   /db_xref="GOA:Q73IV8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IV8"
FT                   /protein_id="AAS13802.1"
FT                   /translation="MKIIIGNASKELGESVVNRLDVQPSSAWISKFTDGEVNVEVANDL
FT                   YNQEVYIIQSLSPPVNDNLMELLLIIDAVNRLGAKRIVVIIPYYGYSRQDRIIKNNNVQ
FT                   SALSAKLVANLIQTAGASSVAVIDLHSSQIEGFFDVPITNLNCFEAFVDSIHTENLAIV
FT                   APDVGAIGRARAFAKTLEEKYKIGLNDKIIVVDKYREKAGTSQVMNIIGEVANKNCVIV
FT                   DDIVDSGGTLCNAALALKGHGAKSVISCITHGVLSGSAVEKISSSSLDKLVITDTILHK
FT                   FEKTGKIEVVSVVDILTHFIQGGKDAS"
FT   gene            39757..40110
FT                   /locus_tag="WD_0037"
FT                   /old_locus_tag="WD0037"
FT   CDS_pept        39757..40110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0037"
FT                   /old_locus_tag="WD0037"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit,
FT                   putative"
FT                   /note="Identified by match to TIGR00135 protein family HMM
FT                   TIGR00135"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13803"
FT                   /db_xref="GOA:Q73IV7"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IV7"
FT                   /protein_id="AAS13803.1"
FT                   /translation="MPAKSTEDVITSLIEFANKRKITITKEEMLKIAQLVRIKLSNDEI
FT                   DHYSKELTMLDWIHDTLLQVNTEGVSPMRYGSIDKDIHVRDDVINSQNIKKEILSNTKP
FT                   EHGYFVVPKVISN"
FT   gene            complement(40152..41414)
FT                   /locus_tag="WD_0038"
FT                   /old_locus_tag="WD0038"
FT   CDS_pept        complement(40152..41414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0038"
FT                   /old_locus_tag="WD0038"
FT                   /product="tolB protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13804"
FT                   /db_xref="GOA:Q73IV6"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73IV6"
FT                   /protein_id="AAS13804.1"
FT                   /translation="MKLFVHLVLFISLFIPYFTKAALYVDIKKSSVGNIGLVVSKCTCK
FT                   TALESELSENIAKVIGTNLSNCGLFNVKRSAEAESKSWKSDTVVTVSLSEISGSALELS
FT                   FRLFDAFTKRELLTQSVVFPAKDWRKIGHLVSDVIHDRLIGEKGHFNTKITYIAEEKDS
FT                   NYKSVRKIAVMNQDGSNIKYLTNGDRFVSTPRFSPNGKGIVYISYANGKSYIILKNLKD
FT                   NTESIISAFEGVVSAPRFSPDGKSLLISHSLGGETNILSLDLSSKRTKKITKGSAISTS
FT                   PSFSPDQKYMAFSSDISGSQQLYVIDFTNKSKKPKRISFGSGRYATPVWSPKGDLIAFT
FT                   KIQSGKFYIGVMKPDGKEERLLSEGHKIESPAWLPNGREIIFTRTESPSNSKLYLVDLV
FT                   KKNQKMVSTPTNASLPDWSYF"
FT   gene            complement(41420..43054)
FT                   /locus_tag="WD_0039"
FT                   /old_locus_tag="WD0039"
FT   CDS_pept        complement(41420..43054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0039"
FT                   /old_locus_tag="WD0039"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="Identified by similarity to OMNI:CC1934; match to
FT                   PF00753 protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13805"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IV5"
FT                   /protein_id="AAS13805.1"
FT                   /translation="MNINKNEFLFLPLGGVGRIGMNVSLYHYQGKWIMIDLGVGFADET
FT                   MPGVELLIADIDFIAQRKKDLLGIIITHAHEDHCGAVPHLWEELQCSIYTTKFTVNFLK
FT                   EKLKEFRLEGIVPVKEVDINGSINLGPFTVEFINVTHSIPEANSILISTEMGSALHTGD
FT                   WKFDPKPVVGLTSNMERLKEIGDKGDLLAAICDSTNILSKHHPESEGEIYNNIYNIIKR
FT                   SKKLVAVSLFASNVARIETISQAAKALNRKVVLLGRSLWRIVKVAQDSGYLTDSPQFLE
FT                   AKEAVNFPREELVLLCTGCQGEPLAATARLAAKNHQAFKMQQGDTMIFSSKIIPGNETR
FT                   AHNMLNAFIEMGVEVITEKTEHVHASGHPTREELKEMYSLIKPKMSIPVHGEYIHTHAH
FT                   VKFAKECGVAKAIMIAPGDIVNLENGGKVDSIDVDYFGIDGMLLRHPESSVIKMRKRMR
FT                   DAGVIVVTAVVNKKNKLLAKPKVFVPGVFEVLEDAATIQKIVKKVESLFSLQPTKKIKN
FT                   KIESSILSILKEYLLKRPIIEVQIEQV"
FT   gene            complement(43264..44382)
FT                   /gene="dnaJ"
FT                   /locus_tag="WD_0040"
FT                   /old_locus_tag="WD0040"
FT   CDS_pept        complement(43264..44382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="WD_0040"
FT                   /old_locus_tag="WD0040"
FT                   /product="dnaJ protein"
FT                   /note="Identified by similarity to EGAD:142917; match to
FT                   PF01556 protein family HMM PF01556; match to PF00226
FT                   protein family HMM PF00226; match to PF00684 protein family
FT                   HMM PF00684"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13806"
FT                   /db_xref="GOA:Q73IV4"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73IV4"
FT                   /protein_id="AAS13806.1"
FT                   /translation="MSKKDYYDLLEVGRNASIDEIKKAYKKLALRYHPDRNPGNQEAEE
FT                   KFKEVTAAYEVLSDSEKRAGYDRYGHEGASGGFQGFSSAGDFSDIFNDFFGGGFGGGAS
FT                   RSRAKRSTTGVSGADLRYDLEITLEDAFKGIQAPIHYVTNVKCDTCQGTGGEGAIKPVQ
FT                   CHTCQGSGRIRTQQGFFTIERTCTTCYGEGEIIQNKCKKCGGSGRRRDEVNISVSIPKG
FT                   IEEGAKVRISGKGEAGTKGGKSGDLYVYVKIIFHKIFARNKADLHCKVPIRMTLAVLGG
FT                   EIDIQSIDGAKIKVKVPEGTQTGTKLRCREKGMPYMNSHARGDLYVQVIVETLNPKNLT
FT                   KKQIELLKALEEEENASVQQQSEGFFSKVKKK"
FT   gene            complement(44465..44542)
FT                   /locus_tag="WD_tRNA-Arg-1"
FT                   /old_locus_tag="tRNA-Arg-1"
FT   tRNA            complement(44465..44542)
FT                   /locus_tag="WD_tRNA-Arg-1"
FT                   /old_locus_tag="tRNA-Arg-1"
FT                   /product="tRNA-Arg"
FT   gene            complement(44606..45241)
FT                   /locus_tag="WD_0041"
FT                   /old_locus_tag="WD0041"
FT   CDS_pept        complement(44606..45241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0041"
FT                   /old_locus_tag="WD0041"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13807"
FT                   /db_xref="GOA:Q73IV3"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IV3"
FT                   /protein_id="AAS13807.1"
FT                   /translation="MDSLFGGRGHTMVNNITNINNGNTTHQGRKENKKESEDSRKLLAL
FT                   GIVAAVVCVAFHAGMCFWYNSSRKVARKEEKIDYLDSKFKTFRNIEFAVGVVSLAALVA
FT                   CAVYPVLPVWGLAILGVNSLVCFAGGLAFHMKHEEELENIEKAKGAVDSCLRQGHGYGD
FT                   SSRYDAPPPYFSQDPNTTPTAPPCSEFDNSNAKRQFENCEGFTYDRNQ"
FT   gene            complement(45767..46177)
FT                   /locus_tag="WD_0042"
FT                   /old_locus_tag="WD0042"
FT   CDS_pept        complement(45767..46177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0042"
FT                   /old_locus_tag="WD0042"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by match to TIGR01784 protein family HMM
FT                   TIGR01784"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13808"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IV2"
FT                   /protein_id="AAS13808.1"
FT                   /translation="MTSTKLERSRMRRKVSRTVLKSSEEGRPSSLRQQYADETTDEDLR
FT                   NIAEKSPIIKLAYDELDRFSWNEKDLVAYEERIMDLRKEEAILEYKLEEGIGKGKIEVA
FT                   KNLLKAGVSVNLIAESTGLSQAEIVQLKQEVA"
FT   gene            complement(46174..46860)
FT                   /locus_tag="WD_0043"
FT                   /old_locus_tag="WD0043"
FT   CDS_pept        complement(46174..46860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0043"
FT                   /old_locus_tag="WD0043"
FT                   /product="reverse transcriptase, interruption-C"
FT                   /note="Identified by match to PF01844 protein family HMM
FT                   PF01844"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13809"
FT                   /db_xref="GOA:Q73IV1"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IV1"
FT                   /protein_id="AAS13809.1"
FT                   /translation="MNLLVSGQPLRQYPTKESKKGYTLLIKPSRNSIKQHTFAIKHKLR
FT                   EMRGAPQEVIIRNLNPINRGWSQYYSSVVSCKIFSSLDNTIHRKLWKWAVFRHPNKGKC
FT                   WIKRKYFKKYNNDNWRFMTSNKIHLIIHSDHVIKRHIKVQKTRSPYDGDWVYWGNRLRE
FT                   IPDKPSRVIKLLKLQQSKCGNCRLWFESDDIIEIHHKDRNRRSNMIKNLSLLHGHCHDE
FT                   LHRRCA"
FT   gene            complement(46857..47198)
FT                   /locus_tag="WD_0044"
FT                   /old_locus_tag="WD0044"
FT   CDS_pept        complement(46857..47198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0044"
FT                   /old_locus_tag="WD0044"
FT                   /product="transposase, IS5 family, OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13810"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IL9"
FT                   /protein_id="AAS13810.1"
FT                   /translation="MRTKYTKVKKMWADMGYQGRNLKNHIKEEYDIDIEIVKRPPCRFW
FT                   VHKDTPPELLPTREQGFKVQPRRWVVERTFAWVNRNRRLSKEYDLLTTSTENFIYLAMS
FT                   RVMLKREYA"
FT   gene            complement(47309..47689)
FT                   /locus_tag="WD_0045"
FT                   /old_locus_tag="WD0045"
FT   CDS_pept        complement(47309..47689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0045"
FT                   /old_locus_tag="WD0045"
FT                   /product="transposase, IS5 family, OrfA"
FT                   /note="Identified by similarity to GP:1256580"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13811"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IM0"
FT                   /protein_id="AAS13811.1"
FT                   /translation="MRKKYPTDLSEREWSRIEKHFRVSYKKGGRPPKYSKREILEAIFY
FT                   VLRTGCQWRYLPNDFPLWKTVYEQFRQWKKQGIFEKMNYEITKYSRRKIGRNEQPSACI
FT                   VDSQSVKTTEKGGSKAMMEVKK"
FT   gene            complement(47717..48759)
FT                   /pseudo
FT                   /locus_tag="WD_0046"
FT                   /old_locus_tag="WD0046"
FT                   /note="reverse transcriptase, interruption-N; This gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error.Identified by similarity to GP:7271418"
FT   gene            complement(49261..49668)
FT                   /locus_tag="WD_0047"
FT                   /old_locus_tag="WD0047"
FT   CDS_pept        complement(49261..49668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0047"
FT                   /old_locus_tag="WD0047"
FT                   /product="conserved domain protein"
FT                   /note="Identified by similarity to OMNI:NTL01RC0577"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13812"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IU8"
FT                   /protein_id="AAS13812.1"
FT                   /translation="MNLVFVGNSKVSKGGSSSNTASLPDQFARDKGFEKRAQLYAAKAY
FT                   SRQADKSGKYIDLKKVFFIAISNCNLFPDKLDYISSHTIRDEKTNEHDLKDFQFVFIEL
FT                   PKFPKNKEEQLESIVDRWLFFFSATRKAVVL"
FT   gene            complement(49646..51019)
FT                   /pseudo
FT                   /locus_tag="WD_0048"
FT                   /old_locus_tag="WD0048"
FT                   /note="transposase, Tn5-related, degenerate; This gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error.Identified by similarity to GP:6723227"
FT   gene            complement(51062..51301)
FT                   /locus_tag="WD_0049"
FT                   /old_locus_tag="WD0049"
FT   CDS_pept        complement(51062..51301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0049"
FT                   /old_locus_tag="WD0049"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13813"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IU7"
FT                   /protein_id="AAS13813.1"
FT                   /translation="MEHGRCWRCRKRKSSKLPEGVTPDTFGPRVKSIIAALSGFYKNSK
FT                   REVASIINDIFNLNISVGSISNLTITHKYKCTYK"
FT   gene            complement(51258..51515)
FT                   /locus_tag="WD_0050"
FT                   /old_locus_tag="WD0050"
FT   CDS_pept        complement(51258..51515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0050"
FT                   /old_locus_tag="WD0050"
FT                   /product="transposase, degenerate"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13814"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IU6"
FT                   /protein_id="AAS13814.1"
FT                   /translation="MYKTKKDKPKSERNVGDQVGHKGNFHATMEADKVVKIELPNICEC
FT                   GGELVICEKPYVHQKVDLPEIRPYVVIGTWSLLEMQKKKK"
FT   gene            51493..51834
FT                   /locus_tag="WD_0051"
FT                   /old_locus_tag="WD0051"
FT   CDS_pept        51493..51834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0051"
FT                   /old_locus_tag="WD0051"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13815"
FT                   /db_xref="GOA:Q73IU5"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IU5"
FT                   /protein_id="AAS13815.1"
FT                   /translation="MSFFVLYNSLELGRDEFFEFKPSLSFNSAFSIFKALFSAFKFSIS
FT                   AFSFSIFCCKFLQSSQRFTTLPHFCSMIILIILLCLPYSTTPLNGYNLLNRKKGKRNPR
FT                   VASYSLSIF"
FT   gene            complement(51846..52043)
FT                   /locus_tag="WD_0052"
FT                   /old_locus_tag="WD0052"
FT   CDS_pept        complement(51846..52043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0052"
FT                   /old_locus_tag="WD0052"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13816"
FT                   /db_xref="GOA:Q73IU4"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IU4"
FT                   /protein_id="AAS13816.1"
FT                   /translation="MLDTLRQPPYHETEGIQLSSSVQIKQQENNVVGVLFLIFCTMCTL
FT                   CLHNISRFLPTQAETRYLKH"
FT   gene            52111..52752
FT                   /locus_tag="WD_0053"
FT                   /old_locus_tag="WD0053"
FT   CDS_pept        52111..52752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0053"
FT                   /old_locus_tag="WD0053"
FT                   /product="dioxygenase, putative"
FT                   /note="Identified by match to PF00775 protein family HMM
FT                   PF00775"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13817"
FT                   /db_xref="GOA:Q73IU3"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR039387"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IU3"
FT                   /protein_id="AAS13817.1"
FT                   /translation="MNVKNILLALLVQMIFSLPLFAADPVLLNCIKTPEIYDLDARPKN
FT                   FSSSNNLRRKPGSPNSAIGELIHIVGRITDINCLPIQNAVVSIWHANSRGVNHYDKNIE
FT                   DDLNFAGSGRFVVNNLGYYNFITIAPGKIGDRAPHINFLVQHPDFPEFTTQMFFADHNC
FT                   DNCADPVLEDFVSNGLASLLITPFTYSDQVIKTYTFNITLGGYNKFSNKR"
FT   gene            52849..54351
FT                   /gene="pepA"
FT                   /locus_tag="WD_0054"
FT                   /old_locus_tag="WD0054"
FT   CDS_pept        52849..54351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepA"
FT                   /locus_tag="WD_0054"
FT                   /old_locus_tag="WD0054"
FT                   /product="cytosol aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /note="Identified by similarity to EGAD:17761; match to
FT                   PF00883 protein family HMM PF00883; match to PF02789
FT                   protein family HMM PF02789"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13818"
FT                   /db_xref="GOA:Q73IU2"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73IU2"
FT                   /protein_id="AAS13818.1"
FT                   /translation="MYSLQLFATEIPAMKITISKISPDFKTIVMGLFEDNETVNDGGVL
FT                   QGKQVIDNIKQFSDFNGSFGEFFSTALPEEKNVIVVGLGKKDEWNENKELNIGGKIYCE
FT                   LSRLKIKKAAVLIEGSAANVAYGAFLRSFKFDKYKTKKDEKITEVEEITVLVKDEQLSN
FT                   AERSFEHLRQEGESIFLARSFITEPPNILYPESYADHIKKELTKLGLEIEVLDKKQMEE
FT                   KKMGALLGVAQGSSKEPKLVVIKWNGASKEQKPIAFVGKGITFDTGGVSLKPSRGMESM
FT                   KYDMAGSATVVGVMHALAGRKAKVNAIGVVALAENAVGGNAQRPSDVVTSMSGQTIEVL
FT                   NTDAEGRLILADALWYTQDRFSPKFMIDLATLTGAIVVALGNNEYAGLFSNNDELANRL
FT                   IDAGNEVNEKLWRFPMNETYDKIIDSPIADVQNIAPAGSGGDSIMAAQFLQRFVNETCW
FT                   AHLDIAGTAWHEKGTDICPRGAVGFGVRLLNKLVEKYYEAND"
FT   gene            55045..56232
FT                   /locus_tag="WD_0056"
FT                   /old_locus_tag="WD0056"
FT   CDS_pept        55045..56232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0056"
FT                   /old_locus_tag="WD0056"
FT                   /product="major facilitator family transporter"
FT                   /note="Identified by match to PF00083 protein family HMM
FT                   PF00083"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13819"
FT                   /db_xref="GOA:Q73IU1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IU1"
FT                   /protein_id="AAS13819.1"
FT                   /translation="MESRAKAWFIWLISNLVVIFSNMQIIYTFISVNLEKELGLTIAQV
FT                   ALANSAYTWTFAILQFFSGATFNVFSSKKIYFFSLSTMILGFFVLINSDNFSHLILSQV
FT                   LIATGASFGFIGAAHTSSICFSAAQFGLMFSLVQTISSLSALVIQILFSNLLAEDAYWK
FT                   NLIVCIILFGVLIFVLTLFCPNTLPKSSSEKRTIKSSMKTVMCSILTVLKLRDIWITSV
FT                   VGAITFGTFLALNTLWAPRLLGNSELNAMESGIATAILWLGLAVGAPIADRISNLFKNR
FT                   KHVISAFALLQGVSIIILLYSHLTVHVVYFCMLMFGFFAGGHMLNFTVGSEIVKRKYIS
FT                   TSSSIINGFMFIGSGVIVSMLALFTDHKMELFAIFAILIVAGILNYATKETYSKK"
FT   gene            56293..56598
FT                   /locus_tag="WD_0057"
FT                   /old_locus_tag="WD0057"
FT   CDS_pept        56293..56598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0057"
FT                   /old_locus_tag="WD0057"
FT                   /product="DNA-binding protein, HU family"
FT                   /note="Identified by match to PF00216 protein family HMM
FT                   PF00216"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13820"
FT                   /db_xref="GOA:Q73IU0"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005684"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IU0"
FT                   /protein_id="AAS13820.1"
FT                   /translation="MDHVTTKDTTVTKATIAGDINQEIGLSKEDSVSIIDDILDEIKTS
FT                   LVKDGIVKISSFGTFLVKKKKERPGNIPNTSEKVMIQARNSVSFRPSKIIKKSINN"
FT   gene            56598..56924
FT                   /locus_tag="WD_0058"
FT                   /old_locus_tag="WD0058"
FT   CDS_pept        56598..56924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0058"
FT                   /old_locus_tag="WD0058"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to OMNI:NTL02ML6634"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13821"
FT                   /db_xref="GOA:Q73IT9"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IT9"
FT                   /protein_id="AAS13821.1"
FT                   /translation="MNKEKLFYTIGEVAEELHLEQHVLRFWEGQFHQIKPTKRKGRRLY
FT                   DRKCIEAIKKVKYMLYDKGYTIKGVQKEFGNDIKVTKNLLQELTDLRDYLTSKINNEES
FT                   NKQA"
FT   gene            56994..57566
FT                   /gene="nlpD"
FT                   /locus_tag="WD_0059"
FT                   /old_locus_tag="WD0059"
FT   CDS_pept        56994..57566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nlpD"
FT                   /locus_tag="WD_0059"
FT                   /old_locus_tag="WD0059"
FT                   /product="peptidase, M23/M37 family"
FT                   /note="Identified by match to PF01551 protein family HMM
FT                   PF01551"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13822"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IT8"
FT                   /protein_id="AAS13822.1"
FT                   /translation="MLLAILIGCGLQKPAPVLLKGEEFYGKRDLEYTREYHLIREPSVQ
FT                   KESRKAIINRIYKDNNNTQNVGVNCKFVMPVKGSATSSDEMCKDGIKIAAQNGTNVVSS
FT                   APGKVIYVGKGLRWYGNLIIVEHKDNYMTVYSYLKNIHVEIGDKVKQGQVIGSAGKSST
FT                   QDKDPQMCFTIRHNGQAVDPLMHMNCN"
FT   gene            57579..60095
FT                   /gene="leuS"
FT                   /locus_tag="WD_0060"
FT                   /old_locus_tag="WD0060"
FT   CDS_pept        57579..60095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="WD_0060"
FT                   /old_locus_tag="WD0060"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /note="Identified by similarity to EGAD:9061; match to
FT                   TIGR00396 protein family HMM TIGR00396; match to PF00133
FT                   protein family HMM PF00133"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13823"
FT                   /db_xref="GOA:Q73IT7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73IT7"
FT                   /protein_id="AAS13823.1"
FT                   /translation="MKYDFKSVEKFYQDKWDFSVSKSGKQEKCYVLEMFPYPSGKIHMG
FT                   HLRNYAIGDVIARYKRANGFEVLHPIGWDAFGLPAENAARDNNISPETWTKENIDNMRT
FT                   QLKSIGLSYNWERELSTCEPDYYKHEQKFFLDFLKHGLAYRKESWVNWDPVDQTVLANE
FT                   QVVDGKGWRSGAVVEKRKLSQWFLKITDFAEDLLKCLQSLKNWPEKVKTMQERWIGKSE
FT                   GATIEFEVVGLNKKLKVFTTYPHTLFGASFCAVAAEHPIVQDLKNGSSVVIPVLDTGIQ
FT                   EIKSKRENDEKIGVYTGLNVKHPFLDKELPLYIANFVLMEYGEGAIFGCPAHDQRDFEF
FT                   AQKYNLPIIPVISSAHLGVIPARDQNSYNGSQCQATQMTKEAYTGDGTMFNSEFLNGLM
FT                   VSEAKEAIVKKFEEKKIGKKTINYRLHDWGVSRQRYWGCPIPIIYCKDCGTVPVPEKDL
FT                   PVVLPIDVEFTSGGNPLDKHPTWKFVDCPKCGKQAERETDTFDTFFESSWYFAAFCSED
FT                   KSIDKDACNRFMPVDYYIGGIEHAILHLLYSRFFCRALTKCGYFDIKEPFSTLITQGMV
FT                   CHATYKDENGKWLFPAEAKELIARGAKVQVGKVEKMSKSKKNTVDPNFIIEKYGADTAR
FT                   LFVLSDTPPEKDMEWSDDGVEGCSRYVNKLWRMVMQLRPVNIHYDNENVTGGLLEYRKK
FT                   IHKLLHGLTDDLENCRLNCVVAKFREMTNLIAEIDVKTGKSLIDEGICILIRVIEPFIP
FT                   HLAESLWQEIGGQPWPKADESLLVDDTVTIAVQINGKLRTTIKVAINLPQEELKKIAID
FT                   SVSSKIDQSKVRTVYAVPNKIVNIVI"
FT   gene            60224..60859
FT                   /locus_tag="WD_0061"
FT                   /old_locus_tag="WD0061"
FT   CDS_pept        60224..60859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0061"
FT                   /old_locus_tag="WD0061"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13824"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IT6"
FT                   /protein_id="AAS13824.1"
FT                   /translation="MKIKRLCVLAVLLTSSLAGAASNSASKSEDKYYAGLNFGAGWGGG
FT                   FKMKPGVVLGYHYDQNSKFELEVLSNIKSLKSIGASLLANYRFYPDLDIDPVKLYVSGG
FT                   LGGYLQITPFGFGVSDTVDGDGNSSQEEKEKEEETQGAPESGGEAAGSSVVDKILSSIS
FT                   YKLKLGVDYEITPQIIGAVGMTMGGQLSGIKAKQIPDATLEIGVRYNF"
FT   gene            61230..61331
FT                   /locus_tag="WD_0062"
FT                   /old_locus_tag="WD0062"
FT   CDS_pept        61230..61331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0062"
FT                   /old_locus_tag="WD0062"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13825"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IT5"
FT                   /protein_id="AAS13825.1"
FT                   /translation="MVKAKMTLPRKSGEKVWNVFYKKNDASNCSGMQ"
FT   gene            complement(61332..62366)
FT                   /pseudo
FT                   /locus_tag="WD_0063"
FT                   /old_locus_tag="WD0063"
FT                   /note="transposase, IS3 family, degenerate; This gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error.Identified by similarity to EGAD:43417"
FT   gene            62503..63210
FT                   /gene="pdxJ"
FT                   /locus_tag="WD_0064"
FT                   /old_locus_tag="WD0064"
FT   CDS_pept        62503..63210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxJ"
FT                   /locus_tag="WD_0064"
FT                   /old_locus_tag="WD0064"
FT                   /product="pyridoxal phosphate biosynthetic protein PdxJ"
FT                   /note="Identified by similarity to SP:P24223; match to
FT                   PF03740 protein family HMM PF03740; match to TIGR00559
FT                   protein family HMM TIGR00559"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13826"
FT                   /db_xref="GOA:Q3V8B3"
FT                   /db_xref="InterPro:IPR004569"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036130"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3V8B3"
FT                   /protein_id="AAS13826.1"
FT                   /translation="MKLGVNIDHVATLRNARGTSYPDPLKAAEIAIDAGADFITVHLRE
FT                   DRRHIRDEDVFNLKKSISTELNLEIAATEEMLEIAKKVKPYSISIVPEKREELTTEGGL
FT                   DIVNMHSKLSSIIEEMHSSSIKVSLFIDPNIDQLKYLEKLGTKPDIIEIHTGDYCDNPS
FT                   EKKLQLITNAAEYVNKLGIECHAGHGITYKHAKKMTRIPHISALNIGHYLISEAVFYGL
FT                   HSVVKTMKMTMSN"
FT   gene            complement(63203..63514)
FT                   /locus_tag="WD_0065"
FT                   /old_locus_tag="WD0065"
FT   CDS_pept        complement(63203..63514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0065"
FT                   /old_locus_tag="WD0065"
FT                   /product="DNA-binding protein, HU family"
FT                   /note="Identified by match to PF00216 protein family HMM
FT                   PF00216"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13827"
FT                   /db_xref="GOA:Q73IT4"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IT4"
FT                   /protein_id="AAS13827.1"
FT                   /translation="MSKEDIIKQLKEDCSSQNIDITKSDLSKIHDAFIKIIKNELHGKG
FT                   EIRLHGIGTFSTAISQEKQCRNPQSGQIMTVPKKTRVKFKASQTLLSILNEKEKAAVS"
FT   gene            complement(63661..64116)
FT                   /gene="rpsI"
FT                   /locus_tag="WD_0066"
FT                   /old_locus_tag="WD0066"
FT   CDS_pept        complement(63661..64116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="WD_0066"
FT                   /old_locus_tag="WD0066"
FT                   /product="ribosomal protein S9"
FT                   /note="Identified by similarity to SP:P02363; match to
FT                   PF00380 protein family HMM PF00380"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13828"
FT                   /db_xref="GOA:Q73IT3"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IT3"
FT                   /protein_id="AAS13828.1"
FT                   /translation="MKSSTINNNDWSEKTIKSAVDSLGRLYATGRRKESVARVWIKPGS
FT                   GKFSVNKKGDLISYFKRESVCQIVKMPFVATSTLDKYDVFATVKGGGLSGQAGALAHGI
FT                   SRALSSVSQDLHSILRNGEFLTRDSRVVERKKYGQHKARKKCQFSKR"
FT   gene            complement(64127..64585)
FT                   /gene="rplM"
FT                   /locus_tag="WD_0067"
FT                   /old_locus_tag="WD0067"
FT   CDS_pept        complement(64127..64585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="WD_0067"
FT                   /old_locus_tag="WD0067"
FT                   /product="ribosomal protein L13"
FT                   /note="Identified by match to TIGR01066 protein family HMM
FT                   TIGR01066; match to PF00572 protein family HMM PF00572"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13829"
FT                   /db_xref="GOA:Q73IT2"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73IT2"
FT                   /protein_id="AAS13829.1"
FT                   /translation="MKTFFLKEKQINKKWFVIDAEGLVVGRLAAFVATLLRGKHKPEYT
FT                   PHMDCGDNVIIINAERVHFTGKKLKDKIYYKHTGYSGGLKKTTPDNILNGKFPERVIEM
FT                   AVKRMLDDGPMARRRFENLYVYSGSEHKHQGQQPEKIDFASLNRKNKK"
FT   gene            64715..65938
FT                   /locus_tag="WD_0068"
FT                   /old_locus_tag="WD0068"
FT   CDS_pept        64715..65938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0068"
FT                   /old_locus_tag="WD0068"
FT                   /product="outer membrane protein TolC, putative"
FT                   /note="Identified by similarity to EGAD:163051; match to
FT                   PF02321 protein family HMM PF02321; match to PF02321
FT                   protein family HMM PF02321"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13830"
FT                   /db_xref="GOA:Q73IT1"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IT1"
FT                   /protein_id="AAS13830.1"
FT                   /translation="MFRLIITLAIIFNTISCYATDVGEVISKAIKNSSKIKSQFYQYKS
FT                   AEKHYKSSGLAGFLPDINLQYNFDSNFNLDTSEKKLTLRQKLIDGGGTFATFSRSSHLL
FT                   KAEKMRFQQLKQELALNAVKAYVNVLQKTEILKLREHKERVSLEHLSAMKKRFSLGEVT
FT                   NAEVLLAKAKFSSSISERVDAEGKLKLVNIAYYHLIGEDADDLSEANDKLPSVPELNEC
FT                   LQLAKTNNLSLKAAVYQKRAAGMEVIAESSKWLPSLNLSASKNFGEDGMKVDKLLENVH
FT                   VVFTLDVPIFKRGVNAFGVSKAKMDAKKSTYDYYETVKNIEQAVVNAWNNVLTAKAIIK
FT                   ASQEAEKAAALALEGVEQEVNLNLKSTSDLLDTEDALFKARSDLVEAKSNYVISVYNLL
FT                   FMINSINL"
FT   gene            65958..66533
FT                   /locus_tag="WD_0069"
FT                   /old_locus_tag="WD0069"
FT   CDS_pept        65958..66533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0069"
FT                   /old_locus_tag="WD0069"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13831"
FT                   /db_xref="InterPro:IPR019632"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IT0"
FT                   /protein_id="AAS13831.1"
FT                   /translation="MHDEQGNQSVKDILEDIKKAISGKNASNDKAEIKDENDDVLYLEE
FT                   EYPEEIEEDGKKENNEKEDIDNDDQSEEMACNNNQFNGHSYNSEEKKDIYLYDNIQMSN
FT                   NKASNSGLQAQNNDHLILKENMEEIKALLGKMQNELQHKQQKKANLTVEELVTSLLKPQ
FT                   LSEWLNKYLHALVKEVVEKELKDIINNK"
FT   gene            66610..67188
FT                   /locus_tag="WD_0070"
FT                   /old_locus_tag="WD0070"
FT   CDS_pept        66610..67188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0070"
FT                   /old_locus_tag="WD0070"
FT                   /product="ribosomal RNA large subunit methyltransferase J,
FT                   putative"
FT                   /note="Identified by similarity to EGAD:22071; match to
FT                   PF01728 protein family HMM PF01728"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13832"
FT                   /db_xref="GOA:Q73IS9"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73IS9"
FT                   /protein_id="AAS13832.1"
FT                   /translation="MNDQYVQKTSKDGYRSRSAYKLVEMDNKFKLFQEGQKIIDLGASP
FT                   GGWSQVASQKGANVVALDIKPMNAINGVEFIQCDIINEFEILREKFKDQKFDVILSDMA
FT                   PESCGLKSLDHIRIMLLCEAALNFAKHFLSHGGTFVVKIFQGESDKDFCNELKKMFKTV
FT                   KYFKPKSSRSESTEMYLVSLGFIGSKPSI"
FT   gene            complement(67587..67694)
FT                   /locus_tag="WD_0072"
FT                   /old_locus_tag="WD0072"
FT   CDS_pept        complement(67587..67694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0072"
FT                   /old_locus_tag="WD0072"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13833"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IS8"
FT                   /protein_id="AAS13833.1"
FT                   /translation="MSFSYKYLRNLPNEKKGKRSPVVIICFKILAFFMF"
FT   gene            68396..70798
FT                   /locus_tag="WD_0073"
FT                   /old_locus_tag="WD0073"
FT   CDS_pept        68396..70798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0073"
FT                   /old_locus_tag="WD0073"
FT                   /product="ankyrin repeat domain protein"
FT                   /note="Identified by match to PF00023 protein family HMM
FT                   PF00023; match to PF00023 protein family HMM PF00023; match
FT                   to PF00023 protein family HMM PF00023; match to PF00023
FT                   protein family HMM PF00023; match to PF00023 protein family
FT                   HMM PF00023; match to PF02370 protein family HMM PF02370;
FT                   match to PF02370 protein family HMM PF02370; match to
FT                   PF02370 protein family HMM PF02370; match to PF02370
FT                   protein family HMM PF02370; match to PF02370 protein family
FT                   HMM PF02370; match to PF02370 protein family HMM PF02370"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13834"
FT                   /db_xref="GOA:Q73IS7"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IS7"
FT                   /protein_id="AAS13834.1"
FT                   /translation="MEKKKFFEIINEVSKSEGLNENNLLERIGNKLKDADSIVYSTYNN
FT                   LKIDKMFSILDSDKIVNYMLVHLAVECNSVPIVKLLLAKEAKVNEPIYELDEAKSKLTA
FT                   LHIAALHGHQEIVQLLLNNDANPLLKDSQGRTPRDIVGDVEGKKAIIKMLEEGEQRYAE
FT                   TRATRRQPYRQGTLLQPNNKTPGNLALNGNNVTAAVQTWGAKHQEENSRITPNNKKVYV
FT                   QDEDEQTSSNSIVNENNTDKVDDTLEKEQAIRERDAMAQKLQEAEQRLANNQKRIEHND
FT                   LHSQHPEQYTTYNGEQTFLNKSNSGDSGIYFDADESEALGQSILENGEDINAQDKDGVT
FT                   HLHWAIADNNKESVELLVKCGAKVDVQDKDGLTPLHYAAAYGCVEIAEYLVEGGANVNA
FT                   QDKVEHTPLYYALANDNKKLAKLLIKHGADRSLIKDEDLIDRLNSMCDQPSEVVPSTFS
FT                   HSKTHNATETPEKAEKVEKRKAKLKELRTQLKDEQKKNELLKQKIQDLESKNTTLNSEL
FT                   EKTKTKTDEVPLEKAQKELTELKSYITGHGARLDTLEKLNEENESLRQEIKNLKNENTT
FT                   LKGELEKTKTKKNEVPLEKAQKELTELRNCVTEHETKLEVLEKLNEENESLEQKIQDLE
FT                   SKNTTLNSELEENENKHSKTKVLLEKAQKELAESKSCIVGHETKLKEFNKENESLTQKI
FT                   RSLENENTPLDGELGKTKTNEVSLEKVGKRQFSPKVAYASLAAMLAVGAALSIASGLSA
FT                   LLIVAAAVVSALIAGGITYTISKPIAEPKPTTELKEVNIQDSAQRCL"
FT   gene            70932..71258
FT                   /locus_tag="WD_0074"
FT                   /old_locus_tag="WD0074"
FT   CDS_pept        70932..71258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0074"
FT                   /old_locus_tag="WD0074"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13835"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IS6"
FT                   /protein_id="AAS13835.1"
FT                   /translation="MSLIDMKTFTKNFKNNEKKLEEFNKEIEDITTIAQDKFAHELENI
FT                   AYDSVQKFRSLLAKELNSTFNNIHSQNVNLLKSSLVEYAISSNFINKKGETALIRSLLN
FT                   IFIR"
FT   gene            complement(71248..71340)
FT                   /locus_tag="WD_0075"
FT                   /old_locus_tag="WD0075"
FT   CDS_pept        complement(71248..71340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0075"
FT                   /old_locus_tag="WD0075"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13836"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IS5"
FT                   /protein_id="AAS13836.1"
FT                   /translation="MGQILLTLAMQLACNIKLNWRSNNSECFIV"
FT   gene            71395..71877
FT                   /locus_tag="WD_0076"
FT                   /old_locus_tag="WD0076"
FT   CDS_pept        71395..71877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0076"
FT                   /old_locus_tag="WD0076"
FT                   /product="uncharacterized phage protein, putative"
FT                   /note="Identified by similarity to GP:15155962"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13837"
FT                   /db_xref="InterPro:IPR021146"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IS4"
FT                   /protein_id="AAS13837.1"
FT                   /translation="MSIRSTSPRISVQRKSKPESFPVTLEEVKSFLRIENDQDDKLISD
FT                   LIFMATDYAEWHMEKSLVKQTWQVSYEDYVPRRIYLSYGPVSKIVLATAMMSKNQEKST
FT                   LKYYFSDVGGYVEFFNCLNAIRVDVVYEAGYDNVPEQIKLGIMRHVSALYKNVNRR"
FT   gene            72249..72659
FT                   /locus_tag="WD_0077"
FT                   /old_locus_tag="WD0077"
FT   CDS_pept        72249..72659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0077"
FT                   /old_locus_tag="WD0077"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13838"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IS3"
FT                   /protein_id="AAS13838.1"
FT                   /translation="MKKIQAINELYSSIYEALKANSDLRKYVTNIYDYLPKQVTIPYLR
FT                   LCVVNYNNLHMLSNFATKARFSCDIYTYHIDSMFAIIRHINLILKSIEGFNNEAILESN
FT                   CAMDQHDEILHSTINFDILIKGGDNEQITAKN"
FT   gene            72634..73023
FT                   /locus_tag="WD_0078"
FT                   /old_locus_tag="WD0078"
FT   CDS_pept        72634..73023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0078"
FT                   /old_locus_tag="WD0078"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13839"
FT                   /db_xref="InterPro:IPR011855"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IS2"
FT                   /protein_id="AAS13839.1"
FT                   /translation="MSKLQLKIKDHDNNFIVLNNIRNLRFTLRNNREEVKDISSFGWRK
FT                   VLDCAGSRHITIKINGILDSVLADELLRNSAMLNSNNDYEISFNAKEKIRLRCSVELYE
FT                   RYYDPVTFDSFTVVLNSAEVVNAFH"
FT   gene            73059..73874
FT                   /locus_tag="WD_0079"
FT                   /old_locus_tag="WD0079"
FT   CDS_pept        73059..73874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0079"
FT                   /old_locus_tag="WD0079"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13840"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IS1"
FT                   /protein_id="AAS13840.1"
FT                   /translation="MRILTKLKKIMNDENLFEEDGDNIEENNDDKRERSLENENQQNQE
FT                   EQHKEEDKQYIIQYIQDYLKVFEDILNQIDEGIDNSDSYERTMQIKRSIDRLIETLYSQ
FT                   AASEDIDAEFETTKHTRDKSESMKRVREKRRKQVIEEVLSSMFAQQQKELMNAKHLSHG
FT                   HETAKDGDVHEAKEKVKSSIRGVLFSVIAHRMDPRRRAGETADGNEKQAHIYGREAVGE
FT                   ALGALLKTFLTAVIAVVREIAKPLQKPETSFAKQVEESRNADSQKGRSV"
FT   gene            74176..74280
FT                   /locus_tag="WD_0080"
FT                   /old_locus_tag="WD0080"
FT   CDS_pept        74176..74280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0080"
FT                   /old_locus_tag="WD0080"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13841"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IS0"
FT                   /protein_id="AAS13841.1"
FT                   /translation="MVKIQLRQSLANSLEQTIMLREVTSVVKLMEWTI"
FT   gene            complement(74381..75415)
FT                   /pseudo
FT                   /locus_tag="WD_0081"
FT                   /old_locus_tag="WD0081"
FT                   /note="transposase, IS3 family, degenerate; This gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error.Identified by similarity to EGAD:43417"
FT   gene            complement(75578..76705)
FT                   /locus_tag="WD_0082"
FT                   /old_locus_tag="WD0082"
FT   CDS_pept        complement(75578..76705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0082"
FT                   /old_locus_tag="WD0082"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to EGAD:163073"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13842"
FT                   /db_xref="GOA:Q73IR9"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IR9"
FT                   /protein_id="AAS13842.1"
FT                   /translation="MQNSASSKTILDKEIFYAELDGKIDLRFGYAFNRDSFNAKPKDKT
FT                   SSYSYLRFLYLQQVYPNTQMGVNVKAGVSGIANLKALDIEKLDMEEWYFIIKNQELGSI
FT                   EYGKRSLVGQSMLINTSKIYAAAGGVNGHWTNYANLRGDHKKDGDPGYNQDKVFWVKPN
FT                   IYSDYNELELGLKQSSINYISPEIYNFQLGFSYVPGKNNLQYSNLIAAGLSYKNSLSND
FT                   IGFTTALTGEFARENLTGCSDGTSKNYECRNQLLHWNFGLKLKLFDLDCIFSYGNGGES
FT                   GERRNPEINNTYYMNAGIAYHSDSYKSSLTYFSSGRDIAGEGTNELTSYALSLENSLFL
FT                   GTSYYFDIVKFSTKEPKTENNNSGYVLLAGLKLSF"
FT   gene            complement(76813..77628)
FT                   /locus_tag="WD_0083"
FT                   /old_locus_tag="WD0083"
FT   CDS_pept        complement(76813..77628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0083"
FT                   /old_locus_tag="WD0083"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13843"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IR8"
FT                   /protein_id="AAS13843.1"
FT                   /translation="MDDFITARRKDDAVVSVCQDNKKKNVLILGLNQVARDLLKYEEKN
FT                   LLNKPLINILSTRAADNVKNYLEYTENGHDLLDILPKVIDFSLIDAKGEDIRTKVKVFR
FT                   TAQFASNKINYELLIRDISLSHKLGIFRDKYLMGKKYKNHDLFDIPGNESTILELYVIL
FT                   NFAFQHQINAAIGVIGLNSSCSETNNALKVIIEHFYKNCRSDDFLGYIDENKVLFVLIN
FT                   CDVKSISKIINRIHSAINKQLLKRKLPSVSIIYGNIAQKQAAKSTSGAF"
FT   gene            77726..77830
FT                   /locus_tag="WD_0084"
FT                   /old_locus_tag="WD0084"
FT   CDS_pept        77726..77830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0084"
FT                   /old_locus_tag="WD0084"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13844"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IR7"
FT                   /protein_id="AAS13844.1"
FT                   /translation="MEWLCCRRIKITVYRLQVTAKNILKHSDILTLPS"
FT   gene            77862..78647
FT                   /gene="fabI"
FT                   /locus_tag="WD_0085"
FT                   /old_locus_tag="WD0085"
FT   CDS_pept        77862..78647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI"
FT                   /locus_tag="WD_0085"
FT                   /old_locus_tag="WD0085"
FT                   /product="enoyl-(acyl-carrier-protein) reductase"
FT                   /EC_number="1.3.1.9"
FT                   /note="Identified by similarity to SP:P29132; match to
FT                   PF00106 protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13845"
FT                   /db_xref="GOA:Q73IR6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IR6"
FT                   /protein_id="AAS13845.1"
FT                   /translation="MTTSLLQGKKGLITGIINKRSIAYGIAKTLSEHGAELAITYQNEI
FT                   IKEKLSPIADELNVELILHCDVSNEKIIDNAFEIIEKKWGTLDFLVHAIAFSDKNELDG
FT                   KYVNTSLDNFLNAMHISCYSFTALAQRAEKMMSNGGSLLTLSYYGAEKVMPNYNVMGLC
FT                   KAALEASVKYIACDLGPQNIRVNAISAGPIRTLASSGISDFHSISEWNRNNSPLRRNVT
FT                   IEDVGKAALYLLSDLSSGTTGEILHVDSGYNVVGMKVVD"
FT   gene            complement(78664..80169)
FT                   /gene="secD"
FT                   /locus_tag="WD_0086"
FT                   /old_locus_tag="WD0086"
FT   CDS_pept        complement(78664..80169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="WD_0086"
FT                   /old_locus_tag="WD0086"
FT                   /product="protein-export membrane protein SecD"
FT                   /note="Identified by similarity to EGAD:162820; match to
FT                   TIGR01129 protein family HMM TIGR01129; match to TIGR00916
FT                   protein family HMM TIGR00916; match to PF02355 protein
FT                   family HMM PF02355"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13846"
FT                   /db_xref="GOA:Q73IR5"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IR5"
FT                   /protein_id="AAS13846.1"
FT                   /translation="MYNRLIVKSFSVLCICLFALYITLPNFFDNKLFISKKRINLGLDL
FT                   KGGASLLLNIDLDFYFKEKLSMLANEIKETLLTKNIESNVQNSVITLNSIDDYKKASVL
FT                   INTINPNLELNRKDSSILISYKPHYKNSLISEVAAESINNVQRRLDKLGTKEVSVQKQG
FT                   QNKILVQVPGVEDTKQIKSLLGKTAKLAFHLANTNIAKVQDIDHETTVMLKDSLGNSYP
FT                   IFRKTEIGGDSLVNASVRFGNLGKPTVHFKFDSIASKRFAKITKENVGKPFAIVLDNTV
FT                   LTVPTIREPILNGEGEISGNFTEKQASELAILLKSGALPAPLKIIEEKNIGPSLGEESI
FT                   KAGEMAATISIIAVALFIIITYGKLGVLASVALFSNVVLILSILTLLEATLTLPGIAGI
FT                   ALTVGMAVDANVLIFERIREEIKSGKRVERAIEEGFKNAIKTILDSNITTLIAAGIMFI
FT                   IGSGAIRGFSVTLSIGILCSMFSAITVTKLLIELCMNPKELAL"
FT   gene            complement(80417..81314)
FT                   /pseudo
FT                   /locus_tag="WD_0088"
FT                   /old_locus_tag="WD0088"
FT                   /note="transposase, IS3 family, degenerate; This gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error.Identified by similarity to EGAD:43417"
FT   gene            complement(81378..82862)
FT                   /gene="guaB"
FT                   /locus_tag="WD_0089"
FT                   /old_locus_tag="WD0089"
FT   CDS_pept        complement(81378..82862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="WD_0089"
FT                   /old_locus_tag="WD0089"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="Identified by similarity to EGAD:9188; match to
FT                   TIGR01302 protein family HMM TIGR01302; match to PF00478
FT                   protein family HMM PF00478; match to PF00571 protein family
FT                   HMM PF00571; match to PF00571 protein family HMM PF00571"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13847"
FT                   /db_xref="GOA:Q73IR4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IR4"
FT                   /protein_id="AAS13847.1"
FT                   /translation="MEACYSFDDILLLPAYSNILPCDADTKTYLTNSIELNIPLISSAM
FT                   DTVTESGFAIAIAQHGGIGCIHKNLSIDEQVLEVRRVKKYESWIVYNPITISQDKTVAE
FT                   AISLMREHNYSGIPVVDQRKLVGILTNRDMRFIEDQNMNVKVSEVMTKDKLVTVREQGV
FT                   NSASAMKLLHENRIEKLLVVDENSCCIGLITVKDIEKYNRYPNSCKDSKGRLRVAAAIG
FT                   TGKKDGIDRCEALIGEEVDVVVVDTAHGHSENVINTIREIKKMYPNTQLIGGNIATKEA
FT                   AEALIDAGVDAVKVGIGPGSICTTRIVTGVGVPQFSAIKNVAEACRARNVRLIADGGVK
FT                   YSGDVAKAIAAGADSVMIGSIFAGTDESPGEIIMYKGRAYKGYRGMGSISAMKRGSASR
FT                   YFQDKDSKLKLVPQGVEGRVPFKGPASGVIHQLIGGLQAAMGYTGNRNIEEMKKNCKFV
FT                   TITASGLRESHAHDIVITQEAPNYAYQTSNLSTDSE"
FT   gene            complement(82988..83848)
FT                   /gene="ksgA"
FT                   /locus_tag="WD_0090"
FT                   /old_locus_tag="WD0090"
FT   CDS_pept        complement(82988..83848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="WD_0090"
FT                   /old_locus_tag="WD0090"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="Identified by similarity to EGAD:18456; match to
FT                   TIGR00755 protein family HMM TIGR00755; match to PF00398
FT                   protein family HMM PF00398"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13848"
FT                   /db_xref="GOA:Q73IR3"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73IR3"
FT                   /protein_id="AAS13848.1"
FT                   /translation="MNFRQLIFKILYNENNMKKFLLKPKKSLGQNFILSSEITKKIVAL
FT                   AGSLENFNVIEIGPGYGALTREILVHNPKSLLSIEKDRDLVKHHDQLLNEHQGKYRIIE
FT                   ADALHIIEEELIERPVKVIANLPYNISVALFLKWLDSIKFFTSLTLMFQKEVADRITAR
FT                   PNSKDYGPLSVLSQLLCDIKKEFDIEPKEFFPRPKIHSSVITVNPLPTPKFVVNLETLI
FT                   KLIRAVFAQRRKMLRNSLQNITNHAETVLENAKLSGNERPENLTIEQFCLLANNVECLL
FT                   CNKMY"
FT   gene            83879..83951
FT                   /locus_tag="WD_tRNA-Thr-1"
FT                   /old_locus_tag="tRNA-Thr-1"
FT   tRNA            83879..83951
FT                   /locus_tag="WD_tRNA-Thr-1"
FT                   /old_locus_tag="tRNA-Thr-1"
FT                   /product="tRNA-Thr"
FT   gene            83976..84704
FT                   /gene="tpiA"
FT                   /locus_tag="WD_0091"
FT                   /old_locus_tag="WD0091"
FT   CDS_pept        83976..84704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpiA"
FT                   /locus_tag="WD_0091"
FT                   /old_locus_tag="WD0091"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="Identified by similarity to EGAD:49267; match to
FT                   PF00121 protein family HMM PF00121; match to TIGR00419
FT                   protein family HMM TIGR00419"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13849"
FT                   /db_xref="GOA:Q73IR2"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73IR2"
FT                   /protein_id="AAS13849.1"
FT                   /translation="MSFLIVANWKMNGMRSSFVDFIGKLNNKSNEITSKLVICPPFTSF
FT                   PSSIELNNNIDIGAQNCHHKKFGSYTGEISAEMLKELGCTYVMLGHSERANEKDSEIKL
FT                   KSEIAIESGLHPIICVGENSEDYKNEKTKEVIEYQCKNRLPTHGEYTVAYEPIWAIGTG
FT                   HVPNNDAIAKVIEVIKLCTSKKHIIYGGSVSSENIENLLSISNLSGVLIGSASLDFDHF
FT                   YKIIQQVEKKFSLINSKISN"
FT   gene            complement(84779..85867)
FT                   /gene="dprA"
FT                   /locus_tag="WD_0092"
FT                   /old_locus_tag="WD0092"
FT   CDS_pept        complement(84779..85867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dprA"
FT                   /locus_tag="WD_0092"
FT                   /old_locus_tag="WD0092"
FT                   /product="DNA processing chain A"
FT                   /note="Identified by similarity to OMNI:CC2447; match to
FT                   TIGR00732 protein family HMM TIGR00732; match to PF02481
FT                   protein family HMM PF02481"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13850"
FT                   /db_xref="GOA:Q73IR1"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IR1"
FT                   /protein_id="AAS13850.1"
FT                   /translation="MKINKLNNKELEVWLSLARTIGPIKFFSILRTHGSLDEVLKYLNK
FT                   VANDKVYGIQDAREEINNAERIGAKIIPACDPDYPDLLRNIPSCPPVITALGDISLLSR
FT                   EIIAIIGGRNSSMNGRNFANKLALDLSEAGFIIVSGLARGIDTAANSVIYKNHPTIAVT
FT                   ASGIDVVYPKENFDLYKKITGNGGLVITELPFATKPKPQYFPQRNRIISGLSLGVAVIE
FT                   ASKRSGSLITADFALNQGREVFAVSGFPLDSRCSGSNYLIKNGAKLIESADDIIESIRF
FT                   SLPPQQKNLFDVEHHFVNQKQEKLQQAKSVIVDHINSVPVDIDELILASGLSTNIALMA
FT                   LLELELENKIERSPGNKISLIF"
FT   gene            85929..86303
FT                   /locus_tag="WD_0093"
FT                   /old_locus_tag="WD0093"
FT   CDS_pept        85929..86303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0093"
FT                   /old_locus_tag="WD0093"
FT                   /product="ferredoxin, 4Fe-4S"
FT                   /note="Identified by similarity to EGAD:22805; match to
FT                   PF00037 protein family HMM PF00037; match to PF00037
FT                   protein family HMM PF00037"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13851"
FT                   /db_xref="GOA:Q73IR0"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR022569"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IR0"
FT                   /protein_id="AAS13851.1"
FT                   /translation="MTHFVTDKCIKCKYTDCVEVCPVDCFYEGKNMLVINPDECIDCGV
FT                   CIPECPVDAIVTDDSIKDILELDEELLSSEQKTFKLFYDINVEYSQKWPNITAKKQPLY
FT                   TAEEYKEKKDKTAYFDENLE"
FT   gene            86633..87280
FT                   /locus_tag="WD_0094"
FT                   /old_locus_tag="WD0094"
FT   CDS_pept        86633..87280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0094"
FT                   /old_locus_tag="WD0094"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13852"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IQ9"
FT                   /protein_id="AAS13852.1"
FT                   /translation="MIKEYHSLFEKISWSCGITAGSAQDANASSFNEVFKLGSKELALA
FT                   MTSDLRKSYDQELFKKYKKEEMSYPEGEGVQFIRELRVLSRILTISLIRKLDEVYKFTP
FT                   EEIERLKEYMLVSNYDISKSLSDIDKYMHALSALIRNSSLDTKKIFELNNRMIIHTTAL
FT                   IDLVTSGVVKKEEAKEQSAEDLEKLICEQYKGAANTPLPLQSTLFEVDKKSA"
FT   gene            87366..88313
FT                   /locus_tag="WD_0095"
FT                   /old_locus_tag="WD0095"
FT   CDS_pept        87366..88313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0095"
FT                   /old_locus_tag="WD0095"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="Identified by similarity to EGAD:163157; match to
FT                   PF01820 protein family HMM PF01820"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13853"
FT                   /db_xref="GOA:Q73IQ8"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73IQ8"
FT                   /protein_id="AAS13853.1"
FT                   /translation="MIPTIAILSGGFSCEREISLMSGKAVKKALDSLSYNAIEIDVDSN
FT                   IAEKLKKINPGLAFIALHGPYGEDGCIQGLLEILGIKYTHSGVMASAVAINKVMSKHIF
FT                   RSLNIDTPKGYVISREDVLKNNIKIDYPYVLKPINEGSSIGVYIIFSHEDYLELKNNSS
FT                   TIMEKMIVEEYIPGIELHTAVLLDEAIGTIEVRPKNKFYDYEAKYTDGFAEHIFPAKIP
FT                   DNIYKMTLEHALKIHQFLGCKTISRSDFRYNPKNNTLKMLEINTHPGFTELSLVPEIAK
FT                   LAKGINFNELVKIIIEDSLQHKNIRDLSHVEQYY"
FT   gene            88294..89052
FT                   /locus_tag="WD_0096"
FT                   /old_locus_tag="WD0096"
FT   CDS_pept        88294..89052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0096"
FT                   /old_locus_tag="WD0096"
FT                   /product="cell division protein FtsQ, putative"
FT                   /note="Identified by similarity to EGAD:163166; match to
FT                   PF03799 protein family HMM PF03799"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13854"
FT                   /db_xref="GOA:Q73IQ7"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IQ7"
FT                   /protein_id="AAS13854.1"
FT                   /translation="MLSSITRSQRSFLRKCALVVITALFLTLILYSSLDKIINRFNYYF
FT                   TWYNDCLSSLLLSSGFSIDEVVVSGNKFTNKKDILSLTDRTQPILYISLSKLAGNIQSV
FT                   SRWIKHVRVHRILPNTLHINIDEHKPFALWKDNNKTSVIDFEGKVIVDDYLVDDLVVIT
FT                   GQNSLSNLEFVKDVLESKTQLSDHISSFAYIGNRRWNIILDNDSTVKLPEDNPYSAWDY
FT                   LNHLHNTTDFTFSDWSIIDMRITDKIFVKR"
FT   gene            90714..91820
FT                   /locus_tag="WD_0098"
FT                   /old_locus_tag="WD0098"
FT   CDS_pept        90714..91820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0098"
FT                   /old_locus_tag="WD0098"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="Identified by similarity to SP:P38422; match to
FT                   PF00768 protein family HMM PF00768"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13855"
FT                   /db_xref="GOA:Q73IQ6"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IQ6"
FT                   /protein_id="AAS13855.1"
FT                   /translation="MLSRLVILLLVFILPFSSYSYQFRTKAKQAVVLDLASDSFIFDHN
FT                   SDEKMAPSSMSKLMTLYIAFDYLKAGIIHMEDKFRVSRKAWERRGSSMFLKEGQSVTVR
FT                   ELLEGITIVSGNDACITLAEGIAGSEENFVAEMNEVAQNLNLNDSHFVNSSGWPDEDHF
FT                   MNAKDLVMLAKRIFTDFPEYYDLFSEQYLTYNEIVQKNKNLLLFHDIGVDGLKTGYTNA
FT                   GGYGIVASAKRNDRRIFAVVNGLNTEKERIEEAKRLIQYSLNHFNTKKIFVKDSVVEEV
FT                   NVLYGKDRKVPITVANDVTITYNRKLHDQIKVRIEYKDMIPAPIKKGQEVGKVFVEIPG
FT                   IEQQTTPLYAANDVQELNFVEKFFRMLF"
FT   gene            91920..92234
FT                   /locus_tag="WD_0099"
FT                   /old_locus_tag="WD0099"
FT   CDS_pept        91920..92234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0099"
FT                   /old_locus_tag="WD0099"
FT                   /product="multidrug resistance protein"
FT                   /note="Identified by similarity to SP:O87866; match to
FT                   PF00893 protein family HMM PF00893"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13856"
FT                   /db_xref="GOA:Q73IQ5"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IQ5"
FT                   /protein_id="AAS13856.1"
FT                   /translation="MCWLYLLLSSILEILWAVTLKFSNSFTKVVPSIATLVIMIISIYF
FT                   LSLAACFLPIRLCYAVSSGICTIGITIIGATTFTENINLSQVLCIVLIVIGSIGLKLSI
FT                   "
FT   gene            92251..92595
FT                   /gene="sugE"
FT                   /locus_tag="WD_0100"
FT                   /old_locus_tag="WD0100"
FT   CDS_pept        92251..92595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sugE"
FT                   /locus_tag="WD_0100"
FT                   /old_locus_tag="WD0100"
FT                   /product="sugE protein"
FT                   /note="Identified by similarity to SP:P30743; match to
FT                   PF00893 protein family HMM PF00893"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13857"
FT                   /db_xref="GOA:Q73IQ4"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IQ4"
FT                   /protein_id="AAS13857.1"
FT                   /translation="MNWIYLLLSSLIEVFWVITLKHSYGFTHLVPSIISILSMALSTYL
FT                   LSLATRSIPIGVCYAIWTGVGAIGASILGVYLFDEPVNLFEVICFILVTFGIIGLKLFD
FT                   TAKQTVDKME"
FT   gene            93139..93423
FT                   /locus_tag="WD_0102"
FT                   /old_locus_tag="WD0102"
FT   CDS_pept        93139..93423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0102"
FT                   /old_locus_tag="WD0102"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13858"
FT                   /db_xref="UniProtKB/TrEMBL:Q73G66"
FT                   /protein_id="AAS13858.1"
FT                   /translation="MNLSWRGYRLIAADGSGMRLPSSGEIVSEFEPNGTTGTIGNLFVD
FT                   LCTSLICSARLAAWNIGEQTLAAEQLPEVITQMRLLNQEKLLFIYDRLQ"
FT   gene            complement(94147..97287)
FT                   /gene="putA"
FT                   /locus_tag="WD_0103"
FT                   /old_locus_tag="WD0103"
FT   CDS_pept        complement(94147..97287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="putA"
FT                   /locus_tag="WD_0103"
FT                   /old_locus_tag="WD0103"
FT                   /product="proline
FT                   dehydrogenase/delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase"
FT                   /EC_number="1.5.99.8"
FT                   /note="Identified by similarity to EGAD:6755; match to
FT                   TIGR01238 protein family HMM TIGR01238; match to PF01619
FT                   protein family HMM PF01619; match to PF00171 protein family
FT                   HMM PF00171; match to TIGR01612 protein family HMM
FT                   TIGR01612"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13859"
FT                   /db_xref="GOA:Q73IQ2"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR005933"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR024082"
FT                   /db_xref="InterPro:IPR024089"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="InterPro:IPR041349"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IQ2"
FT                   /protein_id="AAS13859.1"
FT                   /translation="MISSIQEPNELRKRLQGFYRTDEKSYIRYLVEKAELSADSKNRIY
FT                   NIAKQVIEKIKHNKLSIVDSFMQQYSLSNDEGIALMCLAESLLRIPDDYTIDEIIKDKI
FT                   ANQEWNKYLGHSSSLFVNASTWSLMIGSSILRDNEGDSKFYYAISKLLKNLGEPIIRKA
FT                   VKQAMSMLGNHFVVGETIEEALRYAKLDDNSKFLYSFDMLGETAHTAEDAEEYFNSYMH
FT                   SIKAIGESTEINDCFKSHGVSIKLSALHPRYEFGQFDNIAEELRAKLLELCHEAKKYNI
FT                   SLCIDAEETERLEMSLILFEQLRLDESLSEWEGLGLAVQAYQKRALSVLDFVEDVAIRS
FT                   KHKIMVRLVKGAYWDSEIKRTQELGLNDYSVFTRKSYTDVSYFVCAQKLLSKPNSFYPC
FT                   FGTHNVYTFASIMELADKNHPGFEFQRLHGMAKDLYDYAMSELATNVSCRVYAPVGEHS
FT                   DLLPYLIRRLLENGANSSFVNQISDPNVKIDELISDPLEKAINFNYEPHPGIPLPQDIL
FT                   GPERKNSLGMDISDSVIVSQFADDIKGFSEKKWQIGPIIDGKALFDNAEFIEVVNPAHL
FT                   ENVIGEVSSATSDQALNALEIAHSAFAKWQNVSAEERAKCLEKAADLLEERMKELIYIL
FT                   IVEAGKILSDAIAEVREAIDFLRYYAMIAKNELSDWKKLPGPTGEDNFIFFEGRGVFLC
FT                   ISPWNFPLAIFIGQVSAALAAGNAVLAKPAEQTPIIAYEAVKILHEAGIPKNVLHLIPG
FT                   DGGYLGKILVPDNRIAGVAFTGSTQTAQIINKMLANRDGPIVPLIAETGGLNAMIVDSS
FT                   ALLEQVAMDALLSAFRSSGQRCSALRVLFIQEDIAEKQIKMICGAAQELKIGDPIQLST
FT                   DIGPIIDKASIDMLTQHTQKMSEDEDSNLLFKVPMDTNSHNGYFFPPYIYEIQKISQLK
FT                   QEVFGPILHIIRFNKSQLNEVISDINSTGYGLTFSLQSRIQSQIETISKKISVGNVYIN
FT                   RNQIGAAVGIQPFGGRGLSGTGPKAGGPHYLQRFSTEKVVSVNTTAFGGNTTLMCLD"
FT   gene            complement(97422..100007)
FT                   /gene="acnA"
FT                   /locus_tag="WD_0105"
FT                   /old_locus_tag="WD0105"
FT   CDS_pept        complement(97422..100007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnA"
FT                   /locus_tag="WD_0105"
FT                   /old_locus_tag="WD0105"
FT                   /product="aconitate hydratase"
FT                   /EC_number="4.2.1.3"
FT                   /note="Identified by similarity to EGAD:17358; match to
FT                   TIGR01341 protein family HMM TIGR01341; match to PF00330
FT                   protein family HMM PF00330; match to PF00694 protein family
FT                   HMM PF00694"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13860"
FT                   /db_xref="GOA:Q73IQ1"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IQ1"
FT                   /protein_id="AAS13860.1"
FT                   /translation="MNNSLNAKTTLNIDGKSYNYFSLSSASEFLGIDVTKLPCSLKVLL
FT                   ESLLRNEDGVNVKLDDIRVLADCVNKHTNHEISYKPARVLMQDFTGVPAVVDLASMRDY
FT                   VKKNGGNPSNINPSVPVDLVIDHSVQVDSYGSVSAFSKNVELEVKRNLERYQFLKWGES
FT                   SFTNFRVVPPGTGICHQVNLEYLAQVVCNNDGVIYPDTLVGTDSHTTMVNGLSVLGWGV
FT                   GGIEAESVMLGQPISMVIPEVVGFKLIGRLPEGVTATDLVLTVTNILRTKGVVGKFVEF
FT                   YGDGLDYLSLADRATIANMAPEYGATCGFFPIDQKTLDYLHLTGRPEKLIKLVEAYAKE
FT                   QGLWRGNNELAFFDALELDLSSVKPVMAGPKRPQDKVFLSQVAESFSKSFSVNESKESD
FT                   KLQDGSVVIAAITSCTNTSNPSVMIAAGLVARNAIKLGLKSKPWVKTSLAPGSQVVTEY
FT                   LEKSGLQVDLNALGFNLVGYGCTTCIGNSGPLNKDIEDGIKNKNLTVAAVLSGNRNFEG
FT                   RIHPLVKANYLASPPLVVAYALAGTVQIDLTKDSICKDKNGNDVYLKDIWPTNNEIEDC
FT                   VKSVVTREMFIQKYKDVFSGDEHWRKIKCEKSEIYNWDANSTYIQNPPYFDNLSPKNNK
FT                   IDIKGAQILAMFGDSITTDHISPAGNIASSSPAGLYLKGLGIEPRDFNSYGSRRGNHNV
FT                   MMRGTFANIRIKNEMVSTEGGYTKYIPSQETMPIFDAAMRYKEALIIVAGKEYGTGSSR
FT                   DWAAKGTLLLGIKVVIAESFERIHRSNLVGMGVLPLIFQNGITRKIFDGSKVISIKGEI
FT                   VPGGNLKCIIKGKDNSEQSIQLKCCVQTATETKYLMCGGVLSYILAQSF"
FT   gene            complement(100022..100525)
FT                   /gene="secB"
FT                   /locus_tag="WD_0106"
FT                   /old_locus_tag="WD0106"
FT   CDS_pept        complement(100022..100525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="WD_0106"
FT                   /old_locus_tag="WD0106"
FT                   /product="protein-export protein SecB"
FT                   /note="Identified by similarity to EGAD:163082; match to
FT                   PF02556 protein family HMM PF02556"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13861"
FT                   /db_xref="GOA:Q73IQ0"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73IQ0"
FT                   /protein_id="AAS13861.1"
FT                   /translation="MPQQKMRIHGQYVKDLSFENPNSPFLSSSKAPDINVMVNINSAKL
FT                   EGTKNKEEVNEEKSFHEITLHIEVKATVKDEGIKDGVAFICETKYCGIFSIENLKELSE
FT                   EEVRQALFIGGPTFLFPFAREIIARVTSSGGFPPLMLDPIDFETMYEQQGQQQKSNGSN
FT                   SNFN"
FT   gene            100690..101340
FT                   /locus_tag="WD_0107"
FT                   /old_locus_tag="WD0107"
FT   CDS_pept        100690..101340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0107"
FT                   /old_locus_tag="WD0107"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13862"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR016985"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IP9"
FT                   /protein_id="AAS13862.1"
FT                   /translation="MIELVIYALLAAFIFSRLYNSLGRSANLNLKKLTNVLDVSRSRED
FT                   VVENIEGYIDSNDENSIKVTYKQILKKNKDFSISHFIEGSSIAFELIIKCFNQGNLSQL
FT                   KPLLDKDLYDNFAEKIKHRKEVHESIIVSIVSQKILEIKLVKNAVFIAVYFLSEQINFV
FT                   KNNEGDIISGSTSTINKVEDVWQFKKNVNSSDPSWLLVSIHYKKTSNDKTNDK"
FT   gene            101358..102053
FT                   /gene="dnaQ"
FT                   /locus_tag="WD_0108"
FT                   /old_locus_tag="WD0108"
FT   CDS_pept        101358..102053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="WD_0108"
FT                   /old_locus_tag="WD0108"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="Identified by similarity to EGAD:162766; match to
FT                   TIGR01406 protein family HMM TIGR01406; match to TIGR00573
FT                   protein family HMM TIGR00573; match to PF00929 protein
FT                   family HMM PF00929"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13863"
FT                   /db_xref="GOA:Q73IP8"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IP8"
FT                   /protein_id="AAS13863.1"
FT                   /translation="MESKLREIVLDTETTGLDTESGHRIIEIGCVELINRIPTGKVFHR
FT                   YLNPERDIPYHSFKIHGISEEFLEDKPLFSDVALEFLDFISNDILVIHNAEFDVKFLNM
FT                   ELSKLNARLISSDRVLDTLPLARKKFAGSPASLNALCKRFDISLENRELHGALVDAQLL
FT                   AKVYVELTGGLQTFLFDNECNQDSNSTFVQHKVRNLTPREHLPNSEEIDEHKKLLDKIN
FT                   NTLWNKYIE"
FT   gene            102098..102706
FT                   /locus_tag="WD_0109"
FT                   /old_locus_tag="WD0109"
FT   CDS_pept        102098..102706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0109"
FT                   /old_locus_tag="WD0109"
FT                   /product="SCO1/SenC family protein"
FT                   /note="Identified by similarity to GP:5163245; match to
FT                   PF02630 protein family HMM PF02630"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13864"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IP7"
FT                   /protein_id="AAS13864.1"
FT                   /translation="MVRFIRLLSNVLAALAVVFLGYCYFTKKGIFAPAAIHNAEVKIGG
FT                   DFSLINQDGQILRSSDFKDKYMMIFFGFSSCKRICPMNLGIISETLAKLDEKTNNKLQT
FT                   FFITVDPERDSTERLKEFQQQFDHRIQMLTGEREKIDEVIAKYKVYASKVGGEEEINHS
FT                   SIMYLIGPGGKYVTHFAADLNSDESQSDKILAEIRKYVN"
FT   gene            102737..102997
FT                   /locus_tag="WD_0110"
FT                   /old_locus_tag="WD0110"
FT   CDS_pept        102737..102997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0110"
FT                   /old_locus_tag="WD0110"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13865"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IP6"
FT                   /protein_id="AAS13865.1"
FT                   /translation="MQLHEHYDLRAISMGRHTQLYERCSLGAIPTSGVSSQCPDTGIQL
FT                   LCNLIKNVCFSVRQLPLAHQLSYKQNFWIPVGFVASLLMKG"
FT   gene            103297..103419
FT                   /locus_tag="WD_0111"
FT                   /old_locus_tag="WD0111"
FT   CDS_pept        103297..103419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0111"
FT                   /old_locus_tag="WD0111"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13866"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IP5"
FT                   /protein_id="AAS13866.1"
FT                   /translation="MSSTGMTSSVVQFTFKNECSYSYGRHIGMTLFAVFKNKHS"
FT   gene            103515..105902
FT                   /gene="gyrB"
FT                   /locus_tag="WD_0112"
FT                   /old_locus_tag="WD0112"
FT   CDS_pept        103515..105902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="WD_0112"
FT                   /old_locus_tag="WD0112"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="Identified by similarity to OMNI:CC0160; match to
FT                   TIGR01059 protein family HMM TIGR01059; match to PF00204
FT                   protein family HMM PF00204; match to PF00986 protein family
FT                   HMM PF00986; match to PF02518 protein family HMM PF02518;
FT                   match to PF01751 protein family HMM PF01751"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13867"
FT                   /db_xref="GOA:Q73IP4"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IP4"
FT                   /protein_id="AAS13867.1"
FT                   /translation="MENSYNADAIKILRGLDAVRKRPGMYIGDTDDGSGLHHMVYEVVD
FT                   NAIDESLAGYCDKIEVSINKDGSVSVTDNGRGIPTDIHEEEGISAAEVIMTQLHAGGKF
FT                   DSNTYKVSGGLHGVGISVVNALSSWLELIIWRNKKEHFMRFEDGESIEPLKVVNENTNK
FT                   RGTKVTFMPSTETFNGINFSYSTLESRIRELAFLNSNIDITLRDLRNEPYTESHFNQSN
FT                   QSKDNFGTANFVQYLDKNKTHVTKIASMKGDAEDLGISLEISMEWNDSYYENMLCFTNN
FT                   IRQRDGGTHLAGFRSALTRCINTYATNEGFLKKAKVNLTGEDVREGLTCVLSLKMPDPK
FT                   FSSQTKDKLVSSEARAVVESIVSDKLSTILETDPKLAASIVERAIRSAKGREAARKARE
FT                   LVKSKNNIDIATLPGKLADCQEKAPELSELFIVEGNSAGGTAKQGRNRKTQAVLALRGK
FT                   ILNVERVSLDRIFSSAEIGSLITAIGAGIGSEHFDIEKARYHKIIIMTDADVDGSHIRT
FT                   LILTFFFRHMREVIEKGYLYIAQPPLYKVTKNAKDTYIKDDETFEEYIINSAVKRLTLS
FT                   GTATEFNNLRLILNKCVSTSNISKNYDREIPQNLLESLLILSKKNALSSADEILKYLKL
FT                   MYSEYTWEVEIKDEEKEIHISKLFQGLADKYIFALSMLEGKDMQNILSLLDGISNLFNG
FT                   DSFLKSQETEIRITSPSTLAKIIMDYGKKGLTLQRFKGLGEMNADQLWDTTLNPEARTL
FT                   LKVEIKDCEEADSIFSILMGDIVEPRRDFINSNALNVHDVDI"
FT   gene            105996..106253
FT                   /locus_tag="WD_0113"
FT                   /old_locus_tag="WD0113"
FT   CDS_pept        105996..106253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0113"
FT                   /old_locus_tag="WD0113"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13868"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IP3"
FT                   /protein_id="AAS13868.1"
FT                   /translation="MLDTGIQVAHKQTSIESGYNVFDEIAERLDSSVKHWNESSPTSCR
FT                   DSFAVSLDPANKQRDDGCQGVIPLPSPVIPVPPSPVIQVA"
FT   gene            106591..107642
FT                   /pseudo
FT                   /locus_tag="WD_0114"
FT                   /old_locus_tag="WD0114"
FT                   /note="transposase, IS3 family, degenerate; This gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error.Identified by similarity to EGAD:43417"
FT   gene            107885..109213
FT                   /locus_tag="WD_0115"
FT                   /old_locus_tag="WD0115"
FT   CDS_pept        107885..109213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0115"
FT                   /old_locus_tag="WD0115"
FT                   /product="transposase, IS4 family"
FT                   /note="Identified by similarity to EGAD:8624; match to
FT                   PF01609 protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13869"
FT                   /db_xref="GOA:Q73IB8"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IB8"
FT                   /protein_id="AAS13869.1"
FT                   /translation="MNKITSLSKKLKEFFNEKADKISITTRFIKRKRKLKGSSFVKAMV
FT                   LGNIGVDNCSVETMCQLLNEDSIDITKQGLDFRFTEEAVEFMKRMYNESVLLFKNILQV
FT                   DCKILQQFNSVKLLDSSYITLPNSMEEMYKGYGTSYSGYESNTKSGIKLQLVFDYMNQI
FT                   IDQLNLTEGVRSDQGYRKHLSNILSNDLLISDLGYFVPSSFKQINEIGAYFISRYKSDT
FT                   NIYDVETNQKMELLECLEDKLFLENEVLLGKEAKIRVRIICQKLTEEQSMARRRKANRL
FT                   ARSQGYTSSKRNQKLLNWSIFITNVPENKISAEQVLTIYRVRWQIELLFKLYKSHIRLD
FT                   KLKGKPCRVLCELYAKLCAILIFHGIVGCTEVKKNTELSLTKAFIELKRRVIELFLALK
FT                   NKVNSLKVFLKKLTITWSRFSLKDKYRKTRVSTLTSLNLLTIS"
FT   gene            complement(109315..110595)
FT                   /locus_tag="WD_0116"
FT                   /old_locus_tag="WD0116"
FT   CDS_pept        complement(109315..110595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0116"
FT                   /old_locus_tag="WD0116"
FT                   /product="gcpE protein, putative"
FT                   /note="Identified by match to TIGR00612 protein family HMM
FT                   TIGR00612"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13870"
FT                   /db_xref="GOA:Q73IP1"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73IP1"
FT                   /protein_id="AAS13870.1"
FT                   /translation="MLDKDLILNDNTCELSQISRHKTHVVEVGKVKIGGNNPVVVQSMA
FT                   LGVHIDADNIKSSAKHYAKEITELARTGSELVRIALNSEEVARAIPYIVEEINKEGFDG
FT                   KILVGCGQYELDKLVQDYPDNIKMLGKIRINPGNIGFGDKRDEKFERVIEYAIMHDLPV
FT                   RIGVNWGSLDKYLLQKLMDENSSLSNSRPSDVILRKALVMSALDSAKKAEEIGLNSNKI
FT                   IISCKVSKVQDLILVYMALAKSSNYALHLGLTEAGMGNKGVVNTAAGLTYLLQNGIGDT
FT                   IRASLTQRPGESRTNEVVVCQEILQSIGLRHFNPQVNSCPGCGRTSSDRFRILTEEVNG
FT                   YIKTHMPMWKKKNPGVEHMNIAVMGCIVNGPGESKHANLGISLPGYGEKPVSAVYKNGK
FT                   YFKTLQGDNVSEEFKAIIDNYVKKHYT"
FT   gene            complement(110621..111049)
FT                   /locus_tag="WD_0117"
FT                   /old_locus_tag="WD0117"
FT   CDS_pept        complement(110621..111049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0117"
FT                   /old_locus_tag="WD0117"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13871"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IP0"
FT                   /protein_id="AAS13871.1"
FT                   /translation="MLKKKKLQDRAINKEDLIKKLKEKKIANLDNEPNDMEACIVDDEE
FT                   STMINQHGINIARLRGAVFIDQESVFQYENKQHESEQQEEKKVTSTRKKKVSPINATIK
FT                   ETPSRRTCSHDSIANLDNVDAYSLNGSSSFGSVADTVK"
FT   gene            111135..111284
FT                   /locus_tag="WD_0118"
FT                   /old_locus_tag="WD0118"
FT   CDS_pept        111135..111284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0118"
FT                   /old_locus_tag="WD0118"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13872"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IN9"
FT                   /protein_id="AAS13872.1"
FT                   /translation="MYLLLSLDLASALCTVKKLETKNININKILEKTLSIWCYSKYRVL
FT                   KDSN"
FT   gene            complement(111495..111983)
FT                   /locus_tag="WD_0119"
FT                   /old_locus_tag="WD0119"
FT   CDS_pept        complement(111495..111983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0119"
FT                   /old_locus_tag="WD0119"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13873"
FT                   /db_xref="GOA:Q73IN8"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IN8"
FT                   /protein_id="AAS13873.1"
FT                   /translation="MGITKWVLGFDESDITALQESQQIDAEQFEKVFGALKEWQEAQKI
FT                   DAKQFEEVFSALKEWQEAQKIDVEQFEKVFSALEDKIGTKQFQAMQEHLNGLQEKVETL
FT                   AEAVADQQKIMAICIIVSAVAAIAITSFVAFCIYQGVKLDKEKKTTYLKIRQTQNLIM"
FT   gene            complement(112139..114253)
FT                   /locus_tag="WD_0120"
FT                   /old_locus_tag="WD0120"
FT   CDS_pept        complement(112139..114253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0120"
FT                   /old_locus_tag="WD0120"
FT                   /product="cell division protein FtsK, putative"
FT                   /note="Identified by match to PF01580 protein family HMM
FT                   PF01580"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13874"
FT                   /db_xref="GOA:Q73IN7"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IN7"
FT                   /protein_id="AAS13874.1"
FT                   /translation="MLKKYLKSAIYLSLLIYIYISVFSYNYKDPSLNTATNEEVTNLGG
FT                   IVSSYLADILVQFLGLTSVTIATTIVYLLIFRPSKRLLKILYLILINLGICAILPQLSL
FT                   GITARYRHSGIIGNALINNCPFYIFVIVTSIGLVGSVGWKRTIYSLFFLCKKIACLFVN
FT                   VPFFRSHKTTEYSIAPLVVEEKHRTKITTKQQPKERQKKATEEVLSEFKFPSIHLLSKA
FT                   EESLQRKQLNEMESNKNLSLLEQVLSDFGVQGKIISVCYGPVVTLYKLEPQAGTKSARV
FT                   IGLADDIARSMSALSARISIIRGQNAMGIELPNKEREIVMLRDLLESPEYQNANLNLPI
FT                   ALGKEISGKPVIADLTKMPHLLVAGTTGSGKSVAINTMILSLVYRLSPDECKMIMIDPK
FT                   MLELSIYDAIPHLITPVVTEPKKAVVALKWIVKEMENRYRMMSYLNVRNVINYNQRITE
FT                   AMNSGIELERVVQIGFNSTTGKPLFEKIPIKMETFPYIVVIVDEMADLMLVAGKEIECS
FT                   IQRLAQMARAAGIHIIMATQRPSVDVITGVIKANFPTRISFAVTSKIDSRTILGEQGAE
FT                   QLLGMGDMLYMASGGKIIRVHGPFVSDNEVQDIVDHLKMQGEPNYMEEITKEDENSSTE
FT                   SHDETEDEENDLYNQAVAIIQRDQKVSTSYIQRQLRIGYNRAANIVERMEKEGIVSAPN
FT                   YSGKREILVE"
FT   gene            complement(114254..114532)
FT                   /locus_tag="WD_0121"
FT                   /old_locus_tag="WD0121"
FT   CDS_pept        complement(114254..114532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0121"
FT                   /old_locus_tag="WD0121"
FT                   /product="YGGT family protein"
FT                   /note="Identified by match to PF02325 protein family HMM
FT                   PF02325"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13875"
FT                   /db_xref="GOA:Q73IN6"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IN6"
FT                   /protein_id="AAS13875.1"
FT                   /translation="MHPIIYLLNTLLDLYSFILICWVVLNWLVKLNMVNIYNETVSSIM
FT                   HILNQLTYPPLKIIRRYIPPFNGLDLSIMILLITIHFVKYTVAYYFR"
FT   gene            complement(114704..114979)
FT                   /locus_tag="WD_0122"
FT                   /old_locus_tag="WD0122"
FT   CDS_pept        complement(114704..114979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0122"
FT                   /old_locus_tag="WD0122"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by match to PF01919 protein family HMM
FT                   PF01919"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13876"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IN5"
FT                   /protein_id="AAS13876.1"
FT                   /translation="MGLERYKVKSLKSVVEKDLPNLPKIIRLRVQKAIKERLTVDPINF
FT                   GEPLHHNLKGCRRLRVGDYRVIYRVNQLDHIVTITEIGHRDDIYKK"
FT   gene            complement(114970..115203)
FT                   /locus_tag="WD_0123"
FT                   /old_locus_tag="WD0123"
FT   CDS_pept        complement(114970..115203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0123"
FT                   /old_locus_tag="WD0123"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13877"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IN4"
FT                   /protein_id="AAS13877.1"
FT                   /translation="MVKHMANSGINIALSEETLKHLAELSEFTKQPVQELAGKLFREAV
FT                   ELEMEDFLVSKISDERDVEGAETVDFEDIKWD"
FT   gene            complement(115275..115586)
FT                   /locus_tag="WD_0124"
FT                   /old_locus_tag="WD0124"
FT   CDS_pept        complement(115275..115586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0124"
FT                   /old_locus_tag="WD0124"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to GP:15155631; match to
FT                   PF01919 protein family HMM PF01919"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13878"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IN3"
FT                   /protein_id="AAS13878.1"
FT                   /translation="MKTSGNKQYTIKYLKHVLKRNLPSLPEDVKPSIKDAIKEYLETDP
FT                   IGNGVLLRKRLKEHRRIKVADDYRIVYRVNTVKRIVIIVSIGHRDNIYKQAILDLLKH"
FT   gene            complement(115567..115800)
FT                   /locus_tag="WD_0125"
FT                   /old_locus_tag="WD0125"
FT   CDS_pept        complement(115567..115800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0125"
FT                   /old_locus_tag="WD0125"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13879"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IN2"
FT                   /protein_id="AAS13879.1"
FT                   /translation="MVKLMVNSKVSVTFHPETSQHLVELARATKQSVQKLTEKLVKEAI
FT                   ELEAEDIAFSKIIRELNSDDAEEVEDSEDIWK"
FT   gene            complement(115887..116159)
FT                   /locus_tag="WD_0126"
FT                   /old_locus_tag="WD0126"
FT   CDS_pept        complement(115887..116159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0126"
FT                   /old_locus_tag="WD0126"
FT                   /product="conserved hypothetical protein, degenerate"
FT                   /note="Identified by similarity to EGAD:160085; match to
FT                   PF01919 protein family HMM PF01919"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13880"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IN1"
FT                   /protein_id="AAS13880.1"
FT                   /translation="MKYDIVYSKNFTERDFLNLPKTIRSRITKAINERFTTDPIKFGKP
FT                   LRGRLKGYRRIRVSDYRIIYTVNIAKHKVFVATAGHRDTIYEKAT"
FT   gene            complement(116161..116379)
FT                   /locus_tag="WD_0127"
FT                   /old_locus_tag="WD0127"
FT   CDS_pept        complement(116161..116379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0127"
FT                   /old_locus_tag="WD0127"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13881"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IN0"
FT                   /protein_id="AAS13881.1"
FT                   /translation="MTDSGISITFDPKTSHNLTKLAEITKESVQELAKRLVIEGIECEV
FT                   EDIALYKTIKECEDVDWNTVLSERERT"
FT   gene            complement(116580..117017)
FT                   /locus_tag="WD_0128"
FT                   /old_locus_tag="WD0128"
FT   CDS_pept        complement(116580..117017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0128"
FT                   /old_locus_tag="WD0128"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to GP:15075155"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13882"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IM9"
FT                   /protein_id="AAS13882.1"
FT                   /translation="MEQTDYKKLLNSAKFQVIKKTLDVISGNGFIPHLEILFFTYFNGV
FT                   TMPDRLKKSYPTQMLIILQHQFYDLKVSEDKFSVSLSFQGKQERITIPFFAISEFRDKI
FT                   SGDVLIFDKISIDSDKEYKSEKCTEKLSNGSIISIDQLRDE"
FT   gene            complement(117038..117339)
FT                   /locus_tag="WD_WptmRNA1"
FT                   /old_locus_tag="WptmRNA1"
FT   misc_RNA        complement(117038..117339)
FT                   /locus_tag="WD_WptmRNA1"
FT                   /old_locus_tag="WptmRNA1"
FT                   /product="WptmRNA1"
FT   gene            complement(117503..118093)
FT                   /locus_tag="WD_0129"
FT                   /old_locus_tag="WD0129"
FT   CDS_pept        complement(117503..118093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0129"
FT                   /old_locus_tag="WD0129"
FT                   /product="membrane protein CvpA, putative"
FT                   /note="Identified by match to PF02674 protein family HMM
FT                   PF02674"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13883"
FT                   /db_xref="GOA:Q73IM8"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IM8"
FT                   /protein_id="AAS13883.1"
FT                   /translation="MLFDSLIIFIVVLCVIISVTRGFIKELCALMFLFLSVFLTANHYD
FT                   FFAPNYSKYFDSKVTLNILSTISVFIILNLIFMIINNWLMYILSPIRLGFIDRVTGIFL
FT                   GVLKGILLSYVLFFAVHLYCYTVYDKKEGEYKIEAEDILPNWIINSHSYQALFVTAEEV
FT                   IDMYVPESLILKIKEIGGEMVDQEKPKNNKKEE"
FT   gene            complement(118151..118747)
FT                   /gene="ribE"
FT                   /locus_tag="WD_0130"
FT                   /old_locus_tag="WD0130"
FT   CDS_pept        complement(118151..118747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /locus_tag="WD_0130"
FT                   /old_locus_tag="WD0130"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /EC_number="2.5.1.9"
FT                   /note="Identified by similarity to EGAD:14904; match to
FT                   TIGR00187 protein family HMM TIGR00187; match to PF00677
FT                   protein family HMM PF00677; match to PF00677 protein family
FT                   HMM PF00677"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13884"
FT                   /db_xref="GOA:Q73IM7"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IM7"
FT                   /protein_id="AAS13884.1"
FT                   /translation="MFKGIITDIGTITDTTTHFNSDQIFHIKTQNLSSINKGDSIACSG
FT                   VCLTVVDIMSDTFTVQASQETMKVANLNTWRIGKKINLEQAMRLSDKIDGHLVQGHVDG
FT                   IVKFLTINQNLDSHEIKLSCPQELIKFVAKKSSVTLDGVSLTVNSVINQEFTVNITPYT
FT                   WENTTFQYNKVNDYLNLEIDMIARYLDQLMQHKYN"
FT   gene            complement(118929..120659)
FT                   /locus_tag="WD_0131"
FT                   /old_locus_tag="WD0131"
FT   CDS_pept        complement(118929..120659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0131"
FT                   /old_locus_tag="WD0131"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13885"
FT                   /db_xref="GOA:Q73IM6"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IM6"
FT                   /protein_id="AAS13885.1"
FT                   /translation="MHNSNTETKNKYKIEDLPKLFKEKSRNISKAFSSETIKISTIRSR
FT                   SIESNIQEFSFELTATDKDTFNIRLFRINSLINFFKICLSREKNFTANIKVPKESSELY
FT                   NNYCKTNSYKTVEEFVNSAPPQILLQGTTITLQTDVENINLDNLYQIELFLNEKLQHAE
FT                   KTENEDKKEQSETNQKNAQNKQIVPVTGSFGFDVTNNGKQVTRVSIVVAAMHENVFWFR
FT                   SFFCLPNFFNTSQFFSQQLPKFSIQSNNIPFGVIPAFDQEKRNMDPSSQATRMTGGSIE
FT                   NPILQEAEQNVGQTTSHTEYFKANRKKKSKKQTKELSEKEKPLAIKQAQNDARVAMIDN
FT                   QIEHRGKKLDKIFIEVMSGYKNQDPETFCNIFSSVFNIVYFQDKQLHAILEPGEISEVL
FT                   QILERPQPLSNSLLGKEYLQKQVYRKKEQLLKLVSGVYIQQPSPQDENTPHKSTNPLPI
FT                   KDLSPATNEAKTLPPTNITLKSSLKTVFSSKKAYFCLFIIVASASTLCLWHFPLGKVSM
FT                   LKGLVPPEKRESIGLALNIGLPILTALCVLSLAYFIYSEYSIESIEQVSENDPLSRAYS
FT                   "
FT   gene            120806..121849
FT                   /gene="pheS"
FT                   /locus_tag="WD_0132"
FT                   /old_locus_tag="WD0132"
FT   CDS_pept        120806..121849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="WD_0132"
FT                   /old_locus_tag="WD0132"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="Identified by similarity to EGAD:19995; match to
FT                   PF01409 protein family HMM PF01409; match to TIGR00468
FT                   protein family HMM TIGR00468; match to PF02912 protein
FT                   family HMM PF02912"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13886"
FT                   /db_xref="GOA:Q73IM5"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73IM5"
FT                   /protein_id="AAS13886.1"
FT                   /translation="MNKELLDDILSLEDKAVSEIENASSLQDLEKVRLSYLGKKGVIKA
FT                   YFDNLKEIEDAGKKRNLGEVINVLRNKLDQLIMSKENILKAEEVNFKLQNEAVDITLSA
FT                   RPEKIGKVHPLSKVLNEVKLIFAHMGFKAVDGPDIEDEFHVFDALNTPSHHPAREEQDT
FT                   FYLKNKIDDKRMVLRTHTSSVQIRTMEKTKKFPIKIVAAGRVYRNDFDATHTPMFHQIE
FT                   GLYVDENVNMGQLKFTIHHFLNKFFGDKGLKIRFRNSFFPFTEPSAEVDISYKGSKWIE
FT                   VLGCGMTHPNVFQNVGIDHTKYNGFAFGIGIERLAMLKYQISDLRSFYDNKISWLDHYG
FT                   FHFSSLR"
FT   gene            121850..123142
FT                   /gene="glmU"
FT                   /locus_tag="WD_0133"
FT                   /old_locus_tag="WD0133"
FT   CDS_pept        121850..123142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="WD_0133"
FT                   /old_locus_tag="WD0133"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /EC_number="2.7.7.23"
FT                   /note="Identified by similarity to OMNI:NTL02ML0661; match
FT                   to PF00132 protein family HMM PF00132; match to PF00132
FT                   protein family HMM PF00132; match to PF00132 protein family
FT                   HMM PF00132; match to PF00132 protein family HMM PF00132;
FT                   match to PF00132 protein family HMM PF00132; match to
FT                   PF00132 protein family HMM PF00132; match to PF00483
FT                   protein family HMM PF00483"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13887"
FT                   /db_xref="GOA:Q73IM4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73IM4"
FT                   /protein_id="AAS13887.1"
FT                   /translation="MISKTHTFVILASGHGRRMNSDLPKVLHKIGSFSMLQHVIYNAKQ
FT                   LNPENIAVVVDQPLIERLKCFKDIQLITQELTLGTGDAVKTAMRNLRELPDSSIVVVQY
FT                   GDTPLIKSSTITKMISYLEGKALVCLGFRTSNKEYGRLIIENGSLREIVEAKSDKNNHE
FT                   EFLANAGIMVACAKNLRELVEKIECNSSTHEYYLTDIVSIAVKSNLNVGYVITGGEEAT
FT                   GINNRNDLIKAEFYFQENKRKIFTDSGVTLVAPETVFFSLDTQIARDSVIYPYVFFGTG
FT                   VKIESGAKILPFSHLENCLIKSNAEVGPFTRIRGNTTIGNKAKIGNFVEVKTSEVGQNT
FT                   RIKHLSYIGNAKVGQESNIGAGTIVCNYDGKNKHETNIGSNCFVGANSSLIAPLNIHDE
FT                   SVIAAGSVIVEDVPEKSLAIAREKQVTKRIK"
FT   gene            124163..124465
FT                   /gene="rplU"
FT                   /locus_tag="WD_0134"
FT                   /old_locus_tag="WD0134"
FT   CDS_pept        124163..124465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="WD_0134"
FT                   /old_locus_tag="WD0134"
FT                   /product="ribosomal protein L21"
FT                   /note="Identified by similarity to EGAD:23167; match to
FT                   PF00829 protein family HMM PF00829; match to TIGR00061
FT                   protein family HMM TIGR00061"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13888"
FT                   /db_xref="GOA:Q73IM3"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73IM3"
FT                   /protein_id="AAS13888.1"
FT                   /translation="MFAVIETGGKQYLVKEGSIIKVEKLEAEEKKEVEINKVICISNSG
FT                   LSYSSNATVKAEVLEQCRGEKIIIFKKKRRKNYRRKTGHRQYITVLRINEISLQK"
FT   gene            124476..124745
FT                   /gene="rpmA"
FT                   /locus_tag="WD_0135"
FT                   /old_locus_tag="WD0135"
FT   CDS_pept        124476..124745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="WD_0135"
FT                   /old_locus_tag="WD0135"
FT                   /product="ribosomal protein L27"
FT                   /note="Identified by similarity to EGAD:12976; match to
FT                   PF01016 protein family HMM PF01016; match to TIGR00062
FT                   protein family HMM TIGR00062"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13889"
FT                   /db_xref="GOA:Q73IM2"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IM2"
FT                   /protein_id="AAS13889.1"
FT                   /translation="MATKKSGGSSCNGRDSAGRRLGIKKDGKVIPGNIIVRQRGTKFHP
FT                   GKNVGIGKDHTIFAKIEGWVSFRRSANKKTFIDILPTDNMKASA"
FT   gene            124755..124831
FT                   /locus_tag="WD_tRNA-Ile-1"
FT                   /old_locus_tag="tRNA-Ile-1"
FT   tRNA            124755..124831
FT                   /locus_tag="WD_tRNA-Ile-1"
FT                   /old_locus_tag="tRNA-Ile-1"
FT                   /product="tRNA-Ile"
FT   gene            124889..126061
FT                   /gene="metK"
FT                   /locus_tag="WD_0136"
FT                   /old_locus_tag="WD0136"
FT   CDS_pept        124889..126061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="WD_0136"
FT                   /old_locus_tag="WD0136"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="Identified by similarity to EGAD:5695; match to
FT                   TIGR01034 protein family HMM TIGR01034; match to PF02773
FT                   protein family HMM PF02773; match to PF02772 protein family
FT                   HMM PF02772; match to PF00438 protein family HMM PF00438"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13890"
FT                   /db_xref="GOA:Q73IM1"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IM1"
FT                   /protein_id="AAS13890.1"
FT                   /translation="MSLYKNLVTSESVAAGHPDKVADQISDAVLDEYLFTDPFARAAIE
FT                   TLVAKDNVIIAGEVFGPNIKNSRIESIVRNTIKDIGYKHDGFHWRKVKVNILLHEQSND
FT                   IAIGLDQGAGDQGIMYGYATTETENLMPAPIFYAHSILKNIMSAVKEAKLGPDAKSQIT
FT                   LAYENNLPVRAESIIVSIQHPEDLDQSKVKEIIYPYIVSSLPEGWMCPEENLLVNPTGR
FT                   FVIGGPVSDCGLTGRKIMVDTYGGYIPHGGGAFSGKDATKVDRSAAYMARYLAKNIVFA
FT                   GLAERCLVQLSYAIGVSKPTSFYIDTFGANKVEERVIKKFIENNIDLSTKGIIKHLSLN
FT                   HPIYKRTACYGHFGKESESDGGFSWESINLSADLRREFNIEGNSKISLDC"
FT   gene            126290..126670
FT                   /locus_tag="WD_0137"
FT                   /old_locus_tag="WD0137"
FT   CDS_pept        126290..126670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0137"
FT                   /old_locus_tag="WD0137"
FT                   /product="transposase, IS5 family, OrfA"
FT                   /note="Identified by similarity to GP:1256580"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13891"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IM0"
FT                   /protein_id="AAS13891.1"
FT                   /translation="MRKKYPTDLSEREWSRIEKHFRVSYKKGGRPPKYSKREILEAIFY
FT                   VLRTGCQWRYLPNDFPLWKTVYEQFRQWKKQGIFEKMNYEITKYSRRKIGRNEQPSACI
FT                   VDSQSVKTTEKGGSKAMMEVKK"
FT   gene            126781..127122
FT                   /locus_tag="WD_0138"
FT                   /old_locus_tag="WD0138"
FT   CDS_pept        126781..127122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0138"
FT                   /old_locus_tag="WD0138"
FT                   /product="transposase, IS5 family, OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13892"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IL9"
FT                   /protein_id="AAS13892.1"
FT                   /translation="MRTKYTKVKKMWADMGYQGRNLKNHIKEEYDIDIEIVKRPPCRFW
FT                   VHKDTPPELLPTREQGFKVQPRRWVVERTFAWVNRNRRLSKEYDLLTTSTENFIYLAMS
FT                   RVMLKREYA"
FT   gene            127119..127790
FT                   /locus_tag="WD_0139"
FT                   /old_locus_tag="WD0139"
FT   CDS_pept        127119..127790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0139"
FT                   /old_locus_tag="WD0139"
FT                   /product="transcriptional activator, tenA family, putative"
FT                   /note="Identified by similarity to EGAD:24145; match to
FT                   PF03070 protein family HMM PF03070"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13893"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IL8"
FT                   /protein_id="AAS13893.1"
FT                   /translation="MNLLVSGQPLKEFSDLIDKIKEHPFNVELINNTLDYEKFKFYLQQ
FT                   DFLYCIDCARAFLIVAARVDDIEMMSSLINLAQGAFYVREQCKKYFEDCDLSDDHKKSR
FT                   ACSAFTDFFMSAAYHNSVNEALVASYSCFNIYQIVIRHMVNEITTKGVKNNKYKEWINI
FT                   YSSETVNAVIDEVTDITNKLYKKASDCEKKRMYEFFKKGLELEIMFWDEAYYSNISSKE
FT                   Y"
FT   gene            127835..128494
FT                   /locus_tag="WD_0140"
FT                   /old_locus_tag="WD0140"
FT   CDS_pept        127835..128494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0140"
FT                   /old_locus_tag="WD0140"
FT                   /product="transcriptional activator, tenA family, putative"
FT                   /note="Identified by similarity to EGAD:24145"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13894"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IL7"
FT                   /protein_id="AAS13894.1"
FT                   /translation="MFSGIIRSCYGSNLLKDIIEHPFNVELANNTLNIENFKFYAQQKT
FT                   LFLGDYIRTTLITASKMEDYSSIISLAEVAQRVVTVNRMLYDYYFTMYGISREKKSLEC
FT                   FNFTNFLLSISHSNTYEAMTVLYSCMFIYETVVDSMKNRFKKNNRYRDWFNFCYSDSVK
FT                   SGCIILENIVDGYCSRARENEKSRMLELFRITAQFVLDFLNGAYNFSRFNQFPKEH"
FT   gene            128542..129369
FT                   /gene="coxC"
FT                   /locus_tag="WD_0141"
FT                   /old_locus_tag="WD0141"
FT   CDS_pept        128542..129369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxC"
FT                   /locus_tag="WD_0141"
FT                   /old_locus_tag="WD0141"
FT                   /product="cytochrome c oxidase, subunit III"
FT                   /EC_number="1.9.3.1"
FT                   /note="Identified by similarity to EGAD:163270; match to
FT                   PF00510 protein family HMM PF00510"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13895"
FT                   /db_xref="GOA:Q73IL6"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IL6"
FT                   /protein_id="AAS13895.1"
FT                   /translation="MKSKEHDFHLVDPSPWPIAVSAAILILALGLVGALHKQIVGMFCL
FT                   VLGISAVSGVLFYWWRDVIREAIYDKCHTAIVKHGLKFAMYLFILSEVVFFIVFFCSFF
FT                   KAWLDPVFLFEAFSPAKKVEWPPEGILPPDPWSLPFMNTLILLLSGTTITWANHSLLKN
FT                   DKKSMIKMLSITILLGVFFIIVQAIEYHEASFSLQETGEKLIYTSNFYMITGFHCAHVI
FT                   IGIIFLSVCLFRARKGQFTLQDHLCFEFASWYWHFVDVVWIFLFLFVYWLSVY"
FT   gene            129370..129858
FT                   /gene="ruvC"
FT                   /locus_tag="WD_0142"
FT                   /old_locus_tag="WD0142"
FT   CDS_pept        129370..129858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvC"
FT                   /locus_tag="WD_0142"
FT                   /old_locus_tag="WD0142"
FT                   /product="crossover junction endodeoxyribonuclease RuvC"
FT                   /EC_number="3.1.22.4"
FT                   /note="Identified by similarity to SP:Q9ZE29; match to
FT                   PF02075 protein family HMM PF02075; match to TIGR00228
FT                   protein family HMM TIGR00228"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13896"
FT                   /db_xref="GOA:Q73IL5"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73IL5"
FT                   /protein_id="AAS13896.1"
FT                   /translation="MVKIIGLDPGISKTGWAIISLNEKNNIEFLGGGTISTDGKLGTGE
FT                   RLHIIFEQLKKVISLYSPNEAAVEKIFVNKNPKSSLTLGYARGVVILALKITKLTMNEY
FT                   DANYVKKSITGNGHADKDQIIFMVKQIVKNLSIKCHHVADALAVAICHAYTKGSCFVE"
FT   gene            complement(129903..130370)
FT                   /locus_tag="WD_0143"
FT                   /old_locus_tag="WD0143"
FT   CDS_pept        complement(129903..130370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0143"
FT                   /old_locus_tag="WD0143"
FT                   /product="conserved hypothetical protein TIGR00250"
FT                   /note="Identified by similarity to EGAD:163163; match to
FT                   PF03652 protein family HMM PF03652; match to TIGR00250
FT                   protein family HMM TIGR00250"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13897"
FT                   /db_xref="GOA:Q73IL4"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73IL4"
FT                   /protein_id="AAS13897.1"
FT                   /translation="MLHRNPDEFLKSIPKDKRIMCLDMGEKQIGIAFSDKTQLIATAHS
FT                   IYHRKNMSKDLGYLHRIFKENESGSMVIGLPLKMDEQETKWCKTIIQFANKIIKKYKVN
FT                   IYLQDESFSTSIATHTLKITGISITKSKKIDDKISACIILQRTLDKINTIK"
FT   gene            131554..132978
FT                   /gene="gatB"
FT                   /locus_tag="WD_0146"
FT                   /old_locus_tag="WD0146"
FT   CDS_pept        131554..132978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="WD_0146"
FT                   /old_locus_tag="WD0146"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="Identified by similarity to EGAD:163081; match to
FT                   TIGR00133 protein family HMM TIGR00133; match to PF02934
FT                   protein family HMM PF02934; match to PF02637 protein family
FT                   HMM PF02637; match to PF01162 protein family HMM PF01162"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13898"
FT                   /db_xref="GOA:P61349"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:P61349"
FT                   /protein_id="AAS13898.1"
FT                   /translation="MTKEDWEAVIGLEVHAQVSSNTKLFSSSSTEFGAEHNTQVSLVDA
FT                   AMPGTLPILNYYCIEQAIRTGLALSAEINKYSYFDRKNYFYPDLPQGYQITQFFEPIVK
FT                   NGRVFINDNEKEIRIARIHLEQDAGKSVHEESKTYVDLNRAGVALMEIVSEPDLRSSAE
FT                   AAECMKKLRQILRYIGSCDGDMEKGSLRCDANVSVRLKGSSTFGTRCEIKNLNSIRYIV
FT                   QAIDYEIQRQIEILESGEEISQDTLLFDVASGKTKVMRSKEDASDYRYFPEPDLLPVEV
FT                   SQDKIDLIQSSLPELPDQKKLRYIEELGINEYDANVITSDKAIADYFEELIKKHDSKLA
FT                   VTWLTVELFGRLNKAGIDIVSSPIKANALSELLDFIVDGTISAKLGKQVFDSMFETGKP
FT                   ASLIIEEQGLKQITDRGQISEVIDKIINNNQDKVQEYKSGKTKLYGFFVGEVMKLTKGK
FT                   ASPDVVNSILSERLSN"
FT   gene            133174..136038
FT                   /locus_tag="WD_0147"
FT                   /old_locus_tag="WD0147"
FT   CDS_pept        133174..136038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0147"
FT                   /old_locus_tag="WD0147"
FT                   /product="ankyrin repeat domain protein"
FT                   /note="Identified by match to PF00023 protein family HMM
FT                   PF00023; match to PF00023 protein family HMM PF00023; match
FT                   to PF00023 protein family HMM PF00023; match to PF00023
FT                   protein family HMM PF00023; match to PF00023 protein family
FT                   HMM PF00023; match to PF00023 protein family HMM PF00023;
FT                   match to PF00023 protein family HMM PF00023; match to
FT                   PF00023 protein family HMM PF00023; match to PF00023
FT                   protein family HMM PF00023; match to PF00023 protein family
FT                   HMM PF00023; match to PF00023 protein family HMM PF00023;
FT                   match to TIGR01612 protein family HMM TIGR01612"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13899"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IL3"
FT                   /protein_id="AAS13899.1"
FT                   /translation="MWLILFLMRVMDKKCPFRLATELKSAAGFDDVVLQCKQNKTTIHR
FT                   FVQVKHKQDGTEKISVGSLLTKSGEFNLLKYFIAYLKIKSNGKFKGEMKYFAIVTNIDF
FT                   DFTDSAQHEVRKLRMMSSGKNKEKEISVIRIDTQDEFLDVGDGVRYKFDNSIISYLQEN
FT                   KDFIKGKVGREVSDKEVEDFLNELVFAVNLPNESQLKELFKGEMSGRLAKKFGYVGDNE
FT                   IFCNDLLEKISDWVKDIKGRFLSPEEGKEFFQKVELWASTLCGIERGVKKGNKGIDKIA
FT                   KQQHKDSKTLNEIHAAVTAQNNKQRPHKKPYGPRDKKSKAREEGDIEESDEFDEIEALE
FT                   FVKRALNIENNLQNKEIKKLAQELQYSQLALKLAVTYISEENIVFSHRGRKRIRVGGYL
FT                   KKCEKIAEKLLDFKSEYKSDRYAKATFITWKITIDAIVQKKFRPEALSILEIMAYFSPN
FT                   EIYIEEIFSQQVANDKEALWNAVELLNRYSMIKLRKGVVNIYRLVQKVTRLKLQEKGRE
FT                   EEVLRKALELINSYDVLIDNSIVASVWGYVSKYGELIDEFYFNPIYGKWKYTPLHSLAE
FT                   SGSYEAVRCVLTHMEEKHPDKFNCVVNARDGSDSTPLCSAVESGGLDIVQYFINKGADV
FT                   NAKSRYGITPLHQAVYDGRVDIVEYLIGKGADINAKDESGFTALHWATMMYRVDVAKVL
FT                   LKHNADVNAKDKDGDTSLHLATKMGRVAVAKVLLEHNVDVNVKNEQNRISLHYVARSGS
FT                   IETIECLIEKGADVNAKDENGNTPLHFAAIMGNFDTARVLLKHNADVDTKNNRGMTALH
FT                   YATDFDHQELVELLSARDTNSIDDGMCMVALAKTLLKHTTNVSVKNECNKTPLHHAAKI
FT                   GSEKLTKYFIKEGDDVNAKDENGNTPLHFAAIMENFDTARVLLKRKADVNAKNNRGMTA
FT                   LHYATDFDHRDLVEWLLAHGASIL"
FT   gene            complement(136130..136549)
FT                   /locus_tag="WD_0148"
FT                   /old_locus_tag="WD0148"
FT   CDS_pept        complement(136130..136549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0148"
FT                   /old_locus_tag="WD0148"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to EGAD:132851"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13900"
FT                   /db_xref="GOA:Q73IL2"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IL2"
FT                   /protein_id="AAS13900.1"
FT                   /translation="MENYFLLFTDSLVSSLVLPIHQGFVFNTMLYFRSYHTPLLMLFFG
FT                   VLGSSLGGIVNWYLGRITISIRKSYRKLENEHKTPKIVKNLLICAVTLLSWVPALGSVI
FT                   QILSGYFKLNLYTLAPLIILSNFFYLLYLILTFGV"
FT   gene            complement(136556..137929)
FT                   /gene="cysS"
FT                   /locus_tag="WD_0149"
FT                   /old_locus_tag="WD0149"
FT   CDS_pept        complement(136556..137929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="WD_0149"
FT                   /old_locus_tag="WD0149"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="Identified by similarity to EGAD:17646; match to
FT                   PF01406 protein family HMM PF01406; match to TIGR00435
FT                   protein family HMM TIGR00435"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13901"
FT                   /db_xref="GOA:Q73IL1"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73IL1"
FT                   /protein_id="AAS13901.1"
FT                   /translation="MVRLYNTLTKKKELFTPIDKDHVKMYVCGPTVYDTAHIGNARSVV
FT                   VYDVLFQLLKFCYGKVTYVRNITDIDDKIINAASEKNSNIESISTYYTKAFHEDMRSIN
FT                   CAEPTHEPKATKNVDYIIKLIEHLLQSGHAYESDKHVYFNIESYHEYGALSGKKTDELV
FT                   PGSRVEVNENKKHPGDFVLWKPANDIDYKLSSYWNSPWGEGRPGWHIECSAMSYAYLGK
FT                   DFDIHGGGIDLQFPHHENEIAQSKSAFAGSMFAKYWIHNGFLTVNEEKMSKSLFNIVKV
FT                   RDLLDSGIKGEVIRYALLKTHYRKPLDWTENVISDAQETLNKFYRLSRGLDTINIDESN
FT                   AEISKDFIDALKNDLNIPEALAILHEMAAKINKMSNESEKLKLTESFVKSARFIGLLES
FT                   SYEKWFAVDVNHQEIERLIDLRKIAKKNKNYDTADKIRDQLKQMGITISDNEDGTTTW"
FT   gene            complement(137922..138578)
FT                   /locus_tag="WD_0150"
FT                   /old_locus_tag="WD0150"
FT   CDS_pept        complement(137922..138578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0150"
FT                   /old_locus_tag="WD0150"
FT                   /product="exopolysaccharide synthesis protein ExoD-related
FT                   protein"
FT                   /note="Identified by similarity to GP:9957205"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13902"
FT                   /db_xref="GOA:Q73IL0"
FT                   /db_xref="InterPro:IPR010331"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IL0"
FT                   /protein_id="AAS13902.1"
FT                   /translation="MSKNDKLTKSDKLASDILKEVADTNNNDSDKVTLFDIKTALHERG
FT                   FGILIIIFSLPLSVPIPVPPGYTTILSIPLILFSLQLLFGFDSPWMPHWLERRSFQRST
FT                   LAFVVEKTSPALKKIEKFMKPRMSFIFYGPGEKILAFVMLLSALSIALPLPLTNFIPAI
FT                   GTTLISLGIMSKDGFLSILGVLISLCGLLLTLVVVVKGPQLIIGAFSFLKSFVYG"
FT   gene            complement(138669..139325)
FT                   /locus_tag="WD_0151"
FT                   /old_locus_tag="WD0151"
FT   CDS_pept        complement(138669..139325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0151"
FT                   /old_locus_tag="WD0151"
FT                   /product="exopolysaccharide synthesis protein ExoD-related
FT                   protein"
FT                   /note="Identified by similarity to GP:9957205"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13903"
FT                   /db_xref="GOA:Q73IK9"
FT                   /db_xref="InterPro:IPR010331"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IK9"
FT                   /protein_id="AAS13903.1"
FT                   /translation="MQKSEKLTKDKKLASDILKEVADTNNNDSNKVTLFDIKTALHERG
FT                   FGILIIIFSLPLSVPIPVPPGYTTILSIPLILFSLQLLFGFDSPWMPSWLERRSFQRST
FT                   LALVVEKTSPVLEKIEKFMKPRLSFIFYGPGEKILAFMMLLCAIIIALPLPFTHFLPAI
FT                   GTTLISLSIMSKDGFLSILGVLVSLCALLLTLVVIVKGPQLITGALSLLKSFTTL"
FT   gene            complement(139492..139659)
FT                   /locus_tag="WD_0152"
FT                   /old_locus_tag="WD0152"
FT   CDS_pept        complement(139492..139659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0152"
FT                   /old_locus_tag="WD0152"
FT                   /product="mttA/Hcf106 family protein"
FT                   /note="Identified by similarity to EGAD:155523; match to
FT                   TIGR01411 protein family HMM TIGR01411; match to PF02416
FT                   protein family HMM PF02416"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13904"
FT                   /db_xref="GOA:Q73IK8"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73IK8"
FT                   /protein_id="AAS13904.1"
FT                   /translation="MSLGPWQLFLVLIIILVLFGAGRLPQVMGDLGKGIKNLKQELKDS
FT                   EKLSSNEPDR"
FT   gene            complement(139788..140561)
FT                   /locus_tag="WD_0153"
FT                   /old_locus_tag="WD0153"
FT   CDS_pept        complement(139788..140561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0153"
FT                   /old_locus_tag="WD0153"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="Identified by match to PF00005 protein family HMM
FT                   PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13905"
FT                   /db_xref="GOA:Q73IK7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030287"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IK7"
FT                   /protein_id="AAS13905.1"
FT                   /translation="MLVNNIGYFYNNQNDFALSNINIKVKKGNVACLLGHSGCGKSTIL
FT                   KLIAGIENPKSGTIFINDRLVASNKASVAIEHRNIGLIFQHSALFPHKTVVENITFAIR
FT                   SSSKREKHLIALEILKLLNIEKYENMYPNALSGGQQQLVAIARVMAQNPDVVLLDEPFS
FT                   NLDILLKCRIRQHILSLFRSKNIPVLMVTHDPQEALKVADFIYVMKNGKIIQSGVSSDI
FT                   YHKPKDDTLAKFFSELSSTLQLSEKFPLIRCKKII"
FT   gene            140709..140785
FT                   /locus_tag="WD_tRNA-Arg-2"
FT                   /old_locus_tag="tRNA-Arg-2"
FT   tRNA            140709..140785
FT                   /locus_tag="WD_tRNA-Arg-2"
FT                   /old_locus_tag="tRNA-Arg-2"
FT                   /product="tRNA-Arg"
FT   gene            complement(140887..142704)
FT                   /gene="uvrC"
FT                   /locus_tag="WD_0154"
FT                   /old_locus_tag="WD0154"
FT   CDS_pept        complement(140887..142704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /locus_tag="WD_0154"
FT                   /old_locus_tag="WD0154"
FT                   /product="excinuclease ABC, C subunit"
FT                   /note="Identified by similarity to SP:P07028; match to
FT                   TIGR00194 protein family HMM TIGR00194; match to PF01541
FT                   protein family HMM PF01541; match to PF00633 protein family
FT                   HMM PF00633; match to PF00633 protein family HMM PF00633;
FT                   match to PF02151 protein family HMM PF02151"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13906"
FT                   /db_xref="GOA:Q73IK6"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73IK6"
FT                   /protein_id="AAS13906.1"
FT                   /translation="MLRQYKEQIKSSPQSCGVYKMVGDKNKVLYVGKAKNLKSRLSDYL
FT                   QFENLSERIRVMLLQVIKVEIFITENEIEALLLEAQLIKSLKPLYNIVLKDGKFYPYIT
FT                   ISKHDYPRIAKYRGKFKKNEFHYYGPFTSAAAVKQTILSLQKAFLLRVCSDQYFSSTKR
FT                   PCIEYQIKRCSAPCINKITKDDYCQSVKQARNTLLGRNKEVKEQLLFTMRKCSSEENYE
FT                   LAAIYRDRVKFLEQIQIQHTDFSFEKDADFFSIVREEDLACISVLSFRNKDNYGSTPYF
FT                   AENCGDHSNDEILSTFLVNFYNSANIPPIQIYVPDSIVDKEIIEQALYKVAQKPVKVLH
FT                   AKNKKERDLLKFVYDNSQHSLEQKLIDYRNNLEKLEELSKIFLLPNIPKRIEVYDNSHI
FT                   SGSQQIGVMIVAGQEGFLKSEYRKFTIKEKFSGDDYKMMREVLTRRFSGNIKGIIPDFL
FT                   LIDGGPGHVSIVQNVLEVLNINVPFACMAKGPDRNAGNERFYMLGREEFSLANDSKVML
FT                   YLQSLRNEAHRFAITSHRKKRDKQFIVSQLSKIPGIGNKRKKALMSYFGSVKNISRASL
FT                   AEIQNVPGISKGLAEVILKYVNYKRGVLE"
FT   gene            complement(142688..144805)
FT                   /gene="glyS"
FT                   /locus_tag="WD_0155"
FT                   /old_locus_tag="WD0155"
FT   CDS_pept        complement(142688..144805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="WD_0155"
FT                   /old_locus_tag="WD0155"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="Identified by similarity to EGAD:45760; match to
FT                   TIGR00211 protein family HMM TIGR00211; match to PF02092
FT                   protein family HMM PF02092"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13907"
FT                   /db_xref="GOA:Q73IK5"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IK5"
FT                   /protein_id="AAS13907.1"
FT                   /translation="MSLQLLFECLSEEIPPRMQNVVATQVKSCIANVFNKNNVKFTSME
FT                   VFITARRITLFVDNINALELKDSNNEVKGPNINAPKSAIEGFLRKYQKNEEDLLVRKVN
FT                   NEDFYFIKRESCSFNIREFLKNQLEEMLKNFSWLKSMRWGEGKERWVRPIKNILCILND
FT                   EIIPVSFAGITASNTTYGHRFLSSGTALTVKAPKDYFELLEKNSVILQMDKRKQFILDQ
FT                   INKFTKEQNLQLEKNDYLLNELTGLIEWPIVLFGEVNQEKSFGLPKEVILSIVNTQQKY
FT                   LALSNGKRISHFVTVVNVNNGEVVKGHERILEARLADAQFLISQDKKENLDYYVKKLGS
FT                   ILFHASLGSVGEKVKRITALSKYIAIFIPHASLIKVECAAYLAKADLATSIVREFPELQ
FT                   GVMGGYYASYFQEDKEVVEAITEHYKPIGPEQECPKSPSAIAVSIADKVDSLVGLIAAG
FT                   EKISGSYDQFGLRRMTIGIIRTILENNLHVPIRLMIDKSVSLYSRLLFNKNTASVDKPN
FT                   RKQISELVFRFCLERFKVILKNRDIRQDVVDSILYKIDINDLLTAEKRTVILDRYLSTP
FT                   EGEQILSTYKRVSNMMSKARKSDGTTYSASYGKRFLIESEEIALSNCAITACKNIKQAI
FT                   KNNHFNVALDELASFAPFINKFMDSIKINCDSDKLRRNRLSLLENVVSIFHLVADFNLI
FT                   QVKQWINAQAI"
FT   gene            complement(144809..145648)
FT                   /gene="glyQ"
FT                   /locus_tag="WD_0156"
FT                   /old_locus_tag="WD0156"
FT   CDS_pept        complement(144809..145648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="WD_0156"
FT                   /old_locus_tag="WD0156"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="Identified by similarity to EGAD:9097; match to
FT                   PF02091 protein family HMM PF02091"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13908"
FT                   /db_xref="GOA:Q73IK4"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IK4"
FT                   /protein_id="AAS13908.1"
FT                   /translation="MNLQSIIKELQDFWASEGCVILHPYTSEVGAGTLHPATIMSAIDT
FT                   KPAKIAYLQPVIRPADGRYSDNPNRLYQHHQYQVIIKPSGNNLQDVYLDSLKVLGISTE
FT                   KYDIKFVEDDWENPSVGASGLGWEVTCNGMEVTQLTYIQQVGGIDCKMIPGEVAYGLER
FT                   LAMCIQGVDNVYDIIWNDNGVTYGDIFKQREYEFSYLALDYYDTKVVQQQFEDTEKLCK
FT                   FLIEKELPMAAYDQCIKTSHLLNLLDARGVLGVNERTAYIGKVRELTKKCCELYMSK"
FT   gene            complement(145693..146421)
FT                   /locus_tag="WD_0157"
FT                   /old_locus_tag="WD0157"
FT   CDS_pept        complement(145693..146421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0157"
FT                   /old_locus_tag="WD0157"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13909"
FT                   /db_xref="GOA:Q73IK3"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IK3"
FT                   /protein_id="AAS13909.1"
FT                   /translation="MLGKVFPAKTVSSLLGIGYLPSWQNYWSSFLILFIVDVILILTYG
FT                   GEYLLYKMPDSGIVVAAVFTKLAIVMLVMQLIGIFIFHAQDPSANSGEKIVIQIASGQV
FT                   LTVALSMPAMMSIYYAVSKLYGNICKQMFQCPFWFNDFMHFFFFLMIPYVFFNVVEVIK
FT                   PWPISSIQLSYNNAMSITFEGIFHTFYAVILLYLTAFIFCDLTMHDAIVLNKSIIQYVR
FT                   ESSAVLGDYLHDTVKKIGIE"
FT   gene            complement(146598..147593)
FT                   /gene="hemB"
FT                   /locus_tag="WD_0158"
FT                   /old_locus_tag="WD0158"
FT   CDS_pept        complement(146598..147593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="WD_0158"
FT                   /old_locus_tag="WD0158"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /EC_number="4.2.1.24"
FT                   /note="Identified by similarity to EGAD:163380; match to
FT                   PF00490 protein family HMM PF00490"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13910"
FT                   /db_xref="GOA:Q73IK2"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IK2"
FT                   /protein_id="AAS13910.1"
FT                   /translation="MFNFPNTRLRRRRSSKWVRNLTSENSLSVNDLVLPLFVHDREETT
FT                   EPISGLPGVKCYSIDGLVSIVKEAKDLGINAVAIFPVVDSKLKSENAEEAYNSDNLICR
FT                   AICAVKLKVPEIGIIADVALDPYTIHGHDGILKDNQMDVENDETISVLCKQALALAKAG
FT                   CDIVAPSDMMDGRVGRIRKSLDDNNFQDVLILSYAVKYCSSFYAPFRQVVGSCGLSHSI
FT                   DKSGYQMDYKNAHEAMCEIEMDINEGADFIMIKPGMPYLDIIKTASDKFNFPIFAYQVS
FT                   GEYAMIKAAANNGWLDYDKVIYESLIGFKRAGASAIFTYAALDIAKNLSA"
FT   gene            complement(147586..148611)
FT                   /locus_tag="WD_0159"
FT                   /old_locus_tag="WD0159"
FT   CDS_pept        complement(147586..148611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0159"
FT                   /old_locus_tag="WD0159"
FT                   /product="NADH dehydrogenase I, H subunit, putative"
FT                   /note="Identified by match to PF00146 protein family HMM
FT                   PF00146"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13911"
FT                   /db_xref="GOA:Q73IK1"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73IK1"
FT                   /protein_id="AAS13911.1"
FT                   /translation="MNTLVNILFILVPLLLSVAYLTYFERKVLAAIQLRHGPSVVGPFG
FT                   LLQPFADAIKLLIKEPIIPFRASTILFIMAPMLTFILALIAWAVIPFGAEVIVENGQQV
FT                   IIPKVIANINVGVLYVLAISSLGVYGVIIAGWSSNSNYAFLGAIRSAAQMISYEVSIGL
FT                   IVAAVVITTGTLNLGEMVVAKHNMPFWVDLLLMPIGIIFFISLLAETNRHPFDLPEAEA
FT                   ELVSGYNVEYSSMPFALFFLGEYANMILASAMMTIFFLGGWYPPLEFSLLYKIPGLIWF
FT                   VLKIVILLFIFIWIRATIPRYRYDQLMRLGWKVFLPISVLWVILISGVLLFTGNLPGSN
FT                   V"
FT   gene            complement(148595..150643)
FT                   /gene="nuoG"
FT                   /locus_tag="WD_0160"
FT                   /old_locus_tag="WD0160"
FT   CDS_pept        complement(148595..150643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoG"
FT                   /locus_tag="WD_0160"
FT                   /old_locus_tag="WD0160"
FT                   /product="NADH dehydrogenase I, G subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="Identified by similarity to OMNI:CC1946; match to
FT                   TIGR01973 protein family HMM TIGR01973; match to PF00384
FT                   protein family HMM PF00384; match to PF00111 protein family
FT                   HMM PF00111"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13912"
FT                   /db_xref="GOA:Q73IK0"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR010228"
FT                   /db_xref="InterPro:IPR015405"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IK0"
FT                   /protein_id="AAS13912.1"
FT                   /translation="MVKVTINSKECEVEHGLTIIQACEVVGVEIPRFCYHERLAIAGNC
FT                   RMCLVEVEGGPPKPVASCAMPVAEGMVIHTDTPKVKKAREGVLEFLLINHPLDCPICDQ
FT                   GGECDLQDITMAYGKGTSRLDEHKRAVPKKHFGPLIETAMNRCIHCTRCVRFLSDVAGT
FT                   NELGGIGRGENVEISTYIKRHISSELSGNIIDLCPVGALTSKPYSFTARPWELSHCETI
FT                   DVLDAVGSAIRVDYRGPEVMRILPRLSEEVNEEWISDKTRFAYDGLKVQRLDRPYIKKD
FT                   GKLAPVDWNEALTVAAKKLKNTKSNKIAAIAGDLADCESMLLLKEMMQKLGSGNIDCRQ
FT                   DGAKLIPNNRGSYVFNTTIEGIENADLCLLINTNPRIEAPIINVRLRKRYLQGNFPVAS
FT                   VGPNIEYLYHVEKLGDNPDILSEIANGNHKFCKLLSAAQSPMLIIGQDALVRDDSESIL
FT                   ILAGKIAEEFNMVRDDWNGFNVLHKAAARVGGLDIGFVPKKGERDINQILEHAESGKIE
FT                   VVYLLGADEIDTSKLENTFVIYQGHHGDKGAHVADVILPGAAYTEKYATYVNTEGRVQR
FT                   TNLAVFPPGEAKEDWLIIKNLSQYLDLSLPYDSLFDVRKKLDTIGPQFRNADQVIKNTW
FT                   VPISNGKINLSDTPFTLKECNFYMTDSISRASKIMADCTKAFYEHTS"
FT   gene            complement(150649..150861)
FT                   /locus_tag="WD_0161"
FT                   /old_locus_tag="WD0161"
FT   CDS_pept        complement(150649..150861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0161"
FT                   /old_locus_tag="WD0161"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to OMNI:NTL01RC0876"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13913"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IJ9"
FT                   /protein_id="AAS13913.1"
FT                   /translation="MAAGGKAKTASKNNPTQRKKAEQKMYKDKPVKPVRYIDRDSRMNY
FT                   MSAQYDNGNLVEDEVSGNPIKWEAV"
FT   gene            complement(150928..151134)
FT                   /locus_tag="WD_0162"
FT                   /old_locus_tag="WD0162"
FT   CDS_pept        complement(150928..151134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0162"
FT                   /old_locus_tag="WD0162"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13914"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IJ8"
FT                   /protein_id="AAS13914.1"
FT                   /translation="MSSTEITPKGLLLSWMETSVSYLNLPRKLPANCNVRTAVRHALEW
FT                   HQGVTFYLNNDCKMIIIRDLLKF"
FT   gene            complement(151796..152617)
FT                   /locus_tag="WD_0164"
FT                   /old_locus_tag="WD0164"
FT   CDS_pept        complement(151796..152617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0164"
FT                   /old_locus_tag="WD0164"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /note="Identified by match to TIGR00758 protein family HMM
FT                   TIGR00758; match to PF03167 protein family HMM PF03167"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13915"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IJ7"
FT                   /protein_id="AAS13915.1"
FT                   /translation="MSNKDLELLKFYHEVGVDCTLTEGEEEKKLESKESVQPSVIQTGT
FT                   KKKDADTRWGDTKDGKDMFPSDWIIEARKLASKCNSVDELRSAVESFEGCEIKKTATNT
FT                   VFSDGNPNAKVMLVGEAPGANEDLQGIPFCGASGMLLDKMLNAINLDRTKVYISNTVFW
FT                   RPPGNRKPTDLELDMCRPFVEKHVALASPQILILVGGIACYSLLDSTKTISNLRGRFHT
FT                   YTNQYLSNSITTAAIFHPAYLLRQPAQKRLAWEDLKKIREYLDNTNNCTNT"
FT   gene            complement(152607..153146)
FT                   /gene="def"
FT                   /locus_tag="WD_0165"
FT                   /old_locus_tag="WD0165"
FT   CDS_pept        complement(152607..153146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="WD_0165"
FT                   /old_locus_tag="WD0165"
FT                   /product="polypeptide deformylase"
FT                   /EC_number="3.5.1.31"
FT                   /note="Identified by similarity to OMNI:CC0272; match to
FT                   PF01327 protein family HMM PF01327; match to TIGR00079
FT                   protein family HMM TIGR00079"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13916"
FT                   /db_xref="GOA:Q73IJ6"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73IJ6"
FT                   /protein_id="AAS13916.1"
FT                   /translation="MSILPIVIAPDERLITRASEVTDINDKIKELVNDMFETMYDAEGL
FT                   GLAAVQVGVLKRIFVMDIQLETIENEPAGYGSTGKFYMINPEITELSDEQVILKEGCLS
FT                   IPEQSHEIKRPKYLTVKYKDLDNEEQTLKASGWLARCIQHELDHLNGILYIRHLSKLKY
FT                   DMAMKKAQKVKKHYEQ"
FT   gene            153285..154523
FT                   /gene="ftsA"
FT                   /locus_tag="WD_0166"
FT                   /old_locus_tag="WD0166"
FT   CDS_pept        153285..154523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="WD_0166"
FT                   /old_locus_tag="WD0166"
FT                   /product="cell division protein FtsA"
FT                   /note="Identified by match to TIGR01174 protein family HMM
FT                   TIGR01174; match to PF02491 protein family HMM PF02491;
FT                   match to PF02491 protein family HMM PF02491"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13917"
FT                   /db_xref="GOA:Q73IJ5"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IJ5"
FT                   /protein_id="AAS13917.1"
FT                   /translation="MYSAVIAKPKRNVFAVLDIGTTKIICLIVKINGNFSYKVTGTGYK
FT                   IAEGVNGGSITNVKHANYSISSTIGLAEQVSEETIDQIYVNIAGCGISSFNVHNEIIAA
FT                   NHEISERDIRRVVFQTFEKYIEDNVIIHNIPLKYHLDDMTDIKEVGGLYGKRLSADVNV
FT                   VTASRPALTNIENCITNNGGLNMAGCIASAYSAGLACLSGDEKELGTAIVDIGGGCTAI
FT                   GIFKRGKLVYASSVPIGGVHITRDIAYGLCTSIERAEYIKILYGSTIVTSIDENEYITM
FT                   QNNENDEPTQVFKSELINIIRPRVEEILEMVREQFQEQKDPINKVVITGGTSQLTSMKE
FT                   IAGYIFNKQVRIGCPESCSGLDGEYDKNPVFSAAIGSIKLIVDTFYKNNSGILGQDGKM
FT                   SKLYNWVKSKVTV"
FT   gene            154656..155438
FT                   /gene="map"
FT                   /locus_tag="WD_0167"
FT                   /old_locus_tag="WD0167"
FT   CDS_pept        154656..155438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="WD_0167"
FT                   /old_locus_tag="WD0167"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /note="Identified by similarity to EGAD:162809; match to
FT                   TIGR00500 protein family HMM TIGR00500; match to PF00557
FT                   protein family HMM PF00557"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13918"
FT                   /db_xref="GOA:Q73IJ4"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IJ4"
FT                   /protein_id="AAS13918.1"
FT                   /translation="MNITIHSQEDFEFMRKAGRLAAETLDFIAPYVKVGVTTNELNDLC
FT                   HDFIINAGAIPAPLNYRGYPKSICTSKNAVVCHGVPDDTPLKDGDILNIDVTVILNGWH
FT                   GDTSRMFWVGKPSIKAKRLCDATYNALMEAIKQVKPGNKLNEIGLAIEKYIRDFGYSIV
FT                   RSYCGHGIGKVFHAPPNVAHFYDQDEDLVLKEGMFFTIEPMINAGKHETLLSKLDDWTV
FT                   TTRDLSLSAQFEHTLGVTKDGAEIFTLSPKNWHFPPYN"
FT   gene            complement(155466..156713)
FT                   /locus_tag="WD_0168"
FT                   /old_locus_tag="WD0168"
FT   CDS_pept        complement(155466..156713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0168"
FT                   /old_locus_tag="WD0168"
FT                   /product="major facilitator family transporter"
FT                   /note="Identified by match to PF00083 protein family HMM
FT                   PF00083"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13919"
FT                   /db_xref="GOA:Q73IJ3"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IJ3"
FT                   /protein_id="AAS13919.1"
FT                   /translation="MQQITKVIFSSLICNTLLWYDHMLFGHLINIIGGVFFPSDDQLTS
FT                   VLKAFGVFAVGFLMRPVGAAIFGHIGDKHGRRVALLLSIILMTLSTVLIAFVPGYQSIG
FT                   ILASILVVCLRLLQGISLGGEAGNAPFLIEHAPKNKKGFFGSIEVLSAIFGSVLSLIAV
FT                   LICKKVSDFESWGWRLPFIFSLAMGLISIYVRYILDESPEYKRQKNPSKLPLKELLNNY
FT                   KKPVLISIGIDLVENASLYIYLVFFNVLTNKILTVNTHFNHIVEILSQIALGGLTILFA
FT                   ILSDKVGREKVMKFAFIAFVIVSYPVFSMLCSGNYLLAHILFIIPIAASLGPVSALMCE
FT                   LFPTKVRYSGFGLSRNIAAGFFGGLAPFICTTIIKVTGQETSASFYMIFCALIGLVAIS
FT                   QIKGELSSKLPKVNQV"
FT   gene            156927..157871
FT                   /gene="mraW"
FT                   /locus_tag="WD_0170"
FT                   /old_locus_tag="WD0170"
FT   CDS_pept        156927..157871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="WD_0170"
FT                   /old_locus_tag="WD0170"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /EC_number="2.1.1.-"
FT                   /note="Identified by similarity to EGAD:162756; match to
FT                   PF01795 protein family HMM PF01795; match to TIGR00006
FT                   protein family HMM TIGR00006"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13920"
FT                   /db_xref="GOA:P62478"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62478"
FT                   /protein_id="AAS13920.1"
FT                   /translation="MTHTPVLLKEMLSLLSPQDGGIYVDATFGAGGYSKAILESADCKV
FT                   YAIDRDETVTKFYDDLSVRYPDRIKLFIEKFSNIKSILSSVEPSPVIPVLDTGKNNWSR
FT                   AGMTSNGVDGVVFDIGVSSMQLDNGDRGFSFLHDGPLDMSMDNSSYINASTFVNALREE
FT                   EIANTIYNYGGERHSRKIARAIINARKKKTIKTTFELADIVRSVVFRGKSKIDPATRTF
FT                   QAIRIWVNDELEELEKGIKAASEILSENGKLIVVTFHSLEDRIVKTFFKDLCATDCKTF
FT                   SLLNKKVIEASIEEVSANPRSRSAKLRAIQRLS"
FT   gene            157868..158179
FT                   /locus_tag="WD_0171"
FT                   /old_locus_tag="WD0171"
FT   CDS_pept        157868..158179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0171"
FT                   /old_locus_tag="WD0171"
FT                   /product="conserved domain protein"
FT                   /note="Identified by similarity to EGAD:162753"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13921"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IJ1"
FT                   /protein_id="AAS13921.1"
FT                   /translation="MRTFCIISIVMFFLSIVGLFKVKLHVQSLNRELIKIKSEINLVQS
FT                   DMKVLQAEWSYLNNPKRLASLVKKYLKNNSLILASQVKNLDSLNGRSVLAQLKIHDQQ"
FT   gene            complement(158480..158779)
FT                   /locus_tag="WD_0173"
FT                   /old_locus_tag="WD0173"
FT   CDS_pept        complement(158480..158779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0173"
FT                   /old_locus_tag="WD0173"
FT                   /product="oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13922"
FT                   /db_xref="GOA:Q73IJ0"
FT                   /db_xref="InterPro:IPR006885"
FT                   /db_xref="InterPro:IPR038532"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IJ0"
FT                   /protein_id="AAS13922.1"
FT                   /translation="MGIDDKVVFRIYKPTRTATQSGLGNTNFWHLKIESGSYYIEPLMG
FT                   WVGSKDPKKQIVLKFDSLEKAVFYAKKRNVKYIIEMPKNVKRLPKSYASNFILK"
FT   gene            158925..159536
FT                   /locus_tag="WD_0174"
FT                   /old_locus_tag="WD0174"
FT   CDS_pept        158925..159536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0174"
FT                   /old_locus_tag="WD0174"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="Identified by similarity to SP:P14194; match to
FT                   TIGR00731 protein family HMM TIGR00731; match to PF01386
FT                   protein family HMM PF01386"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13923"
FT                   /db_xref="GOA:Q73II9"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73II9"
FT                   /protein_id="AAS13923.1"
FT                   /translation="MTQQEIVTINAELRDITKTKAMHSLRKKGNIPGIIYGKGHDNVNL
FT                   TLSAKEFTKQYKSGSLSAHLIELNISGKKEYALVRDIQLHVVKDTVQHVDFQFVDKGSE
FT                   IKIDIPLSFVNESKAPGIKLGGVLNVLCRSIAVKCSPDKIPQVIEVDLSGKMIGQSIHI
FT                   NDVKLPEGVKFVAHEEENFTIVTISAADSDVEEPQAETEE"
FT   gene            159536..160084
FT                   /gene="pth"
FT                   /locus_tag="WD_0175"
FT                   /old_locus_tag="WD0175"
FT   CDS_pept        159536..160084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="WD_0175"
FT                   /old_locus_tag="WD0175"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="Identified by similarity to EGAD:17965; match to
FT                   PF01195 protein family HMM PF01195; match to TIGR00447
FT                   protein family HMM TIGR00447"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13924"
FT                   /db_xref="GOA:Q73II8"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73II8"
FT                   /protein_id="AAS13924.1"
FT                   /translation="MHLIVGLGNPGSQYELTHHNIGFIVVDTICKYWNFHSFSKKADYL
FT                   ITSGIINDNKIMLIKPYSFMNNSGIPVAKIQNFYKLSLDNIVVIHDDADLELGRIKVKK
FT                   GGSSAGHNGLKSIDSFIGNDYWRLRFGVGRPEDQRSLADYVLSKFSNFYNVTPLVEKIA
FT                   KNIHLMLQGDNTAFINLIV"
FT   gene            complement(160087..161049)
FT                   /locus_tag="WD_0176"
FT                   /old_locus_tag="WD0176"
FT   CDS_pept        complement(160087..161049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0176"
FT                   /old_locus_tag="WD0176"
FT                   /product="transposase, putative"
FT                   /note="Identified by match to PF00665 protein family HMM
FT                   PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13925"
FT                   /db_xref="GOA:Q73II7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q73II7"
FT                   /protein_id="AAS13925.1"
FT                   /translation="MGQILHGCAKTTETIRRAIQNSKESIAKLSRYYNLNPKTIIKWRK
FT                   RSFAKDADMGPKHARSTVLTLEEEAVIVAFRKHTLLPLDDCLYALQTSIPHLTRSSLHR
FT                   CLQRHSISRLPDVDGEVKPKKKFKQYPIGYFHIDIAEFRTEEGKLYLFVAIDRTSKFTY
FT                   VELHKSATKPIAAEFLRNLIKILPYKIHTILTDNSVQFTNQKRHKYAFQHIFDRACEEN
FT                   DIEHRLTKVSHPWTNGQVERMNKTLKNATVKKYYYQSHQQLKEHLYDFVMAYNYAKRLK
FT                   TLKGLTPFEFISLQWTKSPELFILNPHHHTLGPYTSCVS"
FT   gene            complement(161492..162640)
FT                   /locus_tag="WD_0177"
FT                   /old_locus_tag="WD0177"
FT   CDS_pept        complement(161492..162640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0177"
FT                   /old_locus_tag="WD0177"
FT                   /product="monoxygenase family protein"
FT                   /note="Identified by match to TIGR01984 protein family HMM
FT                   TIGR01984; match to PF01360 protein family HMM PF01360"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13926"
FT                   /db_xref="GOA:Q73II6"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR011295"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q73II6"
FT                   /protein_id="AAS13926.1"
FT                   /translation="MNYDVIISGGGLLGLITAIGLSCDSVSVAVIEKNSLPRVVDDNRA
FT                   FAISQGSKKILEKLGIWQFVESEAEPILDICILDTVTVHYNHKMVSEEPMGYVINNATI
FT                   WNAINNNFLNKLNIYSPHSYKTIACDSGYVEVILDNNQELISSLLICAEGKNSKLPELF
FT                   SIPTVKFDYKQSSIVFNVKHELHHQNLAVERFFPGGPFAILPMKGGYTSSIVWTEKSEI
FT                   SKMLMDLSEEEFIIELKKRFGSYLGEIKLEGERKLYPLSFVFAKKLYKGRVLLIGDAAH
FT                   SIHPVAGQGLNLGIRDVESIIKHVVAAKASGIDVGSSYLLKKISRNRYFDNFTMALATD
FT                   GLNRMFSNRIFCAKALRNLGLIAVENSNFLKKRFIRHAMGFI"
FT   gene            163209..163733
FT                   /locus_tag="WD_0178"
FT                   /old_locus_tag="WD0178"
FT   CDS_pept        163209..163733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0178"
FT                   /old_locus_tag="WD0178"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13927"
FT                   /db_xref="UniProtKB/TrEMBL:Q73II5"
FT                   /protein_id="AAS13927.1"
FT                   /translation="MTTDCKAKMLNCISKYIEELGENKAAIKQTLTNDKINISDHFYQG
FT                   DKICNEEIFNVGGECQDTKHGNSEYTYDDWKQKIEKSHAKDLLKMLQDKAKDKILKSFE
FT                   DYEKYHENAVEAIKRELDMDSQLKCRDLNCFDRTIKDNLSQKQSELTNIKNNFLDDTQN
FT                   IFKYIQVEDNI"
FT   gene            complement(163808..164830)
FT                   /locus_tag="WD_0179"
FT                   /old_locus_tag="WD0179"
FT   CDS_pept        complement(163808..164830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0179"
FT                   /old_locus_tag="WD0179"
FT                   /product="GTP/ATP binding protein, putative"
FT                   /note="Identified by match to PF01883 protein family HMM
FT                   PF01883"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13928"
FT                   /db_xref="GOA:Q73II4"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q73II4"
FT                   /protein_id="AAS13928.1"
FT                   /translation="MINEKIVRENLKKVIEQKSGKDVIALGIISSIIIKGQDVGFVLEV
FT                   AGNTQANEELRRNCEQAVKAIPGVTKVTVVATCQKKTGQQKAKLHIEGVKNIIVVASGK
FT                   GGVGKSTVALNLALSLAKLKHKVALVDADIYGPSIPKMLGAEKLKPEIQDSKAMPIEKY
FT                   GLHTISIGYFIDKDRAAIWRGPMITKALYNLLMGTKWSDIEYLIVDTPPGTGDVHLSLM
FT                   ENFNLTGAIIVSTPQELSLIDARKIYDMFTKLSVPVIGIVENMSYFIQSGSKIYIFGKD
FT                   GAKKMSEELGIKLLGRVPLDPQICHASDCGNPLMLSEDLAKIYKDIALETVKHCIAVKF
FT                   "
FT   gene            complement(164838..165248)
FT                   /locus_tag="WD_0180"
FT                   /old_locus_tag="WD0180"
FT   CDS_pept        complement(164838..165248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0180"
FT                   /old_locus_tag="WD0180"
FT                   /product="conserved domain protein"
FT                   /note="Identified by similarity to GP:15619657"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13929"
FT                   /db_xref="UniProtKB/TrEMBL:Q73II3"
FT                   /protein_id="AAS13929.1"
FT                   /translation="MKSSKLERSRMRRKVSRTVLKSSEEGRPSSLIQQYADETTEEDLR
FT                   KIAEKAPIIKLAYDELDRFSWNEKDLVAYEERIMDLRKEEGILAKKLDEGKIEGKIEVA
FT                   KNLLKADISIDIISQTTGLPQAEIKRLQEEIT"
FT   gene            complement(165245..165751)
FT                   /locus_tag="WD_0181"
FT                   /old_locus_tag="WD0181"
FT   CDS_pept        complement(165245..165751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0181"
FT                   /old_locus_tag="WD0181"
FT                   /product="HNH endonuclease family protein"
FT                   /note="Identified by match to PF01844 protein family HMM
FT                   PF01844"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13930"
FT                   /db_xref="GOA:Q73II2"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:Q73II2"
FT                   /protein_id="AAS13930.1"
FT                   /translation="MNSAVYSLTISNPPKFYFTQKNSFLSLHFFWVRSVFRHPNKGKCW
FT                   IKRKYFKKYNNDNWRFMTSNKIHFIIHSDHVIKRHIKVQKTRSPYDGDWVYWGKRLRKI
FT                   PDKPLRVIKLLKLQQSKCDNCRLWFKSDDTIEIHHKDRNRRNNMIKNLSLLHGHCHDEL
FT                   HRRCA"
FT   gene            165723..166757
FT                   /pseudo
FT                   /locus_tag="WD_0182"
FT                   /old_locus_tag="WD0182"
FT                   /note="transposase, IS3 family, degenerate; This gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error.Identified by similarity to EGAD:43417"
FT   gene            complement(166849..168210)
FT                   /locus_tag="WD_0183"
FT                   /old_locus_tag="WD0183"
FT   CDS_pept        complement(166849..168210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0183"
FT                   /old_locus_tag="WD0183"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to OMNI:NT01MC3965"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13931"
FT                   /db_xref="GOA:Q73II1"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q73II1"
FT                   /protein_id="AAS13931.1"
FT                   /translation="MWPIIEGGKGIAVSDRRSSGAFAAADAVGTFSGANAKLIDDNGEL
FT                   VPLIYKGKTRNEKHSELIEYSIEAGISQARIANEISKGHGRIHMNVLWEMGAAERVLHG
FT                   ILEGAKGLIHGITCGAGMPYRLGEIAAKYQVYYYPIISSVRAFKALWKRAYQRISSYLL
FT                   GGVVYEDPWLAGGHNGLSNSEDPELPQAPFERVAELRSFMNEIGLSETPIVMAGGVWHL
FT                   KDWEHWFDNLQIGPIAFQFGTRPLLTKESPISAEWKKKLLTLEEGDVFLNKFSPTGFYS
FT                   SAVRNNFIRELQERKLHQVNFSENASEESNSEFAMGSRGRKIYLTAKDKELANTWTKAG
FT                   YTEAMKTPDSTVIFVTPDKFKQIREDQINCMGCLSHCLFSNWKDHGDHSTGRKPDPRSF
FT                   CIQKTLQNVIHDGDIENELMFSGHNVYKFKQDPFYENGYVPAVKELVERILTGY"
FT   gene            complement(168343..168552)
FT                   /locus_tag="WD_0184"
FT                   /old_locus_tag="WD0184"
FT   CDS_pept        complement(168343..168552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0184"
FT                   /old_locus_tag="WD0184"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13932"
FT                   /db_xref="UniProtKB/TrEMBL:Q73II0"
FT                   /protein_id="AAS13932.1"
FT                   /translation="MTVVRIPAASLPCHPSSPLWCHPSSPDYLDPGKLIVHYSNIFDQK
FT                   LDSSVKHWNDTLPMVTALKLQQHE"
FT   gene            complement(168604..169191)
FT                   /locus_tag="WD_0185"
FT                   /old_locus_tag="WD0185"
FT   CDS_pept        complement(168604..169191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0185"
FT                   /old_locus_tag="WD0185"
FT                   /product="kinase, putative"
FT                   /note="Identified by match to TIGR00152 protein family HMM
FT                   TIGR00152; match to PF01121 protein family HMM PF01121"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13933"
FT                   /db_xref="GOA:Q73IH9"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73IH9"
FT                   /protein_id="AAS13933.1"
FT                   /translation="MIISLTGGIGVGKSFVANCFQEFGAVVFDADSVVHQLYKVDKSII
FT                   SYAEKNFPGVVVNGEIDRTVLSKYFLAYDENWKQFQSLVHSAVLRELEFFIAKEKKIDR
FT                   KLLVLDVPLLLETKFYLYCDLIVFVHADSVVQAQRLNERNIDKEKLNLISDVQLSIEEK
FT                   RKMSDFIIDTSVSKEYVFSQVKDIVDSLNLNT"
FT   gene            complement(169487..170665)
FT                   /locus_tag="WD_0186"
FT                   /old_locus_tag="WD0186"
FT   CDS_pept        complement(169487..170665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0186"
FT                   /old_locus_tag="WD0186"
FT                   /product="ribonuclease D, putative"
FT                   /note="Identified by similarity to EGAD:8817; match to
FT                   PF01612 protein family HMM PF01612"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13934"
FT                   /db_xref="GOA:Q73IH8"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IH8"
FT                   /protein_id="AAS13934.1"
FT                   /translation="MLISTTSELENTCEELIAKKPKFIAVDTEFIRNNLIYYPKLSLIQ
FT                   ISYGEKSFIVDALVPEIDLSFIKKIMLNQGITKVFHSCRQDIESLLTVFKCIPTPIFDT
FT                   QVAAMFCHYYHDFIGYSKVVEQYQGIALDKIKAKNSDWLRRPLSEDQLDYAVNDVVHLY
FT                   DLYQILCNKLEENNRMGWFQEEMESIVDINKYLHSPKDAWKRIKFNYEVNPRLILTVKA
FT                   VSEWQETLAQRYNMNRNKIINNAVIADFIEKNVEHVDEILDDLKRNTKNIKDADLLEFV
FT                   NIFNENERNWMQQNNTLSSNYDKSVLDILSIILDSKCKESNISRKLVSSKDELTGSISG
FT                   QTDKLFKGWRYDFFGRSVESFLNTSSKFEISAVKSANNITKIQSNLVENNCC"
FT   gene            complement(170703..170837)
FT                   /locus_tag="WD_0187"
FT                   /old_locus_tag="WD0187"
FT   CDS_pept        complement(170703..170837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0187"
FT                   /old_locus_tag="WD0187"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13935"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IH7"
FT                   /protein_id="AAS13935.1"
FT                   /translation="MLDPSSQGTGMTGEGSTGIGMEKAICVMPMSDRKFCKKSLIAKI"
FT   gene            complement(171550..174012)
FT                   /gene="mutS"
FT                   /locus_tag="WD_0190"
FT                   /old_locus_tag="WD0190"
FT   CDS_pept        complement(171550..174012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS"
FT                   /locus_tag="WD_0190"
FT                   /old_locus_tag="WD0190"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /note="Identified by match to TIGR01070 protein family HMM
FT                   TIGR01070; match to PF00488 protein family HMM PF00488;
FT                   match to PF01624 protein family HMM PF01624; match to
FT                   PF05192 protein family HMM PF05192; match to PF05188
FT                   protein family HMM PF05188; match to PF05190 protein family
FT                   HMM PF05190; match to TIGR01369 protein family HMM
FT                   TIGR01369; match to TIGR01612 protein family HMM TIGR01612"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13936"
FT                   /db_xref="GOA:P61673"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:P61673"
FT                   /protein_id="AAS13936.1"
FT                   /translation="MEQYLNLKAQYKDHLLFYRLGDFYELFFDDAIKAAKLLNIVLTKR
FT                   GNSCGQEIPMCGVPAHSSESYLHKLIDLGFKVAICDQLETADEAKKRGYKSIVKRDVVR
FT                   VVTPGTIIEDSLLEDKSNNYLASIVEQNDEYAISWLELSTGKFFHTLTSLKALDSDLLR
FT                   ISPRELLISEKFTEDEKIRSILKNYKISITQHAQSFFEYSKSHRTLCEFYKIRELGSIG
FT                   NFSKVEIMACGALLEYVRVTQRGSIPRLEFPKTYKQQNFMLIDTSARRNLELFSTQFGE
FT                   KKGSLISVIDHTVTASGGRLLKQMLASPLACSKAINLRLSTAQFFVNNHDSRRKIREIL
FT                   SNIPDIERSLSRLILGRGSPKDMNLLKIGLGKTLELSEFLCKIESGENGSLPQQYVIQT
FT                   EIQPASRAGITVKSDESELSTIHKSLGNHKDLFELLNSAILDNNLSSVKEGGFIHSKYN
FT                   SELSELSYILNNSNKLVTKLRESYRDLTGIAALKILHNNILGYYVEVSANHKITSDIFI
FT                   HRQSLANSMRYTTNELKELENKILTARDAAIGLEMKIFSELCSEVAKESEKIALAANAL
FT                   AKLDIRTAFAELAVQNNYVKPIIDDSKEFNICSGRHPVVEVNDKFIANSINLAGIHLIT
FT                   GPNMAGKSTFLRQNALIAILAHMGSFVPAESAHIGVIDKIFSRVGATDNITAGYSTFMV
FT                   EMIETATIVNQATDRSLVILDEIGRGTGVYDGLSIAQAVIEHIHNVNKCRAIFATHYHE
FT                   LTKVSKYLKNVKCFCVKIREWNGEVIFLHEVIEGIADESYGIHVAKLAGFPDSVLNRAS
FT                   EVFEELKA"
FT   gene            complement(174320..175126)
FT                   /locus_tag="WD_0191"
FT                   /old_locus_tag="WD0191"
FT   CDS_pept        complement(174320..175126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0191"
FT                   /old_locus_tag="WD0191"
FT                   /product="ankyrin repeat domain protein"
FT                   /note="Identified by match to PF00023 protein family HMM
FT                   PF00023"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13937"
FT                   /db_xref="GOA:Q73IH5"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IH5"
FT                   /protein_id="AAS13937.1"
FT                   /translation="MINNLDSIILGIKDGEKAIEDLRVVLKKRKEEVITTQTFNYALQC
FT                   PQTTKEAIVHEILLHFIQNPGEQSLEQVIQYLDGAIQSRIYAKNNPIRNLDEEFRTHIN
FT                   FKDEEGNTLLHHAVIGNKTEEITTLLVTYSANPLIQNADNKVPSDLAQGKTKEVLIKSM
FT                   KKQANTKKESAMVGSLVPGVIIGGFLGVVLGAGVCVAVSLSGGMILGVMIASSLVASIA
FT                   IGLAMYFLSQDYEQAKAIEKTISTVSSEISVDDTTVANGKKGPQLT"
FT   gene            complement(175312..175494)
FT                   /locus_tag="WD_0192"
FT                   /old_locus_tag="WD0192"
FT   CDS_pept        complement(175312..175494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0192"
FT                   /old_locus_tag="WD0192"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13938"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IH4"
FT                   /protein_id="AAS13938.1"
FT                   /translation="MVENLGVVFTTAQRAIVKLEDLGIVSQTSQGKRDRVYCATDILNI
FT                   LEEPTKITENFDSTL"
FT   gene            complement(175518..175631)
FT                   /locus_tag="WD_0193"
FT                   /old_locus_tag="WD0193"
FT   CDS_pept        complement(175518..175631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0193"
FT                   /old_locus_tag="WD0193"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13939"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IH3"
FT                   /protein_id="AAS13939.1"
FT                   /translation="MYIKGSPSGKVFAGYQAFIPSPLPPKFEWDNDLVNSL"
FT   gene            175892..176599
FT                   /locus_tag="WD_0194"
FT                   /old_locus_tag="WD0194"
FT   CDS_pept        175892..176599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0194"
FT                   /old_locus_tag="WD0194"
FT                   /product="membrane protein, TerC family"
FT                   /note="Identified by match to PF03741 protein family HMM
FT                   PF03741"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13940"
FT                   /db_xref="GOA:Q73IH2"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IH2"
FT                   /protein_id="AAS13940.1"
FT                   /translation="MLTDAWTLLTLTLLETILSVDNLIFISLAIDKVPNALRERVRLMG
FT                   LGLALLMRFVILFFTSSILSMQKPIFHTASARDLLMIAGGLFLIVKSSMELRDDIFVCK
FT                   KNKKKANVKSKFFLVVLQIILIDLVFSVDSILTAIALTYNMVIIATAFTFSMLAMLFLS
FT                   SYTAQLIKSNPGLKIIAILFVLLVGVYLILHGFHIELPKGYLYSSFMFALLVEIISKIK
FT                   KINRHTAIHSRYL"
FT   gene            complement(176632..178194)
FT                   /gene="guaA"
FT                   /locus_tag="WD_0195"
FT                   /old_locus_tag="WD0195"
FT   CDS_pept        complement(176632..178194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="WD_0195"
FT                   /old_locus_tag="WD0195"
FT                   /product="GMP synthase"
FT                   /EC_number="6.3.5.2"
FT                   /note="Identified by similarity to EGAD:22228; match to
FT                   TIGR00884 protein family HMM TIGR00884; match to PF00958
FT                   protein family HMM PF00958; match to TIGR00888 protein
FT                   family HMM TIGR00888; match to PF00117 protein family HMM
FT                   PF00117"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13941"
FT                   /db_xref="GOA:Q73IH1"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73IH1"
FT                   /protein_id="AAS13941.1"
FT                   /translation="MSAIAIIDFGSQFTQLIARQVRGMGVYCEIFPSNISFETISKFNG
FT                   FILSGGPQSVNDDCSETSRVVHEIIKLNEATSVPILGICYGQQLICHYFGAKVKESFKQ
FT                   EFGRTKIKILKESPIVKDTWDVNSEVDVLMNHADSVDTIPQGFTVIASGVINQTIAMIV
FT                   NEQRKIYCTQFHPEVKPTTNGSKLLSNFLDIANCKRDWTMKSFIEEQKEKIKNVVGEKK
FT                   VIAAVSGGVDSSVAAALTHKAIGKQLNCIFIDTGLLRKNQTIAMLKEIPINYVDKSNLF
FT                   LSRLKGITDPEEKRKIIGNTFIEVFEEEAKKIGDVDFLMQGTIYSDVVESGHASDNTST
FT                   IKSHHNVGGLPEKMNLKLVEPLRYLFKDEVRLLGKEIGLSDEIIFQHPFPGPGLAVRII
FT                   SEVDKEKVQILQEVDEIYINTMKNYDLYDKIWQAFAVLLPIKTVGVMGDGRTYGYVCAL
FT                   RAVTSSDGMTADAFPFEDKDQHLLVFWDFLRNVGSIIVNNVPGVNRVVYDITSKPPATI
FT                   EWE"
FT   gene            complement(178385..178489)
FT                   /locus_tag="WD_0196"
FT                   /old_locus_tag="WD0196"
FT   CDS_pept        complement(178385..178489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0196"
FT                   /old_locus_tag="WD0196"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13942"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IH0"
FT                   /protein_id="AAS13942.1"
FT                   /translation="MLAAEIPRMNRGMTVRGGMTVRGSMKIIPLLVSG"
FT   gene            complement(179173..180957)
FT                   /gene="nrdA"
FT                   /locus_tag="WD_0197"
FT                   /old_locus_tag="WD0197"
FT   CDS_pept        complement(179173..180957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdA"
FT                   /locus_tag="WD_0197"
FT                   /old_locus_tag="WD0197"
FT                   /product="ribonucleoside-diphosphate reductase, alpha
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="Identified by similarity to EGAD:163261; match to
FT                   PF02867 protein family HMM PF02867; match to PF00317
FT                   protein family HMM PF00317"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13943"
FT                   /db_xref="GOA:Q73IG9"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IG9"
FT                   /protein_id="AAS13943.1"
FT                   /translation="MNNITINYAKDSKLTDFGKAVLSDRYLIENESYQDLFARIANYYS
FT                   DNKEHAQRLYDYMSNLWFMPSTPILSNGGTKRGLPISCFLNETEDSLQGIVDLWNENVW
FT                   LAARGGGIGSYWGNLRSIGESVKGSGKTSGIVPFIVVQNALTLAISQGSLRRGSSAVYL
FT                   PVSHPEIEEFLDLRKPTGGDPNRKALNIHHAVIVTDKFMQAVENDQEWNLISPHNNKVI
FT                   STVKARDIWIKILTARVETGEPYIIFLDATNNNKPESYKKLNLDIKMSNLCSEITLTTG
FT                   YDHLNKSRTAVCCLSSVNLEYYEEWKDNKLFIEDIMRFLDNVLEDFINKAPNEMQRAKY
FT                   SAARERSIGLGVMGFHSFLQSKMVPFESVTAQQWNKKIFKYLREQADIVSKKLAEEKGA
FT                   CSDAKEVDLMERFTHKLAIAPTASISIIAGNTSPGIEPYAANVFIQKTLTGSFVVRNKF
FT                   LQKLLAEKNQDNDKIWSSISTNEGSVQHLDFLSEHEKLTFKTAYELDQRWIIEHASDRT
FT                   SYICQSQSVNLFLPANVHKRYLHKIHMLAWKKGLKSLYYCRSQSMQRADKVSHDIFKKS
FT                   EILQQKTDIDYDECLSCQ"
FT   gene            complement(181016..182092)
FT                   /locus_tag="WD_0198"
FT                   /old_locus_tag="WD0198"
FT   CDS_pept        complement(181016..182092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0198"
FT                   /old_locus_tag="WD0198"
FT                   /product="TPR domain protein"
FT                   /note="Identified by match to PF00515 protein family HMM
FT                   PF00515"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13944"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IG8"
FT                   /protein_id="AAS13944.1"
FT                   /translation="MKSNLSFIKNVALNCMSKLIGVLNIKKVKHFIVNKYNTLHKEMTV
FT                   LLKKSKNLLNTNIEIGLYHFYKGSISDAKLRFWLISIFYPHLPIVWYNIGRCHFAVGNT
FT                   NKAYNYLTRALKLDNDHEEASYYIKKMTNSAPITELPKNLIRQYFDYTGEYFVEHWLIA
FT                   KQYRGHELVHMIITKIFNNSTSELNILDLGCGTGICGHFLKINSIGKHITGIDISSRML
FT                   NIARGCFIKGKPVYNELIHMEMKEFLKQEKNQQYDVIIFAEVLHYLHDFQEELELAKRS
FT                   TSKKGVIVCLIRRKEGEGIDFVNKGDYFRHSESYVQHVAKEINMQISYMSYCKIYGSQV
FT                   DGILFALQHQQKNPKNLT"
FT   gene            182428..185173
FT                   /locus_tag="WD_Wp23SB"
FT                   /old_locus_tag="Wp23SB"
FT   rRNA            182428..185173
FT                   /locus_tag="WD_Wp23SB"
FT                   /old_locus_tag="Wp23SB"
FT                   /product="23S ribosomal RNA"
FT   gene            185258..185368
FT                   /locus_tag="WD_Wp5SC"
FT                   /old_locus_tag="Wp5SC"
FT   rRNA            185258..185368
FT                   /locus_tag="WD_Wp5SC"
FT                   /old_locus_tag="Wp5SC"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(185452..185715)
FT                   /locus_tag="WD_0199"
FT                   /old_locus_tag="WD0199"
FT   CDS_pept        complement(185452..185715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0199"
FT                   /old_locus_tag="WD0199"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13945"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IG7"
FT                   /protein_id="AAS13945.1"
FT                   /translation="MVEHIKEVNNTGFGQMYQFLFLPKGTGTDWRSAFRQQEELFKKVG
FT                   SNVILPEVSNSPSKGNQLGKVGTMLNNVENDQEHIRKKRYRS"
FT   gene            complement(185801..185938)
FT                   /locus_tag="WD_0200"
FT                   /old_locus_tag="WD0200"
FT   CDS_pept        complement(185801..185938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0200"
FT                   /old_locus_tag="WD0200"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13946"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IG6"
FT                   /protein_id="AAS13946.1"
FT                   /translation="MLAKISILNISNIGHYYIILTHRNIMQASYKNLQKDLTICLKKIK
FT                   "
FT   gene            complement(186144..186278)
FT                   /gene="rpmH"
FT                   /locus_tag="WD_0201"
FT                   /old_locus_tag="WD0201"
FT   CDS_pept        complement(186144..186278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="WD_0201"
FT                   /old_locus_tag="WD0201"
FT                   /product="ribosomal protein L34"
FT                   /note="Identified by similarity to EGAD:17142; match to
FT                   TIGR01030 protein family HMM TIGR01030; match to PF00468
FT                   protein family HMM PF00468"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13947"
FT                   /db_xref="GOA:Q73IG5"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73IG5"
FT                   /protein_id="AAS13947.1"
FT                   /translation="MKRTFQPKNLIRKRRHGFRSRMATRAGRKILNRRRSLGCNKLCA"
FT   gene            186566..187474
FT                   /locus_tag="WD_0202"
FT                   /old_locus_tag="WD0202"
FT   CDS_pept        186566..187474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0202"
FT                   /old_locus_tag="WD0202"
FT                   /product="phosphate ABC transporter, permease protein,
FT                   putative"
FT                   /note="Identified by match to PF00528 protein family HMM
FT                   PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13948"
FT                   /db_xref="GOA:Q73IG4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IG4"
FT                   /protein_id="AAS13948.1"
FT                   /translation="MLAFIFKNKRNKIIKLSLFVALAISFFITLFIMLSIFIQSISFFN
FT                   KVAISEFLFCLKWGHNVVTINEEKIGCFGIAPLLVGTLLITIIAMLVVVPLGLFSAIYI
FT                   SEYASEKVCYIVNTTLQVLSAIPTVVYGYFAVVFLSFFIKQVANFFGLSIHSESALVAG
FT                   LSIGIMILPFIISLLEDAIRSVPKSLRYGFMALGATPAETIWHITIPYAMPTILSAILL
FT                   SISRVIGETMIVLMAVGINANLTFNPLNSVTTITVQIATLLTGDQDFNSVQTLAAYALS
FT                   LVLFIITWLLNAFALFVMKRN"
FT   gene            187576..189003
FT                   /gene="atpD"
FT                   /locus_tag="WD_0203"
FT                   /old_locus_tag="WD0203"
FT   CDS_pept        187576..189003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="WD_0203"
FT                   /old_locus_tag="WD0203"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="Identified by similarity to EGAD:5715; match to
FT                   TIGR01039 protein family HMM TIGR01039; match to PF00006
FT                   protein family HMM PF00006; match to PF00306 protein family
FT                   HMM PF00306; match to PF02874 protein family HMM PF02874"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13949"
FT                   /db_xref="GOA:Q73IG3"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73IG3"
FT                   /protein_id="AAS13949.1"
FT                   /translation="MNIGRAIKVTQAVVDIKFEGELPKIFNALKSKLKYKDKELVLEVS
FT                   QHIGDNIVRCIAMDSTDGMSRGDEFVDTGAPISVPIGRSTLGRIFNVVGELIDECGPLK
FT                   GKYNLEPIHRAPPSFTEQRIQEEVLVTGIKVIDLLAPYLKGGKIGLFGGAGVGKTVLIM
FT                   ELINNIAKAHKGFSVFAGVGERTREGNDLYHEMITSNVININEHEKSQAVLVYGQMNEP
FT                   PGARARVALTALTMAEYFRDRENQDVLFFVDNIFRFTQAGSEISALLGRIPSAVGYQPT
FT                   LATDMGAMQERIASTTSGSITSVQAIYVPADDLTDPAPATTFSHLDATTVLSRQIAEMG
FT                   IYPAVDPLDSTSQSLSAEIIGEEHYNVASEVKRILQTYKSLQDIIAILGMDELSDEDKI
FT                   IVDRARKIQKFLSQPFHVAEIFTGMPGKFVSLSDTVSSFKGIVEGKYDHLPEAAFYMVG
FT                   NIDEAIKKAELIQAEAK"
FT   gene            189016..189360
FT                   /locus_tag="WD_0204"
FT                   /old_locus_tag="WD0204"
FT   CDS_pept        189016..189360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0204"
FT                   /old_locus_tag="WD0204"
FT                   /product="ATP synthase F1, epsilon subunit, putative"
FT                   /note="Identified by similarity to SP:P00832; match to
FT                   PF02823 protein family HMM PF02823"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13950"
FT                   /db_xref="GOA:Q73IG2"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73IG2"
FT                   /protein_id="AAS13950.1"
FT                   /translation="MNTFKVQFFSPDDQISFSGVVSLSVTGLEGELMILAHHAPYLIYL
FT                   LPGMITVKMSNQTEKKVVIDSGVLEVANNNCSIITSQIQVFDRAIHDEKSFKNKRISIY
FT                   LSYLDEKFLS"
FT   gene            189494..189601
FT                   /locus_tag="WD_0205"
FT                   /old_locus_tag="WD0205"
FT   CDS_pept        189494..189601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0205"
FT                   /old_locus_tag="WD0205"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13951"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IG1"
FT                   /protein_id="AAS13951.1"
FT                   /translation="MMVWDHTPNQIKIKEGELVVTVGDNDFVLPGIYVG"
FT   gene            189748..189966
FT                   /locus_tag="WD_0206"
FT                   /old_locus_tag="WD0206"
FT   CDS_pept        189748..189966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0206"
FT                   /old_locus_tag="WD0206"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13952"
FT                   /db_xref="GOA:Q73IG0"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IG0"
FT                   /protein_id="AAS13952.1"
FT                   /translation="MISNIIRSIVKYLMRKVIKYISIIGIACLVLLFFISNVETRVKTQ
FT                   EEQLFLAVEDGNAQEVKLLLKNGADPN"
FT   gene            complement(189994..191040)
FT                   /pseudo
FT                   /locus_tag="WD_0207"
FT                   /old_locus_tag="WD0207"
FT                   /note="transposase, IS3 family, degenerate; This region
FT                   contains one or more premature stops and/or frameshifts
FT                   which are not the result of sequencing error."
FT   gene            complement(191146..191856)
FT                   /locus_tag="WD_0208"
FT                   /old_locus_tag="WD0208"
FT   CDS_pept        complement(191146..191856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0208"
FT                   /old_locus_tag="WD0208"
FT                   /product="class II aldolase/adducin domain protein"
FT                   /note="Identified by match to PF00596 protein family HMM
FT                   PF00596"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13953"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IF9"
FT                   /protein_id="AAS13953.1"
FT                   /translation="MLLTKSRVKRDLVYAYQILSYLKFDDHTYTHLSVRSEDQKSFYIY
FT                   PFGMRFDEVDERSLMKVSFDGDVIEGKEYQYNRTGYIIHGFVYQARKDIQAIFHLHTPS
FT                   IVAASSLKDGLLPISQWALHFYNKISYHNYNSLALSDTEGKRLIADLKENFVMLMRNHG
FT                   SITCGRTIQEAMFYSYHLEQACKTQCLTLAMNKELSIPSEEICSKAVKDLLSFESNLGE
FT                   RDWHAWVRLIKSKL"
FT   gene            192137..192760
FT                   /locus_tag="WD_0209"
FT                   /old_locus_tag="WD0209"
FT   CDS_pept        192137..192760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0209"
FT                   /old_locus_tag="WD0209"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13954"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IF8"
FT                   /protein_id="AAS13954.1"
FT                   /translation="MVNINTKKQPAGFFIYPSGLSGSGKLSTAIELSNMINALIVNSKF
FT                   YNNVQACSIYDGVFERDQIPKEVQDRIYGIMQIMLQVIENYPIHSKNYIFIDELMENND
FT                   QNMRMYDSIVRLSKKMNTEILPVVLRCDLPTLQKRIALKRQRKNRKVINLNSIVEKFRT
FT                   DDLFIPPSAIEIENSDMSIKEVAQEIVNQMHKLSNIACTRKNSL"
FT   gene            complement(192755..193330)
FT                   /locus_tag="WD_0210"
FT                   /old_locus_tag="WD0210"
FT   CDS_pept        complement(192755..193330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0210"
FT                   /old_locus_tag="WD0210"
FT                   /product="endopeptidase-related protein"
FT                   /note="Identified by match to PF00814 protein family HMM
FT                   PF00814"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13955"
FT                   /db_xref="GOA:Q73IF7"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IF7"
FT                   /protein_id="AAS13955.1"
FT                   /translation="MSILAIDTVGIGSSIAIVDYDGNCFVEHNSASNNHAESFFQILNT
FT                   LFDKHNYNYDKIDHLVVVVGPGSFTGIRVGISAAQGINLATNKPLYGVSALEVQAYAIS
FT                   LLCTNNKKNIRAIVKNAQGFYTQLFDFNLLPLSAPGSQCHATSSTHMDCNLNASHAGLL
FT                   VRYRLENKQKLNEVEALYLNEPQYMKSL"
FT   gene            complement(193330..194475)
FT                   /locus_tag="WD_0211"
FT                   /old_locus_tag="WD0211"
FT   CDS_pept        complement(193330..194475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0211"
FT                   /old_locus_tag="WD0211"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13956"
FT                   /db_xref="GOA:Q73IF6"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IF6"
FT                   /protein_id="AAS13956.1"
FT                   /translation="MVYKNVLQLLILLTVITSAAFFGHLVPMEVKTFLYSTSLSIKEVL
FT                   LFIMPFIIFALIFSSVNNLKQSAIKFILLLIIMIFLSNLASSLIAYSVGHFIIQNTYSI
FT                   QDITYEETIVPLWSFRLPALLSNFYALACGFVSSIVVSTLLPKKSRELSNKMLDLTLFI
FT                   LKTFLTPIIPIFVLGLALKMQHDQVLSIIFKDYSIIFIIIASATYLYVFLLYGAANSFK
FT                   ITSWIASIGNMIPAFITAMSTMSSNATMPLTLEGSKKNVKQPDIASSVVPITASFHLVG
FT                   DCFFIIILSMIIASGYSLCTTDYVTFLLYFLLFKFAIVAVPAGGIMVMLPILEKYLKFS
FT                   PEMLSLITALYIVFDPIITSANVMGNGAFAIMFTKLYDKLK"
FT   gene            complement(194589..195578)
FT                   /gene="nrdB"
FT                   /locus_tag="WD_0212"
FT                   /old_locus_tag="WD0212"
FT   CDS_pept        complement(194589..195578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdB"
FT                   /locus_tag="WD_0212"
FT                   /old_locus_tag="WD0212"
FT                   /product="ribonucleoside-diphosphate reductase, beta
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="Identified by similarity to EGAD:163259; match to
FT                   PF00268 protein family HMM PF00268"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13957"
FT                   /db_xref="GOA:Q73IF5"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IF5"
FT                   /protein_id="AAS13957.1"
FT                   /translation="MSLLEADPIYKPFNYPWAYDAWLQQQRIHWIPEEVPLADDVKDWK
FT                   TKLSSVEKNLLTQIFRFFTQADIEVNNCYMRHYSNIFKPTEICMMLASFSNMETIHIAA
FT                   YSYLLDTIGMPESEYQAFLKYDAMRKKYEYMLEFEESKKHDKKHVAKTLAVFGAFTEGL
FT                   QLFASFAILLNFQRFGKMKGMGQIIAWSARDETLHTNSIIMLFNTFIKENNEIWDNEFK
FT                   EELYSACRTIVELEDEFIKLAFDLGDVEGLSAEEVRNYIRYVANRRLMQLGLESIYDVN
FT                   DNPIPWLDEILNGVEHTNFFENRVTEYSRAATQGTWEEAFTENDTNNK"
FT   gene            195710..196048
FT                   /locus_tag="WD_0213"
FT                   /old_locus_tag="WD0213"
FT   CDS_pept        195710..196048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0213"
FT                   /old_locus_tag="WD0213"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13958"
FT                   /db_xref="GOA:Q73IF4"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IF4"
FT                   /protein_id="AAS13958.1"
FT                   /translation="MRVLISFILLFTVSCTHTIHNHGAPGISVELWSKIKVGDDKEKVV
FT                   HTLGSPTLVSKFDDNVWYYVSYKIKQANFLGKRKYSSKSLQISFDQDGKVEDTKETDIL
FT                   ERSLAVSD"
FT   gene            complement(196746..197315)
FT                   /locus_tag="WD_0214"
FT                   /old_locus_tag="WD0214"
FT   CDS_pept        complement(196746..197315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0214"
FT                   /old_locus_tag="WD0214"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13959"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IF3"
FT                   /protein_id="AAS13959.1"
FT                   /translation="MLFSLSSTKAQTNDTLAVPIPQRKKEIVEHTVVAQPRQIIEMQEE
FT                   VIINEGKEFIPIPKRKKSVEKKLRRDVRGAKNEIGNEKSVESKKDELVVTEIINSIRDK
FT                   LTKCWSIPESIAYKENFNIKINLLLSSQGEIIMADVADSDSYRNNPLFRSIADNAMRAV
FT                   YKCSPLTGLPTQHHHIWREVTLDFIL"
FT   gene            complement(197426..197767)
FT                   /locus_tag="WD_0215"
FT                   /old_locus_tag="WD0215"
FT   CDS_pept        complement(197426..197767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0215"
FT                   /old_locus_tag="WD0215"
FT                   /product="transposase, IS5 family, OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13960"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IL9"
FT                   /protein_id="AAS13960.1"
FT                   /translation="MRTKYTKVKKMWADMGYQGRNLKNHIKEEYDIDIEIVKRPPCRFW
FT                   VHKDTPPELLPTREQGFKVQPRRWVVERTFAWVNRNRRLSKEYDLLTTSTENFIYLAMS
FT                   RVMLKREYA"
FT   gene            complement(197878..198258)
FT                   /locus_tag="WD_0216"
FT                   /old_locus_tag="WD0216"
FT   CDS_pept        complement(197878..198258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0216"
FT                   /old_locus_tag="WD0216"
FT                   /product="transposase, IS5 family, OrfA"
FT                   /note="Identified by similarity to GP:1256580"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13961"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IM0"
FT                   /protein_id="AAS13961.1"
FT                   /translation="MRKKYPTDLSEREWSRIEKHFRVSYKKGGRPPKYSKREILEAIFY
FT                   VLRTGCQWRYLPNDFPLWKTVYEQFRQWKKQGIFEKMNYEITKYSRRKIGRNEQPSACI
FT                   VDSQSVKTTEKGGSKAMMEVKK"
FT   gene            198458..199489
FT                   /locus_tag="WD_0217"
FT                   /old_locus_tag="WD0217"
FT   CDS_pept        198458..199489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0217"
FT                   /old_locus_tag="WD0217"
FT                   /product="phage uncharacterized protein"
FT                   /note="Identified by similarity to GP:6723225"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13962"
FT                   /db_xref="InterPro:IPR009362"
FT                   /db_xref="InterPro:IPR041527"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IF0"
FT                   /protein_id="AAS13962.1"
FT                   /translation="MTKIIAKEYTEFLEQLKDHIATNRYKAALAVNSKLILLYHHIGTE
FT                   ILKRQKEHTWGAKVIDQLSKDLRSTFPEMKGFSMRNLKYMRKFAEEYPDVEFVQEPLAQ
FT                   LTWYHNITLLEKIESHEIRLFYVKKAIEHGWSRNIMVMQIELGLHKRQGKAITNFKEKL
FT                   PSPQSDLAHYTLKDPYIFDFLSIGKDAHEREVEKGLVGHMEKFLLELGEGFAFVGRQFH
FT                   LDVGNKDFYIDLLFYHLKLRCFVVIELKDKDLKPEYAGKMNFYLSAVDDLLKHSTDQPS
FT                   IGLILCKSKDDVLAKYTLRDMNKPIGLAEYRITENLPENIKTALPTIEELEAELSKISD
FT                   EEK"
FT   gene            199489..199712
FT                   /pseudo
FT                   /locus_tag="WD_0218"
FT                   /old_locus_tag="WD0218"
FT                   /note="portal protein, degenerate; This region contains one
FT                   or more premature stops and/or frameshifts which are not
FT                   the result of sequencing error."
FT   gene            199696..200418
FT                   /locus_tag="WD_0219"
FT                   /old_locus_tag="WD0219"
FT   CDS_pept        199696..200418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0219"
FT                   /old_locus_tag="WD0219"
FT                   /product="recO-related protein"
FT                   /note="Identified by similarity to OMNI:NTL02ML6125"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13963"
FT                   /db_xref="GOA:Q73IE9"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73IE9"
FT                   /protein_id="AAS13963.1"
FT                   /translation="MRWKDEGIIIAAKKYGDKNLILSLFTKNHGKRRGLTKLTNNSNYK
FT                   FQISNLLHAEWSAKLPENLGFLKCELIESPFHHFFQDRLKSITIVSFSSILEKVLPESE
FT                   PCAMLYDNLRYFIDVIKHNNQSWQSHYLNLELLLLTQLGFKLDLSKCAVTGVKENLQFI
FT                   SPKTGRAVSKKVGDYYADKLLPFPQMLHDVYNNNLQNSYSFQEFQLGLKVTGYFLNKYL
FT                   FLQLNVKFPELRNLMLSL"
FT   gene            200591..200755
FT                   /locus_tag="WD_0220"
FT                   /old_locus_tag="WD0220"
FT   CDS_pept        200591..200755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0220"
FT                   /old_locus_tag="WD0220"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13964"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IE8"
FT                   /protein_id="AAS13964.1"
FT                   /translation="MSGCHPSAPMMSSQCPDTGIQKSLLVNKQTSMESGYNVFDEIIWK
FT                   TGFQCQALE"
FT   gene            complement(200878..202260)
FT                   /locus_tag="WD_0221"
FT                   /old_locus_tag="WD0221"
FT   CDS_pept        complement(200878..202260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0221"
FT                   /old_locus_tag="WD0221"
FT                   /product="response regulator/GGDEF domain protein"
FT                   /note="Identified by similarity to EGAD:40409; match to
FT                   PF00990 protein family HMM PF00990; match to PF00072
FT                   protein family HMM PF00072; match to PF00072 protein family
FT                   HMM PF00072; match to TIGR00254 protein family HMM
FT                   TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13965"
FT                   /db_xref="GOA:Q73IE7"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IE7"
FT                   /protein_id="AAS13965.1"
FT                   /translation="MTAKILVVDDVLSNVKLLEARLKAEYYTVIVAHDGEEAIDLVAKQ
FT                   QPDIILLDIMMPKMNGFEVCKELKSDPLTTHIPIIMVTALHDTHDRVQGINAGADDFLT
FT                   KPINETALSSRIKSLTRLKMIIDEWRLRGETNAEIGGVAGNSIMDYSNQIFDANVLVID
FT                   EDVHQAEQIYNILKQRFRSIKILSDPMEALKVGIENGYDLIISDMQFSKTDGLRLCSEF
FT                   RSKVETRYTPILILSEDYDKNNLVKALDVGANDYLTVPLDEGELIARVNSQVKRKRYQD
FT                   ALRMNLFNNAEMSIKDPLTNCYNRRYFDAHLRNIVKDSVEKDRRLSLMILDIDYFKIVN
FT                   DSFGHSAGDELLKQIQKRISENIRVTDLLARFGGEEFVVVMPDTNVSDAYTIAERIRKI
FT                   IAKKPFILADKNTTHDVTVSIGIAEMQESDLDNIKEFIVRADKYLYKAKNSGRNRVVTG
FT                   YS"
FT   gene            complement(202232..202543)
FT                   /locus_tag="WD_0222"
FT                   /old_locus_tag="WD0222"
FT   CDS_pept        complement(202232..202543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0222"
FT                   /old_locus_tag="WD0222"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13966"
FT                   /db_xref="GOA:Q73IE6"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IE6"
FT                   /protein_id="AAS13966.1"
FT                   /translation="MLHRKMFNIGLSEILVVALVSIIVLDKNKVPVFIDFIKTIYRYFT
FT                   IVRLKARRLLKDAGIEDLYKECNTEKVNYIVGKNGKLYPTYDIDNTSKDNDSEDSGSR"
FT   gene            complement(202533..207257)
FT                   /locus_tag="WD_0223"
FT                   /old_locus_tag="WD0223"
FT   CDS_pept        complement(202533..207257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0223"
FT                   /old_locus_tag="WD0223"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to OMNI:NTL03PA03068; match
FT                   to PF05088 protein family HMM PF05088; match to TIGR01612
FT                   protein family HMM TIGR01612"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13967"
FT                   /db_xref="GOA:Q73IE5"
FT                   /db_xref="InterPro:IPR007780"
FT                   /db_xref="InterPro:IPR028971"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IE5"
FT                   /protein_id="AAS13967.1"
FT                   /translation="MCIDHNVDTESLFKLADQENQQDKEKIKKFIKYFYSFVYKSDLKA
FT                   NDKFLLYIVNDAYNFVSQKEKDESKLVVSNIDDIPGIEGDFTTIKITNDDMPFLVDSVI
FT                   ATIKSHDLTICYYSNSIINIKRKDGLIDEIYSLEESNGVKESVIYVIIKGISDSFVDTL
FT                   KESLQKTLKAVNCVVKDWHLMLKKLDEASLSVIPAGIQEKDTWIPVSRTGMTPDRNQEQ
FT                   KDFLVWLKNNNFVFLGYQEYIAGKDEKLVCDSKKDLGLMRVGQSTLIPSANLDSLYILR
FT                   SDLISIVHRHTYMNCIGVKEFDDQGNVVKERRFFGLFTSVAEVQDIRTIPIIRDKVKVI
FT                   EKNAGFVTGGHNNKALISILQVFSCDELFQSNEDELFKICISIMSLAIRPRVRLFLRRV
FT                   GDFISCIVLIPMHYASARLMFKIRDILKDETSAGSSDIYNNHIINEYDLMKLHVVLKTK
FT                   NASVLDDEVLRIENKLRNITEKWEDRFIDNLYNTFSTVEDIFIRYCKAFPISYQESFEP
FT                   HDAYYDMKKLEIVRKKGVSEVDLRLTRDNLNYQLKVYTPNNGGLELSKILRITKNLGAK
FT                   ILSHNGYYIEINGGIWIHHFVLSRVDELIDNITLKEQFEITLAKVFSKEIKNDYFNSLI
FT                   IIAGLKWKEVLLVRALSAYLKQTSFNYNPEYIQKVVSEHPKIVKYLIQLFHARFDPNID
FT                   IDRAETTDIVREKIEELLKEISNVSHDCVLRSIFNLIMAILRTSYYQDDKPYLSTKFDS
FT                   SKINGLPDPRPYRELYIYSNLFEGIHLRGGKLARGGLRWSDRTEDFRTEVLGLMKAQMT
FT                   KNAVIVPVGAKGGFVIKQAYKDKNILREKSVECYKSFIRGMLDITDNVVDGKIIPPGNV
FT                   IRYDEDDPYLVVAADKGTASFSDYANQIASEYNFWLGDAFASGGSVGYDHKKMGITARG
FT                   AWIAAQRHFWKMNKDIYQNATVIGIGDMAGDLFGNGMLLSKNIHLIGAFNHMHIFIDPN
FT                   PDAEKSFTERKRLFKLPFSTWMDYNKDLISQGGRVFERSSKQVNLSQEMKKCFDITEDT
FT                   LSPSDLIRYLLKAEVDFIWNGGIGTFVKAKSESHSMVGDKANDELRVNGKDIRASMFIE
FT                   GGNLGCTQLGRIEYAERGGYINADFVDNSAGVICSDLEVNIKIAFVSAMKAGGISLEKR
FT                   NEILASMVDEVASKVLENHNRIETKALLLECLQAKERLEQDHRLLLSLEKSGLLNRSVE
FT                   FLPTDEEVARMLTGAEGFSSPQLSILISYARTAIKNKIIHSDLPEKDLISNDYLLGYFP
FT                   KKMSTEFKDFILKHQLRREIISTCIANDVVNRMGCIFINNLVENTGIKVHEAVNIYIVV
FT                   NHLYDLNNLWQKIDELDGKIDINSYLQIVRNVQKFIGRVSFWLVKNLSFVELDDVTKFK
FT                   DAIETLGHDVLDEHLLKVYNHGYTSLVELNIDKDLAKKIADLCVLTYALDIISVAEQTS
FT                   LSILDAGKIYFELKSLLRFDLIRTIAIKMKSSSSYWDRSLVNDLLDDLSNYHHKLAVKV
FT                   IKATDNPEDKVQTWACNDKDYIERYNSFLDEMVASKLDLSKLIFIIRRIKLLAS"
FT   gene            complement(207285..209846)
FT                   /gene="clpB"
FT                   /locus_tag="WD_0224"
FT                   /old_locus_tag="WD0224"
FT   CDS_pept        complement(207285..209846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="WD_0224"
FT                   /old_locus_tag="WD0224"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpB"
FT                   /note="Identified by similarity to EGAD:20010; match to
FT                   PF02861 protein family HMM PF02861; match to PF02861
FT                   protein family HMM PF02861; match to PF00004 protein family
FT                   HMM PF00004; match to PF00004 protein family HMM PF00004"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13968"
FT                   /db_xref="GOA:Q73IE4"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73IE4"
FT                   /protein_id="AAS13968.1"
FT                   /translation="MDLNKFTEKAKSLIQSAQMKALGAGHQIFMPEHLLKVMLEDESGL
FT                   VQDLINACGGNVQSISDAVDSAIKKLPVIEGPGSGGLQLSREIAKVFEDSIGIAKRNKD
FT                   SFVAVERLLQGLTAQKDDTVGKILAENGVTPQKLNSVVAEMRKGSSADSPNSEEKLNAA
FT                   KKYTKDVTELAMQGKLDPVIGRDEEIRRTMQVSLRRTKNNPVLIGEPGVGKTAIVEGLA
FT                   NRIVANDVPLGLHDAKVLALDLGALIAGTKFRGEFEERLKAVINELSRAEGKVILFIDE
FT                   LHTLVGAGATSGAMDASNLLKPALARGEVRCIGATTLDEYRQHIEKDPALARRFQPVFI
FT                   SQPTETDTISILRGLKERYEVHHGIRITDGAIIAAATLSNRYITDRFLPDKAIDLIDEA
FT                   ASRVRIEMDSKPEVIDELERKVIQLKIEAEALKKESDENSKQRLKKINEEIENLNSKFA
FT                   DLNSKWQMEKNKIARIQETAEKLDNARKELELVQRSGNLGRAGELMYGVIPQLENELKN
FT                   QEKVTDSFLKKEVTGDDIANIVSKWTGIPVDNMMHSEKEKLLNMENEIGRRVIGQKDAI
FT                   EAISNAVRRSRSGVQDTNKPFGSFLFLGPTGVGKTELAKALAEFLFDDQSALLRFDMSE
FT                   YMEKHSVSKLIGAPPGYVGYEQGGRLTEAVRRRPYQVILFDEIEKANPDIFNLLLQILD
FT                   EGRLTDSHGKLIDFRNTILILTSNLGAEIMLKGNVDSVRNEVMQIVKSAFRPEFLNRLD
FT                   EIIIFHSLTRDDIYKIIDVQFSYLQKTLAKRKLSISLLQEAKELIAQTGYDPEYGARPL
FT                   KRVIQECIQNNLAKLVLSGEVVENDELIVYALDNEILVKKV"
FT   gene            210249..210527
FT                   /locus_tag="WD_0225"
FT                   /old_locus_tag="WD0225"
FT   CDS_pept        210249..210527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0225"
FT                   /old_locus_tag="WD0225"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13969"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IE3"
FT                   /protein_id="AAS13969.1"
FT                   /translation="MEICSFSRELMLQILYISLQNGIRFLHYPLPAFSSAFLAVCLPYR
FT                   RKYRLTLFLLSYNSGLGDFSIPVICVHPEMKNVTLPFGRSLSASLAL"
FT   gene            complement(210618..211061)
FT                   /locus_tag="WD_0226"
FT                   /old_locus_tag="WD0226"
FT   CDS_pept        complement(210618..211061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0226"
FT                   /old_locus_tag="WD0226"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by match to TIGR01784 protein family HMM
FT                   TIGR01784"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13970"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IE2"
FT                   /protein_id="AAS13970.1"
FT                   /translation="MAFSKFLDPKNNFAFKRIFGTEKNKDILIHFLNDILGFAGKDEIE
FT                   EIEFLSTIMDAEIASKKQSIVDVFCTDSAGTQLIIEMVRPESLRSYCLKGEEFLQKETK
FT                   RVLKLIKPDVLPSESMHQCESGNRLVPSDADNEPPLEKEDAQS"
FT   gene            complement(211124..212953)
FT                   /locus_tag="WD_0227"
FT                   /old_locus_tag="WD0227"
FT   CDS_pept        complement(211124..212953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0227"
FT                   /old_locus_tag="WD0227"
FT                   /product="elongation factor Tu family protein"
FT                   /note="Identified by match to TIGR01394 protein family HMM
FT                   TIGR01394; match to PF00009 protein family HMM PF00009;
FT                   match to PF00679 protein family HMM PF00679; match to
FT                   TIGR00231 protein family HMM TIGR00231; match to PF03144
FT                   protein family HMM PF03144"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13971"
FT                   /db_xref="GOA:Q73IE1"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IE1"
FT                   /protein_id="AAS13971.1"
FT                   /translation="MNEFKSIRNIAIIAHVDHGKTTLLDNMLKQSGTFRENQEVQERVM
FT                   DSGDQERERGITILAKCTSIMWGDEKINIIDTPGHADFGGEVERVLCMADGVLLLVDAA
FT                   EGPMPQTKFVLSKALKANLKPIVIINKVDRPDSRIDEVLNEIYELFFNLDATNEQLDFP
FT                   VLYASGRNGWCAKELSDERKDLSPLFSTVIDYIKPSVYNQNAPFAMLVTLLESDKFLGR
FT                   ILTGKVYQGIAKVNSDLKVLDLDGKVIERGRLTKLLSFSGLKRIPVEQAVAGDIIAIAG
FT                   LEEASVSDTIAAPEVTTAVSSTPVDPPTMAITLSVNDSPFAGQEGTKLTSTAIKDRLYA
FT                   EAETNVAITVTLAPSGEAFEVGGRGELQLGVLIENMRREGFELSVSRPRVLFKEEGGKK
FT                   LEPIEEVVIDVDDEYSGIIMEKLSFRKGEVTDMRPSGNGRTRLTFLVPSRGLIGYQGEF
FT                   LTDSRGTGIINRLFHSYAPHRGPISGRRNGVLISTDKGEAVAYAIFNLQDRGIMFIKPQ
FT                   DKVYCGMVVGQHSRDNDLEINVLKGKQLTNVRASGSDEAIKLTPPKIMTLEDMIAYIDD
FT                   DELVEVTPKSIRLRKKFLDPNERKRAGRAKNKE"
FT   gene            complement(213059..213661)
FT                   /gene="pyrE"
FT                   /locus_tag="WD_0228"
FT                   /old_locus_tag="WD0228"
FT   CDS_pept        complement(213059..213661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="WD_0228"
FT                   /old_locus_tag="WD0228"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="Identified by similarity to OMNI:CC1555; match to
FT                   TIGR01367 protein family HMM TIGR01367; match to PF00156
FT                   protein family HMM PF00156"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13972"
FT                   /db_xref="GOA:Q73IE0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR006273"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IE0"
FT                   /protein_id="AAS13972.1"
FT                   /translation="MILDENNLIIKEFKEAEAILHGHFVLSSGLHSDTYIQCAKIFENP
FT                   SRAMKVCALLADKIKKELNSSIDLILSPAIGGIIVGYEIGRQLGIKTMFCERVNGKFEL
FT                   RRGFKIKKGEKILLIEDVITTGKSSLEAVECAEGEGEGGKVVAEASLIKRNSETKLPFP
FT                   VISLIELNIKNYSEEELPSELKQLPITKPGSREYLTK"
FT   gene            complement(213665..214849)
FT                   /locus_tag="WD_0229"
FT                   /old_locus_tag="WD0229"
FT   CDS_pept        complement(213665..214849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0229"
FT                   /old_locus_tag="WD0229"
FT                   /product="sodium/glutamate symporter family protein,
FT                   putative"
FT                   /note="Identified by match to PF00375 protein family HMM
FT                   PF00375"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13973"
FT                   /db_xref="GOA:Q73ID9"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ID9"
FT                   /protein_id="AAS13973.1"
FT                   /translation="MHKFAILFSILLAIVAYYLNNEIIFEIAKLFSDIFISLLNLISLP
FT                   LVFLSIVSTISGLKDSIEIKVLVKKTLFYTLLTTIIAAFVALSFYLLIDPARKNFISNT
FT                   IGSINSSNHSYFSYLKSLIPSNFVQVFLENNMIGSILIAFLMGGAIVSLSKEKQDILYQ
FT                   VFSALFDTLLKIAQGLLKFIPLAVWSFITCFLHELKGGSEFYNLLWYFVCIMSANFVQA
FT                   FLILPLFMWYKGISPIQTLKGVMPALTLAFFSKSSSATLPTTIECVQNKLKVPKKLSSF
FT                   ILPICTTINMNACAAFILITVMFVAEMNGYVFSLSEMLIWIFLATGAAIGNAGVPMGCY
FT                   FTATSYLMSMNVPLHIMGLILPIYTIIDMFETAINVWSDVCITQIINKECNSET"
FT   gene            complement(215048..216427)
FT                   /gene="pyrC"
FT                   /locus_tag="WD_0230"
FT                   /old_locus_tag="WD0230"
FT   CDS_pept        complement(215048..216427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrC"
FT                   /locus_tag="WD_0230"
FT                   /old_locus_tag="WD0230"
FT                   /product="dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /note="Identified by similarity to EGAD:21772; match to
FT                   TIGR00857 protein family HMM TIGR00857; match to PF01979
FT                   protein family HMM PF01979"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13974"
FT                   /db_xref="GOA:Q73ID8"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ID8"
FT                   /protein_id="AAS13974.1"
FT                   /translation="MCFIKKTLDLFYNRYSNIMTQTWDLLQTGQKEGYKIAYTNARIID
FT                   PETKLDIKGSLLTEGDKIVDFGESLFSTSGVDETIDCKGLVLMPGLIDIHVHFREPGQE
FT                   HKETIYTGSKSAAAGGVTTVVCQPNTVPAIDSVILAKYLKYRALETSHVNVEFYAKITT
FT                   SEEHLTEMALLKEAGAVGFTDDGMPVMNPMIMRQALLYSSMLNVPIAQHAEDLNLSAGG
FT                   AINEGKISEELGVKGILSASESVMVNRDILLMKDMENVHYHILHVSSKDSLDAIKRAKD
FT                   LGLNVTCEVTPHHFTLTEDIVKQHGAIAKMNPPLRTEEDRLAMVEGLKTGVIDCIATDH
FT                   APHDRSSKDLPLENAAFGIVGLETMLPLSLELYHSGQMGLLDVLAKLTYKPADIIHIPR
FT                   GRIQKNLAADLILVDLNHEWEIKTDNFASKSKNSPFDGRKVKGHVVRTVVSGKTIYSQK
FT                   S"
FT   gene            complement(216496..217737)
FT                   /locus_tag="WD_0231"
FT                   /old_locus_tag="WD0231"
FT   CDS_pept        complement(216496..217737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0231"
FT                   /old_locus_tag="WD0231"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13975"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ID7"
FT                   /protein_id="AAS13975.1"
FT                   /translation="MGTTKISKFPFNIKGKVAKQHAEPIIEKNLYTILGFKDIEDFENK
FT                   TSKLVNKKVWQSFVNCFAKEIDYAATEEVVKNIVCNIAKSDQGNAFTKTEHLILNEKQD
FT                   NKKREKAIRKAISILRKINPEKAFNELSVIKKQAEDFLQTDFCKAQSKSLQGFAPSGGQ
FT                   LFAETLKYIETLERLSEVKKEGLVRDFLLNHVSLLNKKYPKSQGKREDAITILSSDELK
FT                   NFYNKSVKEGMLQPMASYKGCRNLYDKMNQIKNESKSIIKREEREENLKKIDKSIISAI
FT                   NDIKKHREAILNCKDFQSSYIKEKKEHPFRGNACQKMIDIYQERIVGYQEKIRQNLNQI
FT                   KAILKSAPQEMDDVEEFEEIIDDIHEAKQCDEIFDSALICLSNIQNELDIQLENPSTEL
FT                   RASHINVKTELTRL"
FT   gene            217906..220032
FT                   /locus_tag="WD_0232"
FT                   /old_locus_tag="WD0232"
FT   CDS_pept        217906..220032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0232"
FT                   /old_locus_tag="WD0232"
FT                   /product="cytochrome c-type biogenesis protein CcmF,
FT                   putative"
FT                   /note="Identified by similarity to EGAD:7083; match to
FT                   PF01578 protein family HMM PF01578"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13976"
FT                   /db_xref="GOA:Q73ID6"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003567"
FT                   /db_xref="InterPro:IPR014070"
FT                   /db_xref="InterPro:IPR032523"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ID6"
FT                   /protein_id="AAS13976.1"
FT                   /translation="MPELGNILLLLACLLSLTYLFLPLSSCRFITTAIFFCVSASMAIL
FT                   IYCHITNDFSLENVYYHSHTTKPLIYKICGVWGNKEGSMLLWTLVLVMYLLLMDIYIPS
FT                   VIPVSPSVIPVSSSVIPVPRHWDPDNLIANEYIKWQCNKNWIPVSSTGMTPERTNGSKL
FT                   KKISLITHGLICFCFLLFTLIESSPFTKMPGIETDGLGFNPILQDIGLAIHPPILYLGY
FT                   LGFSVPFSLSIAGLILNTEGNVWAKIVRPWVLISWSLLTLGISLGSWWAYRELGWGGFW
FT                   FWDPVENVSLMPWLIAVALTHLLLVVRNFNVLRNFAILLTLTTFILSVTGTFLVRSGIL
FT                   TSVHTFADDPRYGLYILALLGVITVSSLVIFVVFTRKNHTPAMSFQCLTLESRKKLATQ
FT                   VTEGRRFFSRFTMILMNNLLFITAFFIVFVGTLYPTVLEYLTGELISVGAPYYNSLFNS
FT                   IALAILVLTMIGQYCSWQGNSLLPIFREYRFSFCSAAAILPFIFHMELIIVLSITISIA
FT                   LLIFVLEAYSKRIRLFKVAFGESILLARRVSKSYYAMMLAHAGVAILVLGIAYSVGWQE
FT                   KKENYLKIGDSITVNKFKVTLRNIELIKEKNFHAVRGTMDIRNLLNNKILGEVTPEYRF
FT                   YLAEGQKNVESSIYHNLLSDIYVVIGEIDKSKSKIAAKVHYKPGMSIIWLGSFLIAFGS
FT                   LLAAFPFSGRARIV"
FT   gene            220206..221777
FT                   /locus_tag="WD_0233"
FT                   /old_locus_tag="WD0233"
FT   CDS_pept        220206..221777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0233"
FT                   /old_locus_tag="WD0233"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13977"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ID5"
FT                   /protein_id="AAS13977.1"
FT                   /translation="MNGGVSGKEKVIRTPFDFKEPYSDWRQIFKRPNQQYNPSNYDSSS
FT                   EINEHDIETQKIEEGDGHDSGISSDDEDDRTTYTAVQLTNDSLDSQRYTGICIPTPTDG
FT                   WVGENNHQTGLSGDLPDVSNNPQIFESTDSVQLDNIVFSNLIQLSLISQEHNSTCNDHV
FT                   ICDSGHNSDDEDQIPEDFPSRKRVRSIEIDQFEPLYKKRKIEAQNNQKYTENVCNPTNG
FT                   GLLGESDNPQTFESDPLQHGSNGLGYNFNGYSQATYSKLSASDQEEGQGYSLGGSCENK
FT                   ENLTKGAGGSNQTFEGEQKSSEFPKVDNWSDSDGNSEDSSDSKKGSYYSSGNLDSMELT
FT                   DDLDSENDRDLEDDNPFLKDSLFMKLKMSLTQSKQDLIDKCCGEVRGITEQNEQKDIKN
FT                   TPESIKCIVAKYLEKEVMLNLKCSCCNKTVTNTVFEEIKDLTSGSHISNRSNTFVFDNF
FT                   PYQSKDKNCNKESKGQNCNKESEDQNCNKKNEVSEEDIIKSIVSNLLLEGGKVKRHNFF
FT                   DGNEFE"
FT   gene            222084..222362
FT                   /locus_tag="WD_0234"
FT                   /old_locus_tag="WD0234"
FT   CDS_pept        222084..222362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0234"
FT                   /old_locus_tag="WD0234"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13978"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ID4"
FT                   /protein_id="AAS13978.1"
FT                   /translation="MDVSKGGIEMSFTTEVGEISIYLSPSEKGSNKIKVEIDGENRARL
FT                   NELKNRGKSLGENCLLGGKSVEEAIEHESFERYGSVPNTAMKEPSLG"
FT   gene            222590..223465
FT                   /gene="secF"
FT                   /locus_tag="WD_0235"
FT                   /old_locus_tag="WD0235"
FT   CDS_pept        222590..223465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="WD_0235"
FT                   /old_locus_tag="WD0235"
FT                   /product="protein-export membrane protein SecF"
FT                   /note="Identified by similarity to EGAD:162985; match to
FT                   PF02355 protein family HMM PF02355; match to TIGR00916
FT                   protein family HMM TIGR00916"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13979"
FT                   /db_xref="GOA:Q73ID3"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ID3"
FT                   /protein_id="AAS13979.1"
FT                   /translation="MALRLIPDNLDIKFSKYRDLTALISIILIIFSIFTVVLRGVNLGI
FT                   DFAGGILIEIKSSDENHSILDALKENGFTVQSSKAGDNLVMRFKDEGDEDKIKKIKSIL
FT                   EEKLGSSISYRKIDYVGPQISSTQIFEGMLSMLIAIVGIFFYVWFRFNWQCGFSGITAL
FT                   IHDVILTVGFISLTGIEFNISSVAALLTVIGYSINNSVIIYDRIREYRRSGKSGRMSEV
FT                   VDASINATLFRTILTSGTTLLAALPLVLICTDAVRDFSLIIFFGILIGTCSAIFISAPI
FT                   LTYRALISRL"
FT   gene            complement(223472..223987)
FT                   /locus_tag="WD_0236"
FT                   /old_locus_tag="WD0236"
FT   CDS_pept        complement(223472..223987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0236"
FT                   /old_locus_tag="WD0236"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to OMNI:CC1307; match to
FT                   PF00077 protein family HMM PF00077"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13980"
FT                   /db_xref="GOA:Q73ID2"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR001995"
FT                   /db_xref="InterPro:IPR011969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ID2"
FT                   /protein_id="AAS13980.1"
FT                   /translation="MNAVKNLVIWLLIIATTAMLIDSQRDKLSDRFLSTFLPYKGRIQN
FT                   SGQNSGSIEFTKSYDGHFYIQAQVNDRNITFLLDTGATDIVLSQKDALHVGINLQNVQD
FT                   FKIYETAKGQIKAGVVQIPQVKIGNFLINDVQASVNTHSMSHSLLGMSFLRYFHFTIRD
FT                   NKLILYRD"
FT   gene            224122..225831
FT                   /locus_tag="WD_0237"
FT                   /old_locus_tag="WD0237"
FT   CDS_pept        224122..225831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0237"
FT                   /old_locus_tag="WD0237"
FT                   /product="60 kDa inner-membrane protein"
FT                   /note="Identified by match to PF02096 protein family HMM
FT                   PF02096"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13981"
FT                   /db_xref="GOA:Q73ID1"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/TrEMBL:Q73ID1"
FT                   /protein_id="AAS13981.1"
FT                   /translation="MSEAKSLILAAILSMLIMVSWRIIYDNFFSTSQNQPLIENIEHIE
FT                   SFNDLAPIIYQNRSEIINSTREQRVSLTNNMIKGSISLKGARFDDLILTNYHLEPSSSS
FT                   PQVVLLSPAESKDVYFAEFGWLDPSNKIKVPDSKAVWRADKLNQKEVNLSWDNENGILF
FT                   RMKINLDDNYMFKVEQVVENNTKDNVVLVPYGKINRKRDNINESYWISHEGVLGAFDNK
FT                   LEEWTYKDISKKHLIKASTSEKNWFGFADKYWLTAIIPEKSDKINVSIKHTNVNNTDKF
FT                   QVDFVKPYKSILPGASVSNVNYFFAGAKKLNLLDSYKDTLNIPLFDKAVDFGVLYFITK
FT                   PVFLLLEYFNFVLKNFGLAILLLTLVIKLLMLSLFNRSYISMFKVKSLQPELTRIKELY
FT                   KNDSLKQHKETIALFKRNNVNPMSSIFPMLIQIPVFFALYKVLFVTIEMRHAPFFLWIK
FT                   DLSAPDPTNIFTLFGLFNYNFPISIGILPIIFGATMIIQQKLSEKDQTSKDDIQVNVMK
FT                   FLPYISVFIFSSFPAGLVIYWIFSNIITLIQQSLIKLFLTKKVVVNVENTNS"
FT   gene            225809..226237
FT                   /gene="ribH"
FT                   /locus_tag="WD_0238"
FT                   /old_locus_tag="WD0238"
FT   CDS_pept        225809..226237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="WD_0238"
FT                   /old_locus_tag="WD0238"
FT                   /product="riboflavin synthase, beta subunit"
FT                   /EC_number="2.5.1.9"
FT                   /note="Identified by similarity to EGAD:8483; match to
FT                   PF00885 protein family HMM PF00885"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13982"
FT                   /db_xref="GOA:P61729"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:P61729"
FT                   /protein_id="AAS13982.1"
FT                   /translation="MSRILIVNSIYYTEIANLLLEGAIDKLKGSNASYDVVEVPGTFEI
FT                   PATILFAVKSGHTNYDGYLALGCVIRGETDHYQYVCKGVIEGLNEVVMHYAIPLGMGVI
FT                   TADSKDKALVRADKNKKNVGGHAASTVLRMIDLHNKLK"
FT   gene            226237..226719
FT                   /locus_tag="WD_0239"
FT                   /old_locus_tag="WD0239"
FT   CDS_pept        226237..226719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0239"
FT                   /old_locus_tag="WD0239"
FT                   /product="N utilization substance protein B, putative"
FT                   /note="Identified by match to PF01029 protein family HMM
FT                   PF01029"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13983"
FT                   /db_xref="GOA:Q73IC9"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IC9"
FT                   /protein_id="AAS13983.1"
FT                   /translation="MEEKPVDKKWRIKRSTARFLAVQIAYSNIFVGYNKSTFKLENCEL
FT                   KDYINKLKDIFECEEFEHQFLENLLYKVIKSSEEYDKIIESYLHPSWSLSRLNLISLSI
FT                   LRVAICELANCDTPVPVVINEYTNIASDLLDKPSEIGFINGLLDKAKDAVKLNKNP"
FT   gene            226892..227817
FT                   /pseudo
FT                   /locus_tag="WD_0240"
FT                   /old_locus_tag="WD0240"
FT                   /note="transposase, IS5 family, degenerate; This gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error.Identified by similarity to EGAD:5722"
FT   gene            227855..228025
FT                   /locus_tag="WD_0241"
FT                   /old_locus_tag="WD0241"
FT   CDS_pept        227855..228025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0241"
FT                   /old_locus_tag="WD0241"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13984"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IC8"
FT                   /protein_id="AAS13984.1"
FT                   /translation="MMQQSHPSVSYLDDKKGSTGMTLSVVQFTFKNECLYSYVSSTGMT
FT                   RKGTLEFLFQH"
FT   gene            complement(228147..228686)
FT                   /locus_tag="WD_0242"
FT                   /old_locus_tag="WD0242"
FT   CDS_pept        complement(228147..228686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0242"
FT                   /old_locus_tag="WD0242"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13985"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IC7"
FT                   /protein_id="AAS13985.1"
FT                   /translation="MSSTCTLAPLAAFAATPLGIGILAIVAVALVSSAMYAISKNNEIS
FT                   ELRAPKIVVNNDRKNGKETALLVTKDTFKEMARNNQVKDEEGKVEKGKHYIALSLEGKN
FT                   YRIIVDINQLTNTLGNTLLFEIGSLKEKNDEGKFEAVNETKWNKTLGLDKDGAKGVKTY
FT                   LGSLIVEQVASQQQTV"
FT   gene            complement(228864..229325)
FT                   /gene="dut"
FT                   /locus_tag="WD_0243"
FT                   /old_locus_tag="WD0243"
FT   CDS_pept        complement(228864..229325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="WD_0243"
FT                   /old_locus_tag="WD0243"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /note="Identified by similarity to EGAD:156248; match to
FT                   TIGR00576 protein family HMM TIGR00576; match to PF00692
FT                   protein family HMM PF00692"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13986"
FT                   /db_xref="GOA:P61913"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:P61913"
FT                   /protein_id="AAS13986.1"
FT                   /translation="MQRSKIKVEIKRLSHGEDLSLPCYATTQSAGMDLYAALNDSAVLN
FT                   PLERLLVPTGIVIAIPNGFEGQIRPRSGLAAKHGITVLNSPGTIDSDYRGEVKICLINL
FT                   SNQPYEIKRGDRIAQILISPVSQVIWDDREEFCAEETGRNAGGFGSSGR"
FT   gene            complement(229501..229611)
FT                   /locus_tag="WD_0244"
FT                   /old_locus_tag="WD0244"
FT   CDS_pept        complement(229501..229611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0244"
FT                   /old_locus_tag="WD0244"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13987"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IC5"
FT                   /protein_id="AAS13987.1"
FT                   /translation="MTVVRVSSQRPYDVIPVPRHWDPEDLISTKWLHNKD"
FT   gene            complement(229740..230651)
FT                   /gene="argB"
FT                   /locus_tag="WD_0245"
FT                   /old_locus_tag="WD0245"
FT   CDS_pept        complement(229740..230651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="WD_0245"
FT                   /old_locus_tag="WD0245"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="Identified by similarity to EGAD:43490; match to
FT                   PF00696 protein family HMM PF00696; match to TIGR00761
FT                   protein family HMM TIGR00761"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13988"
FT                   /db_xref="GOA:Q73IC4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IC4"
FT                   /protein_id="AAS13988.1"
FT                   /translation="MKSSEFLKGEVSFEQKAEILLEVLSNIPSFVGETFVIKCGGTIIL
FT                   DETLFNTFVHNVVLLKQLGINPVIIHDGEYEINSVLKMLDMNSKFVNGIRLTDKDTMKI
FT                   IEMALCGSVNKKIVQYINSAGGSAIGLCGKDGNLIKAEKITATLREDRSNNIEKILDMG
FT                   FIGRPTEINPDILFFIEESDFIPVIAPIGHGKDGETYHIDADSTASAIAIAVSASKMII
FT                   LSDTDEEIDKIGGRKISVKNLNASIDCGKIKGEKFIERLMAYVKMAEECAGVVHIVDGR
FT                   ISNIMLDLFTESNSSISIVSDL"
FT   gene            complement(230656..231249)
FT                   /locus_tag="WD_0246"
FT                   /old_locus_tag="WD0246"
FT   CDS_pept        complement(230656..231249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0246"
FT                   /old_locus_tag="WD0246"
FT                   /product="GTP-binding protein"
FT                   /note="Identified by match to TIGR00650 protein family HMM
FT                   TIGR00650"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13989"
FT                   /db_xref="GOA:Q73IC3"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73IC3"
FT                   /protein_id="AAS13989.1"
FT                   /translation="MAKQITSNCNFIFGASDIKSLPNESAPEIAFAGRSNVGKSSLINL
FT                   LINSKKAARVSSKPGCTRQINFYSMYDDKFRLVDLPGYGYSHAGKEEIIQYLNLIEYYL
FT                   IQRENLRRVFVLIDSKVGLKEIDKDFIYWLIYNNINFNIVLTKIDKVSQKSLGAVIEDI
FT                   QKWINNENVSIHQMSIRVKHKITKVRDEFFKFTR"
FT   gene            231348..232427
FT                   /gene="prfA"
FT                   /locus_tag="WD_0247"
FT                   /old_locus_tag="WD0247"
FT   CDS_pept        231348..232427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="WD_0247"
FT                   /old_locus_tag="WD0247"
FT                   /product="peptide chain release factor 1"
FT                   /note="Identified by similarity to EGAD:29990; match to
FT                   TIGR00019 protein family HMM TIGR00019; match to PF00472
FT                   protein family HMM PF00472; match to PF03462 protein family
FT                   HMM PF03462"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13990"
FT                   /db_xref="GOA:Q73IC2"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73IC2"
FT                   /protein_id="AAS13990.1"
FT                   /translation="MDMENNLQDLKKKFNDIERNLENPTNLSQKEFITLSKEYSELRPI
FT                   IKIIDEYNTLKEEISDLEEIMKDENSEGDIKELAKEEFFEKHKVLLPKIKAKLKLALLP
FT                   KDEDDSRNAILEIRAGTGGEEAALFAAMLFRMYQKYAERRNWKFEPISISNTGIGGYKE
FT                   ASALINGTEVFARLKFESGVHRVQRVPETESSGRLHTSAATVAILPEVEEVDFKIEEKD
FT                   LRIDVYRSSGPGGQSVNTTDSAVRVTHLPTGIVVIQQDEKSQHKNKAKALKVLRARLYE
FT                   IERQKKEMERSTMRKSQIGSGDRSERIRTYNFPQSRITDHRINLTSHRLEQIIKEGELD
FT                   EFIEALISRNEAERLAGES"
FT   gene            complement(232455..233618)
FT                   /locus_tag="WD_0248"
FT                   /old_locus_tag="WD0248"
FT   CDS_pept        complement(232455..233618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0248"
FT                   /old_locus_tag="WD0248"
FT                   /product="drug resistance transporter"
FT                   /note="Identified by match to PF00083 protein family HMM
FT                   PF00083"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13991"
FT                   /db_xref="GOA:Q73IC1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IC1"
FT                   /protein_id="AAS13991.1"
FT                   /translation="MLLPFLLILSLIAKFIEIDISVPSFPDMVHYFNVPEGIIQLTIAY
FT                   NFLGFCIGGLFFGPLSECYGRRRIMIIGNTLLLIGAVGCVFAPSIFWLLISRFVQGIGV
FT                   STSVVVFAIVADSYKGDEAVKFIGIMNSVLTVVMAIAPVLGSFINEIVGWRGNYATVAI
FT                   LCLISWVLLLLALPETKKNRDIFSLKKTMKDYRKLLSNPRFVTLSLMSSLFSAAYMSFI
FT                   TCGPFLYMKTFGLSSTIYALHQGAIVGCFSLISLFAGKILQKLGAIKCVISGTSVGAIG
FT                   SLLLVIFSIIVPHSFYLVTLSMIIFSIGCAIFQPVIFNASINVFPEIKGTASSAVSFIR
FT                   AFIMAIFIGLTSYIYNGQTISVAVLVLSAIVLELVFTVYLLRLKDPM"
FT   gene            234082..235011
FT                   /locus_tag="WD_0249"
FT                   /old_locus_tag="WD0249"
FT   CDS_pept        234082..235011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0249"
FT                   /old_locus_tag="WD0249"
FT                   /product="membrane protein, putative"
FT                   /note="Identified by similarity to EGAD:163309; match to
FT                   PF03547 protein family HMM PF03547"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13992"
FT                   /db_xref="GOA:Q73IC0"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IC0"
FT                   /protein_id="AAS13992.1"
FT                   /translation="MFLTLFLKILPIYITIFIGYLAGKYLKIDRNTISQILFYIANPIV
FT                   ILYGVSHTEVNLKVISLPILIWFIGSTMSLSVYYLSSFLFKDNTRNILAFSSGSTSMGY
FT                   FGLPIAMALFDEDSVSVYVVCYIGMALFENSLGFYIAANGIYTAKECILKLFKLPSLYA
FT                   MVLGFFLSIYDIQIPTFLTDVMMNIRSTFVTLGMVLLGVSIANIASFKIDWKLALITIT
FT                   AKYVFWPLFVLGIVLLDKHVIGIYDESIYKALMLLAIIPVSGSSIILANILNYQPDKAT
FT                   LLLLISTAVGLFYVPLIISLFFTKLVPF"
FT   gene            235221..236267
FT                   /pseudo
FT                   /locus_tag="WD_0250"
FT                   /old_locus_tag="WD0250"
FT                   /note="transposase, IS3 family, degenerate; This gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error.Identified by similarity to EGAD:43417"
FT   gene            236375..237706
FT                   /locus_tag="WD_0251"
FT                   /old_locus_tag="WD0251"
FT   CDS_pept        236375..237706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0251"
FT                   /old_locus_tag="WD0251"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to GP:6685121; match to
FT                   PF02646 protein family HMM PF02646"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13993"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IB9"
FT                   /protein_id="AAS13993.1"
FT                   /translation="MLFNSIALVVSLLLFFYIIVKKLSEKKANLEGNLCKLEQELQETK
FT                   QTLLTKNEEIVDLRVKKAELEVTLQKEREEKKKEIELLTKAEERLTNTFKALSLDALQT
FT                   NNNNFLNLAKEVIDSKLKETESDFKKRQATINEVVTPIKEKLEKFDNEIRELEKERVGA
FT                   YEGLKEQIGALMNQTSSLANALRKPHIRGKWGEMQLKRVVEMAGMIEYCDFFTQPSVID
FT                   KNEDNLLRPDLIIKMPSGKQIIIDAKVPLDSYMDAISQNDLQIQKEKLKNHSLAIKKHI
FT                   NDLGKKEYWNQFENTPELVVLFLTGEGVFSAALEYEPALIEIGVEKKVIIATPITLIAL
FT                   LRAIAYGWKQEMIAENAKKISELGHILYERICTMGENFDNLRRSLKSAVDHYNKTAGSL
FT                   EARVFPAAREFNKLGIHAKNKSLSAAKELESLPRSLHTEELKVD"
FT   gene            complement(237748..239076)
FT                   /locus_tag="WD_0252"
FT                   /old_locus_tag="WD0252"
FT   CDS_pept        complement(237748..239076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0252"
FT                   /old_locus_tag="WD0252"
FT                   /product="transposase, IS4 family"
FT                   /note="Identified by similarity to EGAD:8624; match to
FT                   PF01609 protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13994"
FT                   /db_xref="GOA:Q73IB8"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IB8"
FT                   /protein_id="AAS13994.1"
FT                   /translation="MNKITSLSKKLKEFFNEKADKISITTRFIKRKRKLKGSSFVKAMV
FT                   LGNIGVDNCSVETMCQLLNEDSIDITKQGLDFRFTEEAVEFMKRMYNESVLLFKNILQV
FT                   DCKILQQFNSVKLLDSSYITLPNSMEEMYKGYGTSYSGYESNTKSGIKLQLVFDYMNQI
FT                   IDQLNLTEGVRSDQGYRKHLSNILSNDLLISDLGYFVPSSFKQINEIGAYFISRYKSDT
FT                   NIYDVETNQKMELLECLEDKLFLENEVLLGKEAKIRVRIICQKLTEEQSMARRRKANRL
FT                   ARSQGYTSSKRNQKLLNWSIFITNVPENKISAEQVLTIYRVRWQIELLFKLYKSHIRLD
FT                   KLKGKPCRVLCELYAKLCAILIFHGIVGCTEVKKNTELSLTKAFIELKRRVIELFLALK
FT                   NKVNSLKVFLKKLTITWSRFSLKDKYRKTRVSTLTSLNLLTIS"
FT   gene            complement(239195..240427)
FT                   /locus_tag="WD_0253"
FT                   /old_locus_tag="WD0253"
FT   CDS_pept        complement(239195..240427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0253"
FT                   /old_locus_tag="WD0253"
FT                   /product="transposase, IS256 family"
FT                   /note="Identified by similarity to EGAD:5635; match to
FT                   PF00872 protein family HMM PF00872"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13995"
FT                   /db_xref="GOA:Q73IB7"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IB7"
FT                   /protein_id="AAS13995.1"
FT                   /translation="MSQANRTNGLVDYKELETNILSSIQEGKPLTGRDGALTPFIKRLL
FT                   EASLEGEIESHMSAKSEENNRRNGRNAKTLRTSAGSFELLTPRDREGNFEPQIVKKRQT
FT                   SLHPELEAKVLSTYASGMGYRDIASHVEEIYDHKISAAEISSITDKLLPIINEWRSRPL
FT                   QSVYPIVFMDGMFFKVKEDGHCVSKCMYNILGINQNGRKEVLGFYLAESEGATFWLGVL
FT                   NDLKERGVEDILIACIDGLKSFPTAINSVFPSAEVQLCIVHQIRNSLKYVSSKDVKVFM
FT                   NDLKKIYRASSKEIAENYLLELEEKWGEKYPLVIKSWQNNWENLSSYFKYSGPVRKLIY
FT                   TTNPIEGLHRQIRKFTKTKGSFTSTNALYKQVYCAIKKVEQKWIMALPNWALTMSQLDI
FT                   FFPGRLKIELN"
FT   gene            complement(240449..241096)
FT                   /locus_tag="WD_0254"
FT                   /old_locus_tag="WD0254"
FT   CDS_pept        complement(240449..241096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0254"
FT                   /old_locus_tag="WD0254"
FT                   /product="transcriptional regulator, putative"
FT                   /note="Identified by match to PF01381 protein family HMM
FT                   PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13996"
FT                   /db_xref="GOA:Q73IB6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IB6"
FT                   /protein_id="AAS13996.1"
FT                   /translation="MEVYVFVSASNVSYGIGQKIENCRLMRGHTQIGLAGQVGLTYQEV
FT                   NSYENGYTPIPIGVLYVIARVLSVNAVDLLPKLITVREYKDEDEEILYLTKIYENQKLG
FT                   KIVPSLVRFVHISEKINQEEARLEVAKNLVKEGVSVDIISQATGLSIYEYDSTEREICT
FT                   DSIYYRIGQRIREWRLIKRYTQEDLANKVGLTLKEIQGTFKEVCQTEKKVIN"
FT   gene            complement(241135..242061)
FT                   /locus_tag="WD_0255"
FT                   /old_locus_tag="WD0255"
FT   CDS_pept        complement(241135..242061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0255"
FT                   /old_locus_tag="WD0255"
FT                   /product="transcriptional regulator, putative"
FT                   /note="Identified by match to PF01381 protein family HMM
FT                   PF01381; match to PF01381 protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13997"
FT                   /db_xref="GOA:Q73IB5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IB5"
FT                   /protein_id="AAS13997.1"
FT                   /translation="MVVFVEKSLDCKVGEKVKNWRLERGYTQKDLAEKIGVKYWVILQY
FT                   EKGNRGISIKRLYAIAEALSVSITNLIPASKEKIGFKNEEGEILNLVREYKKINDHELR
FT                   RMFCLLTKFVQVSEKSSRKSEKIKIANGLVKAGISVDIVSKTIGLSADECIEEKVGSIY
FT                   YKIGKKIKEWRLVREYTQKDLGEKMSTTRHEVSNYEQGRTAVPLDKLYEMAEALSINIT
FT                   DLLIEKDEGSRVENELPNLIKEYKEIESQELRNALIKSLFEGIRICEEKVREIERIKVA
FT                   KDLVKGGISIDIILQAVGLPVDIVLDR"
FT   gene            complement(242140..243333)
FT                   /locus_tag="WD_0256"
FT                   /old_locus_tag="WD0256"
FT   CDS_pept        complement(242140..243333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0256"
FT                   /old_locus_tag="WD0256"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13998"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IB4"
FT                   /protein_id="AAS13998.1"
FT                   /translation="MSNKIIVPFDDQEGGTYELNIDLDRLSKGEVLNAIVGIGRTKEQP
FT                   TFVSKINKAKKPEEIAPFPGREVRENKINYGKGFDYVYGTKPVSDQEDKNPFASALKKI
FT                   KPSAEKLSWFKSAVVRAKSPNELHKVVDEALAAGARLNACNDGEWSLAEYVILGTHFHK
FT                   FDKADRKKLIRKLMLNGAEFHDTLLENKLIGEIYNELQPEVQPQIDERLEELEKAGESA
FT                   VQEGELIDVEIDNTTSYIEFSGDSKVEVAKILEANRKLGSNILKIGNDAVEVKSEKGGI
FT                   RNYIDMSDESSIILQFPTSIGQLNIILYHDVKKYDQVQVRVENKEMWAELQKRGEEIGK
FT                   NCLFGGVKLQEAVEKGNFTRCGIWNEKYAIKEISNDEVLSSWVNRVCGGSKETFREL"
FT   gene            complement(243504..243803)
FT                   /locus_tag="WD_0257"
FT                   /old_locus_tag="WD0257"
FT   CDS_pept        complement(243504..243803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0257"
FT                   /old_locus_tag="WD0257"
FT                   /product="DNA repair protein RadC, truncation"
FT                   /note="Identified by similarity to SP:P25531; match to
FT                   PF04002 protein family HMM PF04002"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAS13999"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IB3"
FT                   /protein_id="AAS13999.1"
FT                   /translation="MKIIYFDQKCRLKGEEVFTGTVDKVPFYIREVTRKALIRKATSII
FT                   ISHNHPEGRLKPSDEDEAVTKDLAKACQTIGIRLLDHIIITSVGYFSFKEQGLL"
FT   gene            complement(243932..245244)
FT                   /pseudo
FT                   /locus_tag="WD_0258"
FT                   /old_locus_tag="WD0258"
FT                   /note="reverse transcriptase, authentic frameshift; This
FT                   gene contains a frame shift which is not the result of
FT                   sequencing error."
FT   gene            complement(245829..246833)
FT                   /locus_tag="WD_0259"
FT                   /old_locus_tag="WD0259"
FT   CDS_pept        complement(245829..246833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0259"
FT                   /old_locus_tag="WD0259"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to OMNI:NT01MC2680"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14000"
FT                   /db_xref="InterPro:IPR011204"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IB2"
FT                   /protein_id="AAS14000.1"
FT                   /translation="MDENKIVFYTTPGGNIEIEVLCRDENLWLTQKRMAELFDVQLPAI
FT                   SKHIKNIFESGELQEKEVVSTFEVTAADGKNYPTQLYNLDTIIAVGYRVNSKKATLFRV
FT                   WATKVLKDFIIKGFALDSERLKNGKKFGKDYFNELLEKIREIRASERRFYQKITDIYAE
FT                   CSADYDPNSEITKQFYAKVQNKLYWAIYGLTAAELICSRVDHKKPHMGLTTWKDGPGKK
FT                   IHKSDVSIAKNYLTEEELSELNHIVSMYLDYAELQAKKNRLMKMQDWAEKLDAFLLFND
FT                   YEVLKDAGKVSAEVAKALAEGEYEKYRVIQDKLHESDFDELIKASKESEKITI"
FT   misc_feature    247493..270172
FT                   /note="PHAGE01; Putative lysogenic prophage region."
FT   gene            247670..247810
FT                   /locus_tag="WD_0261"
FT                   /old_locus_tag="WD0261"
FT   CDS_pept        247670..247810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0261"
FT                   /old_locus_tag="WD0261"
FT                   /product="conserved hypothetical protein, interruption-N"
FT                   /note="Identified by similarity to GP:6723241"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14001"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IB1"
FT                   /protein_id="AAS14001.1"
FT                   /translation="MSILTLDLGKQTGWAILTDGVIQSGSESFHGNRFSGGGMALLHRY
FT                   L"
FT   gene            248155..248481
FT                   /locus_tag="WD_0262"
FT                   /old_locus_tag="WD0262"
FT   CDS_pept        248155..248481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0262"
FT                   /old_locus_tag="WD0262"
FT                   /product="conserved hypothetical protein, interruption-C"
FT                   /note="Identified by similarity to GP:6723241"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14002"
FT                   /db_xref="GOA:Q73IB0"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IB0"
FT                   /protein_id="AAS14002.1"
FT                   /translation="MRERFSDIEAVYFEEVRRHLGTDAAHCYGGFLAHLTAWCEENNIP
FT                   YQGVPVKTIKRFITGKGNASKSEVIEAVKGKGFIPQDDNEGDALALMFYVNNFSKDFNM
FT                   LDSA"
FT   gene            248608..249837
FT                   /locus_tag="WD_0263"
FT                   /old_locus_tag="WD0263"
FT   CDS_pept        248608..249837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0263"
FT                   /old_locus_tag="WD0263"
FT                   /product="prophage LambdaW1, DNA methylase"
FT                   /note="Identified by match to PF01555 protein family HMM
FT                   PF01555; match to PF02195 protein family HMM PF02195"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14003"
FT                   /db_xref="GOA:Q05HL9"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR015840"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q05HL9"
FT                   /protein_id="AAS14003.1"
FT                   /translation="MNLATHYYPIENLVEYDRNPRKNDDVVNRMCASIREFGFCIPIVA
FT                   KSNGTVVDGYLRLKAARKLGMESIPVVLSDNLSEAQTKAFRLLANQSANWAKWDDDLLK
FT                   LEIQELEDLQFDLKMTGFELEKVQRFLDDLDGENSEKEDFSDLAGDSKKVKITKPGDLW
FT                   ILGGHRIYCGDSCLVESFKAVLDDKMADITVCDPPYNVAYGDSQEREDKKILNDDQGEK
FT                   YELFLYDICSHVLAYTKGAIYICASSSELATLQKVFEEAGGRWSTFIIWAKNHFTLGRS
FT                   DYQRQYETILYGWKNGNKREWHGGRNQSDLWFYDKPTYNSLHPTMKPVELMERAIVNSS
FT                   RPGDIVLDPFSGSGSTLIACERTGRICRTIELDPTFVDVTIKRWQVYTGREAILSNTGK
FT                   TFAQIQEEKR"
FT   gene            249854..250345
FT                   /locus_tag="WD_0264"
FT                   /old_locus_tag="WD0264"
FT   CDS_pept        249854..250345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0264"
FT                   /old_locus_tag="WD0264"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to OMNI:NT01MC4573"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14004"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IA8"
FT                   /protein_id="AAS14004.1"
FT                   /translation="MEGGKITQTEWARELGVSKQYVCYLVKKGIVELEDGLIDREQANE
FT                   AVAAIRDPSQPLRRKNPEGEEVGNNKLSMMLLKTRIKNEMERGRLLEAKAKAEIGELIS
FT                   VEEVKTEAFNVARVVRNNLLNIPDRVSALLASINDTEKIHETLTEEIRTALEELTQSVF
FT                   "
FT   gene            250515..252341
FT                   /locus_tag="WD_0265"
FT                   /old_locus_tag="WD0265"
FT   CDS_pept        250515..252341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0265"
FT                   /old_locus_tag="WD0265"
FT                   /product="prophage LambdaW1, terminase large subunit,
FT                   putative"
FT                   /note="Identified by match to PF05876 protein family HMM
FT                   PF05876"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14005"
FT                   /db_xref="InterPro:IPR008866"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IA7"
FT                   /protein_id="AAS14005.1"
FT                   /translation="MIYSSSFYTGLKPDPLLKVSEWADRNRQLSTIASSEPGKWRTERT
FT                   PYLKEIMDSLSSSSPAEKVVFMKGAQIGGTEAGNNWIGYIIDQTPGPMLVVQPTVEMGK
FT                   RWSKGRFAPLIEDMPCLRSKIKDPRSRDSGNTVQSKEFPGGTVVVTGANSPVGLRSMPV
FT                   RYLFLDEVDAYPGDSGGEGDPVLLSIARTNTFTRRKIFLVSTPTVHGISRIEKEFESSD
FT                   KRYFFVPCPHCDHYQVLKWSQIKWKDKDPSTAHYVCIEYSGKIENHQKTEMLARGEWRA
FT                   TREEGKKEAKIGFHLSSLYSPVGWYSWKQAVEDYLHAKENEQLLKVWINTTLGETWVDK
FT                   GEVPDWKQLFERRENFPIGMVPKGGKIVLTAGVDVQKDRLEAEVVAWGMGRESWSIDYQ
FT                   VLEGDTGSGEVWGKLSELLNHHFIGENGLEYMISMMAVDAGYATQEVYNWVRSHQGSGR
FT                   VMAVKGVNKALVPLNSPSRVDVTVGGQKLKRGIKLWPVGVSILKSELFQLLNVLTEGAP
FT                   GYCHFPEYPPEYFKQLTAEQLITKVVKGYTKQEWQKIRDRNEVLDCRVYARAASIALGI
FT                   DRWPESKWESLVGEKAKKSKKVRRSQWLSEKS"
FT   gene            252338..252562
FT                   /locus_tag="WD_0266"
FT                   /old_locus_tag="WD0266"
FT   CDS_pept        252338..252562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0266"
FT                   /old_locus_tag="WD0266"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14006"
FT                   /db_xref="GOA:Q73IA6"
FT                   /db_xref="InterPro:IPR004174"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IA6"
FT                   /protein_id="AAS14006.1"
FT                   /translation="MMYNQEYLTQVKEAIKKLQSGERVVSIAYGDHVVRYGEVQINDLL
FT                   SLRQRIKAELKVAGVKRKIVISTNKGIDK"
FT   gene            252608..253021
FT                   /locus_tag="WD_0267"
FT                   /old_locus_tag="WD0267"
FT   CDS_pept        252608..253021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0267"
FT                   /old_locus_tag="WD0267"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14007"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IA5"
FT                   /protein_id="AAS14007.1"
FT                   /translation="MIGNVERLQRELLEEMGSISLGSSNTRALEIVNQLGEDHINDTIM
FT                   TLDGRQFTALDCAIMFDSQGNNPRINERPRINNNAFRELEGAIRSAGGRTSEELGRRQD
FT                   IPYDRESFNEQVSTFLTDVTIEHVMAGRLHLMV"
FT   gene            253222..253443
FT                   /locus_tag="WD_0268"
FT                   /old_locus_tag="WD0268"
FT   CDS_pept        253222..253443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0268"
FT                   /old_locus_tag="WD0268"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14008"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IA4"
FT                   /protein_id="AAS14008.1"
FT                   /translation="MVNSRVNVTFNPKTSQHLIELAKATKQSVQKLTEKLIKEAIELEA
FT                   EDIAFSKIVRELDADDSEEVEDSEDIWK"
FT   gene            253424..253732
FT                   /locus_tag="WD_0269"
FT                   /old_locus_tag="WD0269"
FT   CDS_pept        253424..253732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0269"
FT                   /old_locus_tag="WD0269"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to EGAD:161985; match to
FT                   PF01919 protein family HMM PF01919"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14009"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IA3"
FT                   /protein_id="AAS14009.1"
FT                   /translation="MKTSGNKRYTIKYLKHVLKRNLPSLPEAIKPKIKDAIREYLATDP
FT                   IGNGVLLRNRLKGHRRIRVDDYRVVYRVNTAERKVTIVSIGHRDNIYKQAILDLLKH"
FT   gene            253852..255269
FT                   /pseudo
FT                   /locus_tag="WD_0270"
FT                   /old_locus_tag="WD0270"
FT                   /note="prophage LambdaW1, portal protein, authentic
FT                   frameshift; This gene contains a frame shift which is not
FT                   the result of sequencing error."
FT   gene            255335..256429
FT                   /pseudo
FT                   /locus_tag="WD_0271"
FT                   /old_locus_tag="WD0271"
FT                   /note="prophage LambdaW1, minor capsid protein, authentic
FT                   point mutation; This gene contains a premature stop which
FT                   is not the result of sequencing error."
FT   gene            256859..257871
FT                   /pseudo
FT                   /locus_tag="WD_0272"
FT                   /old_locus_tag="WD0272"
FT                   /note="prophage LambdaW1, transposase, IS110 family,
FT                   authentic frameshift; This gene contains a frame shift
FT                   which is not the result of sequencing error.Identified by
FT                   similarity to EGAD:15947; match to PF02371 protein family
FT                   HMM PF02371"
FT   gene            257895..258266
FT                   /locus_tag="WD_0273"
FT                   /old_locus_tag="WD0273"
FT   CDS_pept        257895..258266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0273"
FT                   /old_locus_tag="WD0273"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to GP:6723248"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14010"
FT                   /db_xref="InterPro:IPR004195"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IA2"
FT                   /protein_id="AAS14010.1"
FT                   /translation="MSCITEQNNLGDLLKYEASNLYSRDQITVTKGQNLSLGTVVGCNI
FT                   EDNVIKIINPTATDGTQTAIGVIASDVNVKENTKAVIITRIAMLADHAVVWPANITEEQ
FT                   KAAAIKQLEARGIIIRKGV"
FT   gene            258344..259345
FT                   /locus_tag="WD_0274"
FT                   /old_locus_tag="WD0274"
FT   CDS_pept        258344..259345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0274"
FT                   /old_locus_tag="WD0274"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to GP:6723249"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14011"
FT                   /db_xref="InterPro:IPR005564"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IA1"
FT                   /protein_id="AAS14011.1"
FT                   /translation="MQNPFTNSAFSMTELTKAINILPINYGRTESLNLFPSRSVRFRHI
FT                   TIEEQNGVLSLLPTQVPGAPATVGKRGKRKIRTFTIPHIPHDDVVLPEEVQGIRAFGSE
FT                   NELKALANVVTDHLELMRNKHAITLEHLRMGALKGIILDADGSELLNLYNEFEITPKVV
FT                   NFALGIATTDVKRKCMEVLRHIEDNLSGEYMTGVHALVSPEFFDALTSHSKVKEAYERW
FT                   QEGAALRNDMRSGFTFCGITFEEYRGQATDPEGTVRRFIEKDTGHCFPLGTASTFTTYF
FT                   APADFNETVNTLGQPLYAKQEPRRFDRGTDLHTQSNPLPMCHRPGILVKLAA"
FT   gene            259436..259696
FT                   /locus_tag="WD_0275"
FT                   /old_locus_tag="WD0275"
FT   CDS_pept        259436..259696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0275"
FT                   /old_locus_tag="WD0275"
FT                   /product="conserved hypothetical protein, degenerate"
FT                   /note="Identified by similarity to GP:6723250"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14012"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IA0"
FT                   /protein_id="AAS14012.1"
FT                   /translation="MFRDIKRLFADCFAHLGQQALYESKDKSYMVQILKQQPDKLYEIG
FT                   EGQFVGEILILEVSIFDVLQPVVDTVLQVNKKITKIVQAVS"
FT   gene            complement(259882..260904)
FT                   /locus_tag="WD_0276"
FT                   /old_locus_tag="WD0276"
FT   CDS_pept        complement(259882..260904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0276"
FT                   /old_locus_tag="WD0276"
FT                   /product="prophage LambdaW1, transposase, IS110 family"
FT                   /note="Identified by match to PF02371 protein family HMM
FT                   PF02371; match to PF01548 protein family HMM PF01548"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14013"
FT                   /db_xref="GOA:Q73I99"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I99"
FT                   /protein_id="AAS14013.1"
FT                   /translation="MINNFLGIDISKDRFDVSLSFISNKGKRETRKRSFKNNDHGFQGL
FT                   LSFLQKHNVEQVKACMEATGCYSEALAEFLHNTGHFVSVVNPACIRFYAKSKLIRQKND
FT                   QTDAEIIADYCQRQEPIRWAPPSPELKKLKHLYRCSAALKDELTLVNNHLEKKERLPKE
FT                   VANAWEDLAMNIKQKIERIKNSLRELLNKHKELLENFQLLLTIPGIGEESAVAILAEVP
FT                   NIKAFKDARQLAAYAGAIPRNITSGTSVHAKPRLSKSGSRTLCKAMYFLAIVAKNHNPT
FT                   IMTFCKRLKEKGKHNMAIVGAAMRKLLHIVFGVLRSKKAFDPDHIKNYRARSLAESLVL
FT                   "
FT   gene            261085..261228
FT                   /locus_tag="WD_0277"
FT                   /old_locus_tag="WD0277"
FT   CDS_pept        261085..261228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0277"
FT                   /old_locus_tag="WD0277"
FT                   /product="conserved hypothetical protein, truncation"
FT                   /note="Identified by similarity to GP:6723250"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14014"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I98"
FT                   /protein_id="AAS14014.1"
FT                   /translation="MLKLKTSDAFDKIQGDIFIIDKRKYKVYSPPLRDNSGMLWKIQAS
FT                   GV"
FT   gene            261229..261726
FT                   /locus_tag="WD_0278"
FT                   /old_locus_tag="WD0278"
FT   CDS_pept        261229..261726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0278"
FT                   /old_locus_tag="WD0278"
FT                   /product="prophage LambdaW1, minor tail protein Z,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14015"
FT                   /db_xref="InterPro:IPR010633"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I97"
FT                   /protein_id="AAS14015.1"
FT                   /translation="MRINIEVTGSIIQSIDAERKKVEKATVRALNKTALWVRSQTVKQV
FT                   SEEKQIPKKAMRKKLSVDKANRKRLWSVVKLSSQWIGVAKLGSIKQTKIGAKVGSRTYE
FT                   GAFIATMKNGHIGIFRRRYTTSLPIDEIKINTHARETMKELVSNEVERVFEKYFDHELN
FT                   FI"
FT   gene            261733..262206
FT                   /locus_tag="WD_0279"
FT                   /old_locus_tag="WD0279"
FT   CDS_pept        261733..262206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0279"
FT                   /old_locus_tag="WD0279"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to OMNI:NTL03PA00616"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14016"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I96"
FT                   /protein_id="AAS14016.1"
FT                   /translation="MFWRDLHQKICKTLKEEIPAIQTCEVYPAVRREIIAPAAFVELAS
FT                   LEPGKDPGTEELALRARFEVRVVVDGTVEDSQVVVRSLAAEIARVVNKNTWDVENVSAG
FT                   EFISAGGDDFKPELDAYLVWLVEWVHELHTGQSMWLETGIIPHTISVGENVRA"
FT   gene            262193..262656
FT                   /pseudo
FT                   /locus_tag="WD_0280"
FT                   /old_locus_tag="WD0280"
FT                   /note="prophage LambdaW1, baseplate assembly protein V,
FT                   putative, authentic frameshift; This gene contains a frame
FT                   shift which is not the result of sequencing error."
FT   gene            262659..262913
FT                   /locus_tag="WD_0281"
FT                   /old_locus_tag="WD0281"
FT   CDS_pept        262659..262913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0281"
FT                   /old_locus_tag="WD0281"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14017"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I95"
FT                   /protein_id="AAS14017.1"
FT                   /translation="MAKAVVCIGDYCSGIPAHVCMSGSSDVFVNGRSVCRKGDILTLGE
FT                   KLTQGSNSVFVNDIGITRTGDLVSCGFHVMGDSKNVFAE"
FT   gene            262919..263245
FT                   /locus_tag="WD_0282"
FT                   /old_locus_tag="WD0282"
FT   CDS_pept        262919..263245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0282"
FT                   /old_locus_tag="WD0282"
FT                   /product="prophage LambdaW1, baseplate assembly protein W,
FT                   putative"
FT                   /note="Identified by similarity to GP:6723254; match to
FT                   PF04965 protein family HMM PF04965"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14018"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I94"
FT                   /protein_id="AAS14018.1"
FT                   /translation="MNASTGKELEGLNHLKQSIVDILTTPIGSRVMRRDYGSRLLELVD
FT                   KPINRDLTLEIYAAVAEALQKLEQRFKLEKVKITEVKEGKVNISLDGIYLPNGKNIHFD
FT                   GIMV"
FT   gene            263248..264057
FT                   /locus_tag="WD_0283"
FT                   /old_locus_tag="WD0283"
FT   CDS_pept        263248..264057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0283"
FT                   /old_locus_tag="WD0283"
FT                   /product="prophage LambdaW1, baseplate assembly protein J,
FT                   putative"
FT                   /note="Identified by similarity to GP:6723255; match to
FT                   PF04865 protein family HMM PF04865"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14019"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="InterPro:IPR014507"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I93"
FT                   /protein_id="AAS14019.1"
FT                   /translation="MEQPNIIEPLNFEEIFSRMKEELVSRDESFTALVESDPAIKILEV
FT                   AAWRELLLRERINEAARSNLLKFARGEELDNLAEFYGAERQDGEEDERFRKRIKAKIKG
FT                   WSTGGSKEHYRYHALSADRRVKDALVESKVPGSVEISILSTELSTNGIASEELLDIVRK
FT                   RVTRDDIRVLTDTITVVGCNIIEIDIHSKISIKRPDIIETVKKKFIEKFEATKRLGWKV
FT                   TKSWIIANLFVEGVENVELIEPRKDVVVLGNECVCLGKLEIELMGKS"
FT   gene            264009..265217
FT                   /locus_tag="WD_0284"
FT                   /old_locus_tag="WD0284"
FT   CDS_pept        264009..265217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0284"
FT                   /old_locus_tag="WD0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to GP:6723256"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14020"
FT                   /db_xref="InterPro:IPR006521"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I92"
FT                   /protein_id="AAS14020.1"
FT                   /translation="MRLFRQARNRINGQKLMLLPPNSTKEERAIVEAIDYKVDPSRIKG
FT                   FKFNSKDEILPWIIEEYGLGEILRWVKDKGKAIREGIKFQRLRGTPASLKIALKWANIE
FT                   DITIIEEPPGKHFFELQVGIRDVPNDFFVDAVVELAKLSLPARSRLMRLFNDHYNIGRF
FT                   ILDESFFGSLLSDYSGTKIEKDGPVLSFGRVNFFRSSGPVVRIIENYLRNHYEQALSND
FT                   IYRLDVAILGETEPHTKNYNGIYERNHVWYNFKALYPLPQSLLPAIKFAKAQIVLSDSW
FT                   NLGEINACFPVTSIEEEGDKFLLGSSKLSEQLWNLKYKPVLERFSVTHHYKVEDFTNQK
FT                   VIRFGLAEHNVHFESDLDSEQKDSIHELERYILVFYPGVLTWHEHRHLNRSWEEKQVVC
FT                   LMS"
FT   gene            265391..265993
FT                   /locus_tag="WD_0285"
FT                   /old_locus_tag="WD0285"
FT   CDS_pept        265391..265993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0285"
FT                   /old_locus_tag="WD0285"
FT                   /product="prophage LambdaW1, ankyrin repeat domain protein"
FT                   /note="Identified by match to PF00023 protein family HMM
FT                   PF00023; match to PF00023 protein family HMM PF00023; match
FT                   to PF00023 protein family HMM PF00023"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14021"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I91"
FT                   /protein_id="AAS14021.1"
FT                   /translation="MWISQEERDDFNELFQELLAGKLSKKHINRKNENGETMLHRAAKM
FT                   STRKKVNWLIWEGADVDARDNEGYTPLHSAALGMRLENVKELIEARADINATEEDGNTA
FT                   LHLACMVGGKKIVEELIKAGAEINLVSISGFSPMYYASDEETREVLKKKGGKIVNKQRE
FT                   LMEKISKVSEKQVVNGGKKLNDVEERAVDVCRLFVRK"
FT   gene            266255..266845
FT                   /locus_tag="WD_0286"
FT                   /old_locus_tag="WD0286"
FT   CDS_pept        266255..266845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0286"
FT                   /old_locus_tag="WD0286"
FT                   /product="prophage LambdaW1, ankyrin repeat domain protein"
FT                   /note="Identified by match to PF00023 protein family HMM
FT                   PF00023; match to PF00023 protein family HMM PF00023; match
FT                   to PF00023 protein family HMM PF00023"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14022"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I90"
FT                   /protein_id="AAS14022.1"
FT                   /translation="MVKFSKKEREEFNKSWKEVLDNSIENINKKDTKGRTILHYAVGMP
FT                   DPKKVKLLIKKGADVDAADAGKYRPLHLAVMGQRLENTKELIKAGVDVNAVERSSKFAA
FT                   LHLACMVAEIKIVEELVKAGGNVEQKDKFGKTPMDYVRNNKEIKEVLENVKMANKQREF
FT                   IERIRVVSESTAAGVIVAKEEVKELETMDEKVL"
FT   gene            266878..267306
FT                   /locus_tag="WD_0287"
FT                   /old_locus_tag="WD0287"
FT   CDS_pept        266878..267306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0287"
FT                   /old_locus_tag="WD0287"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to GP:6723259"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14023"
FT                   /db_xref="InterPro:IPR021322"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I89"
FT                   /protein_id="AAS14023.1"
FT                   /translation="MEGIEKKVLNLEKKALEELRKIWRKVFVEEAPRNSKKYLIPRLAY
FT                   RLQEKAYGEISRKGAKRLKYLADRLEQGKRISSDKLPAVGTEWILERGEETHAVMVTDK
FT                   GLIYREEFFTSLSAVAGKIMGMSYNGPLLFGMRDKKVS"
FT   gene            267309..268811
FT                   /locus_tag="WD_0288"
FT                   /old_locus_tag="WD0288"
FT   CDS_pept        267309..268811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0288"
FT                   /old_locus_tag="WD0288"
FT                   /product="prophage LambdaW1, site-specific recombinase,
FT                   resolvase family"
FT                   /note="Identified by similarity to GP:6723260; match to
FT                   PF00239 protein family HMM PF00239"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14024"
FT                   /db_xref="GOA:Q73I88"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I88"
FT                   /protein_id="AAS14024.1"
FT                   /translation="MLKEVRCAIYTRKSNEDGLEQKFNSLDAQRVACKKYIKSREGWVA
FT                   LAKRYDDGGYSGSNLNRPAIKELFEDVKAGEVDCVVVYTLDRLSRETKDCIEVTSFFRR
FT                   HRISFVAVTQIFDNNTPMGKFVQTVLSGAAQLEREMIVERVKNKIATSKEEGLWMGGNV
FT                   PLGYDVKEKELIINEKEAKVIKHIFERYMELRSMAELARELNREGYRTKAKSDIFKKAT
FT                   VRRIITNPIYMGKIRHYEKQYKGKHEAIIEEEKWQKAQELIKNQPYRGKKYEEALLKGM
FT                   IRCRCCKVNMTLTYSKKENKRYRYYICNNHLRGKGCKSMNRTVVAGEVEKEVMKRAECL
FT                   YENWEKGAKKEKWENLSFGKQKEAVKKLIKTVWVREDGIEVCSESEEKFIPMNLKKKGN
FT                   KCTVVEPEGKTNNALLKAVVRAHLWKRQLEEGKYRSVKELSIKINIGTRRIQQILRLNY
FT                   LAPKIKEDIVNGRQPSNLRLVDLREIPMLWSEQMEKFYKLAS"
FT   gene            268881..269024
FT                   /locus_tag="WD_0289"
FT                   /old_locus_tag="WD0289"
FT   CDS_pept        268881..269024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0289"
FT                   /old_locus_tag="WD0289"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14025"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I87"
FT                   /protein_id="AAS14025.1"
FT                   /translation="MPVKKKERTDKLCGLTEKEKGKFDTLKQEIENLGKKKVLYVLEKD
FT                   EK"
FT   gene            268999..270213
FT                   /locus_tag="WD_0290"
FT                   /old_locus_tag="WD0290"
FT   CDS_pept        268999..270213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0290"
FT                   /old_locus_tag="WD0290"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14026"
FT                   /db_xref="GOA:Q73I86"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I86"
FT                   /protein_id="AAS14026.1"
FT                   /translation="MFWRRTKNENSIAEKFNDDTLQKILTTKIPYSEEGRKGVFTLPCY
FT                   AISLKNNQAFETFLQEAAKRKFLKDLLNDELNGEILGVQKTTYTVLAYCISEKNSKAVR
FT                   AVLEVSKENGILKEILDQKMIKEKANSQKISYTLIDYANKQNCKEIVATLKEFKESLNI
FT                   EVKPVSGNAETSCEDINKDCEDLEIHEPMLASSEEAKNILTKDDIDQTQSSSISTTTFT
FT                   EVVKRDQTQSCSHSKSRSAENGKSLTEIKHKRKLIKTDTESREKLTDNLTWESKATAQL
FT                   RGDINKDSELIFETSEKAQNALTEEEPDIPSPTELYFDSKGNSVDEKSSKKAIQPIVAG
FT                   VVGAVLLASGVALYIMKMPVIAAVVGIAGLVCLSFALYNVLKPSTKLEKVESVEQPIQS
FT                   SLNLA"
FT   gene            complement(270374..271048)
FT                   /locus_tag="WD_0291"
FT                   /old_locus_tag="WD0291"
FT   CDS_pept        complement(270374..271048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0291"
FT                   /old_locus_tag="WD0291"
FT                   /product="prophage LambdaW1, ankyrin repeat domain protein"
FT                   /note="Identified by match to PF00023 protein family HMM
FT                   PF00023; match to PF00023 protein family HMM PF00023; match
FT                   to PF00023 protein family HMM PF00023; match to PF00023
FT                   protein family HMM PF00023; match to PF00023 protein family
FT                   HMM PF00023"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14027"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I85"
FT                   /protein_id="AAS14027.1"
FT                   /translation="MHTSKPTAAEKDLNSKLFYAVEQNNLDKVKELIRNGADIHAREIS
FT                   SKKTMHIAVKKGNKNIVEFFLNEGISVNDTNNSGWTPLHYAAFGGELEIAKLLVANGAN
FT                   VRAENAYGQKPIDLIHYGKDDGYKGIMELLLNKGGGKVNDIDKEGWTLLHYAAFNGNLE
FT                   TVKFLIDKGASIHTKNNGRETPLDLAREGGSTEVVNMLSSINTKVTDVSVSQLSIPRKR
FT                   TV"
FT   gene            complement(271150..273255)
FT                   /locus_tag="WD_0292"
FT                   /old_locus_tag="WD0292"
FT   CDS_pept        complement(271150..273255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0292"
FT                   /old_locus_tag="WD0292"
FT                   /product="prophage LambdaW1, ankyrin repeat domain protein"
FT                   /note="Identified by match to PF00023 protein family HMM
FT                   PF00023; match to PF00023 protein family HMM PF00023"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14028"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I84"
FT                   /protein_id="AAS14028.1"
FT                   /translation="MLTRDISRPEQVFSGAEISEKKELEEKSNTRQGQSEIGGSFDDQY
FT                   ELIIEYLLQIPPSNDRLEILRKQGHSQSDIDEMFSQGDSWYTQSTISSFRSYNSPPSLM
FT                   DSKYSLSKQVSVWSALDHNLTESQKKLNIELLNVLKYLEWHDEGALFDYDNGQVDELEE
FT                   FLKNNRGNPDLKAVLNVKRGESGSTVLHAIAGAHIGASYRQEDRTINLLLEAGASPNIQ
FT                   DDKGETPLHRASAMGYDKNIYSLLRGNADPNICDGQGKTPQQTAVDNHNYHVERCFFTD
FT                   NQKKLRKELNNILNRHRYKEGNLNYIVTLTLFQFFEDLERFLHEHKNNKDLKVVLNTRN
FT                   IAGKSEVLEHVKNAFSGFQAADEIKKLLLEAGAKEFTYERKKCLPKSGVLWGNIIPAQE
FT                   EKLSRSLGILSEIQDINQLEKFVKIAIKSGVRLNYRFTVPSPFEGYSFTDYVIKRISEL
FT                   EKCPKVASGIICQLVSKGAVFGSPESIDVIDELGLECKDHKANMIKAFEGYINDAHRFI
FT                   KVAKSATTSKLNDIAIGNTTLYLEYSEESKIDIAKITDGARSLWLNYENAGYERNIVKI
FT                   GESEVEIITQNGKRHYTDLTANSNIALIFCTSFGELEVRLYSDKQNENRIRVEARDQGM
FT                   LKKLKDCGEEIGKNCSLGYHSVYDAIERGYFEKPASSSRIVQEEKLQNGKWADQVRYTR
FT                   KNGAQIR"
FT   gene            complement(273445..273591)
FT                   /locus_tag="WD_0293"
FT                   /old_locus_tag="WD0293"
FT   CDS_pept        complement(273445..273591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0293"
FT                   /old_locus_tag="WD0293"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14029"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I83"
FT                   /protein_id="AAS14029.1"
FT                   /translation="MSKLWVHGRKKLTLPKRRRKKNFHNKSVFLEGAVMTQGNWDSDKN
FT                   FAG"
FT   gene            complement(273600..275225)
FT                   /locus_tag="WD_0294"
FT                   /old_locus_tag="WD0294"
FT   CDS_pept        complement(273600..275225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0294"
FT                   /old_locus_tag="WD0294"
FT                   /product="ankyrin repeat domain protein"
FT                   /note="Identified by match to PF00023 protein family HMM
FT                   PF00023; match to PF00023 protein family HMM PF00023; match
FT                   to PF00023 protein family HMM PF00023; match to PF00023
FT                   protein family HMM PF00023; match to PF00023 protein family
FT                   HMM PF00023; match to PF00023 protein family HMM PF00023;
FT                   match to PF00023 protein family HMM PF00023; match to
FT                   PF00023 protein family HMM PF00023; match to PF00023
FT                   protein family HMM PF00023"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14030"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I82"
FT                   /protein_id="AAS14030.1"
FT                   /translation="MKDLVNVPRNRQGWTSLHYAVKNGNVGKINDLIKGGKNVDAQDEQ
FT                   GWTPLHLAATGSYTKVVNAQMYGDDIHARETGSEEPIYIKACKNIIESFLDKLLNIKVV
FT                   GALIKGKAEINAKDNQGMAPLHWAVKVGHINVVNGLIKGKAEINAKDNQGRTPLHWAAL
FT                   IDRTSAVKALIKGKAEINAKDNQERTPLHLSIQIGRTDVVNTLIDKKAEINAKDRQGRT
FT                   PLHWAASKGGIEVVNALIEKGADVNAVNKYGDAPLRFAARDGHIDIVKALIQGGANVNA
FT                   RNSDGTPLHTAYGHEEIVKLLIEKGADVNAVNSNGDTPLRFADRNGHIDTVKALINYVT
FT                   KLEAADLYVSQKNLEEKNRLIGDLHDLHSSYPQHLQNCKKEVKKIEKESQELHSFLKKS
FT                   DINELISVWERNADIQNQIDNHDNLKEQYPEYAHILINKANEVKKEIFLHNHQPLIDAL
FT                   SAHYKCDIKTMTFAGIENFFKVVHRDDFKEKLGNGGITLKNFVDLKNVEKRDDVPKLGV
FT                   IAFKHGCQLSEPRVTRVIDQALSL"
FT   gene            275579..276469
FT                   /locus_tag="WD_0295"
FT                   /old_locus_tag="WD0295"
FT   CDS_pept        275579..276469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0295"
FT                   /old_locus_tag="WD0295"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14031"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I81"
FT                   /protein_id="AAS14031.1"
FT                   /translation="MKDYHQLRPLHLRHQYSITKEAKCDLSYDNASDNSSQSDEIGYNK
FT                   IGATSGASKPSSWIDAVKGVFQFISSPLRAALPSFSENSSSRSGTAGSSSNHSDTVRNP
FT                   NIQYTSQFSREVCASNNASLMFFLLQAFLDKKCPLPKFSDVNPVKALFYTSDIIKLFKE
FT                   VLEKQAESKGGIKMHRLDINFEKLFEKINEKIRSGEFNEISGILKSYAEEALPGREPGD
FT                   PGRLSPKKFDKFMAEFNRRIDPVINQLMQQMLSRLEVSDVKEQQISLEPKSYLNNTSVQ
FT                   CHLTQARGQGKVLIP"
FT   gene            complement(276458..277369)
FT                   /locus_tag="WD_0296"
FT                   /old_locus_tag="WD0296"
FT   CDS_pept        complement(276458..277369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0296"
FT                   /old_locus_tag="WD0296"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to GP:18144083; match to
FT                   TIGR01784 protein family HMM TIGR01784"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14032"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I80"
FT                   /protein_id="AAS14032.1"
FT                   /translation="MTFSKFLDPKNDVSFKRIFGTEKNRDILIHFLNDILGFTGKNEIK
FT                   DIEFLSTIQDLDIAAKKQSIVDVLCRDSTGAQYICEMQVAKTKGFEKRAQYYAAKAYSR
FT                   QADKGDQYHNLKEIIFIAIADCVLFPNKSEYKSKHTIRDEDTNEHDLKDFYFIFIELPK
FT                   FPKNKEDQLENIVEKWVYFFRYADETSEEELEKIIGSDVIIKKAYEELNRFNWSEKEFI
FT                   AYGQEIKRILDEQAVLAQKLDDATEKGREEGKEEGIQIGHEKGRKAEKIEVAKNSLKAG
FT                   VSIDVIAQITGLSIDEIQKLRN"
FT   gene            277823..277930
FT                   /locus_tag="WD_0297"
FT                   /old_locus_tag="WD0297"
FT   CDS_pept        277823..277930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0297"
FT                   /old_locus_tag="WD0297"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14033"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I79"
FT                   /protein_id="AAS14033.1"
FT                   /translation="MNNKNKSKDRKKEIEFRIDLTQKKWRERKEFFRVK"
FT   gene            277949..278845
FT                   /pseudo
FT                   /locus_tag="WD_0298"
FT                   /old_locus_tag="WD0298"
FT                   /note="transposase, IS3 family, degenerate; This gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error.Identified by similarity to EGAD:43417"
FT   gene            complement(279000..279128)
FT                   /locus_tag="WD_0299"
FT                   /old_locus_tag="WD0299"
FT   CDS_pept        complement(279000..279128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0299"
FT                   /old_locus_tag="WD0299"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14034"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I78"
FT                   /protein_id="AAS14034.1"
FT                   /translation="MVGYLLCTKISAFFLTLSRKSGEKVWNVFHKENDESKCSGMQ"
FT   gene            279696..280460
FT                   /gene="coxB"
FT                   /locus_tag="WD_0300"
FT                   /old_locus_tag="WD0300"
FT   CDS_pept        279696..280460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxB"
FT                   /locus_tag="WD_0300"
FT                   /old_locus_tag="WD0300"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /EC_number="1.9.3.1"
FT                   /note="Identified by similarity to EGAD:163131; match to
FT                   PF00116 protein family HMM PF00116; match to PF02790
FT                   protein family HMM PF02790"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14035"
FT                   /db_xref="GOA:Q73I77"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034210"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I77"
FT                   /protein_id="AAS14035.1"
FT                   /translation="MVKLFALLIIFYSNISVASAPTSWQFGFPAPATEVMEAVVRSHSF
FT                   VMLVMVTIMLFVWALLAYIAFRFRKSKVTNISKTTHSVPLEIIWFVIPTIIVGILAFEN
FT                   AKLLKLQEEIPKADITLKVIGHQWYWSYQYPEYQGVSFDSYIKGKEDFIEGDLKLFSVD
FT                   NNIILPVNTNVRLQVTAGDVIHSWGVPAFGVKIDAIPGRLNEAWFNIKKPGVYYGQCYE
FT                   LCGQGHGFMPIVVEAVSKEDFNKWIENRKLVS"
FT   gene            280476..282026
FT                   /gene="coxA"
FT                   /locus_tag="WD_0301"
FT                   /old_locus_tag="WD0301"
FT   CDS_pept        280476..282026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxA"
FT                   /locus_tag="WD_0301"
FT                   /old_locus_tag="WD0301"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="Identified by similarity to EGAD:5976; match to
FT                   PF00115 protein family HMM PF00115"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14036"
FT                   /db_xref="GOA:Q73I76"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I76"
FT                   /protein_id="AAS14036.1"
FT                   /translation="MSDVPKGIKRWLFSTNHKDIGTLYIIFSILAGIIGGLLSVIIRTQ
FT                   LMHINILNNNYQLYNVMVTGHALIMVFFMIMPALMGGFGNWFVPLMIGAPDMAFPRMNN
FT                   LSFWLLVSSFILLILSVFIGEGPGTGWTLYPPLSQVMSHPSAGVDIAILALHVAGMSSI
FT                   VGAINFIVTIFNMRTKGMSLTKMPLFVWSVLLTAFMLIVALPVLAGAITMLLTDRNIGT
FT                   SFFDPAGGGDPVLFQHLFWFFGHPEVYVIIFPAFGIISQVVSTFSHRPVFGYIGMVYAM
FT                   IGIAVFGFMVWAHHMFTVGLSADAAAFFSTTTIFIGVITGVKVFSWIATMWGGAIEFKT
FT                   PMLFALGFIFMFVGGGITGIILSHGGIDKLLHDTYYVVAHFHYVMSLAALFGAFAGFYY
FT                   WIGKMSGKQYNERLGQIHFWLTFISTNITFLPQHFLGLAGMPRRIPDYPDAFIPWNYIS
FT                   SIGSYMSFVSVMFFVFIVIHLFKWGKKAGDNPWEGDTLEWTVSSPPPFHTFEKPPVVK"
FT   gene            282028..282915
FT                   /gene="ctaB"
FT                   /locus_tag="WD_0302"
FT                   /old_locus_tag="WD0302"
FT   CDS_pept        282028..282915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaB"
FT                   /locus_tag="WD_0302"
FT                   /old_locus_tag="WD0302"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="Identified by similarity to SP:P08301; similarity to
FT                   SP:P08301; match to TIGR01473 protein family HMM TIGR01473;
FT                   match to PF01040 protein family HMM PF01040"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14037"
FT                   /db_xref="GOA:Q73I75"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73I75"
FT                   /protein_id="AAS14037.1"
FT                   /translation="MYTSVLLNVESTILDFWRLLKPRIMYLVVFTAVAGMVTAPGSMHP
FT                   FLALISLICVALGSGSAGAINMWYDRDIDLLMERTKNRPIPSGRVSAESALEFGITLGI
FT                   LSVFIMAIAVNYISAALLAVSILFYVFIYTIWLKRRTPQNIVIGGAAGAFPPMIGWAAV
FT                   TNSVSWESFILFLVIFMWTPPHFWALSLNKSEDYAKASIPMSNIVYGPEKTRKYILIYS
FT                   VLLVLTSLLPALFLKKALLYLSMATFEGCVFIWYAVSVMKFKNHSSQKKMFSYSISYLF
FT                   SLFASIIFCSIDLF"
FT   gene            283091..283528
FT                   /gene="rnhA"
FT                   /locus_tag="WD_0304"
FT                   /old_locus_tag="WD0304"
FT   CDS_pept        283091..283528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="WD_0304"
FT                   /old_locus_tag="WD0304"
FT                   /product="ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /note="Identified by similarity to EGAD:29509; match to
FT                   PF00075 protein family HMM PF00075"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14038"
FT                   /db_xref="GOA:Q73I74"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73I74"
FT                   /protein_id="AAS14038.1"
FT                   /translation="MSKKEVIIYTDGACSGNPGAGGWAAIILFQDYRKDIYGREENTTN
FT                   NKMELTAVINGLKVLKFSCNINLYTDSLYVKHGITEWINKWKMNGWKTSNKKSVKNMEL
FT                   WKELDNVASQHEIDWKWVKAHSGDKYNEEADSLARKAIIDA"
FT   gene            283521..286643
FT                   /locus_tag="WD_0305"
FT                   /old_locus_tag="WD0305"
FT   CDS_pept        283521..286643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0305"
FT                   /old_locus_tag="WD0305"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14039"
FT                   /db_xref="GOA:Q73I73"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR039441"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I73"
FT                   /protein_id="AAS14039.1"
FT                   /translation="MLKKITILFSVALLFILCFFIFFKPLEININYIDFYVKHKISKIF
FT                   VGSSVNMENTSVVWQKDGKDPYLVITDLAIANPNFTIKVPELFVHFKLSSLFKASTNLS
FT                   QVSADNVHVCIKREETNVNPQNSLDLLDNHYLSSNRLPSVSFQRVTLESRKKETSSQAT
FT                   WMTRTSAGMTGKKDTGMTGKNFKMTESSAKNLLKTIREFFFDLNADSKIEFTNIAIDKS
FT                   TEDEFFIDKLYIGKGEDFNVLDIHVNTKDGKGFLDDLSITIKNRNNLLNVYGTFYDLKL
FT                   GLLSKFSTLVKSYNLDKNIGFKGSFSVKINKKDEIVDGNIYVLNTENYLNKNLALTNVN
FT                   INLTYSDGIISVKNFHFKLNDTYLSLIGKMNFSTSHALLRINISKFAAKDLCTYIPDSV
FT                   VNSKFKSWYCDNIDGDVLNTIVSFNGKINNLVDDDLSDIVIVADIENGSVKFDEDFEQV
FT                   KELKGDLIIKNNDLEITVNSAKFQNFTVNGGDIEMKSLNKEDSVLTINGKAVSDAYGLY
FT                   EPIRFKLDDVVKVERDKVSGMAKSVFNFRIFNLNADDKKVDFSANFHSEIDNLAVYNAS
FT                   LGKYDIKLSFGSDFIDLNGSGMVNNTQLLFDLKSSNRNESFAWNLTGDLPAQIFNFDSG
FT                   YVSANLESVINQDKTGYVNGDIDLSEFESHSSYLGWKNRFEDHNKILFSTRLKGAGELL
FT                   VDKLDIVGNDLDIKFSGRVENGNLYLNSSSFKLPDNDFSIEIESGKEKNAITIYGEEIN
FT                   LSDILGLLGKNSNGLNKDIEISMNVDNVIMKEGIVIKNAKLNVTCTKGNCNGSQFTGQF
FT                   LEDSSNILAEYSGIGLEIYADNSGMLLRSLGISKSIKNGKLSFYLSPQRESGEHYGTLS
FT                   ISNFYIKDAPLLTTLLSMSSLPGIVNAIKNEGVYFYKCNAPFSYKDGTIEIEESWLEGA
FT                   ELGISTGGKLDIRNYKFQVAGQVIPAYLINKSLLKIPIIGKLLTGGKSRGIVSIDYKAS
FT                   GDDKNNNVSVDLISSLTPNLLKRLLGVFDRIMTKTNESGLKGGVKKKFGSI"
FT   gene            286864..287022
FT                   /locus_tag="WD_0306"
FT                   /old_locus_tag="WD0306"
FT   CDS_pept        286864..287022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0306"
FT                   /old_locus_tag="WD0306"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14040"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I72"
FT                   /protein_id="AAS14040.1"
FT                   /translation="MSCQCVTLVSIQKGVIPVSATFMTSFTMCHIVMFVQLWNESRYDV
FT                   LLGSAIV"
FT   gene            complement(287206..288855)
FT                   /gene="groEL"
FT                   /locus_tag="WD_0307"
FT                   /old_locus_tag="WD0307"
FT   CDS_pept        complement(287206..288855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="WD_0307"
FT                   /old_locus_tag="WD0307"
FT                   /product="chaperonin, 60 kDa"
FT                   /note="Identified by similarity to EGAD:13402; match to
FT                   PF00118 protein family HMM PF00118"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14041"
FT                   /db_xref="GOA:Q73I71"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73I71"
FT                   /protein_id="AAS14041.1"
FT                   /translation="MTNVVVSGEQLQEAFREVAAIVDSTVAITAGPRGKTVGINKPYGA
FT                   PEITKDGYKVMKGIKPEKPLNAAIASIFAQSCSQCNDKVGDGTTTCSILTSNMIMEASK
FT                   SIAAGNDRVGIKNGIQKAKDVILKEIASMSRTISLEKIDEVAQVAIISANGDKDIGNSI
FT                   ADSVKKVGKEGVITVEESKGSKELEVELTTGMQFDRGYLSPYFITNNEKMIVELDNPYL
FT                   LITEKKLNIIQPLLPILEAIVKSGKPLVIIAEDIEGEALSTLVINKLRGGLKVAAVKAP
FT                   GFGDRRKEMLEDIATLTGAKYVIKDELGIKMEDLTLDDLGTAKNVKITKDNTTVVSENS
FT                   DSDSVKARIEQIKSQIETSTSDYDKEKLRERLAKLSGGVAVLKVGGATEVEVKERRDRV
FT                   EDALHATRAAIEEGIVPGGGVALLYASSVLDKLKGASDEEQIGINIIKKVLSAPIRRLV
FT                   KNAGLESAVIIDYLIKQNDKELIYNVEAMNYANAFTAGVIDPAKVVRIAFETAVSVASV
FT                   LITTESMIVDVPSKENASSPMGAGEMSGMGGF"
FT   gene            complement(288956..289246)
FT                   /gene="groES"
FT                   /locus_tag="WD_0308"
FT                   /old_locus_tag="WD0308"
FT   CDS_pept        complement(288956..289246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="WD_0308"
FT                   /old_locus_tag="WD0308"
FT                   /product="chaperonin, 10 kDa"
FT                   /note="Identified by similarity to EGAD:30514; match to
FT                   PF00166 protein family HMM PF00166"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14042"
FT                   /db_xref="GOA:Q73I70"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73I70"
FT                   /protein_id="AAS14042.1"
FT                   /translation="MSSISLNVLDDSVLIKPISEEKQGGIVLPSSAEKKPTKGEVIAIG
FT                   EGSRNSSGERVTLTVKAGDKVFYRQWAGTEIEHNNEKLIVMKESDILAVIK"
FT   gene            289405..290211
FT                   /locus_tag="WD_0309"
FT                   /old_locus_tag="WD0309"
FT   CDS_pept        289405..290211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0309"
FT                   /old_locus_tag="WD0309"
FT                   /product="aminomethyl transferase family protein"
FT                   /note="Identified by similarity to EGAD:162645; match to
FT                   PF01571 protein family HMM PF01571"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14043"
FT                   /db_xref="GOA:Q73I69"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I69"
FT                   /protein_id="AAS14043.1"
FT                   /translation="MSYIPFLSRGVIVLYGPDTRDFLQGIITNDINKLDSQKAIYSLLL
FT                   SPQGKYLYDFFLIEYGKYTLLECENMHLQQIIEKLDLLKTYLRVKIKDVSALYKVGVLF
FT                   NTKLAECSSKSQVIFQDPRHKLLGMRIIHKDEMKEPVGDFTQYEKVRIQNLVPDGAKDM
FT                   VQNSSFPLQFLIDKVNGISFNKGCYIGQEVVNRMSRQEIFRRKLYLVEGDNALPDIGTK
FT                   VTNENNEEIGELRSSVDNIGFALLNTGKSHANLYAGGVKCVKTLKS"
FT   gene            290237..290407
FT                   /locus_tag="WD_0310"
FT                   /old_locus_tag="WD0310"
FT   CDS_pept        290237..290407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0310"
FT                   /old_locus_tag="WD0310"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14044"
FT                   /db_xref="GOA:Q73I68"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I68"
FT                   /protein_id="AAS14044.1"
FT                   /translation="MLDKLRQPPYHGIEGIQLSSSVQIKQQENNVVGVLFLIFCTMCTL
FT                   CLHNISGFLPI"
FT   gene            complement(290940..291032)
FT                   /locus_tag="WD_0311"
FT                   /old_locus_tag="WD0311"
FT   CDS_pept        complement(290940..291032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0311"
FT                   /old_locus_tag="WD0311"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14045"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I67"
FT                   /protein_id="AAS14045.1"
FT                   /translation="MSVSVQQSGKIGRQDKPKNREKVSLQQLVS"
FT   gene            complement(291029..292768)
FT                   /gene="recJ"
FT                   /locus_tag="WD_0312"
FT                   /old_locus_tag="WD0312"
FT   CDS_pept        complement(291029..292768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recJ"
FT                   /locus_tag="WD_0312"
FT                   /old_locus_tag="WD0312"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ"
FT                   /EC_number="3.1.-.-"
FT                   /note="Identified by similarity to EGAD:163328; match to
FT                   TIGR00644 protein family HMM TIGR00644; match to PF01368
FT                   protein family HMM PF01368; match to PF02272 protein family
FT                   HMM PF02272; match to TIGR01369 protein family HMM
FT                   TIGR01369"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14046"
FT                   /db_xref="GOA:Q73I66"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I66"
FT                   /protein_id="AAS14046.1"
FT                   /translation="MLLEIEKRSITNALWKLQEADQRQILTLTQRFELPEILARILVTR
FT                   GVNIENASDFLYPLIRSLLPDPFHLLDMDKAVSRIIRAIKNDENLAIFGDYDVDGATSS
FT                   ALINRYLRAIDIHSIIYIPDRVDEGYGLNTDALLQLKKNGIDLCISVDCGTLAYQPIED
FT                   AKAFGLDIIVVDHHLGTEKLPSAVAVVNPNRLDESSPYNNLAAVGVSFLLIVALNKSLR
FT                   EQGFFTNKKEPDLFDLLDLVALGTVCDVMQITGLNRALVSQGLKVMSTRKNVGLRVLFD
FT                   ALGILEKPSVSRLGFSIGPCINAGGRIGEASLGARLLSTDDDEEAHSIALKLIDLNNAR
FT                   KVLENEALLEATAQAEKSAQSGANFIMISGNWHQGIIGIIASRLKEQFHLPTVVISLNN
FT                   GIGKASCRSILGVDIGAAVLSAKFINLIIEGGGHSMAAGFSIKEDKINDLHDFFTERFS
FT                   NSINEKTLKADSIVTAKAINLSLWNQLQRLGPFGVGNPEPRFIIQGAKIRKPEVIGVDH
FT                   IKCFIADDNVMVRAIAFRSANTHLGSAIMQGNVKAILGKISMNYWNGNEFVQFLIEDVL
FT                   TIS"
FT   gene            complement(292829..293062)
FT                   /locus_tag="WD_0313"
FT                   /old_locus_tag="WD0313"
FT   CDS_pept        complement(292829..293062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0313"
FT                   /old_locus_tag="WD0313"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14047"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I65"
FT                   /protein_id="AAS14047.1"
FT                   /translation="MTPFFFLDPNSQGTGMTKKGGTGTTKWSVCFCHPMIAKKTWSRAG
FT                   MTPKGLLPSWMETSVSYLDDTFFLLSLGYAEV"
FT   gene            complement(293059..293262)
FT                   /locus_tag="WD_0314"
FT                   /old_locus_tag="WD0314"
FT   CDS_pept        complement(293059..293262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0314"
FT                   /old_locus_tag="WD0314"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14048"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I64"
FT                   /protein_id="AAS14048.1"
FT                   /translation="MSSQCPDTGIQHFTQSHQERCILHNTFMLTNLIKFLDPSVSYSDD
FT                   KKRSTGMTGEGGYLDDIIGALG"
FT   gene            complement(293834..295093)
FT                   /locus_tag="WD_0315"
FT                   /old_locus_tag="WD0315"
FT   CDS_pept        complement(293834..295093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0315"
FT                   /old_locus_tag="WD0315"
FT                   /product="membrane protein, putative"
FT                   /note="Identified by similarity to EGAD:163406; match to
FT                   PF00115 protein family HMM PF00115"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14049"
FT                   /db_xref="GOA:Q73I63"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I63"
FT                   /protein_id="AAS14049.1"
FT                   /translation="MFLAVCALACSGLLSIIVIFLRLPFISSLVPSAQYIFDNALVIHV
FT                   NLSILVWMCSIISLLFIINLQNTNSWFNFSWVLSTLSMLLMFISAFVPNTEVIKSNYIP
FT                   VLQNKLFLLGLSLFIASILVNTMLAYTSKKEVSFLSVGQIGLVIILVSSFLCFVLAYNN
FT                   MPPGLYHSDNNLFYEYLFWGGGHLLQFAFTQGMFLVYLIMLSSNDISLASNNKITILPL
FT                   FINTILAVGAPFVYFVYPVDSAKLIQFFTWHMRIAGAVLPCFLIILVCYNIRTFINDKS
FT                   NYLLHSFLLFTYGDVLGVLTIEGNVTIPAHYHGSVVGITIAFMNFVYWMLPKLNFKEIK
FT                   SSMVRLQIYAYSIGHFLHITGLVWLGGYGALRKVADLPSISSMLARTCFIIGGAISVVG
FT                   GMLFVIIVLLHLLKGKARTN"
FT   gene            complement(295128..296423)
FT                   /locus_tag="WD_0316"
FT                   /old_locus_tag="WD0316"
FT   CDS_pept        complement(295128..296423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0316"
FT                   /old_locus_tag="WD0316"
FT                   /product="Na+/H+ antiporter family protein"
FT                   /note="Identified by match to PF03553 protein family HMM
FT                   PF03553"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14050"
FT                   /db_xref="GOA:Q73I62"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I62"
FT                   /protein_id="AAS14050.1"
FT                   /translation="MFYLTNFLPILLFLFLFVGSGIYFTILGVSNAFYQLSPLVAIVPA
FT                   IALGWVLYKGNTEEKMYAFLDGVRDRNIITMCIIFLLAGAFSEVTKAIGSADATVNLAL
FT                   SFIPTQFLLIGLFFVAAFISTAIGTSMGTIATIAPIAVELTQAGISPSLGVATVVGGAM
FT                   FGDNLSIISDTTIASVMSQKADIKKKLKLNAKVALIASIFTIIILFYSSSNSAAISVKE
FT                   YSLLLVTPYIILILLANFGINVFTALVLSITFAGIIGFINNNNHGLLFLSQNITKGFMS
FT                   MHEIMLLSLMVGGLSGLVGKNSKELADKLSSWVMIQRGGQKTAQLFIAKIVSIFDILLA
FT                   NNTIAIIFSGEIARDIAKKYEIPPHYSAAWLGIFSCVFQGLIPYGAQLLLASTIAGVSP
FT                   LAVVPHVYYCYVLGIIAVLYIVLNKIEKKDCA"
FT   gene            complement(296713..299166)
FT                   /gene="lon"
FT                   /locus_tag="WD_0317"
FT                   /old_locus_tag="WD0317"
FT   CDS_pept        complement(296713..299166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon"
FT                   /locus_tag="WD_0317"
FT                   /old_locus_tag="WD0317"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /note="Identified by similarity to SP:O69177; match to
FT                   TIGR00763 protein family HMM TIGR00763; match to PF05362
FT                   protein family HMM PF05362; match to PF00004 protein family
FT                   HMM PF00004; match to PF02190 protein family HMM PF02190;
FT                   match to TIGR01612 protein family HMM TIGR01612"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14051"
FT                   /db_xref="GOA:Q73I61"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I61"
FT                   /protein_id="AAS14051.1"
FT                   /translation="MNIERAVSSSFTALPVLPLRDVVIFPNIMVPLFIGREKSVNALEY
FT                   AISSSNHQNEIFLVAQKDGSVDNPEPEDLYEVGVLASIVQPLIKLPDNAVKVIIRGIRR
FT                   GRVVEYISSHTLLQARVELDNYYKEDEDNIDLEALRRSVVDAFDSWCKLNKKNQPEVAI
FT                   NSIDQIKEVDQLVDTVASHLNIKVSDKQSILEAYDPEERLKKAFAFIEREMSILNAQNR
FT                   LYKTIKSQVESTQKVYYLNEQLKAIQKELGEFENGDEGNILNEFEKKINETKLSQEARE
FT                   KAITDLKRYKKMNPISPEATVISSYLHWLLELPWGKYKDAKINLNAAKKILDENHYGIE
FT                   KVKDRIIEFLAVLKRVKEIKGPILCLVGPPGVGKTSLAKSMARAVGRDFVRIALGGVRD
FT                   ESEIRGHRKTYIGSMPGKIIQHMKKANSCNPLFLLDEIDKMGSDSRGDPASALLEVLDT
FT                   EHNKHFTDHHLEVEFDLSSVMFVATANSLNLPHPLRDRMEIIQLSGYTEDEKISIATHH
FT                   LIPKLKKEHGLYQKEWDITNEALYELIRLYTRESGVRSMERELAKLMRKAVKEILTDKN
FT                   KKISVRVDNLQDYLGVRKYTFGIAENESLVGIVTGLAYTETGGDILMIESVLIPGKGEI
FT                   KYTGKLGEVMQESIKAAYSYIRSNCLFFGIKPEKFQNNDIHLHVPEGAVPKDGPSAGGA
FT                   VCTSIVSLMTNIPVNKNVAMTGEVTLRGRVLAIGGLREKLLAALRGSIKTVIIPSENEK
FT                   DMQEIPASIKEGINVVFAKNIDEVMKVALMHPTTPINGDDNQNSVPSSIENKDDTFPIS
FT                   ETLKH"
FT   gene            complement(299182..300459)
FT                   /gene="clpX"
FT                   /locus_tag="WD_0318"
FT                   /old_locus_tag="WD0318"
FT   CDS_pept        complement(299182..300459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="WD_0318"
FT                   /old_locus_tag="WD0318"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpX"
FT                   /note="Identified by similarity to EGAD:29482; match to
FT                   TIGR00382 protein family HMM TIGR00382; match to PF00004
FT                   protein family HMM PF00004"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14052"
FT                   /db_xref="GOA:Q73I60"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73I60"
FT                   /protein_id="AAS14052.1"
FT                   /translation="MDNNNDLHYCSFCNKAQDEVDKLITNSSDGLKVFICNECIELSHK
FT                   AISQKKDRSFNSDRISDMKLLLKKPEDIKNFLSKHVVGQKHAQHVLSVAMYNHCQSMVQ
FT                   FHAISDIEIEKSNIMLIGPTGSGKTLLAKTLAKVSDVPFAMADATTLTEAGYVGDDVES
FT                   VLSRLLQAANYDVVKAQRGIVFIDEIDKITRKSEGTSITRDVSGEGVQQALLKIMEGTV
FT                   AYVPPQGGRKHPQQEFIQVDTSNILFICGGAFEGLDKIIEARKKGTSVGFGADISQSKE
FT                   QKKKNALHDVQPEDLIKFGLIPEFVGRVPITAVLDELDHEDLIHVLTEPRNALIKQYKA
FT                   LLAFSKVNLEFSDEAISAIAKKAISYKTGARMLRAILESLLLDIMYTSGNGGFEGSTIV
FT                   ITKKMVELGKATVNHNNNGNVITVND"
FT   gene            complement(300459..301085)
FT                   /gene="clpP"
FT                   /locus_tag="WD_0319"
FT                   /old_locus_tag="WD0319"
FT   CDS_pept        complement(300459..301085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="WD_0319"
FT                   /old_locus_tag="WD0319"
FT                   /product="ATP-dependent Clp protease, proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /note="Identified by similarity to EGAD:163297; match to
FT                   PF00574 protein family HMM PF00574; match to TIGR00493
FT                   protein family HMM TIGR00493"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14053"
FT                   /db_xref="GOA:Q73I59"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73I59"
FT                   /protein_id="AAS14053.1"
FT                   /translation="MTLIPIVVEQTSRGERAYDIYSRLVKERIIFVTGPIEDNMASVIV
FT                   AQLLFLESENPNKDICMYINSPGGVVTAGLSIYDTMQYINPDVSTLCIGQAASMGSLLL
FT                   AAGTKGKRYSLPHSRIMIHQPSGGYHGQATDIEIHANEILRVKKKLNQIYEKHTGNSLK
FT                   KIEGMMERDKFMDPEEARKIGLIDRVIAERTDIEIENIKVKQKVG"
FT   gene            complement(301097..302431)
FT                   /locus_tag="WD_0320"
FT                   /old_locus_tag="WD0320"
FT   CDS_pept        complement(301097..302431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0320"
FT                   /old_locus_tag="WD0320"
FT                   /product="trigger factor, putative"
FT                   /note="Identified by similarity to SP:O68129; similarity to
FT                   SP:O68129; match to TIGR00115 protein family HMM TIGR00115;
FT                   match to PF05697 protein family HMM PF05697; match to
FT                   PF00254 protein family HMM PF00254"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14054"
FT                   /db_xref="GOA:Q73I58"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73I58"
FT                   /protein_id="AAS14054.1"
FT                   /translation="MSNNIPQNTVEVSSVYTYKELSIDKLKYEYEITVGSDYIKQKVNS
FT                   RLQEIAENAKSPGFRAGKMPYDLVVANYKNEALEYVINNTIDYCSSDLMKKIEVKSHIY
FT                   PKVDVISLPDLGKENEEGNFVYKLSFESMPEVPVIDLDKINLKKIEAKIEEEDIKEFID
FT                   SIKTKFPNFASVDDASYQAKDGDKLIIDFEGRIRNKLFQGGSSKNFAVNLGSGTFINGF
FT                   EDQLTGMKKGETKNFKLKFPENYQAISLAGQEADFSVRVNEIQIAKDFENDDEIAKSIG
FT                   FKDYSLLINHAKKMIGDQCTEMRNLLIKKELFDYLDANYSFDLPTDIVKQEQQRMEGEL
FT                   GAQNDSRKEAEKRVKLAMLFMKFSAEHKISLTQNDVLSVIVNQYVSKDVQFDRVLKHFE
FT                   SNKQFQELVRGQALEYKVTDYIIEKVSKEEQIVSVKELKELFDNI"
FT   gene            complement(302590..302671)
FT                   /locus_tag="WD_tRNA-Leu-2"
FT                   /old_locus_tag="tRNA-Leu-2"
FT   tRNA            complement(302590..302671)
FT                   /locus_tag="WD_tRNA-Leu-2"
FT                   /old_locus_tag="tRNA-Leu-2"
FT                   /product="tRNA-Leu"
FT   gene            302812..303408
FT                   /locus_tag="WD_0321"
FT                   /old_locus_tag="WD0321"
FT   CDS_pept        302812..303408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0321"
FT                   /old_locus_tag="WD0321"
FT                   /product="membrane protein, putative"
FT                   /note="Identified by similarity to EGAD:162680; match to
FT                   PF04972 protein family HMM PF04972; match to PF04972
FT                   protein family HMM PF04972"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14055"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I57"
FT                   /protein_id="AAS14055.1"
FT                   /translation="MRLITSFLLAIFLITQSGCTTLIIGGVVATAAATAITMQDKSLGN
FT                   IIDDTTMVIRINKGLLKHGLFSSIKVKVSEGRVLLIGSVDTPEKQLTAEKIAWQQKEIK
FT                   EVINEIRVIPIQMASMLDTTVDGMITAEIRTRLLGKRNIKSINYSVNTVDRVVYLMGIA
FT                   QNKAELKAVIAIARKVKGVKQVVSYVRYRYSKLRH"
FT   gene            303469..304398
FT                   /gene="gshb"
FT                   /locus_tag="WD_0322"
FT                   /old_locus_tag="WD0322"
FT   CDS_pept        303469..304398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshb"
FT                   /locus_tag="WD_0322"
FT                   /old_locus_tag="WD0322"
FT                   /product="glutathione synthetase"
FT                   /EC_number="6.3.2.3"
FT                   /note="Identified by similarity to SP:P35667; match to
FT                   PF02951 protein family HMM PF02951; match to PF02955
FT                   protein family HMM PF02955"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14056"
FT                   /db_xref="GOA:Q73I56"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I56"
FT                   /protein_id="AAS14056.1"
FT                   /translation="MKIAFQMDENINFETDTTFALIKEAQRRGYEIFVYTPDNLALKLN
FT                   YPIAFAQQVSVDDFSFISKKDVAINLNEMNIIFIRQDPPFDMRYITTTYILEKTSALVI
FT                   NNPTEIRNCPEKLITSLFPELIPPTLITENISMIRDFYYNYQDIILKPLYSYGGNDVIR
FT                   IQDENSIQVVVDLMIAKYECPVIAQSFCKNIDKDKRILLLYGQPIGVMKRIPKISGEIR
FT                   TNMRLGASFEPAQMNDRNNEICNKIGPELKKRGLIFVGIDIIDDFLLEINTTSPTGVVY
FT                   INKLYNISLEKDLWDVFEEKASSHQLNL"
FT   gene            complement(304383..305414)
FT                   /gene="murG"
FT                   /locus_tag="WD_0323"
FT                   /old_locus_tag="WD0323"
FT   CDS_pept        complement(304383..305414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="WD_0323"
FT                   /old_locus_tag="WD0323"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.-"
FT                   /note="Identified by similarity to EGAD:163164; match to
FT                   PF04101 protein family HMM PF04101; match to PF03033
FT                   protein family HMM PF03033"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14057"
FT                   /db_xref="GOA:Q73I55"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73I55"
FT                   /protein_id="AAS14057.1"
FT                   /translation="MDIILATGGTGGHIFPAIALAKALKTQGYNCILFTDKKTNKNTDI
FT                   ESYTLPLRRPSSNKFKFFLFLIYSSMLALYQVRKLKPKSVIGFGSYASFPTLLAARVLS
FT                   IPIILHEQNTVLGRVNRFFFKSAKLIATSFPETKYAEGNKCIFTGNFVDIKAQSHSSTE
FT                   KILNILVIAGSQGANFFDDVVSSVICDLPIKMKKKIRVTQQCTKKNVNKVKSLYKSEKI
FT                   DCELSEFFDDMENRLANAHLVISRAGATSIAEITLARRSAIYIPYPYSKDNHQFYNAKY
FT                   IEDSRAAIIVKQNSEAKKNLTEVLFDLLNNSQKLRDMTNSTEKTGIKNGTTEFVKVIVH
FT                   RFS"
FT   gene            305502..305876
FT                   /locus_tag="WD_0324"
FT                   /old_locus_tag="WD0324"
FT   CDS_pept        305502..305876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0324"
FT                   /old_locus_tag="WD0324"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14058"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I54"
FT                   /protein_id="AAS14058.1"
FT                   /translation="MPKSNSKKEPNEKNKPQEQREGRSGGFLELLKNIIKILFNSVVDL
FT                   PEHEQHNKMKSTNLQQGLDTKGKGPEDLHPKAKLEVKEAAKGLKEELQNSDAGGNQSIE
FT                   TKVPNQTTTQDIDNSKTMER"
FT   gene            complement(305882..307255)
FT                   /gene="lpdA"
FT                   /locus_tag="WD_0325"
FT                   /old_locus_tag="WD0325"
FT   CDS_pept        complement(305882..307255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpdA"
FT                   /locus_tag="WD_0325"
FT                   /old_locus_tag="WD0325"
FT                   /product="alpha keto acid dehydrogenase complex, E3
FT                   component, lipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="Identified by match to TIGR01350 protein family HMM
FT                   TIGR01350; match to PF00070 protein family HMM PF00070;
FT                   match to PF02852 protein family HMM PF02852"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14059"
FT                   /db_xref="GOA:Q73I53"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I53"
FT                   /protein_id="AAS14059.1"
FT                   /translation="MNEYDITVIGSGPGGYIAAIRAAQLGFKTAIVEKEKNLGGICLNW
FT                   GCIPTKSLLRASEVYRLIKRSKEFGIEVKGANFDIQSIVKYSRNVVDKLSSGVAYLMKK
FT                   NNIKVHQGFGKLAGNGTIKVVSDKEEQEIVSKHIILATGVRARNLPGIEADGDLIWNAQ
FT                   HAMTPERLPKSLLIIGSGAIGIEFASFYSTLGVDVTIIEIKSTILPLEDKDISDLAQEI
FT                   FTKQGIKIYTNSSVKALTKSKDSAQVLLSSGESKEFERVIVAVGIQANIENIGLENTKI
FT                   KLSPSGFIETNEWYETSESNVYAIGDVAGPPCLAHKASHEAVICIEKIAGKNAHALKKE
FT                   CIPNCTYSHPQIASIGLTEEQAIKGGYDIKIGKFHSNFNGKSVALSETEGLVKTIIDKK
FT                   TGEILGSHMIGAEVTELISNFALAKQLEGTDFDIKSTIFPHPTISEMIHESVLAADVK"
FT   gene            complement(307331..308245)
FT                   /pseudo
FT                   /locus_tag="WD_0326"
FT                   /old_locus_tag="WD0326"
FT                   /note="transposase, IS110 family, internal deletion; This
FT                   region contains one or more premature stops and/or
FT                   frameshifts which are not the result of sequencing
FT                   error.Identified by similarity to GP:3005554"
FT   gene            complement(308729..309070)
FT                   /locus_tag="WD_0327"
FT                   /old_locus_tag="WD0327"
FT   CDS_pept        complement(308729..309070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0327"
FT                   /old_locus_tag="WD0327"
FT                   /product="transposase, IS5 family, OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14060"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IL9"
FT                   /protein_id="AAS14060.1"
FT                   /translation="MRTKYTKVKKMWADMGYQGRNLKNHIKEEYDIDIEIVKRPPCRFW
FT                   VHKDTPPELLPTREQGFKVQPRRWVVERTFAWVNRNRRLSKEYDLLTTSTENFIYLAMS
FT                   RVMLKREYA"
FT   gene            complement(309181..309561)
FT                   /locus_tag="WD_0328"
FT                   /old_locus_tag="WD0328"
FT   CDS_pept        complement(309181..309561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0328"
FT                   /old_locus_tag="WD0328"
FT                   /product="transposase, IS5 family, OrfA"
FT                   /note="Identified by similarity to GP:1256580"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14061"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IM0"
FT                   /protein_id="AAS14061.1"
FT                   /translation="MRKKYPTDLSEREWSRIEKHFRVSYKKGGRPPKYSKREILEAIFY
FT                   VLRTGCQWRYLPNDFPLWKTVYEQFRQWKKQGIFEKMNYEITKYSRRKIGRNEQPSACI
FT                   VDSQSVKTTEKGGSKAMMEVKK"
FT   gene            complement(309626..310566)
FT                   /pseudo
FT                   /locus_tag="WD_0329"
FT                   /old_locus_tag="WD0329"
FT                   /note="transposase, IS5 family, degenerate; This gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error."
FT   gene            310942..312285
FT                   /locus_tag="WD_0330"
FT                   /old_locus_tag="WD0330"
FT   CDS_pept        310942..312285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0330"
FT                   /old_locus_tag="WD0330"
FT                   /product="sodium/alanine symporter family protein,
FT                   putative"
FT                   /note="Identified by match to PF01235 protein family HMM
FT                   PF01235"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14062"
FT                   /db_xref="GOA:Q73I50"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I50"
FT                   /protein_id="AAS14062.1"
FT                   /translation="MDTVKFVLLLPTILLMLVAGVYLSIKLKWLQVFRLPYALSLLGAK
FT                   KGENKFSSIAALFTILGGNLGVGNISGTAVALKTGGPGSILWMAIIIVITSVIKYVTCY
FT                   LSIKTRKEKNERFIGGPVAYMTDAFNSRKATIVFLVIMMMVSITVGNLVQVNSLSIPLN
FT                   MIDVPVVVGGIVMAIIFFVIAALSLKKIKIFISAMIPIMTVSYLTLCGIILFKFSENIL
FT                   PSLKLITSSFFTTSSFNSGLSLGLILEMLTIIQVGTLRGIFATDIGLGLEGIVHSSIVP
FT                   KKNNNKFIIEQSLITIISPFIVAFIVFITTMVLLVTDSWVTDLESTNMCIFAFRKAMNW
FT                   PYIDYLIMAIMFCFAFTTIFTWFFCSKQTIRYVSMDNKYTKIWIVIFTMIIPLGAIGKV
FT                   RLLWDVADISIAALLFINILAILKLTSQDPEVFTMSSRYLKLQKQSYS"
FT   gene            312321..312479
FT                   /locus_tag="WD_0331"
FT                   /old_locus_tag="WD0331"
FT   CDS_pept        312321..312479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0331"
FT                   /old_locus_tag="WD0331"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14063"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I49"
FT                   /protein_id="AAS14063.1"
FT                   /translation="MISVKKDVIPVPRHWDPGILIGTKLVSIKVANLMLKHNIFDGVRE
FT                   RLDSRLE"
FT   gene            312632..315310
FT                   /locus_tag="WD_0332"
FT                   /old_locus_tag="WD0332"
FT   CDS_pept        312632..315310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0332"
FT                   /old_locus_tag="WD0332"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14064"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I48"
FT                   /protein_id="AAS14064.1"
FT                   /translation="MGTNDTQQEHIYNERIQEIFPLFDKIKKEDDPIYNARVDFNTVKF
FT                   LTKHANWNWDEEENKDKAYGVILQKCDKTKKAGQDLESEVKERLKEYVDDVAGVSIYGN
FT                   HASITLGNNKKEFKISEFLNSDFCEKNEISGFSTLHSDGKSGMHGFVAEEEGKKIRHYV
FT                   VTDGSYEMTLKWYAEGKECKIKIKIDANGVDLVKGDDFSLERLEVNRDVKIGGLFLHEI
FT                   QFREKGQGKANEMQHNKDSNELSSETTTRIDVNRGVSVQATDITQKKEDHHSHFGLQSN
FT                   SRRQSYDSGIGKDFDDKINSQEAKEKRELRQAAREANSGGQVYNLQSLFEENPQNKKTP
FT                   PPLPPRTSSLPPKKGVFDEQGGAKSGSQKPDDLRENEQTPNNQQKGATSDSSDSSTFTK
FT                   SVSHNQDNRQEDERYDNPTFGHAVPGSQKPDRSEQTPNDQQQPKTQQQEGNSKGDLLQD
FT                   IRNFKKNNLRHIDVDDRKASIAGSRKNNPSPLETLKDIIPYSSSPDNSDNQDASDAKWK
FT                   ESEQPLSATALNNKSDSGYSSPTHDNNEQSQVNPEQLEKSLENIEQSDQTPPENLLKEI
FT                   RDRSQQDNRGLRQVDPTDKLSQDKEDGLQKDDLADVKIVEGPTISVSASTPNSISDSGY
FT                   ISPTNSDSKSQTDLKQVGRKLEEHIRQSNLTLFEELKNTLGQENLGLKSADQSQISEET
FT                   KKRLREVGLLKDSSTDIKANDSGYSSPTHDNNEQSQVNPEQLKKSLENIEPKEIGDTSE
FT                   LKGALGNPDKGLREPAQQATKENIPKDSFSENILEKIGEGKQYDPIRKWLEKTVAEREN
FT                   NDTNPTVDKNSELYKLLEKDEAQLKAGVIEEERGDTLTEHTDGYDRNRIALANRNKRPL
FT                   DWAKQVAESQQKKDTNKGISI"
FT   gene            complement(315302..315898)
FT                   /gene="maf"
FT                   /locus_tag="WD_0333"
FT                   /old_locus_tag="WD0333"
FT   CDS_pept        complement(315302..315898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maf"
FT                   /locus_tag="WD_0333"
FT                   /old_locus_tag="WD0333"
FT                   /product="maf protein"
FT                   /note="Identified by match to PF02545 protein family HMM
FT                   PF02545; match to TIGR00172 protein family HMM TIGR00172"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14065"
FT                   /db_xref="GOA:Q73I47"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73I47"
FT                   /protein_id="AAS14065.1"
FT                   /translation="MTERSLNNLILASSSKRRIALLKQINIEPGLILPADIDEAPLKKE
FT                   LPKDYSIRMAKSKAEKIQSLNPNYFVLGVDTVVACGRRILLKAENVEQAEKCIRLLSGR
FT                   RHRVYTSVCLLTPDQSKQHIRTVVTIVKFKRLSEQEIKYYLASEEWKNRAGGCNIQGLA
FT                   GVFVLFLRGSYSSVIGLPLHETYCLLSNYFNFNLY"
FT   gene            complement(315876..316139)
FT                   /gene="infA"
FT                   /locus_tag="WD_0334"
FT                   /old_locus_tag="WD0334"
FT   CDS_pept        complement(315876..316139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="WD_0334"
FT                   /old_locus_tag="WD0334"
FT                   /product="translation initiation factor IF-1"
FT                   /note="Identified by similarity to SP:P73301; match to
FT                   TIGR00008 protein family HMM TIGR00008"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14066"
FT                   /db_xref="GOA:Q73I46"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I46"
FT                   /protein_id="AAS14066.1"
FT                   /translation="MIKDEKSKTIFEVEGAVTALLPAAEFRVKLDNEHEIICHVSGKVR
FT                   RSKIRIIIGDRVLVEMSIYDRNARKGRIIRRLKGTSDRTISK"
FT   gene            complement(316252..318729)
FT                   /locus_tag="WD_0335"
FT                   /old_locus_tag="WD0335"
FT   CDS_pept        complement(316252..318729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0335"
FT                   /old_locus_tag="WD0335"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14067"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I45"
FT                   /protein_id="AAS14067.1"
FT                   /translation="MIGSLAKEEKTAEAGKTGDQLEKCIGPTSLNREVYYSTLIYYTLK
FT                   ELYSQLGDISYANKTRSEKEIINFYVLPQFARFKEIIDEDIKKDPSFANSAIVKFCSSI
FT                   IKNNKLLKELEEVSIPAKNSSVKARVSFQLKNLKEKVWFLGKLKEKKNFTYVQRAFGDK
FT                   WSFYDLINDGDLKKTYIDKAVTESANKSFKEDIDKCIKLAEQGKEAASKYLGEKGVEFR
FT                   AYYTETDNTHRVLNINLINYNRSEQTRISDILQQEKDIKELNIYCNKKHEIHSHRKGKE
FT                   RYYEFKEGAYYEMKSTWPVKDGSEMCTMIMNVSSDGITEVLKFNDEDFVLSDEILELIK
FT                   QNDELYIQGLSLYDAVLEKGKAADVVPTANNNFQNESIAAYREEPEGELDPKVDADNSL
FT                   PPSINSNASTQTEVNLQHTETQTEVASQQIETKTEVNLQHTGTQTEFASQQMDELILNN
FT                   QMLSEKNVELKQEMSNLKKEAVELKQKIEAGLQVINKKHHELIQENQRLQEKLETTQAE
FT                   ANQTIVKLEKQNSNLQDRFEKEEQKNTELQTELAQKNEELAGVLKELQGKAQELKGVYE
FT                   EKRKLKEELKIVNAGKKNLEKELNQAREDAEQIMVERRQQKERLKDQLRELDQEYKVQV
FT                   EIEQKIKESDRQDSDLQDTLGEERLKLNIEELENEYEEFPGDKVLTLKLTKDEDKVEEL
FT                   RNELEREKEKCKQLLEEENEWGDELVGMLDGLEEKIRADEQRSFNNQLTGEISNESGNA
FT                   PRQKKRLSKSSSVDNESYVPLREKTTLLRSLSVDSGLDSDEENCDNDLSFNISPISSIE
FT                   KVAESRNVGRVSL"
FT   gene            complement(318981..319733)
FT                   /pseudo
FT                   /locus_tag="WD_0336"
FT                   /old_locus_tag="WD0336"
FT                   /note="transposase, IS5 family, degenerate; This gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error.Identified by similarity to GP:1256580"
FT   gene            complement(319813..321090)
FT                   /gene="purA"
FT                   /locus_tag="WD_0337"
FT                   /old_locus_tag="WD0337"
FT   CDS_pept        complement(319813..321090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="WD_0337"
FT                   /old_locus_tag="WD0337"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="Identified by similarity to OMNI:NTL02ML2990; match
FT                   to PF00709 protein family HMM PF00709; match to TIGR00184
FT                   protein family HMM TIGR00184"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14068"
FT                   /db_xref="GOA:Q73I44"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73I44"
FT                   /protein_id="AAS14068.1"
FT                   /translation="MNNIVIVGLQWGDEGKGKIVDYLSENADVVVRFQGGNNAGHTIVV
FT                   DDEVYKLNLLPSAVLRPGKISIIGNGVALDPHALISEIESLKVKGVDVNYNNLMVSESC
FT                   PLILSIHKDKEKLFEDLNGNHKIGTTNKGIGPCYEDKVGRRAIRLCDLENADELNKRVD
FT                   ILLNYHNAIRKGLNYQVVKKEEILKEIQEISEKILSYKKPVWKILNDLMKEGKKIIFEG
FT                   AQGAFLDIDHGTYPFVTSSNTVASQAITGSGLSSNAYIIGVVKAYTTRVGNGPFPTEQK
FT                   NEVGDSLFTIGKELGTVSNRRRRCGWFDAVLVRQAVQLSGVSSIVLTKLDVLNSFDTIK
FT                   ICTGYKYSGKMYDYLPASHSIQGELEPIYEEFPGWKENTQGKRSIETLPINLIKYIEGL
FT                   EKLIGVPIHLISTSPKREDVIKLKDF"
FT   gene            321271..322866
FT                   /locus_tag="WD_0338"
FT                   /old_locus_tag="WD0338"
FT   CDS_pept        321271..322866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0338"
FT                   /old_locus_tag="WD0338"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14069"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I43"
FT                   /protein_id="AAS14069.1"
FT                   /translation="MKETKGKNNKSPVVRLKATAKEFNFSKLRADQDNKLANSGETMFL
FT                   DFQRMNFIINGKEIDKNLIIAFKEGAKHRKSELFNSDDIYNDEIFNKKGTREIDTDHGK
FT                   AFVASVLEDIEKELVSNALGELWKNHCENSKTANHQKTDSYKKEFEEFYNAGQRYIHLL
FT                   PTEKDENKDYRSFAKEVFKKMFRYAGAEVPSDAILEELVTNCNQAGYEAAPFIQTQLAL
FT                   GQSFIVENPKKVINIDCANQNNVRIRSDMRLPILSVKNQVMHGDKICNLSSSLEFTIES
FT                   HNGEDFVTYRDGKLSLTTPKELKNYKDNGKSLFDIIKEYFQKFCAKLGFKPETKIQIEH
FT                   GFGAQSNYLDGTISTTGSDANEEFINLLSENLRERLLGSGVALEDEDVDDVVEVRVSTV
FT                   IDLLSDYAKLEDNKEHRELLISKVADNLGLSTQDKTAPEVLMELGSLPSLTKGQVNHNQ
FT                   VQSVVNTFIKLIIEGKSEVYKKGGAINAIHKEIDKAIVEQEKKATNKQDIENDKWTDRI
FT                   KKQNYSAESHEHLP"
FT   gene            complement(322918..323334)
FT                   /pseudo
FT                   /locus_tag="WD_0339"
FT                   /old_locus_tag="WD0339"
FT                   /note="conserved hypothetical protein, authentic point
FT                   mutation; This gene contains a premature stop which is not
FT                   the result of sequencing error.Identified by similarity to
FT                   EGAD:16011"
FT   gene            complement(323343..324053)
FT                   /gene="ccmC"
FT                   /locus_tag="WD_0340"
FT                   /old_locus_tag="WD0340"
FT   CDS_pept        complement(323343..324053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmC"
FT                   /locus_tag="WD_0340"
FT                   /old_locus_tag="WD0340"
FT                   /product="heme exporter protein CcmC"
FT                   /note="Identified by similarity to EGAD:10853; match to
FT                   TIGR01191 protein family HMM TIGR01191; match to PF01578
FT                   protein family HMM PF01578"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14070"
FT                   /db_xref="GOA:Q73I42"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I42"
FT                   /protein_id="AAS14070.1"
FT                   /translation="MFLLKPTNFSYFSKKALPWLGVICFACFLIGMSLALFFSPEDYKQ
FT                   GEIVRIMYIHVPSAWLALGIYGLIASLGFISLVWNNSIASVLAHAAAPAGTVFSAICLI
FT                   TGSIWGKGTWGTWWVWDARLTSMLILFFLYVGYLSLWSAFDNEARAEKSAAVFAIFSAI
FT                   NIPIVKFSVNLWSTLHQPASILRKGGIAIESSLLLPLVAMFMFCATFFLVVWILYSLYL
FT                   INLYKIKREISMRY"
FT   gene            324189..325019
FT                   /locus_tag="WD_0341"
FT                   /old_locus_tag="WD0341"
FT   CDS_pept        324189..325019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0341"
FT                   /old_locus_tag="WD0341"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to EGAD:162943; match to
FT                   PF03618 protein family HMM PF03618"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14071"
FT                   /db_xref="GOA:Q73I41"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026565"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73I41"
FT                   /protein_id="AAS14071.1"
FT                   /translation="MTLKKLNLHLVSDSSGETVISVAKSALKHFRSVETIEYVWSFVKG
FT                   EEQIDKILEEINRKSDEHNFVICTITDDELRKYLKDNCIKLKIPYRAILSHIIREISSY
FT                   LEIEKDEKLDLHTEINNEYFQRIEAINYTINHDDGQNIQDIDKADIILVGVSRTSKSPT
FT                   STYLAYRGYKVANIPFVSGVPFYVDLAKLKNKLTIGVTIDVSRLIEIRKNRLTSINNED
FT                   NNIYANPEKVEKEIKEAEELFKQNNWPIIDVTQKSIEEVSATIIQYFNKMLSID"
FT   gene            325069..325197
FT                   /locus_tag="WD_0342"
FT                   /old_locus_tag="WD0342"
FT   CDS_pept        325069..325197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0342"
FT                   /old_locus_tag="WD0342"
FT                   /product="ribosomal protein L36"
FT                   /note="Identified by similarity to OMNI:CC3321; match to
FT                   TIGR01022 protein family HMM TIGR01022"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14072"
FT                   /db_xref="GOA:Q73I40"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73I40"
FT                   /protein_id="AAS14072.1"
FT                   /translation="MKVKGSLKSHRNRDKNCKVVKRGGKIYIINKVKPRCKARQGS"
FT   gene            325247..325561
FT                   /locus_tag="WD_0343"
FT                   /old_locus_tag="WD0343"
FT   CDS_pept        325247..325561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0343"
FT                   /old_locus_tag="WD0343"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to EGAD:163222"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14073"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I39"
FT                   /protein_id="AAS14073.1"
FT                   /translation="MLISKKKQKLLCLSAALLISSLTLYFSISTITGKRGLLTLIDLKK
FT                   EIEYNKLLLKDVSSEKEKLDNKVFGLYEKSLDLDLLDEQAKNALGYVNPNELMVVLDVE
FT                   "
FT   gene            325641..326738
FT                   /pseudo
FT                   /locus_tag="WD_0344"
FT                   /old_locus_tag="WD0344"
FT                   /note="transposase, IS3 family, degenerate; This gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error.Identified by similarity to EGAD:43417"
FT   gene            complement(326839..327921)
FT                   /locus_tag="WD_0345"
FT                   /old_locus_tag="WD0345"
FT   CDS_pept        complement(326839..327921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0345"
FT                   /old_locus_tag="WD0345"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="Identified by similarity to GP:3004983; match to
FT                   TIGR01730 protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14074"
FT                   /db_xref="GOA:Q73I38"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I38"
FT                   /protein_id="AAS14074.1"
FT                   /translation="MQLFLTRLINKFYCLKMRNKVIIISSIAFILLFFISSAFLKKDQA
FT                   VHSDNATSSFSVKTQECAPQNRTIYLNFSGTVNPLHRASLVSKISGKIIAIYLPDGEKV
FT                   KRDDVVLKIEDYDRIEQAQKAKALLKQREIEYDSSHKLNKKGYGAQIQVEAAFTALQSA
FT                   KADLKRLELDLENTAVTSPIDGYIDKINANEGDFVNAGQKIADVVNFDQILVVLYVSEN
FT                   EVNKIELGSTAQINLLDGKELAGEVSFISKIAEPKTGSYRVEVKVTNNKMISLQGLTAN
FT                   VRLPSGERFAYKVPSSALSLSDEGALGIKIVDDNNYVVFAPIEIVDHESDGVWIVANNE
FT                   DKPIKLIVLGHLFVKPGDKV"
FT   gene            complement(328123..329205)
FT                   /locus_tag="WD_0346"
FT                   /old_locus_tag="WD0346"
FT   CDS_pept        complement(328123..329205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0346"
FT                   /old_locus_tag="WD0346"
FT                   /product="Fic family protein"
FT                   /note="Identified by similarity to OMNI:NT01MC4477; match
FT                   to PF02661 protein family HMM PF02661"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14075"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I37"
FT                   /protein_id="AAS14075.1"
FT                   /translation="MNWKNFRLSTRLNLEGPVIEQVYELITAVDSVKNSWQITKKLLPQ
FT                   TIERLTHSVIVTSSGASNRIEGNRLTDKEVEDLYKNLRVKKFKNRDEQEIAGYLEMLTL
FT                   IFHDYTDIPISESSILHINNQMLLYSEKDLYHRGKYKASSNRVEAKDQNGKVVGIIFDP
FT                   TPPYLVRKEVQELIDWYHWSLNNKFKHPLIIIANFVFEYLAIHPFQDGNGRTSRLMTNL
FT                   MLLQQGYDFVSIVSHEKIIETNKLDYYLALNKTQSSWKSGKEDISPWLIFFLNVLKTQA
FT                   NEAHYILERENTEYLLSRKQLFFWEWALSLADKEFSRKDAIEALGFPPRTVEAITKKLL
FT                   GMKYLQRLGEGKATRYKVII"
FT   gene            329248..329376
FT                   /locus_tag="WD_0347"
FT                   /old_locus_tag="WD0347"
FT   CDS_pept        329248..329376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0347"
FT                   /old_locus_tag="WD0347"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14076"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I36"
FT                   /protein_id="AAS14076.1"
FT                   /translation="MIKVNSKLYMHSRANYKNYTFSSDPNHIKNYRAKLLEEGLIS"
FT   gene            complement(329443..331191)
FT                   /gene="dnaG"
FT                   /locus_tag="WD_0348"
FT                   /old_locus_tag="WD0348"
FT   CDS_pept        complement(329443..331191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaG"
FT                   /locus_tag="WD_0348"
FT                   /old_locus_tag="WD0348"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /note="Identified by similarity to SP:P30103; match to
FT                   TIGR01391 protein family HMM TIGR01391; match to PF01807
FT                   protein family HMM PF01807; match to PF01751 protein family
FT                   HMM PF01751"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14077"
FT                   /db_xref="GOA:Q73I35"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I35"
FT                   /protein_id="AAS14077.1"
FT                   /translation="MDHIDIIKSKLLLSDLVGKKVRLIKRGDSFVGLCPFHNEKTPSFS
FT                   VSNTKGLYYCFGCLASGDAFEFISQTEGLSFKEALEKLASVTGVELPKNLSITKEDNKL
FT                   FLALDLAANWFAQKNQGVVDYLKQRKILPKIIDKFKIGYAPSSGLKEYLNSSGIEDKIL
FT                   IDIGLVNKNFHDYFYDRLIFPIQSIAGRVIGFGGRALSSEQQPKYLNSPESQLFKKREN
FT                   LYGLNFALSEIRKKQHILVVEGYMDAIALHQAGISNAVAPLGTAISAEQIKNLWRFAKE
FT                   ISICMDGDSAGRHAATRVAELALLILEPGYTLKFVTLPSNKDPYDICNELEYKKEDVLT
FT                   ALDHSTKLHSEYLWHHIIDSNLQNYEKLAPEKYSILEHKFMEYVNTISNSSIRRYYRDY
FT                   FYNKASELRSSFKKQIFNSKTRATKGEYLHNKSPELIEAEQNQAVILRIAVEFPEILNR
FT                   PIFFEQFSHFEFTNEMKRLQQRIIDVISNKSNLDKEALLQELKQFNVIKYVFEKTSVLN
FT                   SQLNERKSAEIVWNNIVLLKELNALRKERTEARLSGNLDLEERLIEQIKQIESSIQEMQ
FT                   MEFIEK"
FT   gene            331900..332004
FT                   /locus_tag="WD_0349"
FT                   /old_locus_tag="WD0349"
FT   CDS_pept        331900..332004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0349"
FT                   /old_locus_tag="WD0349"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14078"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I34"
FT                   /protein_id="AAS14078.1"
FT                   /translation="MPKHWDDTLPGGDYSQITMFVQLWNELRYDVGKP"
FT   gene            332092..333267
FT                   /locus_tag="WD_0350"
FT                   /old_locus_tag="WD0350"
FT   CDS_pept        332092..333267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0350"
FT                   /old_locus_tag="WD0350"
FT                   /product="3-demethylubiquinone-9
FT                   3-methyltransferase/sugar-phosphate isomerase family
FT                   protein"
FT                   /note="Identified by similarity to EGAD:163398; similarity
FT                   to EGAD:164595; match to TIGR01983 protein family HMM
FT                   TIGR01983; match to TIGR00689 protein family HMM TIGR00689;
FT                   match to PF02502 protein family HMM PF02502"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14079"
FT                   /db_xref="GOA:Q73I33"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I33"
FT                   /protein_id="AAS14079.1"
FT                   /translation="MLGIVSIASDHAGYELKSEIKPYLEALGYRVVDQGCTAKQKCVDY
FT                   PNYAVKVVEDITSKKANYGILICGTGLGMSTVANRFEGIYAALCNSVEIAKLAREHGNA
FT                   NVLCLGAGFTASGLAKDIVKQFLETEFSKESRHKKRLDKLSNITSKKKKTKTYNEDEIS
FT                   KFAKMAGQWWDENGKFKPLHIMNPVRVSYIIEKIKELKKCNLKELSLLDVGCGGGILSE
FT                   SMARVGINVVGIDVCEENIKVAHSHAKKVGLNIEYIHTSIEELSNDKKYDVVLLMEVVE
FT                   HVDNLELFMKKAIELLKPEGLIFISTINRTIKSFCLAIIGAEYILNWLPKGTHNWNKFL
FT                   KPSEIANHLRENNVTLQNMAGMEYNVIKREWNLTKGVDVNYILCGLLDLTL"
FT   gene            complement(333279..333719)
FT                   /locus_tag="WD_0351"
FT                   /old_locus_tag="WD0351"
FT   CDS_pept        complement(333279..333719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0351"
FT                   /old_locus_tag="WD0351"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14080"
FT                   /db_xref="GOA:Q73I32"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I32"
FT                   /protein_id="AAS14080.1"
FT                   /translation="MIIERTMRNFLVILFIVFYAFDAHADGATDVMCNVIGYVHGIGGP
FT                   MITVVIIGSSLLAIFGRMPWPALFALGMFVAVFFGAPQIVTKVTEKEVCCLFKGQTLEN
FT                   GKCVAAPGYERVGTGYACRSGWALTNKGYCIKAGQDPSKYWK"
FT   gene            333859..335496
FT                   /gene="metG"
FT                   /locus_tag="WD_0352"
FT                   /old_locus_tag="WD0352"
FT   CDS_pept        333859..335496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metG"
FT                   /locus_tag="WD_0352"
FT                   /old_locus_tag="WD0352"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /note="Identified by similarity to EGAD:150274; match to
FT                   TIGR00398 protein family HMM TIGR00398; match to PF00133
FT                   protein family HMM PF00133"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14081"
FT                   /db_xref="GOA:Q73I31"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I31"
FT                   /protein_id="AAS14081.1"
FT                   /translation="MEQFENFYITTPVYYVNDKPHIGHAYTSLLCDVVARFMKLAGKNV
FT                   KFTTGTDEHGQKIEKAAKAKEMQPKEFTDEVSVSFKELAKFMNFEYDDFIRTTEERHKK
FT                   AVIALWNRLEERGQIYLDSYSGWYSVRDEAFYQESELIDGKAPTGAEVQWIKEESYFFR
FT                   LSNWQEKLLELYKNQPSFIFPESRRNEVISFVRSGLIDLSISRTSFNWGIKVPGNGKHV
FT                   IYVWIDALTNYLTSIGFPSTEGEEYKRFWAEPETQIPVSSTGMTPNQGKTQIPVSSAAN
FT                   LADNSFNVHVIGKDILRFHAVYWPAILLAADLPLPKQIAVHGWWLNEGEKISKSLGNVI
FT                   DPIGLAQEFGVDQLRYFLLREASFGQDGNFSKKNMISRINSELANNIGNLVQRTISFLH
FT                   KQCSGIVPTIDQSLLKGEESLPGCKAILDQVMNHLSKYEFNHIILLIINISSEANAYID
FT                   KSAPWTLSKTDRERMNLVIYKLLEYIRIIGILLQPIVPKSAEMILNQLQIPKEQRDLKS
FT                   LCDACVSSGITLPKPTPVFLRVDAKEEK"
FT   gene            complement(335570..336754)
FT                   /locus_tag="WD_0353"
FT                   /old_locus_tag="WD0353"
FT   CDS_pept        complement(335570..336754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0353"
FT                   /old_locus_tag="WD0353"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14082"
FT                   /db_xref="GOA:Q73I30"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I30"
FT                   /protein_id="AAS14082.1"
FT                   /translation="MVLYFIIREMMNKNNVPYYIAGTLAALTLLASGVFAAAPYIGFLA
FT                   PVAALSVGLPFIIGGAVFSAVAIALSYQAISENKTNSELKNKMKAQEQTISGQKTQLAK
FT                   KEAEVKAKEEENSKLKNKVEAQEEENSKLKDQVRTQKQKSSEQKTQLAEKNKKIEEDKL
FT                   KVAIADGTVQLAKGTVNSAVWFAKEAVNGVLYSGKYAYDNYVPSTESTKGTLSGIGGGL
FT                   KNTYDASIASVRGALNSVGSSLYSRIYGTKVSSPEEQFKREDGSKPSMQELTRLDYLNL
FT                   EVLSSEQKQRANSLDYLNIDNVPKQPDHLNVDAAKSYLMSLSEDQDVFYDAESGDEKGT
FT                   EISSPESQPTKEENGQGWFAWSLGKVKSAITEVVVIGADVTKPYCAKVTKALAT"
FT   gene            complement(336842..338293)
FT                   /gene="dnaB"
FT                   /locus_tag="WD_0354"
FT                   /old_locus_tag="WD0354"
FT   CDS_pept        complement(336842..338293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="WD_0354"
FT                   /old_locus_tag="WD0354"
FT                   /product="replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="Identified by match to TIGR00665 protein family HMM
FT                   TIGR00665; match to PF03796 protein family HMM PF03796;
FT                   match to PF00772 protein family HMM PF00772"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14083"
FT                   /db_xref="GOA:Q73I29"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I29"
FT                   /protein_id="AAS14083.1"
FT                   /translation="MNELANLLSSRSVDKEICKLPHNLEAEQMLIGAMIRDNRICDAVE
FT                   DTITAENFYDPLHQSIFTQISKTRKHGIVANELSLKMFFENDQAFTECGGVEYLAKLAA
FT                   KASIALDIYSLTRIIRDTYLRRCLIKLGQEIVGDSYNYDIENPAQAQIEQAMTKLFNLA
FT                   VKKQGEKTYIKLASSIKDVVEKISTLKNNPEALGVTTGLQDLNQLLGGLQKSDLLILAA
FT                   RPSMGKTALALNIALNACKMLQKRADKQHYVAFFSLEMSAEQLTARLITIDSGISYYKA
FT                   LTGRISDFELHEFINTSTELSELPFIIDDTPALSISALRTRIRLLYQLYNVEVVFIDYL
FT                   QLIRGTTKRSNENRVQEISEVTQGLKAIAKELNIPIVALSQLSRSVEQRDDKKPQLSDL
FT                   RDSGSIEQDADIVMFLYREEYYELRKQPSEGNNKHREWQEKMEKIRNIAELVIAKQRNG
FT                   PIGSVKLYFDSNRGAFKDYTERHSS"
FT   gene            338408..338490
FT                   /locus_tag="WD_tRNA-Leu-3"
FT                   /old_locus_tag="tRNA-Leu-3"
FT   tRNA            338408..338490
FT                   /locus_tag="WD_tRNA-Leu-3"
FT                   /old_locus_tag="tRNA-Leu-3"
FT                   /product="tRNA-Leu"
FT   gene            338515..339111
FT                   /locus_tag="WD_0355"
FT                   /old_locus_tag="WD0355"
FT   CDS_pept        338515..339111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0355"
FT                   /old_locus_tag="WD0355"
FT                   /product="conserved domain protein"
FT                   /note="Identified by similarity to OMNI:VC0842"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14084"
FT                   /db_xref="GOA:Q73I28"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I28"
FT                   /protein_id="AAS14084.1"
FT                   /translation="MLHKFFNRLFSIFSSINVIQKVKKDENGICYVTGLRRYISVLLDL
FT                   IIIVLFLQFCGQAFNQLFTNSEDSKIFSQVAAKSPMQVPLSIEEKAMQSRLVKLMILNQ
FT                   IVQFIMLFCYVIYMWVKFATTPGKLLFGLRVVDAQTFEKMTLKQATKRFFSFILSVAPL
FT                   FLGFLWSNFNKRCQTWHDKIAGTVVVTSKSLRRQS"
FT   gene            339801..339947
FT                   /locus_tag="WD_0356"
FT                   /old_locus_tag="WD0356"
FT   CDS_pept        339801..339947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0356"
FT                   /old_locus_tag="WD0356"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14085"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I27"
FT                   /protein_id="AAS14085.1"
FT                   /translation="MTPFAVFKNECSYNCASCALLNILLKNLISYYTRDKQFIDDEKLQ
FT                   KGA"
FT   gene            339922..340596
FT                   /gene="radC"
FT                   /locus_tag="WD_0357"
FT                   /old_locus_tag="WD0357"
FT   CDS_pept        339922..340596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radC"
FT                   /locus_tag="WD_0357"
FT                   /old_locus_tag="WD0357"
FT                   /product="DNA repair protein RadC"
FT                   /note="Identified by similarity to SP:P25531; match to
FT                   TIGR00608 protein family HMM TIGR00608; match to PF04002
FT                   protein family HMM PF04002"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14086"
FT                   /db_xref="GOA:Q73I26"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I26"
FT                   /protein_id="AAS14086.1"
FT                   /translation="MKNYKKGHRKRLREKIILDNGQSLLDYEVLEHILYSAYSRIDVKP
FT                   VAKSLIESFGSLNKVFNADLEALQNVDDVSNAAISAIFCVKQAFVRSAREEIKNLPVID
FT                   NWEKLLDYLRISIGSLNKENFRVIYMNKKYRLIAEDLQNIGTVDQTPLYVREIIKRALL
FT                   IGSTSIVISHNHPSGDTQPSNSDISLTRQLAEACQSIGIELIDHIIITFSSYFSFKENR
FT                   LL"
FT   gene            340874..341164
FT                   /locus_tag="WD_0358"
FT                   /old_locus_tag="WD0358"
FT   CDS_pept        340874..341164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0358"
FT                   /old_locus_tag="WD0358"
FT                   /product="endo/excinuclease amino terminal domain protein"
FT                   /note="Identified by similarity to OMNI:CC1343; match to
FT                   PF01541 protein family HMM PF01541"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14087"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I25"
FT                   /protein_id="AAS14087.1"
FT                   /translation="MKLSYIYILTNKANSTLYIGVTANLIKRIWEHKNKIVSGFTSRYN
FT                   VNKLVYFEEFEDISLAIARERRLKEWPRQWKINLINQKNPSWIDLYYLALR"
FT   gene            complement(341471..344740)
FT                   /locus_tag="WD_0359"
FT                   /old_locus_tag="WD0359"
FT   CDS_pept        complement(341471..344740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0359"
FT                   /old_locus_tag="WD0359"
FT                   /product="helicase, UvrD/Rep/AddA family"
FT                   /note="Identified by match to PF00580 protein family HMM
FT                   PF00580; match to TIGR01612 protein family HMM TIGR01612"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14088"
FT                   /db_xref="GOA:Q73I24"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I24"
FT                   /protein_id="AAS14088.1"
FT                   /translation="MYNAILVNFYKVLALLMRSNAINPNFSVWVNASAGTGKTKILIDR
FT                   VLRLLLENKRNILCLTFTNAAANEMENRIHSILSKWAICSDSVLAADLEQLDFFPMSSQ
FT                   CVTLGSRKNKDYLTRARRLFSELENLGLTIQTIHAFCYKLISSFPIEAGIAPNCTLSEC
FT                   KELHSIIFNKVLHNETVQDDINLIATEIDENKLRDLLYTLCVKRSASANDSKYIKDKLS
FT                   APDEIHDLQSETIEHVERLAEILSEGSKRDQSYSEILYSTVIPAGIQKKRTSVTRWNDT
FT                   KVENLAKVFLKSESHEKKSISSIATKSILEKFKDAEQIIESVQNVVFTHIRDMNSYQIF
FT                   KRTSSLLGVFKVYVDLYNSEKSKNALLDYNDIINLATNLLSNPNYKDWILFNLDQKIDH
FT                   ILVDEAQDNSISQWKIITNLCDEFFAGNDEKRTLFVVGDVKQSIYRFQGANPHLFNYMQ
FT                   QYFHTKTGGRDWISCQLEKSFRSTPEVLMLVDRIFNNFRAEISFNDNEIKHVPHRENDQ
FT                   GYIEIWPALPRRKEKEQQALQIPLTCRENYIIADRLLAQTIANRIHNWLNEGRILVAKD
FT                   RHIEPRDIMILVRQRNVLVDYIISELKKANVPVVGRDYFRIMDYIAVQDLIALAEFLLL
FT                   QANDLALANALKSPLFNFTEDDLFNIAYDRKEHSLWERIQDYSVVIYSELNYLINLSRI
FT                   ESPLALFTHILRTGKKKFAARLGLECFEVLDEFMNLVLQFENPSLQAFVQWIKENNPEI
FT                   KNDMQSERNAVRIMTIHKSKGLQAPIVFLVDTNTVPRNSESIIFDGTEVPFWCGKNNNA
FT                   YCDQVKREKKLEDYNEYLRLLYVALTRAEDELYILSKEPVQKGSWYDLITKYGEPYEKK
FT                   QRDLQPIFKEKVEVLCVNANYPYIYKKRDYFDVPVISLPPALAHSSVSSQRVTLESSEK
FT                   EGAEWIPVSATWMTDGYARGLIIHSILQYMPKIEKERRKNWVRKYLDNISEDKDEIYSK
FT                   ILAFNEKYGYLFDLEGKSEITLSGTIDGKSVLVRLDRLCITQDKAIIIDYKSHRNVSVS
FT                   LLNEIKKQMLIYKTLVQEIYPNKQVECVVIWVEDLTIQSDF"
FT   gene            344774..345640
FT                   /gene="ispE"
FT                   /locus_tag="WD_0360"
FT                   /old_locus_tag="WD0360"
FT   CDS_pept        344774..345640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="WD_0360"
FT                   /old_locus_tag="WD0360"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /EC_number="2.7.1.-"
FT                   /note="Identified by match to PF00288 protein family HMM
FT                   PF00288; match to TIGR00154 protein family HMM TIGR00154"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14089"
FT                   /db_xref="GOA:Q73I23"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73I23"
FT                   /protein_id="AAS14089.1"
FT                   /translation="MKSFCVKAPAKINLFLHVVDKKETGYHLIEGLFVFANLSNFLEIK
FT                   VGEKDSRYDNSTVEFINSESKINNQYNTVMKAVNLLLRHAPVRTKVTVKVVKNIPIAAG
FT                   LGSGSSDAGAVVRTLGKLWEIDRTILNEIALNVGADVPASVDSKPVFVRGIGEELCHIK
FT                   KFSLPTNVVLVKPKKRFLSTPEVFSKHEGKFSEPIKWSDDAEKDLLKFLKETRNDLQEI
FT                   AISFVPEIKDVISTLKSQEGSILSRMSGSGVSCFGIFDSEENAKAAAVNIGKKQPEWWV
FT                   CNTQLIV"
FT   gene            345644..346009
FT                   /locus_tag="WD_0361"
FT                   /old_locus_tag="WD0361"
FT   CDS_pept        345644..346009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0361"
FT                   /old_locus_tag="WD0361"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to GP:15156648"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14090"
FT                   /db_xref="InterPro:IPR007523"
FT                   /db_xref="InterPro:IPR036748"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I22"
FT                   /protein_id="AAS14090.1"
FT                   /translation="MDITPLISENKNLINGYREGKFLVNNQEYCGSIIIFPEKVIKLKE
FT                   SDINSKEYFESFLTEEIEILLIGTGKTRNILSSSVKSYLMEQKGLNFEFMTTGSACRTH
FT                   NILISEDRFVVSYLIAI"
FT   gene            346011..346811
FT                   /locus_tag="WD_0362"
FT                   /old_locus_tag="WD0362"
FT   CDS_pept        346011..346811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0362"
FT                   /old_locus_tag="WD0362"
FT                   /product="cation ABC transporter, permease protein,
FT                   putative"
FT                   /note="Identified by match to PF00950 protein family HMM
FT                   PF00950"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14091"
FT                   /db_xref="GOA:Q73I21"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I21"
FT                   /protein_id="AAS14091.1"
FT                   /translation="MLTQDFFINSLVAVVVISLVTGALGSFMIWQRLSYLGDSLSHSSL
FT                   LGVALALIFKISPSLSIMLIAITFAILLSLNFNRLYSADTILNIVTNVVLSSSLILMSF
FT                   LPSGNNSIISSLFGDILTLDQSDIVLIFLTSAVVTLILIFRWRYWLMISINQDLAVVEK
FT                   INVTFVRLEFLITLAIFIAIAAQLIGILLIAAFLLIPAASARLISKTPMQMIIVATVFS
FT                   VISGISGLMLSASFDLLTGPAIILVAAVYLIIAYFIRLVLSRLA"
FT   gene            346943..347122
FT                   /locus_tag="WD_0363"
FT                   /old_locus_tag="WD0363"
FT   CDS_pept        346943..347122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0363"
FT                   /old_locus_tag="WD0363"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14092"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I20"
FT                   /protein_id="AAS14092.1"
FT                   /translation="MSEEGFFSKYISQPVKKFYNYITGKTEESDDVAGDVHNIAQGDSE
FT                   SLDTHVQSNENDII"
FT   gene            347128..348120
FT                   /locus_tag="WD_0364"
FT                   /old_locus_tag="WD0364"
FT   CDS_pept        347128..348120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0364"
FT                   /old_locus_tag="WD0364"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to EGAD:163256"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14093"
FT                   /db_xref="GOA:Q73I19"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I19"
FT                   /protein_id="AAS14093.1"
FT                   /translation="MRVTPSKVKKFLEKPDALRGVLIHGSDNSRVDFYVQEIIANLGEY
FT                   SVQVMDFAIVNKSPSLLFSELANVSMFTSKKLIKLINVSGGISKELKNVLDYNASGHYV
FT                   MMVANDLPYNSATKSYMESSKIFGVIACYKDSNSNLYDIISSYLKQNDIKCTNEIIYHL
FT                   QSYFNHSKLPICSELEKLVLYLGERKDLKLTDIELCFSTSGNDYATLDDLCSAIASKDM
FT                   SRFIRISDALISQENFSPIALIRIISNYFLRLENVLLSVQGGMSEQAAIDQLSPPLFFK
FT                   QLQSFKSHLKSLQLSELKKILEKLISLEVTCKKTDLDHKMIFQHALTGS"
FT   gene            348290..349336
FT                   /locus_tag="WD_0365"
FT                   /old_locus_tag="WD0365"
FT   CDS_pept        348290..349336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0365"
FT                   /old_locus_tag="WD0365"
FT                   /product="Fic family protein"
FT                   /note="Identified by similarity to OMNI:NT01MC4477; match
FT                   to PF02661 protein family HMM PF02661"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14094"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I18"
FT                   /protein_id="AAS14094.1"
FT                   /translation="MFDISKIVITPEMLKLVAEIDEFKGAWQLFGNLAPERLQMLKKIA
FT                   TIESIGSSTRIEGARLSDREVEQLLSKLDTRSFRSLDEREIAGYAYVCEEVFQNFNKMP
FT                   FTENTIKQFHIWLLQFSYKDQRHMGEYKKFPNHVEAFDESGKSLGIVFETASPFETATQ
FT                   MQELIYWTSQQLEVKSLHPLLIIGIFIVTFLAIHPFQDGNGRLSRILTTFLLLKLGYIY
FT                   VPYSSLESIIESNKESYYLALRRTQQSLKTSSYDFNPWLIFFLRSLQKQKFHLEQKVSH
FT                   EKVLNLYLPPLSAKVLALLSKHGRLTIKDLENITKANCNTLKKHVSNLVKSNHITQHGK
FT                   GKATWYVI"
FT   gene            complement(349374..349472)
FT                   /locus_tag="WD_0366"
FT                   /old_locus_tag="WD0366"
FT   CDS_pept        complement(349374..349472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0366"
FT                   /old_locus_tag="WD0366"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14095"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I17"
FT                   /protein_id="AAS14095.1"
FT                   /translation="MSGHWDDKNRALGSSGLKLQCLYSCDLYSIAE"
FT   gene            complement(349501..349602)
FT                   /locus_tag="WD_0367"
FT                   /old_locus_tag="WD0367"
FT   CDS_pept        complement(349501..349602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0367"
FT                   /old_locus_tag="WD0367"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14096"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I16"
FT                   /protein_id="AAS14096.1"
FT                   /translation="MLLFLSSQCVTLGSSLYYLVEIKFSGSQCQLLS"
FT   gene            349682..349894
FT                   /locus_tag="WD_0368"
FT                   /old_locus_tag="WD0368"
FT   CDS_pept        349682..349894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0368"
FT                   /old_locus_tag="WD0368"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14097"
FT                   /db_xref="GOA:Q73I15"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I15"
FT                   /protein_id="AAS14097.1"
FT                   /translation="MTVVRVSSQCPDTGIQKSLLVSKQTSIEKRFRLDCRKARFQTGMT
FT                   SFTMYHIAIVVVKALGSEIAVFVQL"
FT   gene            349909..350022
FT                   /locus_tag="WD_0369"
FT                   /old_locus_tag="WD0369"
FT   CDS_pept        349909..350022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0369"
FT                   /old_locus_tag="WD0369"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14098"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I14"
FT                   /protein_id="AAS14098.1"
FT                   /translation="MTELKKRPNILNKRKKLYENQSWSNRLLRQNGQKNTQ"
FT   gene            349961..350746
FT                   /gene="dapB"
FT                   /locus_tag="WD_0370"
FT                   /old_locus_tag="WD0370"
FT   CDS_pept        349961..350746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="WD_0370"
FT                   /old_locus_tag="WD0370"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="Identified by similarity to OMNI:NTL03PA04760; match
FT                   to TIGR00036 protein family HMM TIGR00036; match to PF05173
FT                   protein family HMM PF05173; match to PF01113 protein family
FT                   HMM PF01113"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14099"
FT                   /db_xref="GOA:Q73I13"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73I13"
FT                   /protein_id="AAS14099.1"
FT                   /translation="MKIRVGVIGCLGRMGKKILNELITNTKVEIAGAVARSGSKYIDSD
FT                   IGPIIANLGIKVTSSISGIFESSDVVIDFTTKECMLDCLKAAVKFKTPLVSGTTGIEGV
FT                   DLKEYAAEVPILWSANMSVGVNVLLKLVKKAAELLGNEYDVEIWEMHHNLKKDSPSGTA
FT                   IELGKTIANASKVDFQSNQYLHSGSNIRKKGGIGFAVSRGGGVIGDHSVMFVNSDERIE
FT                   LNHKAIDRTTFARGAVQAAVWLYENKREIPGLYSMQDVI"
FT   gene            350743..351501
FT                   /gene="pstB"
FT                   /locus_tag="WD_0371"
FT                   /old_locus_tag="WD0371"
FT   CDS_pept        350743..351501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="WD_0371"
FT                   /old_locus_tag="WD0371"
FT                   /product="phosphate ABC transporter, ATP-binding protein"
FT                   /note="Identified by similarity to EGAD:43631; match to
FT                   PF00005 protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14100"
FT                   /db_xref="GOA:Q73I12"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I12"
FT                   /protein_id="AAS14100.1"
FT                   /translation="MSNTRASVKDLNLWYGSKQVLFDINLNIYKRKVTTFIGPSGCGKS
FT                   TFLRCFNRMNDYVPGCKTVGELDIDGLGDIYSRDMDVVLLRAKVGMVFQKPNPFPKSIY
FT                   DNVACGPKLHGMAKDKQKLNEMVENSLTKVGLWEELKDRLQDSALNLSGGQQQRLCIAR
FT                   AIAVKPTILLMDEPCSALDPMATNAIENLIQELKLRFTIIMVTHSMKQAKKLSDSVIFF
FT                   HNGRIVESGSTQEIFENAQSLLTKEYILDH"
FT   gene            351580..352623
FT                   /pseudo
FT                   /locus_tag="WD_0372"
FT                   /old_locus_tag="WD0372"
FT                   /note="transposase, IS3 family, degenerate; This gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error.Identified by similarity to EGAD:43417"
FT   gene            complement(352624..352725)
FT                   /locus_tag="WD_0373"
FT                   /old_locus_tag="WD0373"
FT   CDS_pept        complement(352624..352725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0373"
FT                   /old_locus_tag="WD0373"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14101"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I11"
FT                   /protein_id="AAS14101.1"
FT                   /translation="MISGKVTLPRKSGEKVWNVFYKKNDASNCSGMQ"
FT   gene            complement(352803..353907)
FT                   /gene="prfB"
FT                   /locus_tag="WD_0374"
FT                   /old_locus_tag="WD0374"
FT                   /note="peptide chain release factor 2, programmed
FT                   frameshift; This gene contains a frame shift which is not
FT                   the result of sequencing error.Identified by similarity to
FT                   SP:Q9ZDQ2"
FT   gene            354061..355431
FT                   /gene="mgtE"
FT                   /locus_tag="WD_0375"
FT                   /old_locus_tag="WD0375"
FT   CDS_pept        354061..355431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtE"
FT                   /locus_tag="WD_0375"
FT                   /old_locus_tag="WD0375"
FT                   /product="magnesium transporter"
FT                   /note="Identified by match to TIGR00400 protein family HMM
FT                   TIGR00400; match to PF03448 protein family HMM PF03448;
FT                   match to PF01769 protein family HMM PF01769; match to
FT                   PF00571 protein family HMM PF00571"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14102"
FT                   /db_xref="GOA:Q73I10"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I10"
FT                   /protein_id="AAS14102.1"
FT                   /translation="MNIEISSHYGLYKKAIDDLIESLDNEELENVRNIVKTIDSVQLAY
FT                   FLSTSISDHREKLVNILDQHLLSDALVHVVPDLQIEIIETLGIENTAKLLMLLDVEDIV
FT                   TIVKDLDRKSVENILYYLPSKTQKSVEELLSYPEESAGRLIHKDMVIAPYYWTINQLTE
FT                   FVCNYKKIPEKFHQIFIINSKLEPIGSVNLNKVISHSGDTIIKEIMDHDIKIIKTGIDQ
FT                   EEVARIFKDYSLLSAPVVNKNGKIIGVILIEDVIKVVQQETEEDVLKISGVSSKADINA
FT                   PIHKTIIKRLPWLLFNLLAATMCSIVVGFFDDVIKSFIVLPIIMPIIASMSGNAGSQTV
FT                   TLTIRAIATKYLTEQNAKRILMKEFLIGLINGVILSTISLVVLAIRFHNFKVEMIFVVS
FT                   MIMMSIIATFIGTFIPIMLHRLKSDPAVSSSILTSATTDILSAFIFLGLATIFLLNS"
FT   gene            complement(355687..357146)
FT                   /pseudo
FT                   /locus_tag="WD_0376"
FT                   /old_locus_tag="WD0376"
FT                   /note="potassium uptake protein TrkH, putative, authentic
FT                   frameshift; This gene contains a frame shift which is not
FT                   the result of sequencing error.Identified by similarity to
FT                   GP:3288671"
FT   gene            357413..358345
FT                   /locus_tag="WD_0377"
FT                   /old_locus_tag="WD0377"
FT   CDS_pept        357413..358345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0377"
FT                   /old_locus_tag="WD0377"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14103"
FT                   /db_xref="GOA:Q73I09"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I09"
FT                   /protein_id="AAS14103.1"
FT                   /translation="MNHEGIGAGYKDNFLDFAIIGLDAGVKVQGEIGENVEIIKQIWKV
FT                   ANQKTRDFVCCRAIESFRGFGLYNIPALKTVIQEIEEHKRVMDLDMALRRAIRSLNVDQ
FT                   VKTALENCGEDVESVLTRNVYWSDATDIDCLLIYPLMVDYERNLGKEEFEKIKEITKLL
FT                   WDKASPDVRNFWLEDHMVNREGQNTEDNYIIGSLEKQQKEYANIAGEGWLEDFIQEVKG
FT                   YKKDREIKLNEYKGKIALGVVGLCVVGAIAAYVLAYPVVALVLEVSAVSALAVLAYIGG
FT                   VCEKSESPNTKSLNPVVSGCCNNAELPNQ"
FT   gene            complement(358418..359434)
FT                   /locus_tag="WD_0378"
FT                   /old_locus_tag="WD0378"
FT   CDS_pept        complement(358418..359434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0378"
FT                   /old_locus_tag="WD0378"
FT                   /product="phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14104"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I08"
FT                   /protein_id="AAS14104.1"
FT                   /translation="MLRNFLLIFVFVLFTPLSNADARKYIRIVGSSTVFPFISFIAEEF
FT                   NRVFSFKTPVVESIGSGSGFKMFCSGIGEDTPDITTSSRPMKEVERELCKRNKINEVIE
FT                   IIIGYDGVVIANSNQSHRFDFTKKDLFETLSAYSQENDKLVKNNKKFWSNVNQALPKTE
FT                   IEIYGPHQNTGTYETLVNSIMLDQYSCMNSRIFKENYKDQEERKKACGNIRDDGRYIEV
FT                   GINENIIIQKLKSNKNALGIFSFSFLMRNQDKIQGSTIAGIEPTYENISSGKYILARPL
FT                   YLYIKRKHLDTVDGLREFVKEIIDSIGIEDGYLSRLGLIPLSSEDIKKASAKVYDIT"
FT   gene            359576..360133
FT                   /locus_tag="WD_0379"
FT                   /old_locus_tag="WD0379"
FT   CDS_pept        359576..360133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0379"
FT                   /old_locus_tag="WD0379"
FT                   /product="deoxycytidine triphosphate deaminase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14105"
FT                   /db_xref="GOA:Q73I07"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73I07"
FT                   /protein_id="AAS14105.1"
FT                   /translation="MAVMPDKWIREKAENFGMIEPFVNHKSSKGVISFGLSSYGYDARV
FT                   DNKFKIFTNVNSAIVDPKNFSENSFIDKETDVCIIPPNSFVLASTVEYFRIPRNVLVIC
FT                   VGKSTYARCGIIVNVTPLEPGWEGHVTLEFSNTTPLPAKIYANEGACQFVFLSGESECE
FT                   KSYDDMKGKYMNQHGITLPLVK"
FT   gene            complement(360134..360493)
FT                   /locus_tag="WD_0380"
FT                   /old_locus_tag="WD0380"
FT   CDS_pept        complement(360134..360493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0380"
FT                   /old_locus_tag="WD0380"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14106"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I06"
FT                   /protein_id="AAS14106.1"
FT                   /translation="MGNTRFVDQTVIAKDINNDGIRDGGMMMRTVGNDRNFTACGVVTG
FT                   NATNKQEGFATAMGFSCNIVENGIDFQLGCSMRTGTDKKQAIKHLKQSESARTLLSGDS
FT                   GILSIEQFGSSQRKQ"
FT   gene            complement(360575..361144)
FT                   /locus_tag="WD_0381"
FT                   /old_locus_tag="WD0381"
FT   CDS_pept        complement(360575..361144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0381"
FT                   /old_locus_tag="WD0381"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14107"
FT                   /db_xref="GOA:Q73I05"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I05"
FT                   /protein_id="AAS14107.1"
FT                   /translation="MKFEMSEENSKRVLSGTKWITNVGQNYLTSLNNSTKPTSSGKKLI
FT                   NAFLLVPIIVPTAITALSLSLTMLFLNAVNVQKDDSKLSKVIKFIVSSLIYIAATVVLI
FT                   PCIVLNLIISLIPGLIFYYINKDMFSQKDIENSQGQPVNKVEISNDKEYNERVEKEARI
FT                   SGTDQHQNNKEHEQNELRSNSQSNSE"
FT   gene            361426..364761
FT                   /locus_tag="WD_0382"
FT                   /old_locus_tag="WD0382"
FT   CDS_pept        361426..364761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0382"
FT                   /old_locus_tag="WD0382"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to GP:15155976; match to
FT                   TIGR01612 protein family HMM TIGR01612"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14108"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025195"
FT                   /db_xref="InterPro:IPR032876"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I04"
FT                   /protein_id="AAS14108.1"
FT                   /translation="MSTIILSSIFGQAGSIFGPIGRIIGSELGALLGAQLDGAMFGLDA
FT                   EQKVTHGARLKNLQVQTSTYGRTIPIIYGTARVAGNIIWSQPIKEEAITTKSKIGRGMN
FT                   VTYNYYATLAIAICKGKVEKLNRIWADTTSLSFDEIDYTFYSGREDQNPDPFMSSIEGE
FT                   GNVPAYRGISYIVIKNFPLADYNNRVPIFTFEVRTTLKPVGFSIAENIRNINIIPGSGE
FT                   FVYDTKIQKKIAQEKISSNQYIPYGLAQRVNHNNHTKKSDAMLSLDQLKEDLPNVELVS
FT                   VVVNWFVNDLNIKDCKIYPAVEFQDDSAILPDDWQVGGVTRDNAQLISKDASGNPRYGG
FT                   TVSDAALIRYIEELHSRGYKVMLYPMPLLDTKNKEWRGKLSGTPGDISDFFENQYNKFI
FT                   EHYASIAKQTKVEGFIIGSEFAQLTKIRDEQGNYPAVIELVKLAKRIKLQLGKEVTVTY
FT                   AADWSEYHSYDGWYNMDELWSSEYIDVIGIDAYFPLTDGPEPPFGYSVEDVMGGWSSGV
FT                   GYDYFYDYSKSEPEKVKYNDSRYAWKNIEKWWSETHINPSGSKTKWQPKMKKIWFTEYG
FT                   FPSMNGCTNEPNVFVDKGSIESKYPRYSNGEVSFLSQKIAIEGTLKKWQSSEMVEKMFL
FT                   WAWDARPFPYFPNLCDMWTDCHNWQTGHWIQGKLSQLNISNVLSDLLQKAGLKSDQFDT
FT                   SDVKGLLSGYVINDQQSVRSIIKMLQSCYFFDVVEQDSKLKFVQKGRGVTTEIPIGETV
FT                   FSNNSKLANISQLDLNNKVNVVYFNRNFGYPIDVKYAELPKQGAAITVEIPLIMEEGEA
FT                   QNIAEVLLYSSWQERNIYNFKLPIKYAWLVPSDVITILDSEKKHTVRIIKTKFESMSIQ
FT                   VIGVGYDHSIYKLSFPSTRSLMLKEYPPSHISKIIVEMIDLPDIKGNSASFTLISEEKN
FT                   WKGATLFISYNDKDYKPIANTNKQSTYGYVMESTDEGLIVVLRFGVLSSSYNHYLSDGV
FT                   IPALDHISPGSQCLGTGMTEEGFTSTNVSTINVSNLALVGKEIVKFQSAELIDKNKYKL
FT                   SNLIRGQEGTKEYQHTAGEKFTLLDDSVISFEVQRGKKFYLKAVTYGDSLENTEVKVIN
FT                   SFSN"
FT   gene            364831..365634
FT                   /locus_tag="WD_0383"
FT                   /old_locus_tag="WD0383"
FT   CDS_pept        364831..365634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0383"
FT                   /old_locus_tag="WD0383"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14109"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I03"
FT                   /protein_id="AAS14109.1"
FT                   /translation="MVNALKAEVKKLKYADFKANTWDEVISGEGTYKDLNRTHGLAING
FT                   QKITNEFINNLYSKHKNLILRDENGKGNYRPFLRQIFTEMFKHVGATIPNNSIIEELIN
FT                   NYYQGGYTHFLPNDMSQALGSFHLSTQSNCMTREYIMDCREPNCIKLSFSMKYTKMLNY
FT                   DDCTYIETPGFCSSAEFKLKCEDKNVTYEDGKVLLTIPKELKNYKVSGKNLFDVIVEYF
FT                   QKLCEKLGFKFETKVEHSLGEPLKVVSEANASSVEDLKLKVNNQR"
FT   gene            365990..367192
FT                   /locus_tag="WD_0384"
FT                   /old_locus_tag="WD0384"
FT   CDS_pept        365990..367192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0384"
FT                   /old_locus_tag="WD0384"
FT                   /product="bicyclomycin resistance protein"
FT                   /note="Identified by similarity to SP:P28246; match to
FT                   TIGR00710 protein family HMM TIGR00710"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14110"
FT                   /db_xref="GOA:Q73I02"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I02"
FT                   /protein_id="AAS14110.1"
FT                   /translation="MKTALSQNIISLIMILSVAIVDMATDLYSVALPSIANYFKVEGSV
FT                   VQLTISLNLVGFAVSGLIYGPLSDHYGRRPMMLIGMTIFTLASVMCYIADSIMLLILIR
FT                   FIQGAGAGVAGVVGYAAIRDMYSGSEYSRVISKLNMVVALSPGIAPVVGSYIISHGYHW
FT                   KFLFFIMSLAAIAILIFIYFKLQETLTVNKNETSITNITTNIFKQYISIFRNYRFLGFS
FT                   AIHGLTFMWLWAYIANYPFIFESMGIEVQYFGYLISIIVIFYIIGTLINRRYVPKVGVS
FT                   KMLIIGLVLPIISNSLLVYFYFADKLNIFILQTAWIPANIGLALIISNNVTSALETIKG
FT                   IGLGSAVLSFCNMMFGAIGIYIVGKFFRYGILPNLLLTIACSTIAILMYSQLKCTEKHR
FT                   E"
FT   gene            367326..368954
FT                   /locus_tag="WD_0385"
FT                   /old_locus_tag="WD0385"
FT   CDS_pept        367326..368954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0385"
FT                   /old_locus_tag="WD0385"
FT                   /product="ankyrin repeat domain protein"
FT                   /note="Identified by match to PF00023 protein family HMM
FT                   PF00023; match to PF00023 protein family HMM PF00023; match
FT                   to PF00023 protein family HMM PF00023; match to PF00023
FT                   protein family HMM PF00023; match to PF00023 protein family
FT                   HMM PF00023; match to PF00023 protein family HMM PF00023;
FT                   match to PF00023 protein family HMM PF00023; match to
FT                   PF00023 protein family HMM PF00023; match to PF00023
FT                   protein family HMM PF00023; match to PF00023 protein family
FT                   HMM PF00023; match to PF00023 protein family HMM PF00023"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14111"
FT                   /db_xref="GOA:Q73I01"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I01"
FT                   /protein_id="AAS14111.1"
FT                   /translation="MSSSQSRNNFFKAVERGDIDAVNRLISEGADVKVENDKGETPLHI
FT                   AAVWGHKEVVEALLDKGANVNAEDEEGNTPLVLTTDEEIKTLLQSTAKLLEVAKSGNIQ
FT                   EVNSLISEGAKVNVKDQDNKTPLHWAAEKGHKEVVEALLDKGANVDAEDENGDTPLDLA
FT                   TTQDIRTLLQNTDELLKAAGRGDIDTVNDLINQGASVNATDQDGKTPLHCAAKNSHEEV
FT                   VEALLGKDGIDVNLADKNKDTPLHSVLKKGNIDINVLNALLRKEGIDVNLADKNKDTPL
FT                   HSVLKKDNIDINVLNALLGAKEINVNAQDKDDRTPLHLAAKKDNIDINVLNALLGAEGI
FT                   DVNIKDKLAEQTPLHWAVVKGHKEAVEALLGKDGIDVNIEDKHGNTPFKLATDEGIKTL
FT                   LQPAEKSDDGSAGGSSTDSEGGQEEEKRVGDDTELQSDNSKEGEKTSTTSAEQGTDVQD
FT                   NDVGPVASTEPAQTEEQPSSFFGSLFSILMKPFSLIASFFGGFFHGCLGLTKKSLTHNL
FT                   MMILLHLGSINQLNKIMVIIMTRAM"
FT   gene            complement(368985..369203)
FT                   /locus_tag="WD_0386"
FT                   /old_locus_tag="WD0386"
FT   CDS_pept        complement(368985..369203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0386"
FT                   /old_locus_tag="WD0386"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14112"
FT                   /db_xref="UniProtKB/TrEMBL:Q73I00"
FT                   /protein_id="AAS14112.1"
FT                   /translation="MHNHMKAHSSLSSQYVTLFPSKMMSFQHLTLASSFLYKFTKSASF
FT                   YNAKPILTKPNALLAIKFPGSQCQALG"
FT   gene            complement(369209..371281)
FT                   /gene="tkt"
FT                   /locus_tag="WD_0387"
FT                   /old_locus_tag="WD0387"
FT   CDS_pept        complement(369209..371281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tkt"
FT                   /locus_tag="WD_0387"
FT                   /old_locus_tag="WD0387"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /note="Identified by similarity to EGAD:10074; match to
FT                   TIGR00232 protein family HMM TIGR00232; match to PF00456
FT                   protein family HMM PF00456; match to PF02779 protein family
FT                   HMM PF02779; match to PF02780 protein family HMM PF02780"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14113"
FT                   /db_xref="GOA:Q73HZ9"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HZ9"
FT                   /protein_id="AAS14113.1"
FT                   /translation="MNHSHLKSMANAIRFLSIDAVQKANSGHPGMPLGMADVATVLFAK
FT                   YLNHNPDDSKWFNRDRFVLSNGHGSMLLYSILYLTGYISVDELKNFRQMGSKTPGHPEF
FT                   GLTSGVEATTGPLGQGFAAAVGMALAESILEKQFRINHYTYVMLGDGSLMEGISHEAAS
FT                   LAGHLKLNKLIALFDDNDISIDGATCLSCSDDVEKRFLAYGWNVDKIDGHDFDAISLAI
FT                   EQAKKSDKPTMICCKTIIGKFSSRAGTSSAHSGAFSEEDIKQMREKLNWNYEPFHVPED
FT                   VKNAWKKTVERAKQNYTMSFQRVTLESRKEEKEWIPVSSTGMTRESTGMTEENAGMTGY
FT                   HAELQRRLDKHLPDNIAGVLADLKKQICELMPNEATRSSFGRVMELLTESMPELIGGSA
FT                   DLTGSNCTKYEHMQVINSNNYSGSYVHYGVREHAMAACMNGMALHGAILPYGGTFLVFS
FT                   DYCRPAIRLSALMKQQVMYVMTHDSIGVGEDGPTHQPIEHLASLRAIPNLYVFRPADAV
FT                   ETLECVSIALEKKESPALFALSRQNVSYMRKFYSDIDQSANLSKFGAYILCECSKELKV
FT                   TIFATGSEVEIAVEAREKLQEKGIGTRIVSMPCWRLFDEQSDEYKAAILNNDSIKVAIE
FT                   AGSEMGWHKYIGSNGIFIGMKSFGESAPYKTLYEHFNISADHVVKCVCEKLVYIQ"
FT   gene            371395..372009
FT                   /gene="rpsD"
FT                   /locus_tag="WD_0388"
FT                   /old_locus_tag="WD0388"
FT   CDS_pept        371395..372009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="WD_0388"
FT                   /old_locus_tag="WD0388"
FT                   /product="ribosomal protein S4"
FT                   /note="Identified by similarity to SP:P02354; match to
FT                   TIGR01017 protein family HMM TIGR01017; match to PF01479
FT                   protein family HMM PF01479; match to PF00163 protein family
FT                   HMM PF00163"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14114"
FT                   /db_xref="GOA:Q73HZ8"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HZ8"
FT                   /protein_id="AAS14114.1"
FT                   /translation="MTTVITRKYRISRRLGVNLWGRAKDPVNKRKYPPGQHGILGFKKL
FT                   SDFGKQFAAHKKFKFYYAISSKQLRRTFLDAYNRKGYTADNFIGILESRLSSVLYHSGL
FT                   VPTIYSAKQLISHKHVTVNDKVVNISSYRVKPGDIIKIRERAAKIPVVVEAEQKQERKA
FT                   PDYLEADSKEHSVKYLRSPQYSEVPYSADMEVNLVVEFYSR"
FT   gene            372019..372105
FT                   /locus_tag="WD_tRNA-Leu-4"
FT                   /old_locus_tag="tRNA-Leu-4"
FT   tRNA            372019..372105
FT                   /locus_tag="WD_tRNA-Leu-4"
FT                   /old_locus_tag="tRNA-Leu-4"
FT                   /product="tRNA-Leu"
FT   gene            372136..372336
FT                   /locus_tag="WD_0389"
FT                   /old_locus_tag="WD0389"
FT   CDS_pept        372136..372336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0389"
FT                   /old_locus_tag="WD0389"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to EGAD:102137"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14115"
FT                   /db_xref="GOA:Q73HZ7"
FT                   /db_xref="InterPro:IPR007479"
FT                   /db_xref="InterPro:IPR036762"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HZ7"
FT                   /protein_id="AAS14115.1"
FT                   /translation="MKWLDIEDIVEALEEKFPDENIISIRFTELKKKVLSLEEFDDDEK
FT                   RCNEKILEAIQAAWIEERLTA"
FT   gene            372783..373124
FT                   /locus_tag="WD_0390"
FT                   /old_locus_tag="WD0390"
FT   CDS_pept        372783..373124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0390"
FT                   /old_locus_tag="WD0390"
FT                   /product="conserved domain protein"
FT                   /note="Identified by similarity to GP:15073860"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14116"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HZ6"
FT                   /protein_id="AAS14116.1"
FT                   /translation="MLKRSGPKKLKSIIENYALKCMKNKISKNEIRLILNWRNIVGKEI
FT                   AECTKPKKISYAQNINSGVLHLVVTNGSKALEIQHMISLIIEKITIFFGYKAVYGIKIK
FT                   QESIDYLTI"
FT   gene            373162..373476
FT                   /gene="rpmB"
FT                   /locus_tag="WD_0391"
FT                   /old_locus_tag="WD0391"
FT   CDS_pept        373162..373476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="WD_0391"
FT                   /old_locus_tag="WD0391"
FT                   /product="ribosomal protein L28"
FT                   /note="Identified by similarity to EGAD:21484; match to
FT                   PF00830 protein family HMM PF00830; match to TIGR00009
FT                   protein family HMM TIGR00009"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14117"
FT                   /db_xref="GOA:Q73HZ5"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HZ5"
FT                   /protein_id="AAS14117.1"
FT                   /translation="MSRVCELTNRKKSFGNKVSHSNRKTKRTFLLNLHKVTLTSDILNK
FT                   KFRFRVATRTLRTIDYKGDLDAFLLNTRTIKLSEKAQKIKRRLKKVLVKQEVELAVSDA
FT                   "
FT   gene            373469..374332
FT                   /gene="lipA"
FT                   /locus_tag="WD_0392"
FT                   /old_locus_tag="WD0392"
FT   CDS_pept        373469..374332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /locus_tag="WD_0392"
FT                   /old_locus_tag="WD0392"
FT                   /product="lipoic acid synthetase"
FT                   /note="Identified by similarity to OMNI:CC1735; match to
FT                   TIGR00510 protein family HMM TIGR00510; match to PF04055
FT                   protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14118"
FT                   /db_xref="GOA:P61200"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:P61200"
FT                   /protein_id="AAS14118.1"
FT                   /translation="MHSKPQWLRAKAPTGEVFNETLNIVKLHNLHTVCEEAACPNIGEC
FT                   WNKRHATVMILGSVCTRACAFCNVATGIPDKLDPHEPENLAKAIKKLNLKHVVITSVDR
FT                   DDLPDGGANQFIQCIEEIRKITSETTIEILTPDFLNKKGAFEAIAVASPDVYNHNIETV
FT                   PRLYAKIRPRARYFHSLYLLKMVKQINPKVFTKSGLMVGLGETKEEILQVMDDLRSAEV
FT                   DFITIGQYLQPTPKHAKLDRYVTPEEFEHYKYIAYSKGFLVVASSPLTRSSYHAEEDFN
FT                   RLKACR"
FT   gene            374386..375102
FT                   /gene="ubiE"
FT                   /locus_tag="WD_0393"
FT                   /old_locus_tag="WD0393"
FT   CDS_pept        374386..375102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="WD_0393"
FT                   /old_locus_tag="WD0393"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methlytransferase UbiE"
FT                   /EC_number="2.1.1.-"
FT                   /note="Identified by similarity to EGAD:22837; match to
FT                   TIGR01934 protein family HMM TIGR01934; match to PF01209
FT                   protein family HMM PF01209"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14119"
FT                   /db_xref="GOA:Q73HZ4"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HZ4"
FT                   /protein_id="AAS14119.1"
FT                   /translation="MSTIKIEKKSQLVKEVFDSVASRYDTMNDIMSLGMHRLWKDKMVN
FT                   SVHFTKNSKVLDVAGGTGDIAIRVVRKEPSAKVTVCDINQNMLNRGRDKAINSNQINFD
FT                   WVCASAESLPFEDSEFDYCTIAFGIRNVSDRKKALNEAHRVLKPHGKFICLEFAPMHYQ
FT                   NEIFTKLYDLYSFKVIPKIGSIVAKDKSSYEYLVRSIREFPTQADFKMEIEEVGFKNVE
FT                   FHNMSYGIVALHIGTK"
FT   gene            375099..376214
FT                   /locus_tag="WD_0394"
FT                   /old_locus_tag="WD0394"
FT   CDS_pept        375099..376214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0394"
FT                   /old_locus_tag="WD0394"
FT                   /product="cell division protein FtsW, putative"
FT                   /note="Identified by similarity to EGAD:20048; match to
FT                   PF01098 protein family HMM PF01098"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14120"
FT                   /db_xref="GOA:Q73HZ3"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HZ3"
FT                   /protein_id="AAS14120.1"
FT                   /translation="MNIKLWYRTLDYYLILPVFFLLTISFILVYSASPVIAQRLSLPQD
FT                   YFIRRHTIYIVLSLITLVTFSFLNTRTILNLSFAGFALFTILVATAIILGIEVKGAKRW
FT                   LHIVKISVQPSEFVRPFFSVVIASILASEMKFKIHISIIIFLLVFVLLLLQPDFSMSML
FT                   LTYSFIGQMFIACIPFLYFLCIIGMATTGTTIAYLCLPHIKQRIYNFVFFTQRDNFQVT
FT                   KSLEAFKRGQLTGVGPGEGSVKASLPDCHTDFVFSVLAEEFGLITCLATLMLFGIISAR
FT                   LLYIAYRENELFNLLVILGISMQFITQFIINIGVTLSVFPTTGITLPLLSYGGSSLLSS
FT                   SIALGIMLSFSRNQAIALKFRERVMLGRYMD"
FT   gene            complement(376585..377325)
FT                   /locus_tag="WD_0395"
FT                   /old_locus_tag="WD0395"
FT   CDS_pept        complement(376585..377325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0395"
FT                   /old_locus_tag="WD0395"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by match to TIGR01784 protein family HMM
FT                   TIGR01784"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14121"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HZ2"
FT                   /protein_id="AAS14121.1"
FT                   /translation="MKDKPVREKKDLDKGLKRSVGKPACCVSKGGSSSNTTSLPNQVAK
FT                   TKGFEKRAQLYAAKAYSRQADKSGKYVDLKKIFFIAISNCTLFPDKLDYISSHTIRDEK
FT                   TNEHDLKDFQFIFIELPKFPKSREEQLESVVDRWLFFFKYADETTDEDLRKIAEKSPII
FT                   KLAYDELDKFHWNEKDLITYEERIMDLRKEEAILEYRLDLAKEEGRKEREIEVAKNLLK
FT                   AGVSFNIIAQTTGLSMSEIKELQN"
FT   gene            complement(377322..378869)
FT                   /pseudo
FT                   /locus_tag="WD_0396"
FT                   /old_locus_tag="WD0396"
FT                   /note="reverse transcriptase, authentic point mutation;
FT                   This gene contains a premature stop which is not the result
FT                   of sequencing error."
FT   gene            378921..379154
FT                   /locus_tag="WD_0397"
FT                   /old_locus_tag="WD0397"
FT   CDS_pept        378921..379154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0397"
FT                   /old_locus_tag="WD0397"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14122"
FT                   /db_xref="GOA:Q73HL7"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HL7"
FT                   /protein_id="AAS14122.1"
FT                   /translation="MEVCSFSRELMLQILSISLQNGIRFLHYPLPAHPSAFLAGCLPYR
FT                   RKYRLILFLLSYNSGLGGFSIPVELLFAYIQK"
FT   gene            complement(379299..379742)
FT                   /locus_tag="WD_0398"
FT                   /old_locus_tag="WD0398"
FT   CDS_pept        complement(379299..379742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0398"
FT                   /old_locus_tag="WD0398"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by match to TIGR01784 protein family HMM
FT                   TIGR01784"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14123"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HZ0"
FT                   /protein_id="AAS14123.1"
FT                   /translation="MALSKFLDPKLDLTFKKIFGTEKNKNILIHFLNDILGCTEVNTIQ
FT                   EVEFLSTIMDPEIASDKQSIVDVLCRDSSGNRYIIEMVRPESLRSYCLKGEEFIQKETE
FT                   RILKLIEPDVLPSESTHQCELGNQLVPSDADNEPPLDKEDAQS"
FT   gene            complement(380432..380695)
FT                   /locus_tag="WD_0399"
FT                   /old_locus_tag="WD0399"
FT   CDS_pept        complement(380432..380695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0399"
FT                   /old_locus_tag="WD0399"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14124"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HY9"
FT                   /protein_id="AAS14124.1"
FT                   /translation="MKQFRFCSCCDFSPPRKGSSSQKQKTYLTNSASPLIIKLKLLYLL
FT                   SPICRLKGKDYLMYRRLMFNFLQYIDTVCLYKTSSTSRFLSK"
FT   gene            380763..382469
FT                   /locus_tag="WD_0400"
FT                   /old_locus_tag="WD0400"
FT   CDS_pept        380763..382469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0400"
FT                   /old_locus_tag="WD0400"
FT                   /product="ABC transporter, HlyB/MsbA family, putative"
FT                   /note="Identified by match to PF00664 protein family HMM
FT                   PF00664; match to PF00005 protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14125"
FT                   /db_xref="GOA:Q73HY8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HY8"
FT                   /protein_id="AAS14125.1"
FT                   /translation="MRSNIRQLFYYIKPNLSYFVIAFIAVLFSALTILLFGRGLSNIID
FT                   SGTEHDFTTKLLVAILIVLAISLTAFTRLYFIGIGSEKVIARIRYDLYSSITNLQPSFF
FT                   ENTGVQDVISALITDTSVLQSIINSSLLTILRNFVILIGSVAMLLYTNIQLTAYAAAII
FT                   PILLIIMTSLGKKVRSYARFAQDKLSELASFSEENFRSIVTIKSFVLEENEKTRFKEYL
FT                   NSVSKSYVKLVLLRAILVTLVITCVIGSLVVLLFFGIKEVLSNNITIGELSSFVFYSAL
FT                   AAGAINNLSDNISDLQRGLGIVERLFEFKNMKSSIVDADDPIKIYSVQKGISFNGVTFF
FT                   YADKPALDNVSFSIEAGQAVSIVGPSGSGKSTILKLLLRFHDPNKGSITIDGHNIKSIA
FT                   LNDLRSLFGLVPQDHMIFSCSIMENILYGKPGAEYEEVKQAAISAYAMEFIDKLPDKFD
FT                   TFVGKRGLKLSEGQKQRIVIARAILNNPQVLILDEATSALDYKSENLVQKALSKLMQNR
FT                   TTIVITHRLSTALKTDKIIVINHGKVEEVGTHDFLMSKDGLYAKLAKIQWN"
FT   gene            382665..382883
FT                   /locus_tag="WD_0401"
FT                   /old_locus_tag="WD0401"
FT   CDS_pept        382665..382883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0401"
FT                   /old_locus_tag="WD0401"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14126"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HY7"
FT                   /protein_id="AAS14126.1"
FT                   /translation="MLKHNYSDKINNRYSYTNKFSYSDEGVDETIKDKITTEDQVVTDD
FT                   VEEPDAGNDGYSEGMAFSYHGYGNDLI"
FT   gene            382977..384683
FT                   /gene="argS"
FT                   /locus_tag="WD_0402"
FT                   /old_locus_tag="WD0402"
FT   CDS_pept        382977..384683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="WD_0402"
FT                   /old_locus_tag="WD0402"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="Identified by similarity to EGAD:30453; match to
FT                   TIGR00456 protein family HMM TIGR00456; match to PF00750
FT                   protein family HMM PF00750; match to PF05746 protein family
FT                   HMM PF05746; match to PF03485 protein family HMM PF03485"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14127"
FT                   /db_xref="GOA:Q73HY6"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HY6"
FT                   /protein_id="AAS14127.1"
FT                   /translation="MNIFKQISSLIFSKLNELKQRGVISTSAANFIIEPPSNRVHGDIY
FT                   TNVAMVLAKHEKKNPIEIAEVLAKEFELFDEVAKVEIAGSGFINMHLKIEVWHGILKQI
FT                   NELKTEFGTLDIGNNQAINVEFVSANPTGPLHIGHARGAVFGDVLANLLKKVGYKVTKE
FT                   YYINDAGAQIDTLIRSVYLRYKEALGEKISIEKGLYPGEYLKPIGTGLAKKYGAELLEK
FT                   QDNQVIRDYTLSSILEIIKEDMNLLGVNHDVFTSEYELQKSGKIEESIKILSDKGLVYE
FT                   GYLEKPKGKESENWTSRKEMLFRSTKFGDDVDRALKKEDGSWTYFASDIAYHFDKISRG
FT                   FNNMIVELGSDHGGYVKRLKAVVSALSDDQAKIEVKLHNIVNFFENGKPVKMSKRSGNF
FT                   LTARDVVEEVGRDITRFIMLTRKNDMVLDFDFAKVKEQSKDNPIFYVQYAHARAHSLMR
FT                   NAPKELPTADPSLLRTGGELFLIKTLAKWPDVVEIAARLCEPHRITFYLLEVAEAFHVL
FT                   WGYGKSDLNMRFILEDNLNLTAARMFLVQALAHVIASGLSIFNIEPLEEMS"
FT   gene            384778..385002
FT                   /locus_tag="WD_0403"
FT                   /old_locus_tag="WD0403"
FT   CDS_pept        384778..385002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0403"
FT                   /old_locus_tag="WD0403"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14128"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HY5"
FT                   /protein_id="AAS14128.1"
FT                   /translation="MAHSQKKLNVNVSFDSKLAQYLTEMAETQNKTIPEVLVDLVEEEF
FT                   EEDVELSKIADDRLSEGEEEVEDDENIWK"
FT   gene            384983..385282
FT                   /locus_tag="WD_0404"
FT                   /old_locus_tag="WD0404"
FT   CDS_pept        384983..385282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0404"
FT                   /old_locus_tag="WD0404"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by match to PF01919 protein family HMM
FT                   PF01919"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14129"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HY4"
FT                   /protein_id="AAS14129.1"
FT                   /translation="MKTSGNKTYTIKFLKNVIEKEIPALPAKIKLMVQEAIKKRLTVDP
FT                   FNLGKPLCHSFRGQYRIRVSNYRIIYIINHSERKVLITAVGYRKNIYKHRRLHN"
FT   gene            385445..385546
FT                   /locus_tag="WD_0405"
FT                   /old_locus_tag="WD0405"
FT   CDS_pept        385445..385546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0405"
FT                   /old_locus_tag="WD0405"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14130"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HY3"
FT                   /protein_id="AAS14130.1"
FT                   /translation="MTISFREYSTVFTEVAEQTDLNGNNIIERIKGH"
FT   gene            385679..385897
FT                   /locus_tag="WD_0406"
FT                   /old_locus_tag="WD0406"
FT   CDS_pept        385679..385897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0406"
FT                   /old_locus_tag="WD0406"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14131"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HY2"
FT                   /protein_id="AAS14131.1"
FT                   /translation="MVTTFSMRLYGKLYSSVKHWNTSQGHWNDTLYGLLNCNYKCLRNL
FT                   PNEKKGKRSPMVVGYLLCTKISAFFLF"
FT   gene            complement(386284..387579)
FT                   /locus_tag="WD_0407"
FT                   /old_locus_tag="WD0407"
FT   CDS_pept        complement(386284..387579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0407"
FT                   /old_locus_tag="WD0407"
FT                   /product="Na+/H+ antiporter, putative"
FT                   /note="Identified by match to PF03553 protein family HMM
FT                   PF03553"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14132"
FT                   /db_xref="GOA:Q73HY1"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HY1"
FT                   /protein_id="AAS14132.1"
FT                   /translation="MTAFVPLIIFLILYLGSGAYFSFIGTDNPLHQVSPVICLLPALFF
FT                   AVSRGTNKIQHNIDTVIKGMGDKNTLTMCLIFLFSGAFSAVTQSIGSADTVANLILNFL
FT                   PARLLLPGVFLASAFISTAIGTSMGVVALMVPIAVNLAKSGAFGLEIGTATVVGGAVFG
FT                   DNLSMISDTTIASVSSQEASAKDKLKMNSKVALIASIITLIYLAVASNSTKIISISNLD
FT                   YYSIIKIIPYISLIIMGLLEVATLVTITINIIIAGVLGITFFDYAIIQFPHDVYDGFKK
FT                   VNEIVIFALFIGGLSHIMYKQGQKALHKLIDESNITKTKAEFVIAGIASMFTTLVANNT
FT                   IAILLSGGIAKRLAQKHSIAPHRSAYLLDVFACATKGILPYGSQLLLAGSIASVSPISL
FT                   LTQVYYCFILAAVTIGEIIINSRKEKHCAAAT"
FT   gene            complement(387848..387946)
FT                   /locus_tag="WD_0409"
FT                   /old_locus_tag="WD0409"
FT   CDS_pept        complement(387848..387946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0409"
FT                   /old_locus_tag="WD0409"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14133"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HY0"
FT                   /protein_id="AAS14133.1"
FT                   /translation="MDDNLLRLRLHIPLSMLTKQICLLAAKFSGSK"
FT   gene            388214..388366
FT                   /locus_tag="WD_0410"
FT                   /old_locus_tag="WD0410"
FT   CDS_pept        388214..388366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0410"
FT                   /old_locus_tag="WD0410"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14134"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HX9"
FT                   /protein_id="AAS14134.1"
FT                   /translation="MAFFYSKRLITATQLLLNATNLSYKYLRNLLNRKKGKRNPRVASY
FT                   SLSIF"
FT   gene            complement(388608..389231)
FT                   /locus_tag="WD_0411"
FT                   /old_locus_tag="WD0411"
FT   CDS_pept        complement(388608..389231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0411"
FT                   /old_locus_tag="WD0411"
FT                   /product="heme exporter protein CcmA"
FT                   /note="Identified by similarity to SP:P33931; match to
FT                   TIGR01189 protein family HMM TIGR01189; match to PF00005
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14135"
FT                   /db_xref="GOA:Q73HX8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HX8"
FT                   /protein_id="AAS14135.1"
FT                   /translation="MLECENLSCTRNNKVLFKNLSFKAELKSKILITGPNGSGKTSLIR
FT                   SLSGLLPPVSGNIRHCGKDIYDDPKSYISSMVYIGHKNACKDSLTVAQNVEFWAGIRNT
FT                   RELIVAAICCLQLQPVLNIRYGELSAGWKRRVALARLLISNANVWLIDEPFCNLDSATC
FT                   ELVLNLISIRSEQNGIVIITGHSSTEQLCDFTTIDIRNFNRLLV"
FT   gene            complement(389235..389666)
FT                   /locus_tag="WD_0412"
FT                   /old_locus_tag="WD0412"
FT   CDS_pept        complement(389235..389666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0412"
FT                   /old_locus_tag="WD0412"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14136"
FT                   /db_xref="GOA:Q73HX7"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HX7"
FT                   /protein_id="AAS14136.1"
FT                   /translation="MSFGQIIIYSIALLAIVKVFLFLRKIYKNRIRKIIFPRKVFKEEW
FT                   EEDRKFNELYQKNKQKELMKQQEILREKQKDVQVYKEDPEIVDIAKPVGKWTKMVMMGN
FT                   GLMQRFAQLIHREGGQKGFWKLFVKAQASTQGKHKGKGR"
FT   gene            389857..391659
FT                   /gene="aspS"
FT                   /locus_tag="WD_0413"
FT                   /old_locus_tag="WD0413"
FT   CDS_pept        389857..391659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspS"
FT                   /locus_tag="WD_0413"
FT                   /old_locus_tag="WD0413"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /EC_number="6.1.1.12"
FT                   /note="Identified by similarity to EGAD:107365; match to
FT                   TIGR00459 protein family HMM TIGR00459; match to PF02938
FT                   protein family HMM PF02938; match to PF01336 protein family
FT                   HMM PF01336; match to PF00152 protein family HMM PF00152"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14137"
FT                   /db_xref="GOA:Q73HX6"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HX6"
FT                   /protein_id="AAS14137.1"
FT                   /translation="MNCYKTHTCEELRKNDVEKEVTLSGWLYRKRDHGNLIFVDLRDFY
FT                   GITQLVFNNDKDFFDEISNLKLESVITVTGIVEARTEDTVNSSISTGEIEVIVNNLRVE
FT                   SEVEFHFDEEIAKEERSILVSITGEQEYPENMRFKYRFLDLRREKVRNNIILRSQIIAE
FT                   LRKLMIERGFLEIQTPILTASSPEGARDYLVPSRLNPGKFYALPQAPQIFKQLLMVSGF
FT                   DKYFQIAPCFRDEDARADRSPGEFYQLDLEMSFVTQEDIFQIIESTLYRVFAKFSRKSV
FT                   DKDFPRITYKEAMLKYGSDKPDLRNPLLISDVTEIFRDSGFNIFKSNIERGMVVRAIPA
FT                   PKTAEEPRSFFDKKIEHAQKEFGAKGLGYITFDKDGTAKGPIAKFLDENRLNHIREATN
FT                   IEPGDSVFFASDKENEAANIAGKVRTLLGSELSLIDDNIFRFCWIIDFPYFVYDDKSKK
FT                   IDFFHNPFSMPHGGLKDLEDKNPLDILAYQYDLVCNGIELSSGAIRNNKLDIMYKAFAI
FT                   AGYSRGEVDTRFGALVRAFRFGVPPHGGIAPGVDRIVMLLADEPNIREVICFPMNQQGE
FT                   DVLMGAPSKVEDKHLRELSLKVIE"
FT   gene            391721..392983
FT                   /locus_tag="WD_0414"
FT                   /old_locus_tag="WD0414"
FT   CDS_pept        391721..392983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0414"
FT                   /old_locus_tag="WD0414"
FT                   /product="major facilitator family transporter"
FT                   /note="Identified by match to PF00083 protein family HMM
FT                   PF00083"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14138"
FT                   /db_xref="GOA:Q73HX5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HX5"
FT                   /protein_id="AAS14138.1"
FT                   /translation="MNNIQKAILSGMICNMIVWYELTLFGVLTDTIINVFFPSEDHYLS
FT                   TLKFLGVFAIGFAFRPIGAVIFGYMGDKYGRRKTLLTSVILISISSTIMGIIPGYKEIG
FT                   LLSPVLLVFCRIVQGITAGGETSINTAFTIEHSKDKKNLGFLGSMKPFSGALGTLLCIT
FT                   MIFICKRVTGENYEIWGWKLLFYFCFFLGTIGFLTRYILKESLAYKTNKYANNLAHSPL
FT                   LELVRNYKRPLIISINLGIAQNAIVYAAIMFYNISIKELVILSISVKDLMRIVIQVVFA
FT                   ASAVLFAILSDKVGRKRVMIPVLIMLSLIGTCVLPLLSSVNHYVVIITYLLITIPVGAS
FT                   FGIYGSVICELFPTKVRCTGVSLANNISAGIFGGLSPYICMWLIEKTETKLAAGIYLTA
FT                   CALISLISVLQIKAKDRKVDW"
FT   gene            complement(392991..393914)
FT                   /locus_tag="WD_0415"
FT                   /old_locus_tag="WD0415"
FT   CDS_pept        complement(392991..393914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0415"
FT                   /old_locus_tag="WD0415"
FT                   /product="ribosomal large subunit pseudouridine synthase C,
FT                   putative"
FT                   /note="Identified by match to TIGR00005 protein family HMM
FT                   TIGR00005; match to PF00849 protein family HMM PF00849;
FT                   match to PF01479 protein family HMM PF01479"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14139"
FT                   /db_xref="GOA:Q73HX4"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HX4"
FT                   /protein_id="AAS14139.1"
FT                   /translation="MLQSIKTILIEDDNVRLDRYIRRIFPDLKQSVIEKSLRKGLIKVN
FT                   DCKAKSSDRVNSGQTITLKHLNYIENANSDRKYNEKLVNLLRENILYEDEYILAINKPA
FT                   GVIVQGGVKVKISMSDLLDQIREGETFKIVHRLDRDTSGVIIFARNANVARYLMEEFKG
FT                   RRVKKTYLALTSGIPSKDSGTIDYPLVKKYVSGQEKVVVDENSPQNATTHFSIIAKSKH
FT                   NVAYLKLQPITGRTHQLRAHLAHINCPILGDGKYGGKKAFIDGIANKIHLHSHSLSLKL
FT                   PNNKEITITAPITKHIEKSIEALFFD"
FT   gene            complement(394305..395285)
FT                   /gene="pdhA"
FT                   /locus_tag="WD_0416"
FT                   /old_locus_tag="WD0416"
FT   CDS_pept        complement(394305..395285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhA"
FT                   /locus_tag="WD_0416"
FT                   /old_locus_tag="WD0416"
FT                   /product="pyruvate dehydrogenase complex, E1 component,
FT                   pyruvate dehydrogenase alpha subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="Identified by similarity to SP:Q9R9N5; match to
FT                   PF00676 protein family HMM PF00676"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14140"
FT                   /db_xref="GOA:Q73HX3"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017597"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HX3"
FT                   /protein_id="AAS14140.1"
FT                   /translation="MKAENFTKEQIIGFYRKMLLIRRFEEKAGQLYGMGLIGGFCHLSI
FT                   GQEAVAVGTQAASKLGDAFITSYRDHGLMLACDSDPNVVMAELTGKETGCSKGKGGSMH
FT                   VFDVEKKFFGGHGIVGAQVPIGTGIAFANKYKKKDNVVFTYFGDGAANQGQVYESFNMA
FT                   SLWELPVVYIIENNEYAMGTSVQRSTLVTELYKRGESFGIPGKQVDGMDFFSVYEATSE
FT                   AAEHTRSGKGPILLEMKTYRYRGHSMSDPATYRLKEEVEDMKQNHDPISTLKKYMTDNK
FT                   MASEEECKVIDKEIRDLVKKSEDFAKNSKEPSVDELYTDVYKFVS"
FT   gene            395341..395769
FT                   /locus_tag="WD_0417"
FT                   /old_locus_tag="WD0417"
FT   CDS_pept        395341..395769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0417"
FT                   /old_locus_tag="WD0417"
FT                   /product="membrane protein, putative"
FT                   /note="Identified by similarity to EGAD:162940; match to
FT                   PF03653 protein family HMM PF03653; match to TIGR00701
FT                   protein family HMM TIGR00701"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14141"
FT                   /db_xref="GOA:Q73HX2"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HX2"
FT                   /protein_id="AAS14141.1"
FT                   /translation="MNYYHWLEAFHVISVIMWMAGMLYLPRLYVYHATVKPGSENDSLL
FT                   QTMEKRLLRYIINPAMLFSLGLGITLMVIREAYREGWFHVKAFAILLMLIIHMLLAKYR
FT                   KNFAMGSNKKSHIYFRVLNEAVTALIIVIVIMVVVKPF"
FT   gene            395766..396101
FT                   /locus_tag="WD_0418"
FT                   /old_locus_tag="WD0418"
FT   CDS_pept        395766..396101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0418"
FT                   /old_locus_tag="WD0418"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14142"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HX1"
FT                   /protein_id="AAS14142.1"
FT                   /translation="MTDLTQKKQKARICSDAWLMYNTEIKIPVLPFLSSQCLTLGSSFL
FT                   YKFTKSASFYNAKPILTKLNALLAIKSPGCQCQATRMTPFFFLDPSVSYLHDTILFPGS
FT                   QSALLHR"
FT   gene            complement(396383..396484)
FT                   /locus_tag="WD_0419"
FT                   /old_locus_tag="WD0419"
FT   CDS_pept        complement(396383..396484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0419"
FT                   /old_locus_tag="WD0419"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14143"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HX0"
FT                   /protein_id="AAS14143.1"
FT                   /translation="MKVANTGFHPRGQCPLLVIPVLDTGMALLHRYL"
FT   gene            complement(396571..396672)
FT                   /locus_tag="WD_0420"
FT                   /old_locus_tag="WD0420"
FT   CDS_pept        complement(396571..396672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0420"
FT                   /old_locus_tag="WD0420"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14144"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HW9"
FT                   /protein_id="AAS14144.1"
FT                   /translation="MSNRPARDASELASTIDFDKIIQKTGSQCQALG"
FT   gene            396715..398034
FT                   /locus_tag="WD_0421"
FT                   /old_locus_tag="WD0421"
FT   CDS_pept        396715..398034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0421"
FT                   /old_locus_tag="WD0421"
FT                   /product="TRAM domain protein"
FT                   /note="Identified by similarity to EGAD:162744; match to
FT                   TIGR00089 protein family HMM TIGR00089; match to TIGR01574
FT                   protein family HMM TIGR01574; match to PF00919 protein
FT                   family HMM PF00919; match to PF04055 protein family HMM
FT                   PF04055; match to PF01938 protein family HMM PF01938"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14145"
FT                   /db_xref="GOA:Q73HW8"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HW8"
FT                   /protein_id="AAS14145.1"
FT                   /translation="MKGLYIKTYGCQMNVYDSVLMENVIKPLGFNVVSDAGKADLVILN
FT                   TCHIREKAAEKLYSELGKIHSLRKEMTIVVAGCVAQAEGEEVFRRAPFVDIVVGPQSIA
FT                   TLPELIVKASRSKGHVINTDFPEVAKFDKLPDECYGNSQGSSAFLAIQEGCDKFCTFCV
FT                   VPYTRGAEYSRPVNEIFREALKLVANGANEINLLGQNVNAYHGECEGEVWDLGKLISHI
FT                   AKIEKLERIRYTTSHPRDMHESLYLAHAEEPKLMPFVHLPVQSGSNKILHAMNRKHTAE
FT                   EYLEIIDRFRKLKPEIEFSSDFIVGFPGETEKDFEETMKLVEKVRYAQAYSFKYSPRPG
FT                   TPGAERKDQVPEEVKTERLLRLQKLISKQQLEFNQSMVGKTIPVLFSDKKGKHQNQIIG
FT                   KSPYMQSVCIDDSEDKYRDKIVNVKVLEARQSSLLGCAFH"
FT   gene            complement(398174..399639)
FT                   /pseudo
FT                   /locus_tag="WD_0422"
FT                   /old_locus_tag="WD0422"
FT                   /note="proton-dependent oligopeptide transport family
FT                   protein, authentic frameshift; This gene contains a frame
FT                   shift which is not the result of sequencing
FT                   error.Identified by similarity to EGAD:90918"
FT   gene            399816..403151
FT                   /gene="ileS"
FT                   /locus_tag="WD_0423"
FT                   /old_locus_tag="WD0423"
FT   CDS_pept        399816..403151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="WD_0423"
FT                   /old_locus_tag="WD0423"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /note="Identified by similarity to EGAD:46199; match to
FT                   TIGR00392 protein family HMM TIGR00392; match to PF00133
FT                   protein family HMM PF00133; match to TIGR01612 protein
FT                   family HMM TIGR01612"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14146"
FT                   /db_xref="GOA:Q73HW7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HW7"
FT                   /protein_id="AAS14146.1"
FT                   /translation="MKSKHYPDTVSSPDFLSLEKEIIKFWQENKVFERSVEERSKDNCF
FT                   VFYDGPPFANGLPHYGHLLTGFIKDAFARYQTMLQKRVERRFGWDCHGLPAEMGAEKEL
FT                   GISGRTEIEKFGIDKFNDHCRTSVMKFSSEWEKYVNRQARWVDFHNDYKTMDKSFMESV
FT                   MWAFKQLYDKGLVYESVRVVPYSWACETPLSNFETRLDNAYREKVSKAVTVAFELLENP
FT                   QQFKSVKRKCKLLAWTTTPWTLPSNLALAIGKDIKYCAVSVHPLMSFQRVTLESISGSQ
FT                   CLGTGMTGSSEGSSMNGEIYIFAESYLEKFISHSEQNNIPYENCNIKLKANDLAGLSYK
FT                   PLFDYFKDTKNAFRVFIADYVTEEDGTGVVHTAPGFGEEDFYLCQSHDIPVICPIDNSG
FT                   KFTAEVSDLAGVHVFDANDTVIKKLKGQGSWFKTEQYIHNYPHCWRTDTPLIYRTMPSW
FT                   YVAVTKFKSRMVELNKRVNWIPNHIRDGQFGKWLEGAHDWSISRNRFWGTPIPVWKSDD
FT                   ARYPRVDVYGSIEELERDFNVKIDDLHRPFIDTLTRLNPDDPTGKSVMRRVPDVFDCWF
FT                   ESGSMPFAQIHYPFENKEWFESADFITEYIAQTRGWFYTLFVLSTALFNREPFKNCICH
FT                   GVVLDVKGQKLSKRLNNYADPMEVFDRYGSDALRFLMLSGSIICGGNLLLDKEGNSIRD
FT                   VLKNVIKPIWNSYHFFTMYANADGIKAEVCKDYQSTIDRYMISKCFEAVESIQASMNSY
FT                   SSQEACKILIDFFEVLNNWYIRRSRERFWKSDLDQDKTDAYNVLYTVFYYILRAAAPLL
FT                   PLITENIWQGLKYEETSVHLANFPQLEKFDSQLIAKMDLVREVCNSALSIRNTFNIRIR
FT                   QPLGSMIIYHQSSCSFLEGEPLSVIPEFFPVIQVADTGIQCAADSNEYQEMIKDEVNVK
FT                   SLELVNRLEGIASLELKLNFPLLGKRIPDKIKKLVQYVKEGKWKQVENEQIFLGDESEN
FT                   YIIEKGEYELLLKANSEYSSVFDNNKGIVILNTELNDELILEGLARDVVRLIQETRKQA
FT                   DFHISDRIRVIIKTEEEKIKEAINTWFEYIKEQTLALSLDINTEIGTNFYSKEYQDLSV
FT                   SIER"
FT   gene            403331..405709
FT                   /locus_tag="WD_0424"
FT                   /old_locus_tag="WD0424"
FT   CDS_pept        403331..405709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0424"
FT                   /old_locus_tag="WD0424"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14147"
FT                   /db_xref="GOA:Q73HW6"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HW6"
FT                   /protein_id="AAS14147.1"
FT                   /translation="MEAVSNVEEGNNLGLATSEEEEEFFDAVEEQEPLANFNVPLSIFH
FT                   YKDYNSDFFTSWYNISSEIFKEINRTCPEKKILNLALSVLMLPYIAFTALGLVVCSRFQ
FT                   ANSKTQDSVGEDKTKKSETGVPKRLAYGVLATIAIFVNMAVLVALVVPATIALATFYLL
FT                   NRDLSHSLVTALKISMGRYSNKHQNIEVSFHEKEVTGPNIAWDMEIEFPPQFKRLLRDL
FT                   YENENNKWFDVTRNSEHSIVLKLSTNINLKNGLKPLRNEIKDVLATSIQEFAKTMEELI
FT                   KLEKKEITYDKLKELLNEFKSKVVDSIGPNLTSHLIQSAYQVAFIQAIKFQRDRRGEDF
FT                   SLEDEIKNSLVRQELESLRGIGQTRCNNIYKKLKEIHENSSLTNDTLKRGLEDLFKFEY
FT                   DDQEIERRLIKSVMKKVQGKLSQSDIPDKEKQSLRKQLEDLEKKVKVPSDKEASAKIND
FT                   FIEKMYLEIKKYKVQRLLREQKKGVLRLCKKLRKYGESGLAEIIEAFRVQDEGHLEKST
FT                   LEQTLKDQNKRLQAEQNNREKGHPGTRSIEVLLKRNEEILKALKQLELGKKELLINEET
FT                   KNDYKEELTSREKIKFAVIEDDLLKVFKLETFDEKEIKKLLERAELEYCLAEKRIKYPV
FT                   IKTKDNIKHFSQNLLSPLIDNLTKNIINNIPGNSEGCIQKVKNWSKVMFGAIKIGASNA
FT                   YKETTERKALNVAHNTYKEGETFLQCFQSNYEGIGAFLGNLFSDDGVTFKNDVWPKIEE
FT                   HLHGMWDRFFKDIEFNIGNKLDEVSVTQQRQETMIVTQR"
FT   gene            complement(405700..408039)
FT                   /gene="pheT"
FT                   /locus_tag="WD_0425"
FT                   /old_locus_tag="WD0425"
FT   CDS_pept        complement(405700..408039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="WD_0425"
FT                   /old_locus_tag="WD0425"
FT                   /product="phenylalanyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="Identified by similarity to EGAD:16045; match to
FT                   TIGR00472 protein family HMM TIGR00472; match to PF03483
FT                   protein family HMM PF03483; match to PF01588 protein family
FT                   HMM PF01588; match to PF03484 protein family HMM PF03484;
FT                   match to PF03147 protein family HMM PF03147"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14148"
FT                   /db_xref="GOA:Q73HW5"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HW5"
FT                   /protein_id="AAS14148.1"
FT                   /translation="MKFTLSWLLEYLETNASLEEITDKLTHIGLEVEDVIDNSRLTGFI
FT                   VAEVLEVVPHPNADKLKLCKVDDGSKILQIVCGANNVREGMKTVLASLGSTLPESDFTI
FT                   KPTKIRGVLSEGMLCSASELALVQEESEGIIELSDDYKVGDKFFNCDPVIDINVTPNRG
FT                   DCLGIYGIARDLAATGIGTLKTLSIPQLTSSINSPIDVEVTDGESFISGIYIANVKNQE
FT                   SPKWLKDRLESIGMRSISAIVDITNYIMISFSRPMHAYDAKKIEGELTVRKANDGEKFA
FT                   GLNGKEYLLNKDISVIAGDKNIHGIAGIIGGKCSECTLETTDIFLESAWFDPISITKSS
FT                   RQLGISTDASYRFARSVDPEFTFDGLNLAAKMILDLCGGETSSVVSAGSLDSADTKVSF
FT                   DYQDVNKFGSVSVSPDEVLDILTKLGFSIDKKTEGNWNVQVPSWRPDVTIPADLIEEVT
FT                   RIYGYDKIKEEPLPNNVEEVDSTYDNLRILMTNRGFHEVLTWSFMSESTAEKFGYSNKL
FT                   FIIDNPFNNSFNIMRPSIMPNLLQVTADNIAHGISDLAIFEIGPIYDGEAQSKYVLSGI
FT                   RSGNNLPRNHYNTDRKVDVFDAKADCIAALEFFNVNCDNLTIEKAEKEHYHPGKSGTLS
FT                   FKNKVAGYFGELHPNILDLFDIKQKVVGFEVILENIENLPVSRKKFIDYKYQSVKRDFA
FT                   FIVNKDVEVGNIINVIKKSSELITEVLIFDVYHGNNIEPNKMSIALSVTFCSPIHTLTE
FT                   KEIQKESSAIVNLVCENTGGTLRTYR"
FT   gene            complement(408152..408415)
FT                   /locus_tag="WD_0426"
FT                   /old_locus_tag="WD0426"
FT   CDS_pept        complement(408152..408415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0426"
FT                   /old_locus_tag="WD0426"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14149"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HW4"
FT                   /protein_id="AAS14149.1"
FT                   /translation="MNEIDFINTNHPLNLEQEFGNGYIESVDCFLDEDTRDYYIGLNNA
FT                   IIHFFFDGNIDEDAWDYESLKFFLEIDLKGDIEKILSLRKKI"
FT   gene            408645..409370
FT                   /gene="atpB"
FT                   /locus_tag="WD_0427"
FT                   /old_locus_tag="WD0427"
FT   CDS_pept        408645..409370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="WD_0427"
FT                   /old_locus_tag="WD0427"
FT                   /product="ATP synthase F0, A subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="Identified by similarity to SP:P15012; match to
FT                   TIGR01131 protein family HMM TIGR01131; match to PF00119
FT                   protein family HMM PF00119"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14150"
FT                   /db_xref="GOA:Q73HW3"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HW3"
FT                   /protein_id="AAS14150.1"
FT                   /translation="MALNPLEQFKVYTIIELPRLFGYDVSFTNSSFFTMISVILMILFL
FT                   LFGIKKGSVIPGYLQAAVEYVYDFVISIIENNTGSKGLQHIPLIFTVFIFILSCNLVGV
FT                   LPYSFTVTSHVIVTFALSMVVFIYITIVGFKEREVEFLRILLPKGTPSWLAPIIIIIKL
FT                   FAYLVRPVSLSIRLAANMIAGHTIIKVIAGFIVNMNIFFTPAPFLFIIALIGFEVFVAI
FT                   LQAYIFTILTCVYLSDAVK"
FT   gene            409430..409657
FT                   /gene="atpE"
FT                   /locus_tag="WD_0428"
FT                   /old_locus_tag="WD0428"
FT   CDS_pept        409430..409657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="WD_0428"
FT                   /old_locus_tag="WD0428"
FT                   /product="ATP synthase F0, C subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="Identified by similarity to EGAD:13924; match to
FT                   PF00137 protein family HMM PF00137; match to TIGR01260
FT                   protein family HMM TIGR01260"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14151"
FT                   /db_xref="GOA:Q73HW2"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HW2"
FT                   /protein_id="AAS14151.1"
FT                   /translation="MDLVALKFIAIGLAVFGMLGAGLGIANIFSAMLNGIARNPESEGK
FT                   MKSYVYIGAAMVEIMGLLAFVLAMLLIFAA"
FT   gene            409661..410140
FT                   /locus_tag="WD_0429"
FT                   /old_locus_tag="WD0429"
FT   CDS_pept        409661..410140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0429"
FT                   /old_locus_tag="WD0429"
FT                   /product="ATP synthase F0, B subunit, putative"
FT                   /note="Identified by match to PF00430 protein family HMM
FT                   PF00430"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14152"
FT                   /db_xref="GOA:Q73HW1"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HW1"
FT                   /protein_id="AAS14152.1"
FT                   /translation="MPQLDVSTFFSQVFWFLIFFSSLFFVVSCLFLPKLDEIISTRSKE
FT                   VLGSFNSSVHLLRLTEDQITKYNAALTQARIQAKKIIDDALAQVEEMRANVKNILEEED
FT                   KKKSKLIEKKVAEFKSEYTDQLKQMATSIALIYYTKLTNSEIEEEFIADLVSKEF"
FT   gene            410149..410625
FT                   /locus_tag="WD_0430"
FT                   /old_locus_tag="WD0430"
FT   CDS_pept        410149..410625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0430"
FT                   /old_locus_tag="WD0430"
FT                   /product="conserved domain protein"
FT                   /note="Identified by similarity to EGAD:167508"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14153"
FT                   /db_xref="GOA:Q73HW0"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HW0"
FT                   /protein_id="AAS14153.1"
FT                   /translation="MSTSLIIGLAFLVSFVLSYKLLKKVIKNALNNKRNKSKFSSEETE
FT                   KFRKDMLEYYKKSSKKYKELDAEVNKMMNEALDKANSIIKHNRQQLDQTLDDNAHSNLK
FT                   KVTDQVEKALRDLQANTASIAADAVKKIMHERKDDKRSSEVISSFSRDLNKKLH"
FT   gene            410631..412229
FT                   /locus_tag="WD_0431"
FT                   /old_locus_tag="WD0431"
FT   CDS_pept        410631..412229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0431"
FT                   /old_locus_tag="WD0431"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /note="Identified by match to PF00535 protein family HMM
FT                   PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14154"
FT                   /db_xref="GOA:Q73HV9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HV9"
FT                   /protein_id="AAS14154.1"
FT                   /translation="MPILQADNVEKIKFDSSLCKEQEKLFYYKFNIIPWQKLNDTTFFM
FT                   VEDTSRDINRWVEAHYGIDYVLIKVDSEQILNLLNSHFGISEFASNYLYYKNPNFSAKS
FT                   IKLSSIFFASFFIVTSILTLTEKYTYFALMLIFIIGCSSYLFKFIATVFSLCETSNQKV
FT                   DYSKLNEEDFPIYTILLPAFKESAVIEQLIESIESLDYPKSKLDVKLQVESDDQETLAA
FT                   IEKYTLPQYFEVIKVPHSLPRTKAKSCNYAMSFARGKYAVIYDADDKPDPLQLKKALIE
FT                   FNKDDDKLACVQAKLNYYNCDYNFLTKFFSLEYMNWFQYLLPGFQKMNMPIPLGGSSNH
FT                   FSVKILKEVFFWDTYSVTEDADLGLRLAQMGYKTRMIDSETLEESPIAVFAWIKQRARW
FT                   IKGYMQTYIVHLKNIKSLYKHTGFKGILLLNLFVGSAAFIFFTTPFLLLSLILTKVLNE
FT                   LFLYYFVVVYVTNLILLVIAVKQQKMPFYFYIVSIFFPVYSLLHSVAAFLALWEFILYP
FT                   ERWNKTQHGLWKQNL"
FT   gene            412187..413239
FT                   /locus_tag="WD_0432"
FT                   /old_locus_tag="WD0432"
FT   CDS_pept        412187..413239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0432"
FT                   /old_locus_tag="WD0432"
FT                   /product="cytochrome c oxidase assembly protein"
FT                   /note="Identified by match to PF02628 protein family HMM
FT                   PF02628"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14155"
FT                   /db_xref="GOA:Q73HV8"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="InterPro:IPR023754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HV8"
FT                   /protein_id="AAS14155.1"
FT                   /translation="MEQNSAWFMEAKPVAIWLFLCSVMVILMVGIGGFTRLSKAGLSIT
FT                   EWKPITGTLPPLSEQDWLQEKLKYEATPEYKALNYGISMEEFRAIYLIEYVHRLVARLT
FT                   GLVFVLPFIYFTLRRKISKKVVIKLFVALLFGALQAFAGWYMVKSGLVAKPHVSHYRLA
FT                   LHLLLALIIFALFSYQFFDYQIRPKQTKLKISCNTKYYVGIILVLIMIQIIFGAFVAGL
FT                   NAGLIYNTFPLMDGQIVPEDLFFLQPTWLNIFENRATVQFIHRALALLILTLVVILTVK
FT                   NASIKPVYIMLLSVIIQIILGVITLLLHIPIAIAIAHQVFSFILFGSSLYFLCYLRKQT
FT                   TSPICTFFPS"
FT   gene            complement(413188..415263)
FT                   /gene="pccA"
FT                   /locus_tag="WD_0433"
FT                   /old_locus_tag="WD0433"
FT   CDS_pept        complement(413188..415263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pccA"
FT                   /locus_tag="WD_0433"
FT                   /old_locus_tag="WD0433"
FT                   /product="propionyl-CoA carboxylase, alpha subunit"
FT                   /EC_number="6.4.1.3"
FT                   /note="Identified by similarity to EGAD:163374; match to
FT                   PF02786 protein family HMM PF02786; match to PF02785
FT                   protein family HMM PF02785; match to PF00289 protein family
FT                   HMM PF00289; match to PF00364 protein family HMM PF00364;
FT                   match to TIGR01369 protein family HMM TIGR01369"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14156"
FT                   /db_xref="GOA:Q73HV7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR041265"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HV7"
FT                   /protein_id="AAS14156.1"
FT                   /translation="MIEKKYSKILIANRGEIACRIIRTAHKMGISCVCIYSDADVNSVH
FT                   VRQADESRYIGPSPSCLSYLNIEKICEVAVETGAEAVHPGYGFLAENPDFPRALQKHNI
FT                   DFIGPSAETIEVTANKITAKEAARKAGVNVVPGYMGKISNAAHAAQVAKEVGFPVMLKA
FT                   ASGGGGKGMRIVNSKKEIELAFTSATNEAEKSFKDGSIFIEKYIELPRHIEIQIIADKY
FT                   GNIVCLGERECSIQRNNQKIIEETPSPFISEEVRQKMYVQCVSLAKQVGYFSAGTVEFV
FT                   VDQDQNFYFLEVNTRLQVEHPVTEFITGIDIVEEMIRTSCGEKLRFNQDDIKLTGSAIE
FT                   SRICAEDPSKKFFPSSGRIKYYDKPGENDYVRIDDGVAAGSEISMFYDSMIAKVITYGK
FT                   DRVEAISRMQKALSECYIEGVTNNIEFLESIFHHPNFIAAKLHTRFIPDHYPSGFHGDF
FT                   VTEEYIKIFIFTALYVHLENEERYHHKAVNETSQVSFQCVTLESSKKEGAPVSATRMAG
FT                   DRARDLFIVNINDNEYSVNAKYQDNILITVYNHNKYSVIGKWKSSYRLLYITINDDTNI
FT                   ALKIERQGSKYFIRHAGMKAECCIFKPHVAELSRLMLNNETEGISADAVKSPISGLLVK
FT                   LHVNVGDQVEIGQPLFVVEAMKMENIICAEAAMVIKNIPVQEGKNVQIGDVVCFLK"
FT   gene            complement(415336..416091)
FT                   /locus_tag="WD_0434"
FT                   /old_locus_tag="WD0434"
FT   CDS_pept        complement(415336..416091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0434"
FT                   /old_locus_tag="WD0434"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14157"
FT                   /db_xref="GOA:Q73HV6"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HV6"
FT                   /protein_id="AAS14157.1"
FT                   /translation="MDGLVDIAKLLSDNEANINWRYTGPFDKTKQRVQAGNLLHLAARI
FT                   QNKGKFVDICKKNIASVTAHNEYGDNPFHEAARSGILLPAVQEIVNDLEKEANNKITKA
FT                   EEAGDRKEVSRLKEELKCNKKYIKDALCSKGYAFNKKRETPLYYLNAAQQKEIKQIAGI
FT                   KDSFICNQKFHLCLYIIGAIACIAALCLSLYFLFLVSQSFALSSMVAIASGGVTYLSVK
FT                   ACSEIHALHNESTLVENANVQLAGESLGV"
FT   gene            416241..417662
FT                   /gene="gltX"
FT                   /locus_tag="WD_0435"
FT                   /old_locus_tag="WD0435"
FT   CDS_pept        416241..417662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="WD_0435"
FT                   /old_locus_tag="WD0435"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="Identified by similarity to EGAD:16197; match to
FT                   TIGR00464 protein family HMM TIGR00464; match to PF00749
FT                   protein family HMM PF00749"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14158"
FT                   /db_xref="GOA:Q73HV5"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HV5"
FT                   /protein_id="AAS14158.1"
FT                   /translation="MPGIVTRFAPSPTGFLHIGGARTALFNWLYAKHHGGRFLLRIEDT
FT                   DRKRSTQEAIDAIIEGLRWLGMSYDGEIVYQSKRIERHKEVANLLVEKGRAYHCYCPED
FT                   EVAEKKAKAREEGKIYKHKCTTKPPSCHPSSRHWKNMWSRAGMTSGVRSVVRFKVPDSQ
FT                   EIVIDDKIYGQIKVNSDQLDDIVILRSDNTPTYIFAVVVDDHDAGITDIIRGSDHLTNT
FT                   FKHLLIYQALDFDIPRFAHVPLIHGEDGNKLSKRHGATSVCDYEKMGILPKAMRNYLLR
FT                   LGWSHGNDEIISDEQAIEWFNLESIGRSPARLDFKKLEHLNNHYISNMSNEDILTLMLR
FT                   ENTLTDKKKGYLLQGLTELKKRANYLTELLDLAKFYIQDPPLDLSEEAEQIVKSNLDII
FT                   KLLASFLSKIGDENWNKGFLSSQIKECAKLHDMKISDVYHSLRAPITGVMDAPGIIDIM
FT                   VILGKDECIRRLQAI"
FT   gene            417952..418119
FT                   /locus_tag="WD_0436"
FT                   /old_locus_tag="WD0436"
FT   CDS_pept        417952..418119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0436"
FT                   /old_locus_tag="WD0436"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14159"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HV4"
FT                   /protein_id="AAS14159.1"
FT                   /translation="MSFFLLGKFLKHLQRRLVAIKSSLILLFKRLKHKKRQYFKADNNH
FT                   GASFAFFFVW"
FT   gene            418353..420152
FT                   /gene="sdhA"
FT                   /locus_tag="WD_0437"
FT                   /old_locus_tag="WD0437"
FT   CDS_pept        418353..420152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="WD_0437"
FT                   /old_locus_tag="WD0437"
FT                   /product="succinate dehydrogenase, flavoprotein subunit"
FT                   /EC_number="1.3.99.1"
FT                   /note="Identified by similarity to EGAD:22182; match to
FT                   TIGR01816 protein family HMM TIGR01816; match to TIGR01812
FT                   protein family HMM TIGR01812; match to PF00890 protein
FT                   family HMM PF00890; match to PF02910 protein family HMM
FT                   PF02910"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14160"
FT                   /db_xref="GOA:Q73HV3"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HV3"
FT                   /protein_id="AAS14160.1"
FT                   /translation="MDKSAYEIIEHEYDVVVVGAGGAGLRATLGMAATNFSVACISKIF
FT                   PTRSHTVAAQGGISAALGNIGEDDWRWHAYDTIKGSDWLGDQDAIEYMCKNAAKAVIEL
FT                   ENFGVPFSRTEDGKIYQRSFGGMTTHFGKGKSAQRTCAAADKTGHAILHTLYQQCLKFN
FT                   AEFFVEYFVIDLIMDSETCCGVLAWSLCDGTLHRFRAHRVVLATGGYGRVYFSATSAHT
FT                   CTGDGNGMVVRAGLPLEDMEFVQFHPTGIYGSGCLMTEGCRGEGGYLVNSQGEKFMERY
FT                   APKAKDLASRDVVSRAITIEIREGRGVGPKKDHMYLTIAHLDPEVIKLRLPGISETART
FT                   FAGVDVTKDPIPVIPTVHYNMGGIPTNYYGEVITLKQGKEEVVDGLFAIGEAACVSVHG
FT                   ANRLGSNSLLDLVVFGRAAALRAKEKLKSGTPHKKLHSDCTDWIVDRFNKMRFASGGLK
FT                   VAKIRGEMQNTMQKYASVFRVAEVLEEGKKAIKKVAKMMPDISLEDRSMMWNSDLVEAL
FT                   ELANMIPQAVITMECAANREESRGAHAREDFPERDDKNWMKHTIAWLEEKKGQINVKID
FT                   YKKVAEKTLSGEIDFIAPEKRVY"
FT   gene            complement(420124..422022)
FT                   /locus_tag="WD_0438"
FT                   /old_locus_tag="WD0438"
FT   CDS_pept        complement(420124..422022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0438"
FT                   /old_locus_tag="WD0438"
FT                   /product="ankyrin repeat domain protein"
FT                   /note="Identified by match to PF00023 protein family HMM
FT                   PF00023; match to PF00023 protein family HMM PF00023"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14161"
FT                   /db_xref="GOA:Q73HV2"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HV2"
FT                   /protein_id="AAS14161.1"
FT                   /translation="MGIDITALTTNADKLGECIDKNKKQEQDRKDEQLYGIIERKVKKE
FT                   EHKREKPRGQDGTLKKCKRLFEKDASPEVLTKLEESLREQEKYYRYYVQCFLPVLDKAI
FT                   ERSKKISNETKERVKQAISEITYNSKYCNQNDRRDSGIESDYSSDAGDDYEKHSISNPN
FT                   TANEDQEVEKSNEITNSNALLLKAIKNGNNRKFEKYLKDCTDISSIKDEKGNNILHLIV
FT                   SLEKKQKRKFLGILIKMVTKKDLAQLINSENQTPLQVALINKITKEKHESHTIQDNDNT
FT                   LKFLRKLLEHGASHDQLELPEESLKKLSKGQNEYYCKFLKKLAKKAELKQEIKIKTEAK
FT                   VKEIVAHTVNTPNSNSDYPLHLAIKNNDKELFKELLQEGANISLEGANKNNALHHIALL
FT                   KGEYKIKYLKLILDFEKKGVISSEKLHKAINAQNKDDKYPAQVALIRQTEKISSKLKDF
FT                   SRWVRSRPTKHYYTAEFCAELLQNGAENKSDHITIPKEHRKQKYYQTTKRIKDITGVSP
FT                   DPETQEELEEHFSKKNARKNISLPVKWILGGLIFATVFSALAGNMIAAAALSVTIAVCA
FT                   MCYPIYLKLENALNARSSDQSEHTENPATKMSDVSILRQFMNKLDGLTNKPSSLAL"
FT   gene            complement(422317..422934)
FT                   /gene="gmk"
FT                   /locus_tag="WD_0439"
FT                   /old_locus_tag="WD0439"
FT   CDS_pept        complement(422317..422934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="WD_0439"
FT                   /old_locus_tag="WD0439"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="Identified by similarity to EGAD:162873; match to
FT                   PF00625 protein family HMM PF00625"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14162"
FT                   /db_xref="GOA:Q73HV1"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HV1"
FT                   /protein_id="AAS14162.1"
FT                   /translation="MQRKMTVKSEGVLLVLSSPSGAGKTTISAKLLEQSTNLVRSVSMT
FT                   TRKPRPGEINGKDYFFVTEEKFHELCKAGQMLEYAKVFENFYGIPRDFIEQNLSSGISV
FT                   LLSIDWQGAFHLFKLMRKKVVSVFILPPSMEELRLRLQKRNSDDASEIERRLAEAQKEI
FT                   SKRDKYDYVIINDDIDKSVEEISSILNKERLKKLKEKPSLED"
FT   gene            complement(422906..424711)
FT                   /locus_tag="WD_0440"
FT                   /old_locus_tag="WD0440"
FT   CDS_pept        complement(422906..424711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0440"
FT                   /old_locus_tag="WD0440"
FT                   /product="pentapeptide repeat domain protein"
FT                   /note="Identified by match to PF00805 protein family HMM
FT                   PF00805; match to PF00805 protein family HMM PF00805; match
FT                   to PF00805 protein family HMM PF00805; match to PF00805
FT                   protein family HMM PF00805; match to PF00805 protein family
FT                   HMM PF00805; match to PF00805 protein family HMM PF00805;
FT                   match to PF00805 protein family HMM PF00805; match to
FT                   PF00805 protein family HMM PF00805"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14163"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HV0"
FT                   /protein_id="AAS14163.1"
FT                   /translation="MIRFLILILVGHLCYGNETNDEKNQISDFLNALRDAKYVSYSKKD
FT                   FAEFLVQCHKEGVPEDFKKGFGSNLNGANFNQLYLSKSVFDGVSLIGADFSNTDLSDVS
FT                   FIDVDLRGANFSNANLHGIKIKGTNLSFTKFVSANLTDIVFDQSNVSYADFISSDLKKV
FT                   SMHNVIGLHTNFSNVKMNFSNLSNSNVSHVNFSDSEINDTVMQKNNLDNASFFGVDAYK
FT                   LKIQFSSLKNANIYGAELKESDFTGSNLSDACLNSSIIINSNFDETDLSNTQISYVNDD
FT                   NSSFVQSILNGSKIKHAYVSEANLHDADLSNIDFSFSELHQVNVSNADIRHGKFHNTKV
FT                   ANSNMNGSFFDHSLFTYVKIEDSDLSTTSMYKIKIQDSQVYNSTLSRHNIDSSEIENST
FT                   FFNLLADNSSWSNLKVTNSNFIESDFRSSLLHANAFRKTSFFLSNLSNSTISDMSFHSS
FT                   NIYKSSVADVHLTDCKFDNSILIDNQGQKKLAGLENAITSIGDLQEKISQGEKFNVNYS
FT                   YFEFKNMNLENADFSNSTLSRAKFVNVNLNKANFEKTDLRYTVFDNSSLIGTNLSNSNL
FT                   EGSSFLNSDPKSTMLKNAKKNDRKK"
FT   gene            complement(424704..425912)
FT                   /locus_tag="WD_0441"
FT                   /old_locus_tag="WD0441"
FT   CDS_pept        complement(424704..425912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0441"
FT                   /old_locus_tag="WD0441"
FT                   /product="ankyrin repeat domain protein"
FT                   /note="Identified by match to PF00023 protein family HMM
FT                   PF00023"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14164"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HU9"
FT                   /protein_id="AAS14164.1"
FT                   /translation="MLGIFMKNILYFILLAVVFGSPILFAVEQLEEKKIESVHKNENVC
FT                   VRKQDSTNQKDELKSNVDAKQTQEAESKRLDGTTDKEKLQHNENKAFVVEKTISEGERI
FT                   DKDLPNDQLEGSTDKFAQNLPNVANKEVNKDLKPEPLPLSADLNENTANPQKNLQADQK
FT                   IDIKDNELSKSDASQLLEGKKEKVENQSEEKKVKETNSNSKDRNRVKPITKKDEEEQSE
FT                   KKSLQKWTKLNREPIKEWGHKDIQSKSIYKRQYDSLNEHLPTTVFIDDYSKQFFYCIKK
FT                   NNLTCLRGVISKLEKIGLTIQEILRFRNKLGDTPLIYSVKQGEVDIVRFLLLQGADLRV
FT                   VNNNFQSPIDIAIEKKQINIINAIAEMMPHLLEDRKIDNKESSAMYDWAVKTKEIQCDK
FT                   QDD"
FT   gene            complement(426165..427259)
FT                   /locus_tag="WD_0442"
FT                   /old_locus_tag="WD0442"
FT   CDS_pept        complement(426165..427259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0442"
FT                   /old_locus_tag="WD0442"
FT                   /product="GTP-binding protein YchF"
FT                   /note="Identified by similarity to EGAD:163307; match to
FT                   TIGR00092 protein family HMM TIGR00092"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14165"
FT                   /db_xref="GOA:Q73HU8"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HU8"
FT                   /protein_id="AAS14165.1"
FT                   /translation="MSFNCGIVGLPNIGKSTLFNALTESSAAEAANYPFCTIEPNIGKI
FT                   SIKDQRLKQIAAIAGSEKVIYNQLEVVDIAGLVKGASKGEGLGNKFLSHIREVDAIVHL
FT                   LRCFTDDDISHIHSKIDPISDAEVVEMELILADIDSIEKRLPQLEKKAKQGDKELKRQL
FT                   ELMQEVLATLKLGKPARSLENINEDEMKLLQLLTTKPVMYVCNVEDTNVITGNELSKKV
FT                   ERMAEENKSKFYCISAKLEADIANLDSEEEKQSFLSEFGLQESGLDGVARIMYEVLSMI
FT                   TFFTVGPKEARAWPVKIGSTADKAAGVIHTDFEKGFIKAETISFADYIKYGSESACKDA
FT                   GKIRFEGRDYIVQDGDIMHFRFNV"
FT   gene            427377..428282
FT                   /locus_tag="WD_0443"
FT                   /old_locus_tag="WD0443"
FT   CDS_pept        427377..428282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0443"
FT                   /old_locus_tag="WD0443"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14166"
FT                   /db_xref="InterPro:IPR003323"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HU7"
FT                   /protein_id="AAS14166.1"
FT                   /translation="MTTAKKRKLPSDLHDVEVGIKRPRISGQEITLLNSNPYPDNFYVG
FT                   QAIGNGSCFFDSFRQSLEQQTGEQVTAEKLRNDCREFAQKNPPKWFTNAIVNSHDNNGQ
FT                   HRSETVDNYTADIMRNSRWGDPDVEGRILCEKYKVKLHVIENQTVDNQDLSLHELIDNS
FT                   GSKSAGEYNKVDYDDSSTVHIINKGGLHFEPLLDRNKSSAKQLQEQEDFLLAKKLQLDE
FT                   ILEYCNLSKDISERAEVEKGFDKLLAENADGKIGDVVGQCVSDIKQRIEQQNPSSLLRC
FT                   GTESMAEPFHQQRAPQLVKS"
FT   gene            428358..429533
FT                   /locus_tag="WD_0444"
FT                   /old_locus_tag="WD0444"
FT   CDS_pept        428358..429533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0444"
FT                   /old_locus_tag="WD0444"
FT                   /product="poly A polymerase family protein"
FT                   /note="Identified by match to PF01743 protein family HMM
FT                   PF01743"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14167"
FT                   /db_xref="GOA:Q73HU6"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HU6"
FT                   /protein_id="AAS14167.1"
FT                   /translation="MQVDHETSLIIDAIEEFGGEARLVGGCVRDSILQRDVHDIDLATN
FT                   LLPNQTIKALKLRNIKTIPTGLKHGTITAVLNQRSFEITTLRHDVKCDGRHAKVEFTNN
FT                   WQADASRRDFTFNALYADKHGHIYDYFGGIEDLKARRLNFIGNAEDRIKEDYLRILRAF
FT                   RFHAKICVGDLSDEILSVCKKHSHMIQNLSGERIRDEILKLLECNDPFPTLKSMQESDV
FT                   LQKIIPKEVKCEILSSPLLLGTDALVKLALLLRATKKNDRLSLGEYVSKFLRLSNKQKK
FT                   KLLFLLSNDIKTELSEKEQKKYISLFGRELYCDLVKICGVESGENVDEYISFANTFNIP
FT                   KFPLSGDDLISIGHQPGKSLGRNLELLKQHWEDSSYTLTKEELVLYAKNLF"
FT   gene            complement(429517..430764)
FT                   /locus_tag="WD_0445"
FT                   /old_locus_tag="WD0445"
FT   CDS_pept        complement(429517..430764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0445"
FT                   /old_locus_tag="WD0445"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14168"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HU5"
FT                   /protein_id="AAS14168.1"
FT                   /translation="MQDKVDEQQKTIFDQYMIIREQGEEIEATRKDNESLQAQIIELKS
FT                   RLKDKEDKLIELNQQWQASKLVALLKSQTDKLCQAKDKNTELENKVSDLGHENKALRLS
FT                   VNTLTAQLGEMENLGKQLQSVQESKQQLEIDLEGQLKADTKKLQEAKEGQLAKKAGAVS
FT                   TVSTAKSTLSKLRNLPNKLSRDKGLNNFLSGKNEELKKGFPEFKEKHFCHNVLNETIKS
FT                   LSNQDDGKFESSKLLELLESNLKQSAREIIEANVKEVVNGHCNIGKNMGKELRDDTLKA
FT                   KLSPSARKCVKKLEFNKQEGVNKIVDSILHSFNSKNNNNNDSGELLKEIVTGKLTEAKM
FT                   KCFSNKIQELQLALSIRDKFLSPDQGMCNQTQGGVNEYQLTEKAKKEHIPNSSMSSPNI
FT                   ASIHSLNSQKAVRIGS"
FT   gene            complement(430924..431292)
FT                   /locus_tag="WD_0446"
FT                   /old_locus_tag="WD0446"
FT   CDS_pept        complement(430924..431292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0446"
FT                   /old_locus_tag="WD0446"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14169"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HU4"
FT                   /protein_id="AAS14169.1"
FT                   /translation="MLNINNKVNYEINIKRKEKKYSWSTVFAWLYLKTIGRILPKRWNR
FT                   WAENILYYDKTTANNEVQTDAFKTIDGSVQVDLKPEVVEKESQSVVINKDGGVQTDGVA
FT                   LITEEDDEALEEQLEGIN"
FT   gene            complement(431428..431961)
FT                   /locus_tag="WD_0447"
FT                   /old_locus_tag="WD0447"
FT   CDS_pept        complement(431428..431961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0447"
FT                   /old_locus_tag="WD0447"
FT                   /product="phage prohead protease"
FT                   /note="Identified by match to TIGR01543 protein family HMM
FT                   TIGR01543; match to PF04586 protein family HMM PF04586"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14170"
FT                   /db_xref="GOA:Q73HU3"
FT                   /db_xref="InterPro:IPR006433"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HU3"
FT                   /protein_id="AAS14170.1"
FT                   /translation="MNKKFLYSPLSIKSIGENGVFSGYASVFNIVDKQNDLILPGAFKE
FT                   NLNRNKIKLLWQHNPDEPIGSIIDIYENDVGLYITAHLLLGIQKAEEVYLMLKTGTING
FT                   LSIGYIPIEYDVDHKSGARVLKQVELWKVSLVTFPANLAAQVINVKNQNNEQGVLARAI
FT                   EKANAVLADMYISA"
FT   gene            complement(432447..432614)
FT                   /locus_tag="WD_0449"
FT                   /old_locus_tag="WD0449"
FT   CDS_pept        complement(432447..432614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0449"
FT                   /old_locus_tag="WD0449"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14171"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HU2"
FT                   /protein_id="AAS14171.1"
FT                   /translation="MMSFQCLTLESSLYYAATWLKLSLLDPSGLCCIASYDGLKIKKIG
FT                   NISSLLFWYL"
FT   gene            433214..434311
FT                   /gene="gap"
FT                   /locus_tag="WD_0451"
FT                   /old_locus_tag="WD0451"
FT   CDS_pept        433214..434311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gap"
FT                   /locus_tag="WD_0451"
FT                   /old_locus_tag="WD0451"
FT                   /product="glyceraldehyde 3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /note="Identified by similarity to EGAD:107759; match to
FT                   TIGR01534 protein family HMM TIGR01534; match to PF02800
FT                   protein family HMM PF02800; match to PF00044 protein family
FT                   HMM PF00044"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14172"
FT                   /db_xref="GOA:Q73HU1"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HU1"
FT                   /protein_id="AAS14172.1"
FT                   /translation="MTIRVGINGLGRIGRGVLRAIFEIEEYSKQIEVVAVNGSLSAKQH
FT                   AHLIKYDSVHGKFSGDIDFNESQNWISINGKKFSLYRERNPENIPWNVDVILECTGAFN
FT                   KREEAIRHNAEKVIVSAPVPDADVTIVYGVNDDMLEKEHKVISAGSCTTNCLAPIVKVL
FT                   HSSLGIKSGFMTTIHAYTNDQNVLDGNHKDLRRARACGLSMVPTTTGAAKTIGSIIPEL
FT                   KGKLDGTAVRVPVSNVSMVDFTFTTDKKATVKEINEMFKDAALSSTSFQRVTLESNFWI
FT                   PVSATRMTSEGTRMTEGYPMSNVLSICEEPLVSIDFVHNPYSAIVDLTGTYVTGDICRV
FT                   AAWYDNEWAFSLRMLDIALLSYSKV"
FT   gene            434308..435069
FT                   /locus_tag="WD_0452"
FT                   /old_locus_tag="WD0452"
FT   CDS_pept        434308..435069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0452"
FT                   /old_locus_tag="WD0452"
FT                   /product="MttB family protein"
FT                   /note="Identified by similarity to OMNI:CC2001; match to
FT                   PF00902 protein family HMM PF00902; match to TIGR00945
FT                   protein family HMM TIGR00945"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14173"
FT                   /db_xref="GOA:Q73HU0"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HU0"
FT                   /protein_id="AAS14173.1"
FT                   /translation="MNWNSSKYASFYEHFAELRKRVIFCFLFFCVAFGFCYYFKENIYR
FT                   FLLAPLIEATKGSEGFSLIYTDLTEAFFVYLQVAIMSALLFSFPVFAWQFYMFLAPGLY
FT                   KSERAVLLPYLIATPVLFVTGATVVYYYIFPLAWKFFITFEHSGKSFGIPIEFMPSVSE
FT                   YLDLVLQFMFAFGTAFQIPVILTLMVRVGLLTTQSLSNKRRIAIVVIFIIAAILTPPDV
FT                   LSQVGLAIPMLILYELSILICRYIEKKKTKI"
FT   gene            complement(435123..435578)
FT                   /locus_tag="WD_0453"
FT                   /old_locus_tag="WD0453"
FT   CDS_pept        complement(435123..435578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0453"
FT                   /old_locus_tag="WD0453"
FT                   /product="arginine repressor, putative"
FT                   /note="Identified by similarity to GP:9295533; match to
FT                   PF02863 protein family HMM PF02863"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14174"
FT                   /db_xref="GOA:Q73HT9"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HT9"
FT                   /protein_id="AAS14174.1"
FT                   /translation="MHDNTLGEHILNIIQNHEILEQSDLQTLLKERGHNIPQATLSRKL
FT                   KKLKIAKVAGMYKVIDINQYRLPLILNMQISDFGLIVLHTQPGQASSLAYFLDQKYVIY
FT                   SLNNSKNIGIIGTIAGDDTVLLIIKSKAELNKVLQSIYETFPYLSPE"
FT   gene            435704..437085
FT                   /pseudo
FT                   /locus_tag="WD_0454"
FT                   /old_locus_tag="WD0454"
FT                   /note="amino acid ABC transporter,
FT                   permease/substrate-binding protein, putative, authentic
FT                   frameshift; This gene contains a frame shift which is not
FT                   the result of sequencing error.Identified by similarity to
FT                   OMNI:SA1916"
FT   gene            437069..437710
FT                   /locus_tag="WD_0455"
FT                   /old_locus_tag="WD0455"
FT   CDS_pept        437069..437710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0455"
FT                   /old_locus_tag="WD0455"
FT                   /product="amino acid ABC transporter, ATP-binding protein,
FT                   putative"
FT                   /note="Identified by match to PF00005 protein family HMM
FT                   PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14175"
FT                   /db_xref="GOA:Q73HT8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HT8"
FT                   /protein_id="AAS14175.1"
FT                   /translation="MIKMHNVCKLFNNVPVLNNINLIIEQSIVGLAGPSGSGKSTLLRC
FT                   IQKLEVLDSGSIECNDSTGFVFQDFQLFSHMTVWENLTYAPKLKNKTQDQSDSLLESLG
FT                   IASKKNDYPSNLSGGQKQRVALARSLMMNPRILLCDEPTSGLDVATIVDVVELLQSVRD
FT                   MGITMIIASHNLDFLTKISDRIILLKNGKIIVDINPKEIDEPTNYLKNNY"
FT   gene            437813..438193
FT                   /locus_tag="WD_0456"
FT                   /old_locus_tag="WD0456"
FT   CDS_pept        437813..438193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0456"
FT                   /old_locus_tag="WD0456"
FT                   /product="transposase, IS5 family, OrfA"
FT                   /note="Identified by similarity to GP:1256580"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14176"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IM0"
FT                   /protein_id="AAS14176.1"
FT                   /translation="MRKKYPTDLSEREWSRIEKHFRVSYKKGGRPPKYSKREILEAIFY
FT                   VLRTGCQWRYLPNDFPLWKTVYEQFRQWKKQGIFEKMNYEITKYSRRKIGRNEQPSACI
FT                   VDSQSVKTTEKGGSKAMMEVKK"
FT   gene            438304..438645
FT                   /locus_tag="WD_0457"
FT                   /old_locus_tag="WD0457"
FT   CDS_pept        438304..438645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0457"
FT                   /old_locus_tag="WD0457"
FT                   /product="transposase, IS5 family, OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14177"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IL9"
FT                   /protein_id="AAS14177.1"
FT                   /translation="MRTKYTKVKKMWADMGYQGRNLKNHIKEEYDIDIEIVKRPPCRFW
FT                   VHKDTPPELLPTREQGFKVQPRRWVVERTFAWVNRNRRLSKEYDLLTTSTENFIYLAMS
FT                   RVMLKREYA"
FT   gene            complement(439020..440219)
FT                   /locus_tag="WD_0458"
FT                   /old_locus_tag="WD0458"
FT   CDS_pept        complement(439020..440219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0458"
FT                   /old_locus_tag="WD0458"
FT                   /product="phage major capsid protein, HK97 family"
FT                   /note="Identified by similarity to GP:15155961; match to
FT                   TIGR01554 protein family HMM TIGR01554"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14178"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HT5"
FT                   /protein_id="AAS14178.1"
FT                   /translation="MSLTDIAHRINELASSWEQFKLINDRKLKEIESKGRADSATIEQL
FT                   CKVNNAIDSCKERLDLIETAAQRPEVNTDFSTSDKYFSDYIRKGMESGLSHKTLSGDDS
FT                   DIGGYLVTPHIVKRINKRVTDSSPMRQICSSQRISTETLDYIIEDFDRAGAGWSSETVD
FT                   DEDGGNKSKYDFAKDTDTPKIQKISVTTYELYAQPQISQKLLDDAFVDVESWLVEKIAE
FT                   TFSKEESEAFIKGEGTFQPKGILAYENGNSYNKIEQVKTEKLDSDSIMMLYYSLDEYYS
FT                   KNASFLMNRSTLKDIRLLKSQTGQYLWQPSLSLEAPDTLMGIPVYQSADMPPAPNNQLP
FT                   VIAMADFKQAYKIVDNRGMRILRDPYTNKPYVRFFVTKRVGGEVVNTSAIKLLKIASKY
FT                   "
FT   gene            440268..440561
FT                   /locus_tag="WD_0459"
FT                   /old_locus_tag="WD0459"
FT   CDS_pept        440268..440561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0459"
FT                   /old_locus_tag="WD0459"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14179"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HT4"
FT                   /protein_id="AAS14179.1"
FT                   /translation="MASIDVSHSCTNIAIWYIVNDVIPVLDTGIQLLCNLIKNVCFSVR
FT                   QLPLAHQLSYKQNFWIPVSSTGMTSSVVQFTFKNEYPYSYVLGTEMASFFIC"
FT   gene            complement(440754..441551)
FT                   /locus_tag="WD_0460"
FT                   /old_locus_tag="WD0460"
FT   CDS_pept        complement(440754..441551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0460"
FT                   /old_locus_tag="WD0460"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14180"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HT3"
FT                   /protein_id="AAS14180.1"
FT                   /translation="MSNINRIIREVIKEFRSKLPDKEIEEYSGKLNKLHIYQCNKHIIE
FT                   NKKLYHYTINGKTHAMGQHGHNFVKSLEVILRNKPQISLEEVIDFMEKIINFGIDSCYG
FT                   AFEMIFESRSGVTIDDAVNFVKDSLSSKFYGFHGSRIFKVILELNPESSLEEIEKQFSK
FT                   VVDPYFLNAWSRESERAFAKICRLCREGHVENMQKFDFSNFNLDQDSAGALRALLQYCV
FT                   DVSNQKALGDSHELHREEMEGIYKFDDNYDLNLDSDHNDSTWH"
FT   gene            complement(441601..442275)
FT                   /gene="pyrF"
FT                   /locus_tag="WD_0461"
FT                   /old_locus_tag="WD0461"
FT   CDS_pept        complement(441601..442275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrF"
FT                   /locus_tag="WD_0461"
FT                   /old_locus_tag="WD0461"
FT                   /product="orotidine 5`-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /note="Identified by similarity to EGAD:22316; match to
FT                   PF00215 protein family HMM PF00215; match to TIGR01740
FT                   protein family HMM TIGR01740"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14181"
FT                   /db_xref="GOA:Q73HT2"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HT2"
FT                   /protein_id="AAS14181.1"
FT                   /translation="MNPIICALDTQDLNKAISLANALRGKVGMVKLGLEFFAAQGLSGV
FT                   QEVAKCNVPIFLDLKLHDIPNTVAKTVEVIKVLNVEMLTLHISGGTKMLEEALSVVQGT
FT                   KIKLIGVTVLTSMSNEDLNELGVAREVKSQVILLAKLAKKIGLYGIVCSALEAQEVRRE
FT                   CGEDFKIITPGIRIDPGHDDQKRTATPKEAINSGADYIVIGRPITKTTSSAELILKSMK
FT                   EF"
FT   gene            complement(442306..443628)
FT                   /locus_tag="WD_0462"
FT                   /old_locus_tag="WD0462"
FT   CDS_pept        complement(442306..443628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0462"
FT                   /old_locus_tag="WD0462"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14182"
FT                   /db_xref="GOA:Q73HT1"
FT                   /db_xref="InterPro:IPR032733"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HT1"
FT                   /protein_id="AAS14182.1"
FT                   /translation="MSNLLSEANTFYFIASSLATLTLLTSLALIVTSNVPLPLILALAT
FT                   LSVLVLALSYKIISNNKKIEVERNKFAQKEQELENKITLGKEAEKAANKEVEKLKHELT
FT                   REKQNLDKRAKRLDQKVNESEVERESLLEEKKSLEKKLETAKNRTFEIDNELDKTRKEI
FT                   GKLNEQEEKLKLEISCLKKQLEERSRFIAKLKMEVDDNKHLELENKGLNDRIETLREVQ
FT                   KALREKKHELSEKVEALNKEKNKLSKEVEELREEQERLHANLDKLQCKIKEVNKEKKNL
FT                   SKELKEKFEELDEANGLIKNQSFELDGIRKDCNNEVKSLRNSLLERDSQIEDFLKEKEK
FT                   QVNFAQLLIRCVTDNIEEPIRNNDGKAILDTIQILKSALQGEIARLLPDETPSSSLEDL
FT                   GYESLFVSRSSTPTKLPNSLLTESYERSQFNQSESICKTQQ"
FT   gene            complement(444089..445303)
FT                   /locus_tag="WD_0463"
FT                   /old_locus_tag="WD0463"
FT   CDS_pept        complement(444089..445303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0463"
FT                   /old_locus_tag="WD0463"
FT                   /product="ATPase, AAA family"
FT                   /note="Identified by match to PF00004 protein family HMM
FT                   PF00004"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14183"
FT                   /db_xref="GOA:Q73HT0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HT0"
FT                   /protein_id="AAS14183.1"
FT                   /translation="MGDLYNKANAPYLIAGALATLVLLASGTLAVAPYVEFLSSVAAFN
FT                   VALPVALSLSILSVLVLVLSCKMISQNKKLDAQKAEPNEKNGLAKEQENIIQSLEPQIK
FT                   ELNKRLSSQYNEIEKLIASAAKKEELNKLNNEVKELKVKIASVATKEEINKLSNEVEKL
FT                   IGSAATKDEMEELKAKIASAATESKTQEKIFMKFCAKGEKRGKKAFEDFIFIKEIKTKL
FT                   VNIYESIKNNINIVSSAKSGDSEEEQEKIQRGFIFHGPGGTSKSSIVEAIGDQLISLTT
FT                   FIKVSGADLLEKSNINELFNKANENAPCIVLIDEIDSFGKGRTDANRVPLNYFFTRFDE
FT                   ADKGVTVFATTNVSLQDLDASLVRGSRLSSKLKFTMIEGSILKNILKDGLNEKIKSTSM
FT                   LSQEF"
FT   gene            complement(445370..447964)
FT                   /gene="valS"
FT                   /locus_tag="WD_0464"
FT                   /old_locus_tag="WD0464"
FT   CDS_pept        complement(445370..447964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="WD_0464"
FT                   /old_locus_tag="WD0464"
FT                   /product="valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /note="Identified by similarity to EGAD:103665; match to
FT                   PF00133 protein family HMM PF00133; match to TIGR01612
FT                   protein family HMM TIGR01612"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14184"
FT                   /db_xref="GOA:Q73HS9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014070"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022874"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HS9"
FT                   /protein_id="AAS14184.1"
FT                   /translation="MLKEKYGFKEVEDKCNILWEGSKVYRWNGEKDNTFTIDTPPPTIS
FT                   GKLHIGHIFSYCHTDFIARFQRMLGKDVFYPIGFDDNGLPTERLVEQTYKTRAKEVGRE
FT                   KLIEMCHEVIEKSKQEFKELFKSVGISYDWDLEYHTISKETVTLSQMSFIDLYNKGYAY
FT                   RKMQPILWDPVDKTAIAQAEIEDKVFESSLNTIVFSTEENEQINIATTRPELLPACVAV
FT                   FCHPEDARYTHLIGKTTVVPITETKVPIIADDKVKIDKGTGLVMCCTFGDELDIYWQQK
FT                   HNLPMKIIIDQDGRMSLHSVHGQKEEIWIPVSGHWDDTIGATGMTGERATQMTKEGGCD
FT                   QKEEWIPVSATRMTDDILNEINGLKVTAARKRIIEILTEKGLLVESTNISHSVKCAERS
FT                   GAPLEILPTYQWFIKTLEQKAQILDKVKECNWHPSNMRKRMEVWIEGLNWDWCISRQRY
FT                   FGVPFPAWYSKRKGEEGKIILAEIKALPIDPSKDLPKGYSKEEIIPDQDVMDTWATSSI
FT                   TPQLSALAVNSEFSLPNHRYDTIFPADLRSQSHEIIRTWAFYTILKAHYHANSLPWKNI
FT                   MISGWCLADDKKKMSKSKGNIITPHIILETYGADVVRYWAANSRLGVDTVYSENTFKIG
FT                   KRLVTKLWNASKFVSMFMEKHQVMSINSAHETMDKWILSKLYKVIERATNNLLQFEYCE
FT                   ALGAIEEFFWKDFCDSYLELVKKRAYGSSEATLSAKQSLAYVLNVILRLFAPFLPYITE
FT                   EIYHQLYSYNSVHNQSNWPSKEELIYDKYSEEMGDNVIQILNIIRKIKADNNVSVKHLI
FT                   KKLMIKADLRKDKLDQSAQNDLQAVCNAETIEWMQSELETEDEKYIVNIDLY"
FT   gene            448430..449323
FT                   /locus_tag="WD_0465"
FT                   /old_locus_tag="WD0465"
FT   CDS_pept        448430..449323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0465"
FT                   /old_locus_tag="WD0465"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14185"
FT                   /db_xref="GOA:Q73HS8"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HS8"
FT                   /protein_id="AAS14185.1"
FT                   /translation="MNVKSVKKKGGKCFSRLEEMKNLLGFNDGKEGIMVKALSFHPTVQ
FT                   LLEEKNVKITELEAAKKKAEKELRIKTQELQDQLDTAQQEKQDLEAEVEKLKAIDSTAL
FT                   QQQLEEKNAKITELEAQLNNQPNAAQLKAKEDEINKLNDEVAQLKAAPNDTAAQLKAKK
FT                   DEINKLNDEVAQLKAAPNDTAAQLKAKKDETKDLQNRLTEAEEKNRKLEDKSKTTEQPK
FT                   QGNGARYTATVGMGLAAGLIAFTALERTVKLEMLVMIGVAVASALVAGGITYAVLPSTQ
FT                   VDGAKAQEVNENGKKK"
FT   gene            complement(449374..449889)
FT                   /locus_tag="WD_0466"
FT                   /old_locus_tag="WD0466"
FT   CDS_pept        complement(449374..449889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0466"
FT                   /old_locus_tag="WD0466"
FT                   /product="hexapeptide transferase family protein"
FT                   /note="Identified by match to PF00132 protein family HMM
FT                   PF00132; match to PF00132 protein family HMM PF00132; match
FT                   to PF00132 protein family HMM PF00132; match to PF00132
FT                   protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14186"
FT                   /db_xref="GOA:Q73HS7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HS7"
FT                   /protein_id="AAS14186.1"
FT                   /translation="MYHILKYKDYEPKIDESAFIAGGSHIIGKVEIGRDASIWFNCVIR
FT                   GDVGSIKIGNGTNIQDGTVIHVDRNPGGDTIIGSMVTVGHFCVLHACTVHDKAFIGMGS
FT                   TVMDHAVVEPEAMVAAGSLVTHGKVIKSGEIWAGRPAKFFKKMSNEEIKHITQSAQNYI
FT                   MLMKEYKN"
FT   gene            450034..450354
FT                   /locus_tag="WD_0467"
FT                   /old_locus_tag="WD0467"
FT   CDS_pept        450034..450354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0467"
FT                   /old_locus_tag="WD0467"
FT                   /product="preprotein translocase, SecG subunit"
FT                   /note="Identified by similarity to EGAD:23175; match to
FT                   PF03840 protein family HMM PF03840"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14187"
FT                   /db_xref="GOA:Q73HS6"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HS6"
FT                   /protein_id="AAS14187.1"
FT                   /translation="MSVAVLSIFQIILVVVLVILVLLQPPGSSSLSGFSNTQQGVNSMI
FT                   PVKSSENPLSRITAIVAGLFIINTLLLSGLYSKDVHKKSIAEKIILEKKQESEPTSVPF
FT                   EN"
FT   gene            450354..451943
FT                   /gene="pyrG"
FT                   /locus_tag="WD_0468"
FT                   /old_locus_tag="WD0468"
FT   CDS_pept        450354..451943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="WD_0468"
FT                   /old_locus_tag="WD0468"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="Identified by similarity to SP:P08398; match to
FT                   TIGR00337 protein family HMM TIGR00337; match to PF00117
FT                   protein family HMM PF00117"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14188"
FT                   /db_xref="GOA:Q73HS5"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HS5"
FT                   /protein_id="AAS14188.1"
FT                   /translation="MKEAKFIFVTGGVVSSLGKGLVASSVGALLQAHGFKIRIRKLDPY
FT                   LNIDPGTMNPTQHGEVFVTEDGAETDLDLGHYERFTGIKATKDDNITTGKIYHELLKKE
FT                   RRGDYLGKTVQVIPHVTDLIKSFIFNGTEGLDFVICEIGGTVGDIESQPFLEAIRQVNY
FT                   TLGKQRVILIHLTLIPYLAAAQELKTKPTQHSVRELNSAGLQPDIILCRSEKEIFDNQR
FT                   EKIAKLCNVSLSNVIPAPDVSHIYELPVLYSQCGLDTQILEHFHLSKPKPSLTEWDQIV
FT                   HSIRHPTQEVTVSIVGKYTEFPDAYKSLVEALNHGAISNKVKVKINWVNSREKEEKPIG
FT                   EKLQNSHAILVPGGFGDDGVEGKILAINYARTNNIPFFGICLGMQLAIIEFARNVVKLE
FT                   DAHSEEFRNCKHPIVKLAGDQDDDLGGTMRLGAYKCNINANSKMMDAYSNTTISERHRH
FT                   RYIINSDYKDDLEKNGLLCSGISEDGTCIEAVELESHPWFIGVQFHPEFQSKPFSPHPL
FT                   FVSFVKAAIDKK"
FT   gene            451969..452376
FT                   /locus_tag="WD_0469"
FT                   /old_locus_tag="WD0469"
FT   CDS_pept        451969..452376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0469"
FT                   /old_locus_tag="WD0469"
FT                   /product="cytidine and deoxycytidylate deaminase family
FT                   protein"
FT                   /note="Identified by match to PF00383 protein family HMM
FT                   PF00383"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14189"
FT                   /db_xref="GOA:Q73HS4"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HS4"
FT                   /protein_id="AAS14189.1"
FT                   /translation="MELAIEQAKLAQKNDEVPIGAVIVSGDNIISSAHNISSDPTAHAE
FT                   MLAIRQAFSTPTLCDADMYVTLEPCPMCAQAISFARIKRLYFGAYNPKGGGIENGAKIF
FT                   QFCSHIPEVYGGILEIECSFLLKDFFEKLRT"
FT   gene            complement(452417..453679)
FT                   /locus_tag="WD_0470"
FT                   /old_locus_tag="WD0470"
FT   CDS_pept        complement(452417..453679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0470"
FT                   /old_locus_tag="WD0470"
FT                   /product="major facilitator family transporter"
FT                   /note="Identified by match to PF00083 protein family HMM
FT                   PF00083"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14190"
FT                   /db_xref="GOA:Q73HS3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HS3"
FT                   /protein_id="AAS14190.1"
FT                   /translation="MQTRVLISTILCRIAIWYDYMLFIDLINIISREFCFAKDVYSNIL
FT                   QLFGIVGLGAIVRPLGAFIFGHVGDRYGRRIALIITILLISIPSSLIAFIPSHNQVGII
FT                   STILLLAIHITQGIALGGEQGSSVYLIEHLSSRKENLGMYFGMMGFGRSIGVLLSAVIV
FT                   IICKKTTDFCTWGWRLPFIFSAILGLISAYSIYTLGETPAYEKNRKQRNLPDLPIIELI
FT                   KRHKRALILAILISVPVNVAVGFTIFLRTLAKEIASVDVYVTTYINEIVLIITSVLMPI
FT                   SSIAFGMLADKVGKERTAILFIAITMALCCPALSIAYYYKNYLVIALSVMVLSITERGI
FT                   VPIGIVASELFPTNVRFSGVSLSRNISYALHGGFTPMVCIWLTVTFPQTNLAAGLYIVF
FT                   CLLISVVAILQIKPQDKNFDL"
FT   gene            453655..454134
FT                   /locus_tag="WD_0471"
FT                   /old_locus_tag="WD0471"
FT   CDS_pept        453655..454134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0471"
FT                   /old_locus_tag="WD0471"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14191"
FT                   /db_xref="GOA:Q73HS2"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HS2"
FT                   /protein_id="AAS14191.1"
FT                   /translation="MISTPLFALNSIRKCLLILFWLLFGILQPKHMELTFLLWCVIIAM
FT                   NIAYLAALIAATIIKIAAVILCAIMCISIFFILFKGIKEHLDSKGFLSLLKTVGVISII
FT                   LSIISLPLIILSLTTPSPLVVGIVGGIVGAISIIPLIVAYILLVAISNIFITKSL"
FT   gene            454779..455879
FT                   /locus_tag="WD_0472"
FT                   /old_locus_tag="WD0472"
FT   CDS_pept        454779..455879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0472"
FT                   /old_locus_tag="WD0472"
FT                   /product="ATPase, AAA family"
FT                   /note="Identified by similarity to EGAD:18839; match to
FT                   PF00004 protein family HMM PF00004"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14192"
FT                   /db_xref="GOA:Q73HS1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HS1"
FT                   /protein_id="AAS14192.1"
FT                   /translation="MKKIEISELLKRISICLLCVATIVSIAFLFAYMHTMLLSKGYELA
FT                   AHYVSEAMPCVLLVVLLFIVWFVYDQVFSKLKEVELPISIELANSDDKRITFADAIIDD
FT                   SLKQRLQMICCDQMTEEMRKLFGNKSINSLRGYILYGPPGNGKTLIARAIAGESNMNFI
FT                   SISGPELIGVYIGHGAHAVRELFKIAKKYSPCIVFIDEIDAVAQKRSTANNSAYHCRES
FT                   LTQLLTEIDGFKSRKDIIVIGATNLIGGIDPALIRPGRLGQKVYVPNPNIEVRQKILAL
FT                   YMRGTKTDEKLSLQNIADKTEGYSGAELEQLVNEAKISAGAQRRLIVSEEDFSYALHRL
FT                   SPEQERDRIKLVSNAKTQIEETSFIR"
FT   gene            456427..457425
FT                   /locus_tag="WD_0473"
FT                   /old_locus_tag="WD0473"
FT   CDS_pept        456427..457425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0473"
FT                   /old_locus_tag="WD0473"
FT                   /product="pyruvate dehydrogenase complex, E1 component,
FT                   pyruvate dehydrogenase beta subunit, putative"
FT                   /note="Identified by similarity to SP:Q9R9N4; match to
FT                   PF02779 protein family HMM PF02779; match to PF02780
FT                   protein family HMM PF02780"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14193"
FT                   /db_xref="GOA:Q73HS0"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR027110"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HS0"
FT                   /protein_id="AAS14193.1"
FT                   /translation="MATLSVREALCTAIREEMQNDSDVLIMGEEVAEYDGAYKVTKGLL
FT                   KEFGENRIVDTPITEHGFAGLAVGAAFAGLKPIVEFMTFNFSMQAIDQIVNSAAKTNYM
FT                   SGGQLGCPIVFRGPNGAAARVAAQHSQCFAAWYSHIPGLKVIAPYFASDCRGLLKAAIR
FT                   DPNPVIFLENEIAYGHEHEVSDSELSNKDYLLEIGKAAVIREGKDVTITAFSLKLMDAL
FT                   NAADLLSSKGIEAEVIDLRTLRPLDTQTVINSIQKTNRLVSVEEGWPFAGIGAELSAVV
FT                   MEQGFDYLDAPVVRVTGKDIPLPYAANLEKKALPQVEDIVEAVHQVCFRKK"
FT   gene            complement(457401..457775)
FT                   /locus_tag="WD_0474"
FT                   /old_locus_tag="WD0474"
FT   CDS_pept        complement(457401..457775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0474"
FT                   /old_locus_tag="WD0474"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14194"
FT                   /db_xref="GOA:Q73HR9"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HR9"
FT                   /protein_id="AAS14194.1"
FT                   /translation="MNPRKVFNILFIVLFISFSHVGSAAADTNTDTTAQVICNIIGYVW
FT                   GIGGPLMTVVIIGAALLAIFGRMPWPALFALGIFCAVFFGAKTIVIKVMGGIGGTGNTS
FT                   LMDQCGTGDTKKNYFFLKQT"
FT   gene            complement(458475..460271)
FT                   /gene="lepA"
FT                   /locus_tag="WD_0477"
FT                   /old_locus_tag="WD0477"
FT   CDS_pept        complement(458475..460271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepA"
FT                   /locus_tag="WD_0477"
FT                   /old_locus_tag="WD0477"
FT                   /product="GTP-binding protein LepA"
FT                   /note="Identified by similarity to EGAD:24859; match to
FT                   TIGR01393 protein family HMM TIGR01393; match to PF00009
FT                   protein family HMM PF00009; match to PF00679 protein family
FT                   HMM PF00679; match to TIGR00231 protein family HMM
FT                   TIGR00231; match to PF03144 protein family HMM PF03144"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14195"
FT                   /db_xref="GOA:Q73HR8"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HR8"
FT                   /protein_id="AAS14195.1"
FT                   /translation="MNNIRNFAIIAHIDHGKSTLADRLIEECNGLEAREMINQILDSMD
FT                   IERERGITIKAQTVKLNYTANDGNQYCLNLMDTPGHVDFSYEVSRSLAACEGSLLVVDS
FT                   SQGVEAQTLANVYKAIDNNHEIIVVLNKVDLPAADPEKVKLQVEEVIGIDASESVLISA
FT                   KTGLGIKDVLEAIVAKLPAPQGDVNAPLQAILVDSWYDTYLGVVILVRVKNGVLKKGMR
FT                   IVMMSNNATYQIDNIGIFTPKKVMTGELSAGEVGFITASMKEVADCKVGDTITEEKRPC
FT                   SEALPGFKEVHPVVFCSIFPHKTDDFKYLREALEKLHLNDASFTFEAETSNALGYGFRC
FT                   GFLGMLHLEVIQERLEREFDLDLTATAPSVIYRVTTRSGEVLNIHNPSDMPDPTKIEIV
FT                   EEPWITATIMVPDQYLGDILSLCEERRGEQEDLSYIGNTTTALLRYKLPLSEVVFDFYD
FT                   RLKSISKGYASLDWEISSYLVSQIDKLSFLINGEPVDALACIVHKSRAEKRGREICARL
FT                   KDLIPRQQYKIAIQAAVGGKIIARETINPYRKDVTAKLYGGDVTRRMKLLEKQKKGKKR
FT                   LHSIGNVNIPQNAFIQALKISD"
FT   gene            complement(460347..461741)
FT                   /locus_tag="WD_0478"
FT                   /old_locus_tag="WD0478"
FT   CDS_pept        complement(460347..461741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0478"
FT                   /old_locus_tag="WD0478"
FT                   /product="malonyl-CoA decarboxylase, putative"
FT                   /note="Identified by match to PF05292 protein family HMM
FT                   PF05292"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14196"
FT                   /db_xref="GOA:Q73HR7"
FT                   /db_xref="InterPro:IPR007956"
FT                   /db_xref="InterPro:IPR035372"
FT                   /db_xref="InterPro:IPR038351"
FT                   /db_xref="InterPro:IPR038917"
FT                   /db_xref="InterPro:IPR042303"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HR7"
FT                   /protein_id="AAS14196.1"
FT                   /translation="MTKESLVKTDIVKVEDKKAVRSFFKILGGVADAVRSWIGNISPDL
FT                   SNSRDIDSLVLKMNECLNPKGGEVSARKNAVSLGNLYLSLSEKGKIKFLQTLAEKFNPN
FT                   KAEIDEKIREYKKNQDPELNYKFEQDLIKILESPRSKILKQFISLPEGLKFIVDMRSDV
FT                   LKLKNQYRSLNPLESELKNILYTWVDVDLLDLRQIIWDSPASLLEKLIKYEAVHKISSW
FT                   DDLKNRLGLCFAFFHYKIPNEPLIFVEVALVDKIADSIQHLLDESVPSNDPSNASTAIF
FT                   YSISNTQAGLSGISLGNFLIKRVVEKLSQEFKSIKTYATLSPIPGFTKWLKNNLNQDVT
FT                   LLGKLNIKQSSAEILESAEQLKINVECINETKQCMLKLCAYYLLKVNNSNGNAYDPVAH
FT                   FHLSNGASIKQLNWMADTSEKGISQSAGMMVNYLYELPKIDNNHENYMVNKVISCSKKV
FT                   SSMLKE"
FT   gene            complement(462764..463456)
FT                   /locus_tag="WD_0480"
FT                   /old_locus_tag="WD0480"
FT   CDS_pept        complement(462764..463456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0480"
FT                   /old_locus_tag="WD0480"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to EGAD:89862; match to
FT                   PF04263 protein family HMM PF04263"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14197"
FT                   /db_xref="GOA:Q73HR6"
FT                   /db_xref="InterPro:IPR006282"
FT                   /db_xref="InterPro:IPR007371"
FT                   /db_xref="InterPro:IPR007373"
FT                   /db_xref="InterPro:IPR036371"
FT                   /db_xref="InterPro:IPR036759"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HR6"
FT                   /protein_id="AAS14197.1"
FT                   /translation="MQNLHHDHVLHCSTQQQYRSIVVLNGKIPSSSFFKRDIPIIAVDG
FT                   GANKLLSIGVKPDLVVGDLDSVNLDLRANLNTIYLPDQDYCDFSKAMAHLKTVKLLPSI
FT                   VTGITGGAIDHILQNINIFLSTGSIFYTPSPPMVGYTLQKGITHFFSLPKNTKISLLGI
FT                   PRAQISTKGLKWELHLSNLAFPGKNSCFNRSLGNKVSVEVHSGICLAMIYLETVDDAAR
FT                   HHVRQVKK"
FT   gene            complement(463437..463712)
FT                   /locus_tag="WD_0481"
FT                   /old_locus_tag="WD0481"
FT   CDS_pept        complement(463437..463712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0481"
FT                   /old_locus_tag="WD0481"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14198"
FT                   /db_xref="GOA:Q73HR5"
FT                   /db_xref="InterPro:IPR004316"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HR5"
FT                   /protein_id="AAS14198.1"
FT                   /translation="MYINIEECFGFIALIASLIGLSPQVYKAYITKVTRDVSMLMLVNY
FT                   LICSLSWIGYGLYQSSIFVVLSNIAGLVISIISIIQKCYYDAKPAP"
FT   gene            complement(463880..464725)
FT                   /locus_tag="WD_0482"
FT                   /old_locus_tag="WD0482"
FT   CDS_pept        complement(463880..464725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0482"
FT                   /old_locus_tag="WD0482"
FT                   /product="SPFH domain/Band 7 family protein"
FT                   /note="Identified by similarity to OMNI:EF1789; match to
FT                   PF01145 protein family HMM PF01145"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14199"
FT                   /db_xref="GOA:Q73HR4"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HR4"
FT                   /protein_id="AAS14199.1"
FT                   /translation="MDKNTINDRNLSQIRAFPVLIALGLILSLLFLAYDSTIALGVAAV
FT                   SILTFLQGFFINDPNEARVIEFFGHYIGTYFKSGICVTLPFSSKYIVSLKFQNINTEKI
FT                   KVNDANGSPIEISAVIVWRVSSPAKAYYNVNNYHEFVFVQSDSVIRELASNYPYDSESN
FT                   EESLRKNSDKISDELRSMLQQRLDIAGIEITEARISHLAYSSEIAQAMLRRQQAHAITS
FT                   ARRHIVQNAIGIVEEVIAHFEKNKSLQLDGKQKVQLINNLLVALISEQDAQPTISLDNN
FT                   "
FT   gene            complement(464733..465671)
FT                   /locus_tag="WD_0483"
FT                   /old_locus_tag="WD0483"
FT   CDS_pept        complement(464733..465671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0483"
FT                   /old_locus_tag="WD0483"
FT                   /product="M23/M37 peptidase domain protein"
FT                   /note="Identified by match to PF01551 protein family HMM
FT                   PF01551"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14200"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HR3"
FT                   /protein_id="AAS14200.1"
FT                   /translation="MKLIVFMLLFILPLYTAETSTDLAQPFQHGIRKKKATLTTESDRK
FT                   LLFISSTIKSSFFATEGLAPNTVMKLINIYKDFGVDFKKDIVPKSKLEVLFERLPNNQK
FT                   TEEKILYASLIINKKAISLYHYKSQDGKERYFNKEGISLKNGEIFANPLNGDYRISSKF
FT                   GNRKHPVRGKIAFHKGVDYAAKLGTPIYAAAEGVIEYIGKNGGYGNYIKIKHKNEYSTC
FT                   YAHISRFSGDIKLGSKVKQGQVIAYVGSTGVATGPHLHYEVIYNGKHIDPLTIAHKTEV
FT                   KLPDHELREFKLFVNKINKTINRESSSEKEV"
FT   gene            complement(465675..466415)
FT                   /locus_tag="WD_0484"
FT                   /old_locus_tag="WD0484"
FT   CDS_pept        complement(465675..466415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0484"
FT                   /old_locus_tag="WD0484"
FT                   /product="conserved hypothetical protein TIGR01033"
FT                   /note="Identified by similarity to GP:15075777; match to
FT                   PF01709 protein family HMM PF01709; match to TIGR01033
FT                   protein family HMM TIGR01033"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14201"
FT                   /db_xref="GOA:P62043"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62043"
FT                   /protein_id="AAS14201.1"
FT                   /translation="MAGHSQFSNIKHRKGAQDAKRSQKFTKLIREITVAAKQGLPDPEL
FT                   NPRLRSAIFAARKENLPKDKIETAIKNATGNVAGENYEEIQYEGHGPSGTALIVHVLTN
FT                   NRNRTASEVRYIFSRKGGNLGETGSVSYLFDHVGLIVYKAEGVNFDDLFSHGIELEVLN
FT                   VEENDKEGLHVITCEIKDFGKVRDAFYAKFGEPELARLSWQPKDLIEISDKELIDKLSA
FT                   LVEELEDNDDVQYVEGNFTFVDAV"
FT   gene            complement(466475..467182)
FT                   /locus_tag="WD_0485"
FT                   /old_locus_tag="WD0485"
FT   CDS_pept        complement(466475..467182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0485"
FT                   /old_locus_tag="WD0485"
FT                   /product="competence lipoprotein ComL, putative"
FT                   /note="Identified by similarity to EGAD:40678; match to
FT                   PF03696 protein family HMM PF03696"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14202"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR017689"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HR1"
FT                   /protein_id="AAS14202.1"
FT                   /translation="MYKTLITCFIFLICSFTQSYADDLEKTETELYEEAVELFDQKKYK
FT                   QAIRAFHKIEDLYPFSYWAMKAKLLSGVSHYNMGNYSSAASDMADYIYVYSNGEDLPYV
FT                   YYLRVLSYYMQINKVQLGQQTAYKTLELATEYINLFPGSEYVDEIKERAKLITEHISTK
FT                   EYSIGKFYLRRGEYLAAIKRFQNMASYKDSKYFSKSINHLIAAHSALGLDLEAEQYESM
FT                   LLAENLQDAKPEA"
FT   gene            complement(467243..468184)
FT                   /locus_tag="WD_0486"
FT                   /old_locus_tag="WD0486"
FT   CDS_pept        complement(467243..468184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0486"
FT                   /old_locus_tag="WD0486"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14203"
FT                   /db_xref="GOA:Q73HR0"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HR0"
FT                   /protein_id="AAS14203.1"
FT                   /translation="MKIPSGKFSSTKKVPGKNKKKRDFEPLEEFFWDFWPTVDKEVKRE
FT                   RLEQELLALKKRELYRKCASLATMVPFTLLMAIELEKTYSDQVLLGVISGALSHTILPF
FT                   TVLSLICTLYLIYNNRKIAQKERELEIIENGEEVKEKEHNISDIGQCLIYIEAITTALV
FT                   IVGMIMGETSSLEAAEDAILFLANAIAFLATLVSYIDKHEKNKKKETEKSDLDEKSSKK
FT                   TSNISVAGLALAGSSVFLIRRIMLIALASSLNPAVGPTLGLVGIAIFMAVQVLTIHSYS
FT                   KTLKDPKVEGRGESRNAGSSDRSYKEEGPAIA"
FT   gene            complement(468305..468838)
FT                   /gene="pgsA"
FT                   /locus_tag="WD_0487"
FT                   /old_locus_tag="WD0487"
FT   CDS_pept        complement(468305..468838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgsA"
FT                   /locus_tag="WD_0487"
FT                   /old_locus_tag="WD0487"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /EC_number="2.7.8.5"
FT                   /note="Identified by match to TIGR00560 protein family HMM
FT                   TIGR00560; match to PF01066 protein family HMM PF01066"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14204"
FT                   /db_xref="GOA:Q73HQ9"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HQ9"
FT                   /protein_id="AAS14204.1"
FT                   /translation="MLKKNVPNLLTISRALAIPAIILSFYIENKYAGLITISIFVFACI
FT                   TDFFDGYLARAWKVQSKFGKLFDPIADKLIVVSTIIMLVYKHKINDFTIVPSIIIICRE
FT                   ILVSGLREFLIATNVSLPVSKAGKIKTFLQMVAVVALIMNDYYMIQYTGAICLWVAAII
FT                   TMWSGYNYILAGIK"
FT   gene            468973..470295
FT                   /gene="maeB"
FT                   /locus_tag="WD_0488"
FT                   /old_locus_tag="WD0488"
FT   CDS_pept        468973..470295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maeB"
FT                   /locus_tag="WD_0488"
FT                   /old_locus_tag="WD0488"
FT                   /product="NADP-dependent malic enzyme"
FT                   /EC_number="1.1.1.40"
FT                   /note="Identified by similarity to EGAD:91656; match to
FT                   PF03949 protein family HMM PF03949; match to PF00390
FT                   protein family HMM PF00390"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14205"
FT                   /db_xref="GOA:Q73HQ8"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HQ8"
FT                   /protein_id="AAS14205.1"
FT                   /translation="MNDDLDSTTKQEALKYHSRGGNPGKISIMPTKPLSTQYDLSLAYS
FT                   PGVAAPCLEIAKNPEVVYDYTAKSNCVAVISNGTAVLGLGNIGPLAAKPVMEGKAVLFK
FT                   RFADIDAVDIEVGTENIEDFINAVRYLGPSWGGINLEDIRSPDCFIIEKRLNELMDIPV
FT                   FHDDQHGTAVVVAAGIENALDIVEKKLEDVKIIMNGAGAAGIACLEILKSMGAKNIVLC
FT                   DKQGVIYKGRNEDMNEWKEKYAIDTSERSLLDTIKGADVFIGLSAKDVLNEEMLKSMGK
FT                   DPIIFALANPDPEVRPEFAKSVRPDAIIATGRSDYNNQVNNVMGFPYIFRGALDVHATT
FT                   INDEMKIAAADAIAKLAREPVPGEISAVYGSRKMGYGREYIIPTPFDPRLISIVAPAVA
FT                   KAAVDSGVARKAIQDWSKYENQLKSRLSNVLSTLNLLSSHM"
FT   gene            complement(470310..471236)
FT                   /locus_tag="WD_0489"
FT                   /old_locus_tag="WD0489"
FT   CDS_pept        complement(470310..471236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0489"
FT                   /old_locus_tag="WD0489"
FT                   /product="surface antigen, Wsp paralog"
FT                   /note="Identified by match to PF01617 protein family HMM
FT                   PF01617"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14206"
FT                   /db_xref="InterPro:IPR002566"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HQ7"
FT                   /protein_id="AAS14206.1"
FT                   /translation="MQGGFVVGERFKFTYLLVLLTFSFRCLSYDDKINNLENVYIKANY
FT                   FGAFFNAIGSLEGKEDAGDNITEGVFSFNKKERIEAGYSPKYVPGFAGSAAIGYLFKNM
FT                   RVEFEGLYSQTNLYDEDYSDKKKARYIELRRHNDASTGAECNSPWRSGKVDIHIQENCS
FT                   VEAEFRAAFKMKNEGFNNLAGMVNVYRDFNIAKMPFTPYVGIGAGVTRVKFLGKTRYAL
FT                   AYQAKLGINHQLTAQTQAFAGLRYFGILDNQFKDIVPGIKILAGEGYIPAGGGSKVDET
FT                   ARVESTTATITNRFGIYGLEFGLVYHF"
FT   gene            471348..471566
FT                   /locus_tag="WD_0490"
FT                   /old_locus_tag="WD0490"
FT   CDS_pept        471348..471566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0490"
FT                   /old_locus_tag="WD0490"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to OMNI:NTL02ML0042"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14207"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HQ6"
FT                   /protein_id="AAS14207.1"
FT                   /translation="MTIAIHELERIIKQSFPDADIKIHDLAGDDDHYHLKINSKCFLGK
FT                   TKIEQHKMVYKALEGQSIHALQLETNT"
FT   gene            471582..471905
FT                   /locus_tag="WD_0491"
FT                   /old_locus_tag="WD0491"
FT   CDS_pept        471582..471905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0491"
FT                   /old_locus_tag="WD0491"
FT                   /product="glutaredoxin-related protein"
FT                   /note="Identified by similarity to GP:15074715; match to
FT                   TIGR00365 protein family HMM TIGR00365; match to PF00462
FT                   protein family HMM PF00462"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14208"
FT                   /db_xref="GOA:Q73HQ5"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HQ5"
FT                   /protein_id="AAS14208.1"
FT                   /translation="MSNFEQIKKDITENDVVLYMKGTSDFPQCGFSGLVVSILKKLNVK
FT                   FKYINVLENDEIRESIKKFSDWPTIPQLYIKEEFIGGCDITREMYEKGELQSLLKEKKI
FT                   IAE"
FT   gene            complement(472100..473494)
FT                   /gene="fumC"
FT                   /locus_tag="WD_0492"
FT                   /old_locus_tag="WD0492"
FT   CDS_pept        complement(472100..473494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fumC"
FT                   /locus_tag="WD_0492"
FT                   /old_locus_tag="WD0492"
FT                   /product="fumarate hydratase, class II"
FT                   /EC_number="4.2.1.2"
FT                   /note="Identified by similarity to EGAD:78554; match to
FT                   TIGR00979 protein family HMM TIGR00979; match to PF00206
FT                   protein family HMM PF00206"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14209"
FT                   /db_xref="GOA:Q73HQ4"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HQ4"
FT                   /protein_id="AAS14209.1"
FT                   /translation="MDRKTRIESDSLGEVKVPSEHYWGAQTQRSLENFKIGTEKMPEPL
FT                   IKALAIVKLAAARVNMKHGVIDDRVGDAICTAAREVIDGKFNNEFPLVVWQTGSGTQTN
FT                   MNMNEVISNRAIEILGGNLGSKSPIHPNDHVNYGQSSNDTFPTAMHIAAAEQINCLLIP
FT                   NLEKLHKVLDNKVQEFKDIIKVGRTHLQDATPLTLGQEFSGYAAQIKKGIERVKSTLSG
FT                   IYELAQGGTAVGTGLNTKKGFAEDFAKQVAGITNLPFTSAGNKFEALAANDALVELSGT
FT                   LNTVAVSLMKIANDIRLLGSGPRCGIGEIMLPENEPGSSIMPGKVNPTQCEAVTMVCTQ
FT                   VMGNHVAVTISGSNGHFELNVFKPVIIYNVLQSIRLLADASLNFTEKCVVGIKANEERI
FT                   KDLLNQSLMLVTILNTHIGYDNAAKIAKLAYKENITLKEAAAKLQLLTEEEFERIVKPE
FT                   EMVNYL"
FT   gene            complement(473887..474909)
FT                   /locus_tag="WD_0493"
FT                   /old_locus_tag="WD0493"
FT   CDS_pept        complement(473887..474909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0493"
FT                   /old_locus_tag="WD0493"
FT                   /product="GTP-binding protein"
FT                   /note="Identified by match to PF01018 protein family HMM
FT                   PF01018"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14210"
FT                   /db_xref="GOA:Q73HQ3"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HQ3"
FT                   /protein_id="AAS14210.1"
FT                   /translation="MGFIDEVKLCLKAGDGGDGCASFRREKFVEFGGPNGGNGGKGGNI
FT                   VFISDANLNTLLHFRYRRHIKADSGKNGAGRDRSGTAGKDVILKVPVGAQIIDEESEEI
FT                   IVDLDKPGMEFQVAQGGKGGLGNTNFKSSTNKAPRHFTYGQPGEEKHVLLKLKVLSDVG
FT                   IIGMPNAGKSKFLTRCSNSDTKVGDYPFTTVRPHLGMVKVDDSEVVIADIPGIITDAHL
FT                   GVGLGHKFLKHIERCQILLHLIDVTHDDVVLAYSCIHNELELYNSDLVEKEEIVVLNKC
FT                   DLLREAEILEKKNHLANYLNKEVLCLSINGDLQPILRLLSEKLKKSNSKEIDVYDPFKA
FT                   "
FT   gene            complement(474897..476171)
FT                   /gene="eno"
FT                   /locus_tag="WD_0494"
FT                   /old_locus_tag="WD0494"
FT   CDS_pept        complement(474897..476171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="WD_0494"
FT                   /old_locus_tag="WD0494"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="Identified by similarity to EGAD:156362; match to
FT                   TIGR01060 protein family HMM TIGR01060; match to PF00113
FT                   protein family HMM PF00113; match to PF03952 protein family
FT                   HMM PF03952"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14211"
FT                   /db_xref="GOA:Q73HQ2"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HQ2"
FT                   /protein_id="AAS14211.1"
FT                   /translation="MNKVINNVFAREILDSRGYPTIEVEIELCDGAIGRASVPSGASTG
FT                   KLEVLELRDQDEKRYCGKGVLKAVQAVNGIIADEIIGMNAADQNAIDKALIELDGTKNK
FT                   SKLGANATLGVSLAVAKAAANSFKMPLYRYLGGKQTSVMPVPLINIINGGVHADNKLDF
FT                   QEFMILPVGAETFSEAIRISAEVFHNLRSILKKKGYSTNVGDEGGFAPNIESTEEALDL
FT                   IIYVIESAGYSAQSDFALGLDVASSTFYEDGIYKFEHRDLTSEELTEYYCNLVERYPII
FT                   SIEDAMSEDDYEGWKLLTAKLGSKIQLVGDDLFVTNCELICKGIEEKMANAVLIKPNQI
FT                   GTLTETFAAIEMAKSNGYKAVVSHRSGETEDTTISHIAVASNCGQIKTGSLSRSDRLAK
FT                   YNELIRIESALGKDAKYYRGLAWVL"
FT   gene            complement(476176..477672)
FT                   /gene="murC"
FT                   /locus_tag="WD_0495"
FT                   /old_locus_tag="WD0495"
FT   CDS_pept        complement(476176..477672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="WD_0495"
FT                   /old_locus_tag="WD0495"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="Identified by similarity to EGAD:18925; match to
FT                   TIGR01082 protein family HMM TIGR01082; match to PF01225
FT                   protein family HMM PF01225; match to PF02875 protein family
FT                   HMM PF02875"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14212"
FT                   /db_xref="GOA:P61683"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:P61683"
FT                   /protein_id="AAS14212.1"
FT                   /translation="MRILNYTIINLVMSKHLLLNINKTQKGIIHIIGIGGIGMSAIAEI
FT                   LHNSNCKVQGSDAQSNDNINKLQKLGIEVFIGHNANNISQAQIVVHSSAIEFDNVELIA
FT                   AKNNNKTVLHRSDILAEIMKGKYVIAVSGSSGKTTTTAMIASIFDHSGIDATVTVGGIL
FT                   NSYKSNFKLGGSDTFLIEADESDGTMLKIPAKIAVITSINNDHIDYYGTFDNIKNAFSQ
FT                   FVNNAGSAVLPDSVDIDYDAGNSITFGFENGSIRASNIKQHANSIEFDVLNNWIPALRA
FT                   GMTKGKCTEMSSQCVTLGSSPLKNIVLSNAIGIHKVSNALAAISVAIKLGISDADIKKG
FT                   LLEFQGVARRFSLIADIKGVKLIEDYAHHPNEIYATLTAARSITKGKVIGIIEPLRFAR
FT                   IRNFFDEFIRIFMMFDYVILTPVHPPEDKPIPGCGIDDIQKALISNGFNNTKIMNDALL
FT                   ISHFISDSTSPSNIVLFIGAGSNIAKLAKETAALIAEVKV"
FT   gene            477699..478373
FT                   /locus_tag="WD_0496"
FT                   /old_locus_tag="WD0496"
FT   CDS_pept        477699..478373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0496"
FT                   /old_locus_tag="WD0496"
FT                   /product="rare lipoprotein A, putative"
FT                   /note="Identified by match to PF03330 protein family HMM
FT                   PF03330; match to TIGR00413 protein family HMM TIGR00413"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14213"
FT                   /db_xref="GOA:Q73HQ0"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HQ0"
FT                   /protein_id="AAS14213.1"
FT                   /translation="MIKNLTFLCLIFVLISSCSFSNRFNCTAGHYKIGSSYTINGITYY
FT                   PKNCKHYEEIGIASWYGIEDHGTLTANGEAFNRHLISAAHKTLPLPCFVLVTNLENGRK
FT                   LVTRVNDRGPFIEGRIIDLSEKAAQVLGFHKSGLAKVKVQYLRKMSEQLIQNTPHYRKQ
FT                   YEKEMQKRHPKQDSAESKGYVAFFKSAQAAKSAASKLRNQGIKNVRLLFKNDQYCVKVS
FT                   YR"
FT   gene            complement(478966..479103)
FT                   /locus_tag="WD_0497"
FT                   /old_locus_tag="WD0497"
FT   CDS_pept        complement(478966..479103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0497"
FT                   /old_locus_tag="WD0497"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14214"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HP9"
FT                   /protein_id="AAS14214.1"
FT                   /translation="MDETKNLLDKLRQPSYHETEAIYLSSQSLQWINDKKLNVFGVNHA
FT                   "
FT   gene            479223..480230
FT                   /locus_tag="WD_0498"
FT                   /old_locus_tag="WD0498"
FT   CDS_pept        479223..480230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0498"
FT                   /old_locus_tag="WD0498"
FT                   /product="ankyrin repeat domain protein"
FT                   /note="Identified by match to PF00023 protein family HMM
FT                   PF00023; match to PF00023 protein family HMM PF00023; match
FT                   to PF00023 protein family HMM PF00023; match to PF00023
FT                   protein family HMM PF00023; match to PF00023 protein family
FT                   HMM PF00023; match to PF00023 protein family HMM PF00023;
FT                   match to PF00023 protein family HMM PF00023; match to
FT                   PF00023 protein family HMM PF00023; match to PF00023
FT                   protein family HMM PF00023"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14215"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HP8"
FT                   /protein_id="AAS14215.1"
FT                   /translation="MAREEDINQLVENGFDINSKDASGITLLHKFTKEGDLVGVKSLLE
FT                   HEADFNVVDNENRNPLHYAIMHGHKKVAKLFVNQLTINSKDKNGFTPLHLAALQDDTEL
FT                   IDFLITKGAKINEKDAKEGYTPLHIASLYGSKKSVQILIDSGANLECEDNNFRTPLFLT
FT                   IYQCTAHYDSRAEIIEYLIKKGANIEAKDAENNTTLFLAAYNNKMQIVKLIAKKQQASN
FT                   DKIKLKEFFCTKNNHGFDALDCAIEHNNRKMVTFLVSKGIEANDQDFNGNARLHKASHN
FT                   GNTKTVKLLLKLKVNVNAVTKCNRTPLLLAVKKGHTQIVKMLLEVRANMNICEQ"
FT   gene            480285..480587
FT                   /locus_tag="WD_0499"
FT                   /old_locus_tag="WD0499"
FT   CDS_pept        480285..480587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0499"
FT                   /old_locus_tag="WD0499"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14216"
FT                   /db_xref="GOA:Q73HP7"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HP7"
FT                   /protein_id="AAS14216.1"
FT                   /translation="MLTEKGADLNIKCNNGHTAIDMFISKAHSKKNIEENYKKFCRFLM
FT                   LYLKELHSKHKACCILSTLALSLTIIGLPFIFKPIIKYRERSTIYKKIRAMLVYI"
FT   gene            480707..482209
FT                   /locus_tag="WD_0500"
FT                   /old_locus_tag="WD0500"
FT   CDS_pept        480707..482209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0500"
FT                   /old_locus_tag="WD0500"
FT                   /product="type II secretion system protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14217"
FT                   /db_xref="GOA:Q73HP6"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HP6"
FT                   /protein_id="AAS14217.1"
FT                   /translation="MYAVLMAIFKCLILLFIISCTHLPTKQYPINIDNYKHDYPLQQYN
FT                   TSLEINEPAIPEIMPLPIEFPDLTISNQLISINVSEEVSVKDLLIEIGKLSDVNLDMDP
FT                   KISGNIILKLKDKDINEVIQSIANSAKLRYSTSNGVIRIEQDLPYAQNYYVDFINIQHS
FT                   AQSSFVINNNITNSDGSNVDRDYNNVMKSQYSSDLWNSLEKGLNAIMDVNGVDDGEFLS
FT                   SNREAGVIILNARKDIHKAVEEYINKVKKLASSQVMIEAKIVEVVLDDKYLSGMNLNDL
FT                   QDGTKSIINQDNSIINLAMNFGANDLGDLVKNLDKFGTSTVISSPRVHAINNQQAMISF
FT                   TKNHIYFTSDIQKDTRNSNQTLITKMNSVPIGVVLIIHPSINIDTSEIFMDIHPTLSRI
FT                   NGYTKDPDIEYVAQQSKMKLNSDIPIVEIREMNSMLKIKSGEIMVIGGLIEHREDKQSL
FT                   LHQKSKRLANNIRTVETVIFLKATTVPTFGLLDRKDKNLYIY"
FT   gene            complement(482217..483098)
FT                   /locus_tag="WD_0501"
FT                   /old_locus_tag="WD0501"
FT   CDS_pept        complement(482217..483098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0501"
FT                   /old_locus_tag="WD0501"
FT                   /product="surface antigen-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14218"
FT                   /db_xref="InterPro:IPR002566"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HP5"
FT                   /protein_id="AAS14218.1"
FT                   /translation="MIFISCVYFFITYISNDTHIEQVQPLKLETDNNKSVIRSEEVTAK
FT                   EIPIKYQELESSPPSVFQVADQKNMWSRIADQAEPTKEKSKKLDFYVSANGGKVYHDNS
FT                   EIFVKGIQEIGKRVLTLVESHYGFIIKNIVADEMKSIQQFDGKIDFQWFSSMSLGYYAG
FT                   ENGKIDFEAAYSIANIEDSNSPPVFDKSASIFAFLLNFYYNPSVQDTQFAPYIGLGIGP
FT                   TVFRLKRINGSPQSSMPLNVPWFAYQIKLGVDYSIIPEIKTFLGYRYFSVPIPVADDIS
FT                   THNIEVGLIFNF"
FT   gene            complement(483195..484421)
FT                   /locus_tag="WD_0503"
FT                   /old_locus_tag="WD0503"
FT   CDS_pept        complement(483195..484421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0503"
FT                   /old_locus_tag="WD0503"
FT                   /product="MiaB-like tRNA modifying enzyme"
FT                   /note="Identified by similarity to EGAD:163181; match to
FT                   TIGR01579 protein family HMM TIGR01579; match to TIGR00089
FT                   protein family HMM TIGR00089; match to PF04055 protein
FT                   family HMM PF04055; match to PF00919 protein family HMM
FT                   PF00919"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14219"
FT                   /db_xref="GOA:Q73HP4"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HP4"
FT                   /protein_id="AAS14219.1"
FT                   /translation="MNEVITFGCRLNFYESELIKEALKKAKRENVVVVHSCAVTNEAER
FT                   QVKQKIRKIYKNDPNKEIIVVGCAVQLDPEVYSSIPGVSKVLGNQDKLKAENYLLNDDK
FT                   ILVSDNQVEPVLINGFEDKSRAFIEIQNGCNHSCTFCSITEARGNNRSVPINSIIEQIR
FT                   IFVENGYQEVVFTGVDITDFGTDLLGKPSLGSMIRRVLKDIPELKRLRLSSIDVAEVDD
FT                   ELMDLIANESRLMPHLHLSLQSGNNLILKRMKRRHNREQVIEFCHKMKSLRPNIAFGAD
FT                   IIAGFPTETDEMFQDTVDLLKKTNIVYLHAFPYSERKNTPAARMPQVPENVRKERVKNL
FT                   REVNKEIMSSFCQSLINTKQSVLVEQNNVGRTENFALIKLESKAQAKSIVKVNVKGVEN
FT                   NYLIGNIFS"
FT   gene            complement(484452..484547)
FT                   /locus_tag="WD_0504"
FT                   /old_locus_tag="WD0504"
FT   CDS_pept        complement(484452..484547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0504"
FT                   /old_locus_tag="WD0504"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14220"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HP3"
FT                   /protein_id="AAS14220.1"
FT                   /translation="MKIVEIPVSAACIAFIYKKIVMQETLLGYLI"
FT   gene            484811..486280
FT                   /gene="gatA"
FT                   /locus_tag="WD_0505"
FT                   /old_locus_tag="WD0505"
FT   CDS_pept        484811..486280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="WD_0505"
FT                   /old_locus_tag="WD0505"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="Identified by similarity to EGAD:107640; match to
FT                   PF01425 protein family HMM PF01425; match to TIGR00132
FT                   protein family HMM TIGR00132"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14221"
FT                   /db_xref="GOA:Q73HP2"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HP2"
FT                   /protein_id="AAS14221.1"
FT                   /translation="MNELRKLSITQMHDGLKKKSFSAVELVEAHISAVENEKLNAFITK
FT                   TPEIAMKAAKAADEHFSRQKDDLISPLMGVPVGIKDLFCTKGIKTTACSKMLENFVPTY
FT                   ESTVSDLLLKSGAAMLGKLNMDEFAMGSANTNSYFGPVENVWIRKSDGEKVVPGGSSGG
FT                   SAASVAGFLCAGALGSDTGGSVRQPAAYCGVVGIKPTYGRCSRFGMIAFASSLDQAGVI
FT                   TRSVSDSALMLEAICGYDTKDSISSEKPVPKFSSFINGDVKGKRIGIPKEYRMDGISEE
FT                   IVHNWEKVASYLKENGAEVVDVTLPHTKYAIPVYYLICSAETSSNLARYDGVRYGFRVD
FT                   ADTLEEMYSLTRAEGFGKEVKRRILIGAYALSSGHYNEYYEKAQCIRALIRNDFIKAFE
FT                   KIDYILVPSAPTEAFGLNEKPDPLIMCINDVFTVPASLAGLPAISVPVGLSNEGLPLAL
FT                   QVIGNYYDEAGILNVASVIEQNCGRIIRPLA"
FT   gene            complement(486642..487954)
FT                   /pseudo
FT                   /locus_tag="WD_0506"
FT                   /old_locus_tag="WD0506"
FT                   /note="reverse transcriptase, authentic frameshift; This
FT                   gene contains a frame shift which is not the result of
FT                   sequencing error."
FT   gene            complement(488397..488804)
FT                   /locus_tag="WD_0507"
FT                   /old_locus_tag="WD0507"
FT   CDS_pept        complement(488397..488804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0507"
FT                   /old_locus_tag="WD0507"
FT                   /product="DNA repair protein RadC, truncation"
FT                   /note="Identified by similarity to EGAD:152424"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14222"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HP1"
FT                   /protein_id="AAS14222.1"
FT                   /translation="MNNKENSKDRREEIEFRALESNGKALLDREVIETFLSAVHDREEA
FT                   RIIARKLIDSFGIGGVLGQEIDDLKTIEGITDSTVAVVLCLKEAAKRVPREELKKGPVM
FT                   DNLETIVKYLRVSIGVRQEVRKEQLVKIQHG"
FT   gene            complement(488974..489912)
FT                   /locus_tag="WD_0508"
FT                   /old_locus_tag="WD0508"
FT   CDS_pept        complement(488974..489912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0508"
FT                   /old_locus_tag="WD0508"
FT                   /product="transcriptional regulator, putative"
FT                   /note="Identified by match to PF01381 protein family HMM
FT                   PF01381; match to PF01381 protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14223"
FT                   /db_xref="GOA:Q73HP0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HP0"
FT                   /protein_id="AAS14223.1"
FT                   /translation="MKKENKCSNFLDYKVIGQEVRNRRLAKGYTQKDLAKKIDTTYQVI
FT                   LQYEKGTRRISIKKLYELAEALSTTARDLACGQEVSNEERYEEEEILNLVRRHKEIKDQ
FT                   ELRETFYLLTKFIRISEEESGKAVKVEVAKGLVKEGVSAHVISQTTSLSIDEYDNDEKK
FT                   ISIPYKVGQRIKEWRLRRGYTQEDLASKVGIINQRIYEYEQGRAAVSLEMLNEIAKVLL
FT                   INITDLLPETRENENSEAELSRLIEEYKKIKSQELRDVLIKSLLESIQICKEKVKKIEK
FT                   IKIAKNLVKEGISINIILKTVGISLDEIQQI"
FT   gene            complement(489981..491777)
FT                   /gene="mutL"
FT                   /locus_tag="WD_0509"
FT                   /old_locus_tag="WD0509"
FT   CDS_pept        complement(489981..491777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /locus_tag="WD_0509"
FT                   /old_locus_tag="WD0509"
FT                   /product="DNA mismatch repair protein MutL-2"
FT                   /note="Identified by similarity to EGAD:37608; match to
FT                   TIGR00585 protein family HMM TIGR00585; match to PF01119
FT                   protein family HMM PF01119; match to PF02518 protein family
FT                   HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14224"
FT                   /db_xref="GOA:Q73HN9"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HN9"
FT                   /protein_id="AAS14224.1"
FT                   /translation="MAIILLDTKTINRIAAGEVIERPASLVKELVENAIDAGSSEIEIK
FT                   IESGGRNLITVIDDGNGIEKNDLELALMRHATSKLSDSELIEIRHLGFRGEALPSIAAV
FT                   SRMKLSSKASGAKEAWSIRYEGGEKIREITPCSLLQGTYIEVRDLFFATPNRLKFLKTE
FT                   RAETQSIVDIVNNLAMINYSIGFTLTSGNKKLLKYVKQTSLFNRLCEIEEEFQSNSLEV
FT                   KEEEEGIKLKGHICKPNVNRGNSTQIYTFVNGRPIKDNLLVGAIRYAYHDFIPNNRYPF
FT                   AVLHLEVPYDQVDVNVHPNKSEVRFQNKRLIYEIVRRGIIKTLSTRFAAGDQGIEEELI
FT                   FNDSKSQEQVDSQEKKDQKEFYEKRPSLLENRLMKEFNAPDERRQSLPETFKYGESLPQ
FT                   KGTMVLERKQIDLVEDHPLGYARCQVHNTYIIAEAGDRLIIVDQHAAYERLIYECLKQK
FT                   SSIKRQKLLPETVEIKNQAGMGMVKTYKDELFEMGFDIEIQSEDKVTIKEIPAILGTID
FT                   IKEMLVDIVDKLMEMEDTLPIEDKVNKISATIACHGAGRKMKLEEMNEILRQIEKTPYS
FT                   GHERPTYIEMKLIDIEKLFERR"
FT   gene            complement(491768..492288)
FT                   /pseudo
FT                   /locus_tag="WD_0510"
FT                   /old_locus_tag="WD0510"
FT                   /note="ribonuclease, degenerate; This gene contains a frame
FT                   shift which is not the result of sequencing
FT                   error.Identified by similarity to SP:P00647"
FT   gene            492698..493627
FT                   /locus_tag="WD_0511"
FT                   /old_locus_tag="WD0511"
FT   CDS_pept        492698..493627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0511"
FT                   /old_locus_tag="WD0511"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to GP:18144083; match to
FT                   TIGR01784 protein family HMM TIGR01784"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14225"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HN8"
FT                   /protein_id="AAS14225.1"
FT                   /translation="MALSKFLDARNDYAFKRIFGTEKNKDILIHFLNDILGFTGLAAIH
FT                   DVEFLATILDPEIAAKKQSIVDVLCKDSQGSRYIIEMQFTKTKGFEKRAQYYAAKAYLS
FT                   QADQGDDYHNLKEIIFIAVADCIIFPDKSEYKSNHVILDQNSFEHDLKDFYFVFIELPK
FT                   FTKTKEDQLENIVEKWCYFFRYAAETNEEDLDKIVGSDVIIKRAYEEMNKFNWSEEELL
FT                   AYEQMKKRIMDEIAAFAQKFDEGLKVGHEKGRQEGIQIGHEKGKIEGKIEGKIEVAKNS
FT                   LKAGVSIDVIAQITGLSHSEILQLKEKT"
FT   gene            complement(493947..497309)
FT                   /locus_tag="WD_0512"
FT                   /old_locus_tag="WD0512"
FT   CDS_pept        complement(493947..497309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0512"
FT                   /old_locus_tag="WD0512"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14226"
FT                   /db_xref="InterPro:IPR028047"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HN7"
FT                   /protein_id="AAS14226.1"
FT                   /translation="MELQQIIDGILQYGILKVKRLGLVYGSPETWNAGFHGFALGSSIP
FT                   AGIHGARIAYGKLSSSLSRGAFIGGSTVTGGGLFAMNGHAANWDWSKPGMYYGLLDAVT
FT                   GASDLPMLAYSGNKFLRKGFTKVKAGLHNRKYGRLPSHSDHYIDFPEDGPLWKTIKRKT
FT                   GFFPIADSLHLSELKYFMKAVGIVGLPIAFAGLSHDLDMGDPNSYREVFGTAMTINQIF
FT                   STGKYAYRQHKLGRVLKDNDAKRQFSKEIAESAVSQYKDELRNRLHIDRLIESELESLP
FT                   GSSSADGNKILVQKTVKDVVMDYSYKLKEVAETRRDERILTERIVDDTINLYERGSIDV
FT                   PGPSSANVAGSSIYNDIKVRTEQIVSHVIEFYRDKLTKLPEVGDVSNVNISNRAVSIGI
FT                   TDTHIVAGFSGNQDTGLIALYTHKDFKGHKLVDYFFQKDNSKIAGKGIVVADSPELNEV
FT                   MARHMYENQENIKKNNLEELFEKINTESLDKMLGDELSRNGKVNEKVLAFLQENREKGE
FT                   WMSPDSLRAKIVEIYLKSDSSLKDLLLKKEQKVTEASKYNEELKSIPEEEKSVTKWWDE
FT                   YQNLIEQKKSLEKNNKKKIPKEEIKILEEKIQNKEHDENIHQDNRKRLELLKLNEQIIE
FT                   LKKKGKEKDKSKKDELEKEINELKNKAEKSMSERQKLSKEFDDLNKEVNKLEQDIAKKT
FT                   KDLKKEVQEFLKESSLLEEVEKLDKKLAPWVHNNCAEAHVITALTRAKEVFPGHQVEVL
FT                   IKYLATYKELNSGESLVAFDRCSHCVQSTMVIDYAIITEEEWGNWHKERKSKADNMIAI
FT                   YGKVPNFSIHMTNRSVKEENSSSIRKKRSVFLELGEVETISNSKIRAGRVTSISNQLSR
FT                   ESVIDINKKITNSATRTSSWINDLFGWIRSSVSGLLGSELPEVVSSTKSPISQVDAKMD
FT                   VNGTIMLLDLLIRKVTDQKYISTADQSISPLEAQGYALNITKRFEKVVEQAGLKSGISM
FT                   HRLNIDFVEIQKEVTGKIMSGKFDEISGVLSSYLEKACPSREAGCPGKLSSKKFDKFMV
FT                   EFNSRLNVVLNRSIQRILHNGDGRLEVDDAKQMNLEPQSYLSNASVQGHSKDKVSTCLS
FT                   EIGVTKLGGNLNR"
FT   gene            complement(497224..505755)
FT                   /locus_tag="WD_0513"
FT                   /old_locus_tag="WD0513"
FT   CDS_pept        complement(497224..505755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0513"
FT                   /old_locus_tag="WD0513"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14227"
FT                   /db_xref="GOA:Q73HN6"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HN6"
FT                   /protein_id="AAS14227.1"
FT                   /translation="MPNFYKLSFAKQVLPFDEGVQLYQDNSRSGDPLQLYALHKEGLNG
FT                   YRYDNNTWKETLSMRGLHAQQIYFADVLGNGELMLIAKTKEGISFYQHKNNEFSLLNRT
FT                   ENFRNNGFGSVRDWNEPGSIIKFGHFYRNQGLVGILTYRRNYGTKLFVVVKDLLQKQQY
FT                   PIHTPKYDYTIPGNFSQAKFALSDLKQNGQENIIVHGNNGFNIYSFNQTHRLEHLIQVP
FT                   SSAKSDDSEEELFFPNLTGQSYRDIVVLNSSGLFVYQHNSSINNYGLIDYQPSFSKLKG
FT                   WEQEYINSIQFEDIDLDGREDMLFTGPSGINLLSFNNRTNQWQSLLDNSELTISQRHSR
FT                   VMKVLPASPPTTKHPIVFTKYKNQLHLANIVEIEDSLSLEEELEIDNASSKVTTSKVVP
FT                   QVSKVHLEEEKPHLLLRDQLDDSSIIDAVNKNTGKLNFKLPLIDLSNLSSDLKLDVFYD
FT                   GNSQIFGNLGLGWSLPQNFIMVDHQASIFPEDKKYYVILQDLPQQLVFDSKNSTDNVYS
FT                   FKLSNEQSDVQVRYYRDKERWEIDSKGVKQSYGSAQNGAVGWGLKWKNWRGVGSSSTGQ
FT                   EQFANVWYLAQIEDENNNVLHCTYDAINVEVASGKNFTREIYLKTISDDQGNNITFNYS
FT                   DKDKSEYDLPPIVDKQGNINTQMVQTRYLSGYKVSTTNYQQDISFVYEVKDRKRLLSKI
FT                   KQEGDSTNQPILQFSYSKSHMLEKVILPTGASVQFDYQLLEKDFSISVNERIAQKYDVG
FT                   KDYRVDYVDDYVLVSYMDGQEKVVLRMFNQEMTEELYSSLARKDSSKLPLLGRGGAKSY
FT                   GVVLTGGFLAVVLSYSTDQELHLLRQEKGKWLSKSYTFSEKTTINPGKGFMVVVDRDSA
FT                   IEVISWNKDSKEWRKDKPFAESEVPLLLKVFGRGFIFYDNDLLSIGYKDYEDRWRYNTI
FT                   EAIPGVINDIEETLDKFDLDSKRRDDFFAFFKSNALQVSNNLLFLNRWKTEGMKLYSVI
FT                   DLFVLDSSYKLAKREQKKILQDDLNQISDWLENGSGSSFKLAYQIVNDKLKVVAKDVRG
FT                   SIVDEIHKQTDNSNRRNDQKDEVLKDVTKSLEDRAKKPFLLNPYKYLAFLNSQVVICNN
FT                   TKLTFTGDNWKEGTVSEEELKQEKFSVPLDEKFVLKKEDLNSSIKLYNKKSNDKEELVK
FT                   ELGVNQFNQTVIRYPIYLAYQPRDQRVSVIKFANDGNISRTDELSWSEKLSPFSNYQTL
FT                   VTSENSGKTLVFRKQAGHLFPDPVITQVTVSFDDGNKRITGYEYSKAKALGNIIYYENV
FT                   SVVPGNDKESFGWIEETRDFGNQSRTEKRIFNSQKELIKIVNFENKQANATTVDKENLY
FT                   LNTTLLDKTGRLEIAQFFPYEIADEEVGYYGFEGYEVNRIGEKNSTFEKKWVFDEKDII
FT                   REGFSFTGRNYLSLSGKSLVGKFQPNDQSQEYIASCWVRPHSEMFKLGDIVPYLKAVVS
FT                   TENKNETVLPLGEVKLQVGNWFYLEVIVDLFYAKEVLKNVNEVQTNKTLVEEENVKLTT
FT                   SIIVAPSTNTTVDVDHVRFSPLKSSFKANVYTKQVTEVISASGLVERQIYDKYQKQVGS
FT                   ISGYGELKELSTYTKSSSIGKITELKSSVIIQPENGFYEDFASDSFDERWKIDSADAWQ
FT                   ISPGRLQHLTSGTHTLQLNSSDIDRASYGMRFYFSLQSDGSVINFNNNLKVIRTGSKAE
FT                   IAFSGRGQSIPLDGELLIVAEGKRIFVWVDGGLYFDGFLNASLFNLEISGKARISDVIV
FT                   FSKPSVEVTYFNELNEKVQEIVLESENAAIVKEYLYDELGREAIITQPVCIERTNVLAY
FT                   YSDFVTNGNPYKANSVWKTGKLEGDAARIVGEYGYSQVKYCDNPLNEECVVGLPGKEFS
FT                   ISGPYAKRFSSSLDNLFISNLFPASKNYSYRVEHKPGNVKDVSVFDSKDNRVAWYISTP
FT                   KSKSLLSTYEYGENGKLVKSLPPIYHEKVGTFYKMNSQLNSTSREEKTLQDSLGVNISY
FT                   DQRGKIINKTTPDSGKVENLYDKDGLLRFVLHYSNNEKIDNTVYFDYDELGRLRSTGEV
FT                   ISSTPKEELLSLELSGNNTRAYQEFYYSDAEHQPVLRGKIARAITFNSGEPLIEESVLN
FT                   IDKETISKRIVIPTKDSEKPVLIAVNKRYGAGKLREVEYPIDIQDRPLRINYQYDKLGR
FT                   IEGIGVRGKEDLFASFTYNAYGQISSEVHLPDLEKNFTRQYSYNSAGFLIELKDKFLTE
FT                   KVYYTNGSYGGYGYGDGTITRTEFQADWHENCDDSKLGLNEKSFVSEYVTSEKSALCFR
FT                   ELKKGGYLNDNGHQAKVSSTMRGELPIICRYGSTGRHIQNTLGREGFPREYGHSYDYGN
FT                   YQELTKAKYFVGKEVPMPLQRDSFAREIPRMNETASRDIWERLKESCYLVEDNEKVDVS
FT                   LGHGKRGKSFIKGTLLDDLKSVNADYERYKLPLEEVLIEYFAQKRDLSSLKVSLRDAFV
FT                   RWGSIEEANANKIVKMLEEKGYLKNPFAKEFNEVLERYQPYVYEIVSVLSEHFANPLGE
FT                   AEFDVESYSIDANGNHGHFYTGFDRYEIDYRNNTNQVSNVKFQSFALSKMEQNFLVKHD
FT                   SRGNVIQALHKGIEQIDYHPVSNRATKIKLIDSRALEFYYDARGERVLKRVYDKAGETI
FT                   KEIHYIRDEFGRALVEREVTYIAGGLRPDVSVTAYIYGPRGLFGFIRNNEFYSVITDHE
FT                   GSIRLVVKGDEVVAAYDYLPYDNLMRKYESDPEGQISYRYTGQEWDEEIGLYNYHARFY
FT                   DPNIGRFYQIDPKEQYFSPYKYAGNSPVSMVDPDGELAFLVLLPFIIAGAMAGGYLGGA
FT                   AANNRWDPTVWDFKSKETWLGLWIT"
FT   gene            complement(505791..507200)
FT                   /locus_tag="WD_0514"
FT                   /old_locus_tag="WD0514"
FT   CDS_pept        complement(505791..507200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0514"
FT                   /old_locus_tag="WD0514"
FT                   /product="ankyrin repeat domain protein"
FT                   /note="Identified by match to PF00023 protein family HMM
FT                   PF00023; match to PF00023 protein family HMM PF00023; match
FT                   to PF00023 protein family HMM PF00023; match to PF00023
FT                   protein family HMM PF00023; match to PF00023 protein family
FT                   HMM PF00023; match to PF00023 protein family HMM PF00023"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14228"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HN5"
FT                   /protein_id="AAS14228.1"
FT                   /translation="METVPENQEEIIIGLENKVRELKKEIEEIKNSSSASDESYKEQIS
FT                   SLEGQLIVLQRSFNDMKRQSSQTLSEKANEIKRLSAIVKNLRKQGEDLNKKIQENERKY
FT                   LYVECTKDIEARKFKDAEEKLKQINNETETSNVVKQVYSGRINNFPLLLEFGKSIGDAK
FT                   LKFWVYESLSVEMENTQPIDLPKTAELAKALRIGCIDRTNVPNDIRGKARGIFEKLRSL
FT                   VVGANDLCHATTMHHAAEMGDLDVVRLLIDGRAYVDYQDQQLKTPLYYAAEMGNLDVVR
FT                   LLIDKGADVNHQDEYLQTPLYLAAEEGKLDVVRLLIDKGADVNHQDEYLQTPLHYAAEM
FT                   GKLDVVRLLIDSGAYVDSKGKYFETPLQLAAKVGKLDVVRLLIDKGADVNHRDQQSRTA
FT                   LEYATSNSRFDVVKFLKEKQGLRSRRDVKELGNVSNSTLGSLQESVKPSSYVSDIVLEK
FT                   TKESNSSFVLK"
FT   gene            complement(507580..507960)
FT                   /locus_tag="WD_0515"
FT                   /old_locus_tag="WD0515"
FT   CDS_pept        complement(507580..507960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0515"
FT                   /old_locus_tag="WD0515"
FT                   /product="reverse transcriptase, interruption-C"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14229"
FT                   /db_xref="GOA:Q73HN4"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HN4"
FT                   /protein_id="AAS14229.1"
FT                   /translation="MLEFTSFRTTSNGKLMMKQKTSKISLARKIKEIKEWLKMVRSRIC
FT                   LKDWWQKLKAKLTGHYSYFGVSGNYRCLIQFYRPVTKLAFKWINRRSQKKSMDWEQFIH
FT                   YLKVNPLPKPKVYVSLYTGALV"
FT   gene            complement(507953..508294)
FT                   /locus_tag="WD_0516"
FT                   /old_locus_tag="WD0516"
FT   CDS_pept        complement(507953..508294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0516"
FT                   /old_locus_tag="WD0516"
FT                   /product="transposase, IS5 family, OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14230"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IL9"
FT                   /protein_id="AAS14230.1"
FT                   /translation="MRTKYTKVKKMWADMGYQGRNLKNHIKEEYDIDIEIVKRPPCRFW
FT                   VHKDTPPELLPTREQGFKVQPRRWVVERTFAWVNRNRRLSKEYDLLTTSTENFIYLAMS
FT                   RVMLKREYA"
FT   gene            complement(508405..508785)
FT                   /locus_tag="WD_0517"
FT                   /old_locus_tag="WD0517"
FT   CDS_pept        complement(508405..508785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0517"
FT                   /old_locus_tag="WD0517"
FT                   /product="transposase, IS5 family, OrfA"
FT                   /note="Identified by similarity to GP:1256580"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14231"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IM0"
FT                   /protein_id="AAS14231.1"
FT                   /translation="MRKKYPTDLSEREWSRIEKHFRVSYKKGGRPPKYSKREILEAIFY
FT                   VLRTGCQWRYLPNDFPLWKTVYEQFRQWKKQGIFEKMNYEITKYSRRKIGRNEQPSACI
FT                   VDSQSVKTTEKGGSKAMMEVKK"
FT   gene            complement(508823..509811)
FT                   /pseudo
FT                   /locus_tag="WD_0518"
FT                   /old_locus_tag="WD0518"
FT                   /note="reverse transcriptase, interruption-N; This gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error."
FT   gene            complement(510285..510827)
FT                   /locus_tag="WD_0519"
FT                   /old_locus_tag="WD0519"
FT   CDS_pept        complement(510285..510827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0519"
FT                   /old_locus_tag="WD0519"
FT                   /product="conserved domain protein"
FT                   /note="Identified by similarity to GP:12620658"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14232"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HN1"
FT                   /protein_id="AAS14232.1"
FT                   /translation="MKDVLKNPEMIKKEYQRRVLENKNDESSEKKFARRENQIREGIEK
FT                   LMEDYYSQENAGEKGYISEEEFKQTMRKMKERLQGIEEEKKKVVDQKAVEKGISLIINS
FT                   IKNFYSSVKSNLEQLDWQTKRGIIKALIGQINIGCDQVEVGFQIEEPAQDGGILNLYHC
FT                   TTHHNKGVGKMCAPRSA"
FT   gene            510913..511963
FT                   /pseudo
FT                   /locus_tag="WD_0520"
FT                   /old_locus_tag="WD0520"
FT                   /note="transposase, IS3 family, degenerate; This gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error.Identified by similarity to EGAD:43417"
FT   gene            complement(512047..512154)
FT                   /locus_tag="WD_0521"
FT                   /old_locus_tag="WD0521"
FT   CDS_pept        complement(512047..512154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0521"
FT                   /old_locus_tag="WD0521"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14233"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HN0"
FT                   /protein_id="AAS14233.1"
FT                   /translation="MNLSWRGYRLIAADGSGMRLPSSGEIVSEFEPNGN"
FT   gene            complement(512218..512451)
FT                   /locus_tag="WD_0522"
FT                   /old_locus_tag="WD0522"
FT   CDS_pept        complement(512218..512451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0522"
FT                   /old_locus_tag="WD0522"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14234"
FT                   /db_xref="UniProtKB/TrEMBL:Q73G67"
FT                   /protein_id="AAS14234.1"
FT                   /translation="MSFLGEACKKEKILSYKLKMQYTRKLFRKSIVLSFTRTRKLPFST
FT                   VFSMILKLVKKSLGIECELMEPLTCTLKASFF"
FT   gene            complement(512653..513420)
FT                   /locus_tag="WD_0523"
FT                   /old_locus_tag="WD0523"
FT   CDS_pept        complement(512653..513420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0523"
FT                   /old_locus_tag="WD0523"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14235"
FT                   /db_xref="GOA:Q73HM8"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HM8"
FT                   /protein_id="AAS14235.1"
FT                   /translation="MFNNFGVKTVLIDYNKIINLKEIQEKSLIFAKQDETLAKKLTLDR
FT                   IKVEVAKFVKEHKINRIFIPDNLHSAPTPCRQLVTEAIVKIVDDNPAIHLLGICEGIMN
FT                   AKGIEVVSVVSDEEKRRSHLKSAPNPQKEDLPLQQIKIVPNSRLAEVVAKFLIPNENGW
FT                   FSTYFPDAHSGAVSNTPENRRKLESLGYKVAAFSSEGVIEAIEDKHGNVHFQSHPEALV
FT                   VKSDKNLYLSNHKERQVSTLVAIAIMNDFLYRA"
FT   gene            complement(513732..513807)
FT                   /locus_tag="WD_tRNA-Phe-1"
FT                   /old_locus_tag="tRNA-Phe-1"
FT   tRNA            complement(513732..513807)
FT                   /locus_tag="WD_tRNA-Phe-1"
FT                   /old_locus_tag="tRNA-Phe-1"
FT                   /product="tRNA-Phe"
FT   gene            513887..514393
FT                   /gene="coaD"
FT                   /locus_tag="WD_0524"
FT                   /old_locus_tag="WD0524"
FT   CDS_pept        513887..514393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /locus_tag="WD_0524"
FT                   /old_locus_tag="WD0524"
FT                   /product="phosphopantetheine adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="Identified by similarity to EGAD:9109; match to
FT                   TIGR01510 protein family HMM TIGR01510; match to PF01467
FT                   protein family HMM PF01467; match to TIGR00125 protein
FT                   family HMM TIGR00125"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14236"
FT                   /db_xref="GOA:Q73HM7"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HM7"
FT                   /protein_id="AAS14236.1"
FT                   /translation="MNINDKIGIYPGTFDPITFGHLDIIKRACKLVDKLIIGVAENVNK
FT                   HTAFDTKLRTSMAENEIKGLGIDADVISFNGLLVKFAKEQNASVIIRGLRAVSDFDYEF
FT                   QMSWVNYKLLPEIETIFLPASEDTQFISSSFVKEIARLGEDVSKFVSKGVQNELINLNR
FT                   IKNGE"
FT   gene            514462..514653
FT                   /locus_tag="WD_0525"
FT                   /old_locus_tag="WD0525"
FT   CDS_pept        514462..514653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0525"
FT                   /old_locus_tag="WD0525"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14237"
FT                   /db_xref="InterPro:IPR019401"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HM6"
FT                   /protein_id="AAS14237.1"
FT                   /translation="MSKVRVNNRKVCCHGDENDEGSGHPLISLDMGEEEEIACPYCEKT
FT                   FVHDCTVEAVGELTRDEL"
FT   gene            complement(514670..515296)
FT                   /gene="cdsA"
FT                   /locus_tag="WD_0526"
FT                   /old_locus_tag="WD0526"
FT   CDS_pept        complement(514670..515296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="WD_0526"
FT                   /old_locus_tag="WD0526"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /EC_number="2.7.7.41"
FT                   /note="Identified by match to PF01148 protein family HMM
FT                   PF01148"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14238"
FT                   /db_xref="GOA:Q73HM5"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HM5"
FT                   /protein_id="AAS14238.1"
FT                   /translation="MVDNNFIIRMLSSIVILFIFSFATYFSDLSFYLLIFSIAVLSSFE
FT                   WYNLTQGNKILYVFALLLIALPSASLIYLYNLPQGKYALVWFVLTIWGIDVTAYLFGKN
FT                   FGGAKICPIISPGKTWAGLLGAILAGVVCTIFGSIFFGLFSIFYSPIIGLAIAILAQLG
FT                   DFTESLVKRAYGVKDSGNMIPGHGGVLDRMDSFIFTAPLIAIYIS"
FT   gene            complement(515286..515981)
FT                   /gene="uppS"
FT                   /locus_tag="WD_0527"
FT                   /old_locus_tag="WD0527"
FT   CDS_pept        complement(515286..515981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppS"
FT                   /locus_tag="WD_0527"
FT                   /old_locus_tag="WD0527"
FT                   /product="undecaprenyl diphosphate synthase"
FT                   /EC_number="2.5.1.31"
FT                   /note="Identified by match to TIGR00055 protein family HMM
FT                   TIGR00055; match to PF01255 protein family HMM PF01255"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14239"
FT                   /db_xref="GOA:Q73HM4"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HM4"
FT                   /protein_id="AAS14239.1"
FT                   /translation="MLNQESLPKHLAIIMDGNGRWANNQGRVKIDGYKKGSEVAYDIAK
FT                   YCTDLTIPYLTLYAFSMENWLRPKNETDCLFDLFYSVLTNEDKVNFIYNCNIKLNFIGN
FT                   LSLLPSKILDQIKKAEEMTHKNDGLLLTVAVSYGAKQEITQAISNIIKENIAYVSEEEF
FT                   EKFLYTKDLPKLDLLIRTGGEKRLSNFLLWQAAYAELYFCDTLWPDFSCQDLSKALEDY
FT                   TKREKKYGR"
FT   gene            complement(515988..516251)
FT                   /locus_tag="WD_0528"
FT                   /old_locus_tag="WD0528"
FT   CDS_pept        complement(515988..516251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0528"
FT                   /old_locus_tag="WD0528"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14240"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HM3"
FT                   /protein_id="AAS14240.1"
FT                   /translation="MEKAYIANDVIPVFDTGIQSLLYNYLMHLFEIKFPGSQCRSTGMT
FT                   PILHSSINYWCHYSNSLPVMQVADTFQVSIEIQKISLKSKLG"
FT   gene            complement(516257..516814)
FT                   /gene="frr"
FT                   /locus_tag="WD_0529"
FT                   /old_locus_tag="WD0529"
FT   CDS_pept        complement(516257..516814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="WD_0529"
FT                   /old_locus_tag="WD0529"
FT                   /product="ribosome recycling factor"
FT                   /note="Identified by similarity to EGAD:24101; match to
FT                   PF01765 protein family HMM PF01765; match to TIGR00496
FT                   protein family HMM TIGR00496"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14241"
FT                   /db_xref="GOA:P61311"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:P61311"
FT                   /protein_id="AAS14241.1"
FT                   /translation="MLNEIKAKTKERMLKTIQSFHDDIKGVRTGRASASLLDGIVVNIY
FT                   GGHQKLNQVAGVSVIDNKTLSIKVWDISVVGEVKNAILNANLNLNPVVEGSTIRIALPD
FT                   LTQETREKLVKLLHQFAENARIAIRNIRRDIMEETEKMKENKEISEDDFHGAKKEIQNI
FT                   TDDNIKKIDGELSIKEKDILNH"
FT   gene            complement(516822..517565)
FT                   /gene="pyrH"
FT                   /locus_tag="WD_0530"
FT                   /old_locus_tag="WD0530"
FT   CDS_pept        complement(516822..517565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="WD_0530"
FT                   /old_locus_tag="WD0530"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.-"
FT                   /note="Identified by similarity to EGAD:163096; match to
FT                   PF00696 protein family HMM PF00696"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14242"
FT                   /db_xref="GOA:Q73HM2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HM2"
FT                   /protein_id="AAS14242.1"
FT                   /translation="MFISTNEKSEIKYSRVLFKISGEALMGSKQFGHDMEAIGELSKGI
FT                   VEVCNLGVQVCIVVGGGNIFRGTSASLSGCERASSDYIGMLATIINALILQNFLEKNLV
FT                   ASRVLSAIPMATVCEPYIRRKAIRHLEKGRVVIFAAGTGNPFFTTDTAAALRAVEMNCD
FT                   VILKGTQVNGVYSADPKKNEDAVMYDRLSYTDLLTRDLKVMDASAISLARENSIPIIVF
FT                   SLKGEKIVNIIKGQGTYTIVSDCKQ"
FT   gene            complement(517576..518436)
FT                   /gene="tsf"
FT                   /locus_tag="WD_0531"
FT                   /old_locus_tag="WD0531"
FT   CDS_pept        complement(517576..518436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="WD_0531"
FT                   /old_locus_tag="WD0531"
FT                   /product="translation elongation factor Ts"
FT                   /note="Identified by similarity to SP:P80700; match to
FT                   TIGR00116 protein family HMM TIGR00116; match to PF00889
FT                   protein family HMM PF00889; match to PF00627 protein family
FT                   HMM PF00627"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14243"
FT                   /db_xref="GOA:P61340"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:P61340"
FT                   /protein_id="AAS14243.1"
FT                   /translation="MKMNPDDIRELRDRTGLGLSDCKKALEECDGDIKKAVDKLRTIGL
FT                   AKADKKSDRVASDGLVAMCLTENCGVLIELNCETDFVARNEKFIELVLNLASIAHQERC
FT                   TSVDELKNAKYESIGTVQEAIMNGTSVLGEKLELSKLCYLEAKDGVIAGYVHGDVCGLG
FT                   KIGALIALQSSGDKAKLQEIGKQIAMHVVAMKPEALSIDDLDQMKLNNERSIIEEQVRS
FT                   LNKPEEVAKKIVDGRMAKYYEEVVLLEQKFIKDDKMKISDFIKSSELSAVKLSNYELLV
FT                   LGDAD"
FT   gene            complement(518417..519265)
FT                   /gene="rpsB"
FT                   /locus_tag="WD_0532"
FT                   /old_locus_tag="WD0532"
FT   CDS_pept        complement(518417..519265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="WD_0532"
FT                   /old_locus_tag="WD0532"
FT                   /product="ribosomal protein S2"
FT                   /note="Identified by similarity to EGAD:13773; match to
FT                   TIGR01011 protein family HMM TIGR01011; match to PF00318
FT                   protein family HMM PF00318"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14244"
FT                   /db_xref="GOA:Q73HM1"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HM1"
FT                   /protein_id="AAS14244.1"
FT                   /translation="MTNLPKVTVRDLAESGVHFGHKISRWNAKMAPYIYGVHQENRIHI
FT                   IDLRKTLPLLQVAMKALYDVAFQGGRILFVGTKFQAFDIIASEAIRCGQYYVNHRWLGG
FT                   MLTNWGTVSSSIKTLMQYEKILNDEDSILTKKELGNIEKKKQKLDKALGGIREMGAIPD
FT                   ILFIIDTNKEHIAVKEAKKLGIPIVAILDTNSDPDGITYLIPGNDDSRKSIELYCKLAT
FT                   DSILAGIESSLAKSGVKIDDIRGDEFIQEKEDGIVQTKRRRSKVYKEEEREVVTNEDES
FT                   R"
FT   gene            519457..519533
FT                   /locus_tag="WD_tRNA-Asp-1"
FT                   /old_locus_tag="tRNA-Asp-1"
FT   tRNA            519457..519533
FT                   /locus_tag="WD_tRNA-Asp-1"
FT                   /old_locus_tag="tRNA-Asp-1"
FT                   /product="tRNA-Asp"
FT   gene            519671..520042
FT                   /locus_tag="WD_0534"
FT                   /old_locus_tag="WD0534"
FT   CDS_pept        519671..520042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0534"
FT                   /old_locus_tag="WD0534"
FT                   /product="preprotein translocase, YajC subunit"
FT                   /note="Identified by match to TIGR00739 protein family HMM
FT                   TIGR00739; match to PF02699 protein family HMM PF02699"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14245"
FT                   /db_xref="GOA:Q73HM0"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HM0"
FT                   /protein_id="AAS14245.1"
FT                   /translation="MLISEVFAADATSNTSSIGASFASFIPLILIFVVFYFLIIRPQQK
FT                   KLKEHRKMIDQIKRGDTVITSGGIIGEVNKVDEANAQFIIEIAPKVEIKVLKSAISEVL
FT                   SKETQKVAAKPIKKVKSKE"
FT   gene            520123..521943
FT                   /gene="glmS"
FT                   /locus_tag="WD_0535"
FT                   /old_locus_tag="WD0535"
FT   CDS_pept        520123..521943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="WD_0535"
FT                   /old_locus_tag="WD0535"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase (isomerizing)"
FT                   /EC_number="2.6.1.16"
FT                   /note="Identified by similarity to SP:P08633; match to
FT                   TIGR01135 protein family HMM TIGR01135; match to PF00310
FT                   protein family HMM PF00310; match to PF01380 protein family
FT                   HMM PF01380; match to PF01380 protein family HMM PF01380"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14246"
FT                   /db_xref="GOA:Q73HL9"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HL9"
FT                   /protein_id="AAS14246.1"
FT                   /translation="MCGIFGVVSSGDSVIPTLLTGLQKLEYRGYDSSGIAIINNEGKIE
FT                   VKKSEGKVERLCEVVDDSKMSHSTVGIAHTRWATHGVPGLKNAHPIRTNNVVVAHNGII
FT                   ENYNLLKKGLEERGMSFHTDTDTEIIPNMLTLYLDEGLSPIDSLFKCLNNLHGSFALVL
FT                   LFAEYPDALFVAKRNLPLAIGYNCNTVFAASDSNALSAFVERISHLEDDDIAVIKSSGV
FT                   SIYNNGTQVKRSIENSSPSDFLISKNGYPSFMLKEIFEQPRALNKTINQFYKQYKEVIF
FT                   ANKKLFSELSYITIVGCGSSYFAGLIAKYWLENVAQVRVYLEISSEFRYSNVKLEEGSI
FT                   GLFISQSGETADTIEALRYAKSQKQTIISITNTFSSSIEKISDIVLHTLAGPEIGVAST
FT                   KTFSAQLATLACFAVELGKIKGVLGGERIKQLSNAINSIPEYVEHVLNVMKIQHISDSI
FT                   LEHNNVILIGRGSSYGVAMEGALKIKELSYINTTGIAAGEMKHGSIALIDSTVLVIAII
FT                   PYDDLFFKTLSNIQEIIARKGKVIAFSDKQGAPFLRGVCADVVQLPDTDNFISPIIYSV
FT                   AMQFLAYFTAAKKGLDADCPRNLAKSVTVE"
FT   gene            522251..522694
FT                   /locus_tag="WD_0536"
FT                   /old_locus_tag="WD0536"
FT   CDS_pept        522251..522694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0536"
FT                   /old_locus_tag="WD0536"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by match to TIGR01784 protein family HMM
FT                   TIGR01784"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14247"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HL8"
FT                   /protein_id="AAS14247.1"
FT                   /translation="MALSKFLDPKLDLTFKKIFGTEKNKNILIHFLNDILGFTEINTIQ
FT                   EVEFLSTIQDAEIASKKQSIVDVLCRDENGVQVIVEMVRPESLRSYCLKGEEFIQKETE
FT                   RILKLIEPDVLPSESTHQCELGNQLVPSDADNEPPLDKEDAQS"
FT   gene            complement(522839..523072)
FT                   /locus_tag="WD_0537"
FT                   /old_locus_tag="WD0537"
FT   CDS_pept        complement(522839..523072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0537"
FT                   /old_locus_tag="WD0537"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14248"
FT                   /db_xref="GOA:Q73HL7"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HL7"
FT                   /protein_id="AAS14248.1"
FT                   /translation="MEVCSFSRELMLQILSISLQNGIRFLHYPLPAHPSAFLAGCLPYR
FT                   RKYRLILFLLSYNSGLGGFSIPVELLFAYIQK"
FT   gene            523124..524671
FT                   /pseudo
FT                   /locus_tag="WD_0538"
FT                   /old_locus_tag="WD0538"
FT                   /note="reverse transcriptase, authentic point mutation;
FT                   This gene contains a premature stop which is not the result
FT                   of sequencing error."
FT   gene            524668..525501
FT                   /locus_tag="WD_0539"
FT                   /old_locus_tag="WD0539"
FT   CDS_pept        524668..525501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0539"
FT                   /old_locus_tag="WD0539"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by match to TIGR01784 protein family HMM
FT                   TIGR01784"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14249"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HL6"
FT                   /protein_id="AAS14249.1"
FT                   /translation="MKDKPVREKKDLDKGLKRSVGKPACCVSKGGSSSNTTSLPNQVAK
FT                   TKGFEKRAQLYAAKAYSRQADKSGKYVDLKKIFFIAISNCTLFPDKLDYISSHTIRDEK
FT                   TNEHDLKDFQFIFIELPKFPKSREEQLESVVDRWLFFFKYADETTDEDLRKIAEKSPII
FT                   KLAYDELDKFHWNEKDLITYEERIMDLRKEEAILEYRLDLATEKGIQIGEERGIKIGKE
FT                   EGKIEGKIEGKIEGKIEGKIEVAKAMLANNVDVNTIVKFTGLSISEIEELSVNGY"
FT   gene            complement(525616..525807)
FT                   /locus_tag="WD_0540"
FT                   /old_locus_tag="WD0540"
FT   CDS_pept        complement(525616..525807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0540"
FT                   /old_locus_tag="WD0540"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14250"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HL5"
FT                   /protein_id="AAS14250.1"
FT                   /translation="MVNLVELCKNLERKIAKLYQFSLLVNQISDIVELFNCGVRKKGNS
FT                   MAFFLLLSIRLLCSGNWY"
FT   gene            complement(525904..526791)
FT                   /gene="murB"
FT                   /locus_tag="WD_0541"
FT                   /old_locus_tag="WD0541"
FT   CDS_pept        complement(525904..526791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="WD_0541"
FT                   /old_locus_tag="WD0541"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="Identified by similarity to SP:Q9ZDS7; match to
FT                   PF02873 protein family HMM PF02873; match to PF01565
FT                   protein family HMM PF01565"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14251"
FT                   /db_xref="GOA:Q73HL4"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HL4"
FT                   /protein_id="AAS14251.1"
FT                   /translation="MLISLPKVRGIYRYDVLMSKATWLNVGGRADVLFKPCDIEDLTYL
FT                   IKNTELPVSVIGATSNIIVRDSGIRGITVKLGKEFAYIKSKGNNSIVAGGAVLLSNLAH
FT                   FAGNQQISGLEFLVGIPGTVGGGIEMNAGAYGSDIASVVQSIKAVNLEDGNLYEFSSEE
FT                   MGYFYRGHSLKGNWIFVEAEFKGVNSEYELILQRLKEVIERKNKSQPIRGKTAGCIFKN
FT                   PKNYRAWELIDKSGCLRLNIGGARISKKHCNFLLNYDNATASDLENLGNKVKDAVKDKF
FT                   NVELEWEIRVLGSY"
FT   gene            complement(526782..527660)
FT                   /gene="hemC"
FT                   /locus_tag="WD_0542"
FT                   /old_locus_tag="WD0542"
FT   CDS_pept        complement(526782..527660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="WD_0542"
FT                   /old_locus_tag="WD0542"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="Identified by similarity to SP:P06983; match to
FT                   TIGR00212 protein family HMM TIGR00212; match to PF01379
FT                   protein family HMM PF01379; match to PF03900 protein family
FT                   HMM PF03900"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14252"
FT                   /db_xref="GOA:Q73HL3"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HL3"
FT                   /protein_id="AAS14252.1"
FT                   /translation="MLVKIGTRGSKLAVAQALEAKQKLLDSFPNLSIEIVKIKTSGDKY
FT                   ANANLAEIGGKGLFIKEIETELLENNIDMAVHSLKDMPAFFSGGLTIPCVLERLSSCDA
FT                   FISHKHNSLESLPQQATIATSSIRRKVQLLNVRPDLNIVPLRGNVTTRLQNQSFDGIIL
FT                   AEAGLIRLEKHHLITEVLPPKVMLSAVGQGAVCIQCRRNDVKIIDLLEKINNNMSFIGV
FT                   KSERSFMKTVNGSCFTPLAALAEYVSENMLHLRCMLASGKNIYFTERTSFIEDAEKMGM
FT                   DAGLELKSKCL"
FT   gene            528616..529788
FT                   /gene="sucB"
FT                   /locus_tag="WD_0544"
FT                   /old_locus_tag="WD0544"
FT   CDS_pept        528616..529788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucB"
FT                   /locus_tag="WD_0544"
FT                   /old_locus_tag="WD0544"
FT                   /product="2-oxoglutarate dehydrogenase, E2 component,
FT                   dihydrolipoamide succinyltransferase"
FT                   /EC_number="2.3.1.61"
FT                   /note="Identified by similarity to SP:P20708; match to
FT                   TIGR01347 protein family HMM TIGR01347; match to PF00198
FT                   protein family HMM PF00198; match to PF00364 protein family
FT                   HMM PF00364; match to PF02817 protein family HMM PF02817"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14253"
FT                   /db_xref="GOA:Q73HL2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HL2"
FT                   /protein_id="AAS14253.1"
FT                   /translation="MSKIIEIRAPKTLGGESVTEGIVKIKKGIGEAVKVDDLIFEIETD
FT                   KTALELTAEASGQITEFLIKEDDVISPDQLLAKLSMGEVKEEARKEDKSESAAKKDAPS
FT                   ARKIMEENAISAESVKGTGMGGRITKADVIGHMNKAEQPAIKQYELPKSVVNGEQREER
FT                   VKMSKIRQVIAARLKASQNTAAILTTFNEIDMKNVMDLRAKYKDAFEKKYGIKLGFMSF
FT                   FIKAAVQALKEIAEINAEISGDEIIYKHYYDVGVAVGTDKGLVVPVIRGADQMSFAEIE
FT                   LTLVALGKKAREGKLQVSEMEGATFTISNGGVYGSLLSTPIINPPQSGILGMHSIQNRP
FT                   VAVGNAVEIRPMMYIALSYDHRIVDGKGAVTFLVKIKNYIEDPNRLVLEV"
FT   gene            complement(529827..532234)
FT                   /pseudo
FT                   /locus_tag="WD_0545"
FT                   /old_locus_tag="WD0545"
FT                   /note="TPR domain protein, authentic frameshift; This gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error."
FT   gene            532315..532695
FT                   /locus_tag="WD_0546"
FT                   /old_locus_tag="WD0546"
FT   CDS_pept        532315..532695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0546"
FT                   /old_locus_tag="WD0546"
FT                   /product="transposase, IS5 family, OrfA"
FT                   /note="Identified by similarity to GP:1256580"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14254"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IM0"
FT                   /protein_id="AAS14254.1"
FT                   /translation="MRKKYPTDLSEREWSRIEKHFRVSYKKGGRPPKYSKREILEAIFY
FT                   VLRTGCQWRYLPNDFPLWKTVYEQFRQWKKQGIFEKMNYEITKYSRRKIGRNEQPSACI
FT                   VDSQSVKTTEKGGSKAMMEVKK"
FT   gene            532806..533147
FT                   /locus_tag="WD_0547"
FT                   /old_locus_tag="WD0547"
FT   CDS_pept        532806..533147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0547"
FT                   /old_locus_tag="WD0547"
FT                   /product="transposase, IS5 family, OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14255"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IL9"
FT                   /protein_id="AAS14255.1"
FT                   /translation="MRTKYTKVKKMWADMGYQGRNLKNHIKEEYDIDIEIVKRPPCRFW
FT                   VHKDTPPELLPTREQGFKVQPRRWVVERTFAWVNRNRRLSKEYDLLTTSTENFIYLAMS
FT                   RVMLKREYA"
FT   gene            complement(533127..534062)
FT                   /locus_tag="WD_0548"
FT                   /old_locus_tag="WD0548"
FT   CDS_pept        complement(533127..534062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0548"
FT                   /old_locus_tag="WD0548"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14256"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HK9"
FT                   /protein_id="AAS14256.1"
FT                   /translation="MLFLHRGVLYQHSFRLGTEIEEARKFDDLVFECTQGSKKVYRFLQ
FT                   AKHTQDEDNKKIGVGNLLTKDKSGEFGLAKYFVSYLKIKNNQDFADGNLKDFIICTNID
FT                   FDLDQSTARNTVKKLRVKTLGPNEEIEILVEVIDTSDVFFKDGGTRYKFSYIHNNMISV
FT                   VQPAFESAVEEAMEELEEEIKKLQNKPDQNSKRKLERNQTWQREFGRMMNEGRLEDNIK
FT                   EFFDKLVFAVNQPNEIKLADIIKSELGEQFNDIDRQNVYACFQEKMLDWLKEKGRRFLT
FT                   HEDGREFFRKMKEEILEVVRKLVNSSIFPL"
FT   gene            534345..537005
FT                   /gene="secA"
FT                   /locus_tag="WD_0549"
FT                   /old_locus_tag="WD0549"
FT   CDS_pept        534345..537005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="WD_0549"
FT                   /old_locus_tag="WD0549"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="Identified by similarity to EGAD:162785; match to
FT                   TIGR00963 protein family HMM TIGR00963; match to PF01043
FT                   protein family HMM PF01043; match to PF02810 protein family
FT                   HMM PF02810; match to TIGR01612 protein family HMM
FT                   TIGR01612"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14257"
FT                   /db_xref="GOA:Q73HK8"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HK8"
FT                   /protein_id="AAS14257.1"
FT                   /translation="MLDSPLILTAILIFFIFTLSFFFIRKIFGSTNKKIIKSFRKIVQQ
FT                   INALETEMQSLSDEELAGKTEEFKQELKNGKTLNDLLVPAFAVVREASRRFLNMRHFDV
FT                   QLIGGMVLHNGMISEMKTGEGKTLVATLAAYLNSLEGKGVHVVTVNDYLAKRDTEWMSK
FT                   LYNSLGVSVAFITNNLTDEERKEAYSADIVYSTNNELAFDYLRDNMKFSQEDMVQRGFH
FT                   YGIVDEVDSILIDEARTPLIISGPVEENNQIYKHINKIVTKLVDSDYEVDEKGRTVFLT
FT                   EDGISRVEELLRSYNLIPENSSLYDTDSMIMTHYIDQALRAYKLFTADKDYIVKDGKVV
FT                   IIDEFTGRMMEGRRYSDGLHQALEAKENLEIQHENQTLASVTFQNYFRMYNKLSGMTGT
FT                   AATEAEEFRDIYRLNVVKIPTNVPVKRVDIDDEIYGTEKEKFNAVLKFIEECYKRLQPV
FT                   LVGTVSIENSEKLSALLQSHSLKHSVLNARYHEQEAYIIAQAGVPGSITIATNMAGRGT
FT                   DIQLGGNAEMIAKVELKKIKNADEREKKYQEIVERVKKDKEIAIKAGGLCVVGTERHES
FT                   RRIDDQLRGRSGRQGDPGLSKFFLSLEDDLMRIFGSDRMRSFLQKVGLKNNEAIHHPWI
FT                   NKALEKAQKKVEARNYDVRKSLLKFDDVINNQRKVIFKQRNNILGNEINDLLEVYSEVN
FT                   ESVVEGIIQSGYYEDYIENIVKEFHTRYGITLDKEDLAKFLNKQEALNYINDKIQEFFT
FT                   EKEKYFNSQHTTDLWNTIVKQMMIMTLDHLWREHLSVLESLRQSISLRAMGQKDPLNEF
FT                   KREAFLMFESMLEKWKELTIHRLAHFKLADNQEIGNRLHSARNSRLPKVSRNDKCPCNS
FT                   GKKYKHCHGAVTVVS"
FT   gene            complement(537094..538083)
FT                   /locus_tag="WD_0550"
FT                   /old_locus_tag="WD0550"
FT   CDS_pept        complement(537094..538083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0550"
FT                   /old_locus_tag="WD0550"
FT                   /product="ankyrin repeat domain protein"
FT                   /note="Identified by match to PF00023 protein family HMM
FT                   PF00023; match to PF00023 protein family HMM PF00023; match
FT                   to PF00023 protein family HMM PF00023; match to PF00023
FT                   protein family HMM PF00023; match to PF00023 protein family
FT                   HMM PF00023; match to PF00023 protein family HMM PF00023"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14258"
FT                   /db_xref="GOA:Q73HK7"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HK7"
FT                   /protein_id="AAS14258.1"
FT                   /translation="MGSEFEEMLKEILQEINDQGFNKDNIIDKIKDKLQEKDPRVYNGW
FT                   KDNKFDIDHLFLPGIMLRMIAKDTKLTGFFIEYERTLLYVAAEHGHIQIVENLLDNGAK
FT                   TGIKNGYCKEAPLHVAAKHGHIRIVEILSKKEADIDLKNRYGETPLHYAAKYGHTQVLE
FT                   NLLGRSTNVNVQSEVGRTPLHDAANNGHIEVVKHLIKKGADVNVQSKVGRTPLHNAAKH
FT                   GHTQVVEVLLKKGADVNIQDRGGRTPLHYAVQRRYPKLAKLLLNDGADPSFIHRSKAIT
FT                   AGVAVGILAAIVTPLALVYATALPALAIIGITVASCTDSWWNFLWGCV"
FT   gene            complement(538421..539062)
FT                   /locus_tag="WD_0551"
FT                   /old_locus_tag="WD0551"
FT   CDS_pept        complement(538421..539062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0551"
FT                   /old_locus_tag="WD0551"
FT                   /product="transaldolase, putative"
FT                   /note="Identified by match to TIGR00875 protein family HMM
FT                   TIGR00875; match to PF00923 protein family HMM PF00923"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14259"
FT                   /db_xref="GOA:Q73HK6"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HK6"
FT                   /protein_id="AAS14259.1"
FT                   /translation="MEIFLDSVDLNEIKGLKEFIDGITTNPSLIAKSGRKDKYEDLVRE
FT                   ICSIIKGPVSVEVVADSHEEMITEGLNLAKIADNVVIKLPLTHEGLISCKKLWTEHKIP
FT                   VNITLCFSPGQALLAAKVGACFISPFVGRLDDISYDGLSLIEDICTIYSNYGFDTKVLV
FT                   ASVRSPAHVIEAARLGADSITVPAKVLRQLVNHPLTDQGLAIFEKDWGVK"
FT   gene            complement(539102..539443)
FT                   /locus_tag="WD_0552"
FT                   /old_locus_tag="WD0552"
FT   CDS_pept        complement(539102..539443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0552"
FT                   /old_locus_tag="WD0552"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14260"
FT                   /db_xref="GOA:Q73HK5"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HK5"
FT                   /protein_id="AAS14260.1"
FT                   /translation="MNLITNSIKGFYSSVKSDLDWQAKRSLIRTLVKEVNIDLDKVDVV
FT                   FKIKELENPAQNGQNQKMVHCLRGLGTGMTSFFLVQITLMSQYLYSCVIGCLMFTTQKV
FT                   HKVVSQAVG"
FT   gene            complement(539499..539609)
FT                   /locus_tag="WD_0553"
FT                   /old_locus_tag="WD0553"
FT   CDS_pept        complement(539499..539609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0553"
FT                   /old_locus_tag="WD0553"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14261"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HK4"
FT                   /protein_id="AAS14261.1"
FT                   /translation="MCILITIVWVPEVFTATKYALTISKEDFKQAIKKMK"
FT   gene            539714..540765
FT                   /pseudo
FT                   /locus_tag="WD_0554"
FT                   /old_locus_tag="WD0554"
FT                   /note="transposase, IS3 family, degenerate; This gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error.Identified by similarity to EGAD:43417"
FT   gene            complement(541289..542167)
FT                   /gene="folD"
FT                   /locus_tag="WD_0555"
FT                   /old_locus_tag="WD0555"
FT   CDS_pept        complement(541289..542167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="WD_0555"
FT                   /old_locus_tag="WD0555"
FT                   /product="methylenetetrahydrofolate
FT                   dehydrogenase/methenyltetrahydrofolate cyclohydrolase"
FT                   /EC_number="1.5.1.5"
FT                   /note="Identified by similarity to SP:P96050; match to
FT                   PF02882 protein family HMM PF02882; match to PF00763
FT                   protein family HMM PF00763"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14262"
FT                   /db_xref="GOA:Q73HK3"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HK3"
FT                   /protein_id="AAS14262.1"
FT                   /translation="MTIIIDGKKIANDLCERLSQKIDILKREYNIFPCLKVILIGSNPA
FT                   SQVYVRNKQKKAESIGISSETIVLPNNILEDELIEKINELNEDPSVHGILVQLPLPNHI
FT                   SASRVINTVSVEKDVDGFHDENVGKLVKGEKNCLIPCTPKGSLHLIKSIEENLSGKNAV
FT                   VIGRSNIVGKPMFYLLLQENCTVTILHSQSKDLAEYCSKADIVVAAVGKPNFVQADWIK
FT                   KGAIVIDVGINSVNVGKLVGDVDFEGIKGKAKAMTPVPGGVGPMTIAFLMMNTVIAACL
FT                   QKGVDASDFIS"
FT   gene            complement(542151..542726)
FT                   /gene="ubiX"
FT                   /locus_tag="WD_0556"
FT                   /old_locus_tag="WD0556"
FT   CDS_pept        complement(542151..542726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiX"
FT                   /locus_tag="WD_0556"
FT                   /old_locus_tag="WD0556"
FT                   /product="phenylacrylic acid decarboxylase,
FT                   3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /EC_number="4.1.1.-"
FT                   /note="Identified by similarity to EGAD:90870; match to
FT                   PF02441 protein family HMM PF02441"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14263"
FT                   /db_xref="GOA:Q73HK2"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HK2"
FT                   /protein_id="AAS14263.1"
FT                   /translation="MNSRIVIGISGASGSIYGVRILEALKDVDYETHLVISRAGKVTLA
FT                   HEIKEKLEDITSLADFYYSEEKIGEKIASGSFKTSGMIVAPCSMKTMSEIASGVTSNLL
FT                   TRAADVMLKERRKLVLMVRESPLHLGHLQNMLKLTEMGAIIAPPVPAFYIKPKSLDDII
FT                   NHSVGKVLDLFDIKLPDFKEWQGSDNYY"
FT   gene            complement(542719..542985)
FT                   /locus_tag="WD_0557"
FT                   /old_locus_tag="WD0557"
FT   CDS_pept        complement(542719..542985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0557"
FT                   /old_locus_tag="WD0557"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to GP:15075817"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14264"
FT                   /db_xref="InterPro:IPR018753"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HK1"
FT                   /protein_id="AAS14264.1"
FT                   /translation="MEDTVKITAEELKGYIERIEKLEQEKRDVQDHIRDVYAKAADEGW
FT                   DIKVMKQIIRLRKMDDDDREEQEILLDTYKRALGMSYEEELSE"
FT   gene            complement(542999..544282)
FT                   /locus_tag="WD_0558"
FT                   /old_locus_tag="WD0558"
FT   CDS_pept        complement(542999..544282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0558"
FT                   /old_locus_tag="WD0558"
FT                   /product="CBS domain protein"
FT                   /note="Identified by similarity to GP:15075699; match to
FT                   PF01595 protein family HMM PF01595; match to PF00571
FT                   protein family HMM PF00571; match to PF00571 protein family
FT                   HMM PF00571; match to PF03471 protein family HMM PF03471"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14265"
FT                   /db_xref="GOA:Q73HK0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HK0"
FT                   /protein_id="AAS14265.1"
FT                   /translation="MDWLLVLVSSAIFVLLVLSFLFSGAEIGLTSISRSRVNKLKLDGN
FT                   KKARVIDRLLNRKELTIGTVLLGNTIINITCSALFTAIFINLFGNEGILLSTIIMTFCI
FT                   LLFCEVLPKTYAIQNPEKFASFSAYFVLFFVKIFSPLTLGIQFIVNLILKLCGLHKDKE
FT                   VISAADAMRNMITLHRSEGTMLQQDLDMLSSILDLAETEISQIMTHRRNLFSLDIDRNK
FT                   EELIREILTSSHSRVPLWQKEPDNIVGVIHVKALINALREKNNKAEEVDITQVMSRPWF
FT                   IPESTPLSVQLHNFRKNRKHLAFVIDEYGALQGIVTLEDILEEIVGEISDEHDLITENF
FT                   IKKISDNMYHIEGKSTIRDINRQLYWNLPDEEATTLAGMIVNEIERIPDEGEEFSMYGF
FT                   RFKILKKDKNIITVVEVQVKIGNISGSN"
FT   gene            complement(544371..545549)
FT                   /gene="argD"
FT                   /locus_tag="WD_0559"
FT                   /old_locus_tag="WD0559"
FT   CDS_pept        complement(544371..545549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /locus_tag="WD_0559"
FT                   /old_locus_tag="WD0559"
FT                   /product="acetylornithine aminotransferase"
FT                   /EC_number="2.6.1.11"
FT                   /note="Identified by similarity to EGAD:49428; match to
FT                   PF00202 protein family HMM PF00202; match to TIGR00707
FT                   protein family HMM TIGR00707"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14266"
FT                   /db_xref="GOA:Q73HJ9"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HJ9"
FT                   /protein_id="AAS14266.1"
FT                   /translation="MDHVVNAYNRLDTPIVRGEGAYLFDKDGKKYLDFAAGISTTSLGH
FT                   CHPYITDKLKEQSSSLWHCSNIFTIPEQERLAEHLTTLTFADKVFFCSSGLEATEAAIK
FT                   FIRRYFYSKGQAKRNRIITIEGGFHGRSIAAISAGGNEKSREGFAPLLSGFDKVPRNNI
FT                   KALEEKINNEIAAVFLEPIQSEGGVYPLDVEYLQKVREITKAQGIILCFDEVQCGYGRI
FT                   GSLFHYQNVGIEPDMLTCAKAMGNGFPVAACLVKDYIAEAITPGTHGSTYGGNPLAMTV
FT                   GNAVLDIMLKEGFFDHVKRISKYLKEKLLLLAKEFPEMILEVRGEGLLMGIELATLVAD
FT                   KIISRSLDKGLIITRVLNNKVVRVTPPLIIEDEHVNAACNMLYDLFLKIKGI"
FT   gene            545825..546997
FT                   /gene="nuoD"
FT                   /locus_tag="WD_0560"
FT                   /old_locus_tag="WD0560"
FT   CDS_pept        545825..546997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoD"
FT                   /locus_tag="WD_0560"
FT                   /old_locus_tag="WD0560"
FT                   /product="NADH dehydrogenase I, D subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="Identified by similarity to EGAD:163273; match to
FT                   TIGR01962 protein family HMM TIGR01962; match to PF00346
FT                   protein family HMM PF00346"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14267"
FT                   /db_xref="GOA:Q73HJ8"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HJ8"
FT                   /protein_id="AAS14267.1"
FT                   /translation="MPDLKTMMLNFGPQHPAAHGVLRLVLEMDGEVIERADPHIGLLHR
FT                   GTEKLIEHKTYLQALPYFDRLDYVSPMSQEHAYSLCVEKLLQCEVPIRAKYLRVLFCEL
FT                   TRILNHLLNVSSQALDVGAMTPLLWLFEEREKILEFYERASGARFHAAYIRPGGIAADV
FT                   PEDLIEDIAKFIEQFPKYIDDVDELLTENRIWKQRTVGISEISIKQALDWGFSGPMLRA
FT                   AGLAWDLRKSQPYEIYDQLDFDIPIGQNGDCYDRYLVRMAEIRQSISLVKQCIEKMPEG
FT                   QIKTEDRKISPPSRAEMKKSMEALIHHFKLYSEGYHVPEGEAYAVVEAPKGEFGVYIVS
FT                   DGTNRPYRCRIRAPGFAHLQALDFMAKGHMLADVAAIIGSLDIVFGEIDR"
FT   gene            complement(547731..547952)
FT                   /locus_tag="WD_0562"
FT                   /old_locus_tag="WD0562"
FT   CDS_pept        complement(547731..547952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0562"
FT                   /old_locus_tag="WD0562"
FT                   /product="transposase, truncation"
FT                   /note="Identified by similarity to OMNI:SO0356"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14268"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HJ7"
FT                   /protein_id="AAS14268.1"
FT                   /translation="MSQKVVNRTTGLVDYKELEANILSSIREGRPLTGRDGAFTPFIKK
FT                   LLEASLEGEIENHLLAESEERVWLEEVE"
FT   gene            548107..549435
FT                   /locus_tag="WD_0563"
FT                   /old_locus_tag="WD0563"
FT   CDS_pept        548107..549435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0563"
FT                   /old_locus_tag="WD0563"
FT                   /product="transposase, IS4 family"
FT                   /note="Identified by similarity to EGAD:8624; match to
FT                   PF01609 protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14269"
FT                   /db_xref="GOA:Q73IB8"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IB8"
FT                   /protein_id="AAS14269.1"
FT                   /translation="MNKITSLSKKLKEFFNEKADKISITTRFIKRKRKLKGSSFVKAMV
FT                   LGNIGVDNCSVETMCQLLNEDSIDITKQGLDFRFTEEAVEFMKRMYNESVLLFKNILQV
FT                   DCKILQQFNSVKLLDSSYITLPNSMEEMYKGYGTSYSGYESNTKSGIKLQLVFDYMNQI
FT                   IDQLNLTEGVRSDQGYRKHLSNILSNDLLISDLGYFVPSSFKQINEIGAYFISRYKSDT
FT                   NIYDVETNQKMELLECLEDKLFLENEVLLGKEAKIRVRIICQKLTEEQSMARRRKANRL
FT                   ARSQGYTSSKRNQKLLNWSIFITNVPENKISAEQVLTIYRVRWQIELLFKLYKSHIRLD
FT                   KLKGKPCRVLCELYAKLCAILIFHGIVGCTEVKKNTELSLTKAFIELKRRVIELFLALK
FT                   NKVNSLKVFLKKLTITWSRFSLKDKYRKTRVSTLTSLNLLTIS"
FT   gene            549454..549789
FT                   /locus_tag="WD_0564"
FT                   /old_locus_tag="WD0564"
FT   CDS_pept        549454..549789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0564"
FT                   /old_locus_tag="WD0564"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14270"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HJ5"
FT                   /protein_id="AAS14270.1"
FT                   /translation="MNVPEIHEYEIGYTAISFDKLYQIAEGLSVNIKVLLPKTRESKKL
FT                   LSLMDEYREQESLVKSLSEDMKSGKEKVKKAEKIRVAKNLVKAGVSTDVILRASGLTVD
FT                   ELGECEN"
FT   gene            complement(549882..550790)
FT                   /locus_tag="WD_0565"
FT                   /old_locus_tag="WD0565"
FT   CDS_pept        complement(549882..550790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0565"
FT                   /old_locus_tag="WD0565"
FT                   /product="patatin family protein"
FT                   /note="Identified by match to PF01734 protein family HMM
FT                   PF01734"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14271"
FT                   /db_xref="GOA:Q73HJ4"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HJ4"
FT                   /protein_id="AAS14271.1"
FT                   /translation="MVKYILSVDGGGIRGIIPAIILAEIEQRTRKTIAEIFDLMAGTST
FT                   GGIVVAGLCKKDKPQYSANDLVEFYREYGPYIFKSSFFRRSILSWFNCAQYPHKNIESV
FT                   LDKYFGEDILKNTLSNVLITSYDIQNNCPFFFKSWKEGNIKLKDALRAATAAPTYFAPK
FT                   YLKVNQKEMVLVDGGVFANNPAACAYASGKRLFPNDDILLLSIGTGRTDRSIANSRRFG
FT                   KIGWIKPLLNVMFASSLDAVNYQLDQVIADKYIRIQSQLKIASPDMDNITSKNIKSLQQ
FT                   EANAMIEDNQELIDKFCDVLS"
FT   gene            complement(551076..551597)
FT                   /locus_tag="WD_0566"
FT                   /old_locus_tag="WD0566"
FT   CDS_pept        complement(551076..551597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0566"
FT                   /old_locus_tag="WD0566"
FT                   /product="ankyrin repeat domain protein"
FT                   /note="Identified by match to PF00023 protein family HMM
FT                   PF00023; match to PF00023 protein family HMM PF00023"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14272"
FT                   /db_xref="GOA:Q73HJ3"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HJ3"
FT                   /protein_id="AAS14272.1"
FT                   /translation="MKKIKYNERDKLHFVWFILLIVCVVITYCYQKSKATDNYNKTLQV
FT                   ATSNCNLGIVKLLVKDMAPNLSGTTLHCAARKGCLDIIRFLIEEEKVNINALDRNAFKR
FT                   IALHHAAGEGHLEVIKFLLEKGANPNIRDIDGKNPRDVAVLRSRHNKDKPYDEIIHLLY
FT                   NAEKEHESEQ"
FT   gene            complement(551654..552598)
FT                   /locus_tag="WD_0567"
FT                   /old_locus_tag="WD0567"
FT   CDS_pept        complement(551654..552598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0567"
FT                   /old_locus_tag="WD0567"
FT                   /product="prophage P2W3, tail protein D, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14273"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HJ2"
FT                   /protein_id="AAS14273.1"
FT                   /translation="MQPDFIIDKCESIKDRVISLHLTDESGIIDDVVEVCVDYRDEDID
FT                   IPNELNIALGYKEFGIFPMGIYTVNEVTIQGPPKTLLIKAHATNLRISLKAKVSKEWRQ
FT                   ITIENLVKEIAQKHGYGYKVAEEFKDVLIPHINQADESDISLLTKIATEREAMAKLASG
FT                   YILFISKNMAKSATGKALGTTTIRPQDTINWKVHFTVRDKYNSVVAKWHSYEKGETIKE
FT                   TVGSGEPSYIMLELYSNAESALSAANAKLKQLKLNNETLDVTMPGNPQIFAEAKLNLLG
FT                   FNQALDGEWIINRAEHTLNSSGYLTMLSASLSK"
FT   misc_feature    552257..559919
FT                   /note="PHAGE03; Putative lysogenic prophage region.
FT                   CONSIDER ANNOTATING AS PYOCIN? Putative
FT                   attL/R=tatttcttttact."
FT   gene            complement(552599..552808)
FT                   /locus_tag="WD_0568"
FT                   /old_locus_tag="WD0568"
FT   CDS_pept        complement(552599..552808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0568"
FT                   /old_locus_tag="WD0568"
FT                   /product="prophage P2W3, tail protein X, putative"
FT                   /note="Identified by match to PF05489 protein family HMM
FT                   PF05489"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14274"
FT                   /db_xref="InterPro:IPR008861"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HJ1"
FT                   /protein_id="AAS14274.1"
FT                   /translation="MTIYYVSKENEMLDLICWKHYGFTDGVVELVLAENLGLAEYGSFL
FT                   PAGLKIKLPTIKKIVQKSKLKVWE"
FT   gene            complement(552805..553155)
FT                   /locus_tag="WD_0569"
FT                   /old_locus_tag="WD0569"
FT   CDS_pept        complement(552805..553155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0569"
FT                   /old_locus_tag="WD0569"
FT                   /product="prophage P2W3, tail protein U, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14275"
FT                   /db_xref="InterPro:IPR009734"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HJ0"
FT                   /protein_id="AAS14275.1"
FT                   /translation="MMLSLGPYKFAPTSLKYSRENRWSTIECIENMPLLQNIGQGVENI
FT                   DLEGMIYLHNLNVLNQLKSVKETEKPHILVDSLGNILGQFVITRLEEKQMYFLPNGLPR
FT                   KIEFSLSLKSYR"
FT   gene            complement(553152..555194)
FT                   /locus_tag="WD_0570"
FT                   /old_locus_tag="WD0570"
FT   CDS_pept        complement(553152..555194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0570"
FT                   /old_locus_tag="WD0570"
FT                   /product="prophage P2W3, tail tape measure protein"
FT                   /note="Identified by match to TIGR01760 protein family HMM
FT                   TIGR01760"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14276"
FT                   /db_xref="GOA:Q939B7"
FT                   /db_xref="InterPro:IPR010090"
FT                   /db_xref="UniProtKB/TrEMBL:Q939B7"
FT                   /protein_id="AAS14276.1"
FT                   /translation="MKAIEKPSKTLKAEFDKAKTSAIKAKEAYLKKRDALHSFNEEVRK
FT                   SGRNIKYLVSDQHKLGSSIEVLKGKYGKLGSAIRSHQSFLASKAHFKSQIIETIGLGLT
FT                   FAAPVKVAIDFESAMADVTKVVDFKKGTDEATKFAKKLKEMSRTIPLSAAELAQIAASG
FT                   GQLGIKKEDLFMFTETVAKMSTAFDMSAEQAGDSIAKLSNVYGIDVSKMEYVGNVINHL
FT                   SDNTAAKAKDMVEALAIVGGTAKQFGLDIKETSSLVNAFVSLGKQPAKAATAINALLSK
FT                   LQTAEEQGGDFKAALEQMGITAEEIVQRISENGEEALLYFFQALKKMDNQERSTILMKL
FT                   FGQEYQDDIALLAGSFNKYEDAIRLLSDTEEYKSSLQKEFQNRVDTTASKLRLLRNAIA
FT                   EVGMNLGSVMLPTLKSIAEFLQEKTRSIALFAEKYPTLTKAIMGTVAALISLKVVAVGL
FT                   GYGFTLLGSTIFSLKANLLGVFSFLSATVFPAVVTGLRAVTLANPIGLLITGLVTGAAL
FT                   VITNWQKVKDFFSSFWKSIIKPIEEAFSWIGESIFGKVLGNSPLKEFEKRKTEVKAVHT
FT                   PLKSNILNSGNPVLGNSIIKEFSKRNKNSFRVKSLIEETESDKIFARSKFENKEQNKTQ
FT                   NITNNYTISIKAEPNQDVRSLADEVIKRIREKSRDVLFDTVETFY"
FT   gene            complement(555204..555416)
FT                   /locus_tag="WD_0571"
FT                   /old_locus_tag="WD0571"
FT   CDS_pept        complement(555204..555416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0571"
FT                   /old_locus_tag="WD0571"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14277"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HI8"
FT                   /protein_id="AAS14277.1"
FT                   /translation="MSTLSIKIGAVLDGSFSTVIKGSSSQLTHLGENIRKLDSSLKSVS
FT                   KFKQLGHDVLTSKRSWKGFEDQVKS"
FT   gene            complement(555526..555783)
FT                   /locus_tag="WD_0572"
FT                   /old_locus_tag="WD0572"
FT   CDS_pept        complement(555526..555783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0572"
FT                   /old_locus_tag="WD0572"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to OMNI:NTL01XF00730"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14278"
FT                   /db_xref="InterPro:IPR019289"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HI7"
FT                   /protein_id="AAS14278.1"
FT                   /translation="MQAITLNNPITVDGISVSELTVRRPKVRDYLAIESLNGSDLSKEV
FT                   TLTANLTSVAKEAIEELDIADYVKIQEVLKDFFSPIIQKT"
FT   gene            complement(556124..556324)
FT                   /locus_tag="WD_0573"
FT                   /old_locus_tag="WD0573"
FT   CDS_pept        complement(556124..556324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0573"
FT                   /old_locus_tag="WD0573"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14279"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HI6"
FT                   /protein_id="AAS14279.1"
FT                   /translation="MDSKAHTNSIEQLTGLLVSVAQSQDKSVLKLLTELMEEEIEDMEL
FT                   SKIADERYKEKRVKHQDAFWD"
FT   gene            complement(556386..556883)
FT                   /locus_tag="WD_0574"
FT                   /old_locus_tag="WD0574"
FT   CDS_pept        complement(556386..556883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0574"
FT                   /old_locus_tag="WD0574"
FT                   /product="prophage P2W3, contractile tail tube protein"
FT                   /note="Identified by match to TIGR01611 protein family HMM
FT                   TIGR01611; match to PF04985 protein family HMM PF04985"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14280"
FT                   /db_xref="InterPro:IPR006498"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HI5"
FT                   /protein_id="AAS14280.1"
FT                   /translation="MLPKILRNFNVFVDGRGYAGKIDEITLPKLTIKTEEYRAGGMDIP
FT                   INIDMGMEKLEADFTFAEYDSELFRLFGLIDGNSVSLTLRGGMQGNDIEAVIINLRGIF
FT                   KEFDFGNWKPAEKATLKCTVAAHYYKLTIGGNELIEIDAENMIRKINGVDQMALLQTIL
FT                   GI"
FT   gene            complement(556895..558081)
FT                   /pseudo
FT                   /locus_tag="WD_0575"
FT                   /old_locus_tag="WD0575"
FT                   /note="prophage P2W3, major tail sheath protein, putative,
FT                   authentic frameshift; This gene contains a frame shift
FT                   which is not the result of sequencing error."
FT   gene            complement(558074..558625)
FT                   /locus_tag="WD_0576"
FT                   /old_locus_tag="WD0576"
FT   CDS_pept        complement(558074..558625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0576"
FT                   /old_locus_tag="WD0576"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14281"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HI4"
FT                   /protein_id="AAS14281.1"
FT                   /translation="MSIYIRFENDKQVETTTLESKPTENDWYEAPEDFDWQKSYCLTEG
FT                   GKIAQRTKEDIQKELLDNAKLCAFDSMRFYYDNHTHQYAGHSHQKAKSYEIQAEAAKSI
FT                   LADQDEKDKEIIEPLAKVRGITVIEMARIIEEKVKKAVKAIIKCEELEDLAKRKIEEAK
FT                   SENELQTLLDDFRKKIQRNG"
FT   gene            complement(558632..559966)
FT                   /locus_tag="WD_0577"
FT                   /old_locus_tag="WD0577"
FT   CDS_pept        complement(558632..559966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0577"
FT                   /old_locus_tag="WD0577"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14282"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HI3"
FT                   /protein_id="AAS14282.1"
FT                   /translation="MIADKKAISDIAQMTKVKEIIDALQKRLKDLAENSTPDQLAYLAK
FT                   ALESIIDKSAVSEIVQMTDGKLKELLDSAKKHLTDLDNKKASSLAVISESEKQLLKRID
FT                   EKGTTNLSLLDTRKNANIAAINSISNSHKDGLKGLVNNFRTVNDVPSGSSIIREIETRI
FT                   ENILNEVKTRDEQLKASLINEIRKRNMVEPGSLPFLFGVLGRKNNYFGHGTFTTELGKW
FT                   SSDITKTDYMLQLLAGSHTYNTDYVSFYRPRQLSFIEGSKGTFIYGELCTKSFSGSYDE
FT                   IYYYPYAALGVVFVKNTTNVNINKTMEFVGSSYSSTEYGGAGLFVGTPDNTNSNKSSIS
FT                   KIVWKNVYQYTSSDSKLAGSGNVEIPAGKTVAILLYTSSYLYSRTQVSQGMLASNYVHN
FT                   YGQFIQWGIYNIRSNFLTTGLEVDVERTLRGWQCPGLSNTYEIWR"
FT   gene            complement(560059..560253)
FT                   /locus_tag="WD_0578"
FT                   /old_locus_tag="WD0578"
FT   CDS_pept        complement(560059..560253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0578"
FT                   /old_locus_tag="WD0578"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14283"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HI2"
FT                   /protein_id="AAS14283.1"
FT                   /translation="MPNDETRRGYPLPHPENIAVEDVVRIRRAIEKVDEDMSNRENKHN
FT                   QLKSNFERFRFETFLNFWE"
FT   gene            complement(560258..561436)
FT                   /locus_tag="WD_0579"
FT                   /old_locus_tag="WD0579"
FT   CDS_pept        complement(560258..561436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0579"
FT                   /old_locus_tag="WD0579"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14284"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HI1"
FT                   /protein_id="AAS14284.1"
FT                   /translation="MENQGRISGKIKIPANIPAGTKLVQFYGDKGSYGEATYTGKKTIT
FT                   IEERRRVIAARRVDPLAQTFTLNESRHIGGVELWFVNKGKKRVVVQIRETAVGMPSQTV
FT                   IAESYIEPKDIKIDGTATRITWSPVWCESSREYAIVLLTDDADTAVKIAELGEYDVVNS
FT                   RWVTSQPYQVGVLLSSSNASTWTPHQNLDLTFRLLAAKFSENSHVIDLGKVTANNVSDL
FT                   IVLTNVEKVAFDTNVEFILTDEEGKENFLSDNLPLALRERLSGELTVKANLKGAKEKSP
FT                   VLYPGLQLVLGNLSESGDYVTRSITAGANTKITITYDALIPGTADVKAYVEQSVKGWQL
FT                   VNLTSGKPIGENWVERTHVLTNFNSNETRVKLVLSGTVIYRPKVKNLRVVIT"
FT   gene            complement(561446..563374)
FT                   /locus_tag="WD_0580"
FT                   /old_locus_tag="WD0580"
FT   CDS_pept        complement(561446..563374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0580"
FT                   /old_locus_tag="WD0580"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14285"
FT                   /db_xref="InterPro:IPR032096"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HI0"
FT                   /protein_id="AAS14285.1"
FT                   /translation="MTLNAYYNRFNPDKEYEKSLFLAGRGLQSAELNETQEYALSKIKG
FT                   IGDAIFRDGDVITGSNCIIDRETGKVTLEGGKIYLRGAVRKVEKEEFVIPLSTTVRIGV
FT                   YYVESTITELEDENLRDPAIGTRNYQEVGAARLKVSTIWGYQAEGLSPRFSEGEFYPIY
FT                   KIENGVLIEHSPPPQANIVTTALARYDKEANGSYVVNGLEVMFLQKEEGEGGKKIFVIN
FT                   EGKAHVDGYEIELPHSIRVSFDEDPDIKSVESEPHTFQPNSQRVMELKVNDFPISEIKK
FT                   VDITVQKTITVTHGSYSGAIDPIPDSAVLEIIQVKQGNVIYENSIDYKLNAGNVDWSLP
FT                   GKEPAPGSSYQITYRCRTHVSPEDISEQGCKVKGAVDNSLVLIDYTWKMPRYDLITIDS
FT                   KGVVRRIKGISHPWRPSMPRAPSGQLLLCYIHQTWKKGEGVKIVNNAIHAVPMNELEAM
FT                   KKGINDLYALVAEERLRNDANSREPTTKKGVFVDSFFDDDMRDQGILQSAAIVNKELIL
FT                   PIDVTIADIDGGEKTYLLPYELEPVLEQLLQTKGEKINPYQAFDPVPAKVTMNKNIDHW
FT                   TEVTTNWKSPVTRVFNVKETTELLSSTSYETEFMREATQNFEIEGFATGEKLKEVKFDG
FT                   LSIQPIP"
FT   gene            complement(563391..564092)
FT                   /locus_tag="WD_0581"
FT                   /old_locus_tag="WD0581"
FT   CDS_pept        complement(563391..564092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0581"
FT                   /old_locus_tag="WD0581"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14286"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HH9"
FT                   /protein_id="AAS14286.1"
FT                   /translation="MSILTQSGRAAIAASIKKQSIHLAWGTGDSSWESSHKVEKTFVKG
FT                   EIKFDHQPIFDRQPIKDVKVFTGQTTYQPSIDYTVNGSTGVIKLTENSSIPVSDKVTVE
FT                   YSESTPPELITSEKLLNELGRRTADEVLFCTGDENGELITPSGRFRPSNVPTNNLYLKF
FT                   TFDFTDAANQVIRELGVMVGTKIKEELPEGQRYFEPQDVEEHGILLILEHTVPLIRTAA
FT                   TRETFSFVVTF"
FT   gene            complement(564175..566223)
FT                   /locus_tag="WD_0582"
FT                   /old_locus_tag="WD0582"
FT   CDS_pept        complement(564175..566223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0582"
FT                   /old_locus_tag="WD0582"
FT                   /product="regulatory protein RepA, putative"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14287"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="InterPro:IPR038724"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HH8"
FT                   /protein_id="AAS14287.1"
FT                   /translation="MDIYCSQRNGHYKLLGKKEQLRTQLLSNIRSCLSYLLPRGTFRGD
FT                   KFYVGDLQGNKGQSMIVELTGSKAGLWHDFSTGEGGDIFDLWAAVTGKNQFTDTIEDIA
FT                   KWIGYSEKNNTLGQPTASWNYYDESDQVIVTVYRYNTDSGKRYLPFDVKRSSFTLPETR
FT                   PLYNIPGIVKSDKVILVEGEKCADALIEQGMTATTAMLGANAPIEKTDWSPLKGKHVII
FT                   WPDNDEPGKQYAEKVVKKLTFLGVLSLTLLEIPENKPKGWDSADGIEEKMNIPEFIENN
FT                   SKKIIVKQLLNIQEWSVERFIGPVPEQKFLVEGLFPLGVTSILAAMGDTGKGMLLLDLA
FT                   LKVASRKDQPCGFGPLVTEHGSVVIFSAEDDMSEIHRRLERLDSQCERLKYKDRLFIVP
FT                   LPNVSGSLTIIKSVSGKVIETSPEFELITKQLNKIKNLKLIVFDPLASFVHADLNTDPA
FT                   VGDYLISLLSDLAGSTGASIITAHHMRKPKSEKPISTVEQARDAIRGTSALVNGVRCSY
FT                   AFWSVEDAAKPTIFKSIGESVRQNALFYGAIVKANGLADRTLRTYLRNEETGLLEDITE
FT                   RLRIKNMNEKDSKQHLITAITRAAISGHPFTHTGSTGVYKQRHRLPEEFHSIGRDRMER
FT                   IVQELLQTRKLVKGMATGSKEDKWLDIPSGPFARGVGKFSCGAELFS"
FT   gene            complement(566241..566918)
FT                   /locus_tag="WD_0583"
FT                   /old_locus_tag="WD0583"
FT   CDS_pept        complement(566241..566918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0583"
FT                   /old_locus_tag="WD0583"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14288"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HH7"
FT                   /protein_id="AAS14288.1"
FT                   /translation="MPQDIIGPRILTPGGLLVIGGTPKIGKSHFLLSLLVHLVAGRSFL
FT                   GMKPTRPLKIFYLQNEMEYDYIRERIQQLNKLPHLATENLVVTNKMNLTLNEEGIEKIK
FT                   NMVEEKFDLVVIDSPYNYVNYGLQHAIEKLRSKINTMAGIIITNHTKKVSTSTLEKNPF
FT                   QALVGANALRSFYTSGIVIFQPNKRTNILQVVYELRNGRSIPTKFINKINGCWKSANVI
FT                   ART"
FT   gene            complement(567043..567468)
FT                   /locus_tag="WD_0584"
FT                   /old_locus_tag="WD0584"
FT   CDS_pept        complement(567043..567468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0584"
FT                   /old_locus_tag="WD0584"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14289"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HH6"
FT                   /protein_id="AAS14289.1"
FT                   /translation="MVAILKYDEGKLWAAVITRAIQDAAGKNPKLKKEACQWIRSRSFE
FT                   TVCELANLDFKRLKNMLNKFGINKENFMDFSSKNALKIKSLLINNIKDCLSYLLPEGKS
FT                   YQNKFYIGSRNGRRKCRKLVQPDRRKERKYNRPLDFS"
FT   gene            complement(567453..567953)
FT                   /locus_tag="WD_0585"
FT                   /old_locus_tag="WD0585"
FT   CDS_pept        complement(567453..567953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0585"
FT                   /old_locus_tag="WD0585"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to OMNI:NT01MC4467"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14290"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HH5"
FT                   /protein_id="AAS14290.1"
FT                   /translation="MLQDFLTDFNNAKLQSSLIPKGTIVKVKMAIKPGGYENWFTKNYT
FT                   TGSIYLNVEFTVTEGPYAKRKIFQIIGIKNGKAEGEEDIWGESGRSMLRSILESSRNIH
FT                   ANDTSEKAVTARRINSIADFNDLEFTAKVGVETNNTYGDRNRITTVITPELQKNFQDDW
FT                   LPF"
FT   gene            complement(567991..568245)
FT                   /locus_tag="WD_0586"
FT                   /old_locus_tag="WD0586"
FT   CDS_pept        complement(567991..568245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0586"
FT                   /old_locus_tag="WD0586"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0586"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14291"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HH4"
FT                   /protein_id="AAS14291.1"
FT                   /translation="MNLLVSGQPLTHHTKKLSKKMLEEDPFQGLSGAGSLRGFYSTGMV
FT                   MFAHDEESSARQIVFELRNGERVPNKLVDKINGHWQLME"
FT   gene            complement(568242..568583)
FT                   /locus_tag="WD_0587"
FT                   /old_locus_tag="WD0587"
FT   CDS_pept        complement(568242..568583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0587"
FT                   /old_locus_tag="WD0587"
FT                   /product="transposase, IS5 family, OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14292"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IL9"
FT                   /protein_id="AAS14292.1"
FT                   /translation="MRTKYTKVKKMWADMGYQGRNLKNHIKEEYDIDIEIVKRPPCRFW
FT                   VHKDTPPELLPTREQGFKVQPRRWVVERTFAWVNRNRRLSKEYDLLTTSTENFIYLAMS
FT                   RVMLKREYA"
FT   gene            complement(568694..569074)
FT                   /locus_tag="WD_0588"
FT                   /old_locus_tag="WD0588"
FT   CDS_pept        complement(568694..569074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0588"
FT                   /old_locus_tag="WD0588"
FT                   /product="transposase, IS5 family, OrfA"
FT                   /note="Identified by similarity to GP:1256580"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0588"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14293"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IM0"
FT                   /protein_id="AAS14293.1"
FT                   /translation="MRKKYPTDLSEREWSRIEKHFRVSYKKGGRPPKYSKREILEAIFY
FT                   VLRTGCQWRYLPNDFPLWKTVYEQFRQWKKQGIFEKMNYEITKYSRRKIGRNEQPSACI
FT                   VDSQSVKTTEKGGSKAMMEVKK"
FT   gene            complement(569102..569692)
FT                   /locus_tag="WD_0589"
FT                   /old_locus_tag="WD0589"
FT   CDS_pept        complement(569102..569692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0589"
FT                   /old_locus_tag="WD0589"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14294"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HH1"
FT                   /protein_id="AAS14294.1"
FT                   /translation="MLQNFLTIGQKIPFFSVKEYLDDRSPIPEDIISPRILTKRGLLVL
FT                   GGPPKIGKSDFLISWLVHMAAGVPFLGMVSNRPLKIFYMQTEIEYMKERLQQLDNELLN
FT                   VAANNLIITPKVHLSFNHDEISGIKEIVNERFKPDVLAIDPLRNIFSSEYGNENDNSAM
FT                   LFFLQKTLEKLRSAVNPDACIVLRGCPETSKRL"
FT   gene            complement(569704..570525)
FT                   /locus_tag="WD_0590"
FT                   /old_locus_tag="WD0590"
FT   CDS_pept        complement(569704..570525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0590"
FT                   /old_locus_tag="WD0590"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to OMNI:NT01MC2145"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0590"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14295"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HH0"
FT                   /protein_id="AAS14295.1"
FT                   /translation="MKIMNSNERLKVQTGIKMVIFGPYGIGKTSLLKTINEPTLCLDFE
FT                   AGLLAVQDWQGDSVSIRTGNEARDIACLIGGPNPALKSDSAYSQRHYEHVSSKYKELAS
FT                   EFLKYRCVFINSITVASRLCLLWSKMQPEAFSERSGKQDMRAAYGLLAQEMMAWLNQFQ
FT                   HIPNKDIITVGTLGQYLDDFNRSTWLPQCEGAKTASEIPGIVDEVISMVGIKKDDGTEV
FT                   RSFVCQTINSWGYPAKDRSGCLNMVEEPHLGKLLTKIKTKAFAIQPVTPNI"
FT   gene            complement(570619..571113)
FT                   /locus_tag="WD_0591"
FT                   /old_locus_tag="WD0591"
FT   CDS_pept        complement(570619..571113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0591"
FT                   /old_locus_tag="WD0591"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to OMNI:NT01MC1472"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0591"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14296"
FT                   /db_xref="GOA:Q73HG9"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HG9"
FT                   /protein_id="AAS14296.1"
FT                   /translation="MKNSYQGIDSTIVKHVRFQASRLKSKSCFINESLEDIEQELFCQV
FT                   WQYLNQHDEKRSSFSTFVARLANYCARNMLRNQLCLKRNITFDDINDDIPDHRNSEIEA
FT                   IIRTDINNIISTLSEKDSNLCQLLKVFTITEVSVITKIPKTTIYRTLERIRNKFSVLEK
FT                   L"
FT   gene            571699..572145
FT                   /pseudo
FT                   /locus_tag="WD_0593"
FT                   /old_locus_tag="WD0593"
FT                   /note="conserved hypothetical protein, degenerate; This
FT                   region contains one or more premature stops and/or
FT                   frameshifts which are not the result of sequencing
FT                   error.Identified by similarity to GP:17430253"
FT   gene            572259..573485
FT                   /locus_tag="WD_0594"
FT                   /old_locus_tag="WD0594"
FT   CDS_pept        572259..573485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0594"
FT                   /old_locus_tag="WD0594"
FT                   /product="prophage LambdaW4, DNA methylase"
FT                   /note="Identified by match to PF01555 protein family HMM
FT                   PF01555; match to PF02195 protein family HMM PF02195"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14297"
FT                   /db_xref="GOA:Q05HL6"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR015840"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q05HL6"
FT                   /protein_id="AAS14297.1"
FT                   /translation="MNLAIHYYPVENLVEYKRNPRKNDDVVNRMYASIREFGFRIPIVA
FT                   KSDGTVVDGHLRLKAARKLGMESIPVVLSDNLNEPQTKAFRLLANQSANWAKWDDELLK
FT                   VEIQELEDLQFDLKMTGFELEKVQRFLDDFDGKEEVERGVLELIDKKVEIAKPGDLWIL
FT                   GDHRIYCGDSCVVESFKAVLDDKMADITVCDPPYNVDYGSSQEREDKKILNDNQGEKYE
FT                   LFLYDICSNILAYTKGAIYICISSSEFSTLQKAFEEAGGKWSTFIIWAKNHFTLGRSDY
FT                   QRQYEAMLYGWKSGNKREWHGGRNQSDLWFYDKPIHNSLHPTMKPVELMEKAIVNSSRP
FT                   GDTVLDPFSGSGSTLIACERTGRICRTIELDSKFVDVTIKRWQVYTGREAILSGTGKTF
FT                   AQIQEEKQQ"
FT   misc_feature    573236..582685
FT                   /note="PHAGE04; Putative lysogenic prophage region.
FT                   Putative attL/R=agta[ga]agctaatgga."
FT   gene            573499..573978
FT                   /locus_tag="WD_0595"
FT                   /old_locus_tag="WD0595"
FT   CDS_pept        573499..573978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0595"
FT                   /old_locus_tag="WD0595"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to OMNI:NT01MC4573"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0595"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14298"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HG7"
FT                   /protein_id="AAS14298.1"
FT                   /translation="MEKITQTEWAREIGVSNQYVCYLVKKGIIELENGLVNREQANEAV
FT                   AAIRDPSQPLRRKNPENENTSNLSTMLLKTRIKNEMERGKLLEAKAKAEIGELVAVEEV
FT                   KRDAFNVARVVRNNLLNIPNRVSALLASLSDTEKIHMALTEGITNSLQELSNIKF"
FT   gene            573982..575463
FT                   /locus_tag="WD_0596"
FT                   /old_locus_tag="WD0596"
FT   CDS_pept        573982..575463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0596"
FT                   /old_locus_tag="WD0596"
FT                   /product="prophage LambdaW4, ankyrin repeat domain protein"
FT                   /note="Identified by match to PF00023 protein family HMM
FT                   PF00023; match to PF00023 protein family HMM PF00023; match
FT                   to PF00023 protein family HMM PF00023; match to PF00023
FT                   protein family HMM PF00023; match to PF00023 protein family
FT                   HMM PF00023; match to PF00023 protein family HMM PF00023;
FT                   match to PF00023 protein family HMM PF00023; match to
FT                   PF00023 protein family HMM PF00023; match to PF00023
FT                   protein family HMM PF00023"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14299"
FT                   /db_xref="GOA:Q73HG6"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HG6"
FT                   /protein_id="AAS14299.1"
FT                   /translation="MSANLSLELIKCLINQPGVDVNVRGLNGKTPLHYAVEINELSMVA
FT                   LLLNRKNINPLITDDNGKSALDCAREEILQALINHKYGLEKDSLLHLAAMLNEANAVRF
FT                   LLDKGTNVNEQNALLHTPLHLAAGAGHEQIVEILIREGNADKDVLDARNHAAIHYAVNN
FT                   KKLGVVKLLSNLGANVNVVGSGRNAMKLSSLHVAISSSNYDERDLCLDIVRCLINVPNA
FT                   GVNLQDYENKTPLHYAERLKTIEVLLTREDIDPLIKDDNGKTPFCYAKEANRLDIVKIL
FT                   VSNRYGADKNSLLHLAARKGYEDLIDGILGEGVEIDAVDESGKTGIYVAVKHGHFNVVK
FT                   LLLKRGADATDVFQYAIITNNAKLIKLLSKEKEIVLFGRQKNFPTFHLLSNKYFEERKI
FT                   ADKKIKKYINIVCVSITVCAIVIVGIYPNIIAAVMVGIVALIAAIAMSNLTQKYIEEAL
FT                   EKKMFIELESEKTSECSSILSDVEVSSNDGEELAI"
FT   gene            575460..577283
FT                   /locus_tag="WD_0597"
FT                   /old_locus_tag="WD0597"
FT   CDS_pept        575460..577283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0597"
FT                   /old_locus_tag="WD0597"
FT                   /product="prophage LambdaW4, terminase large subunit,
FT                   putative"
FT                   /note="Identified by match to PF05876 protein family HMM
FT                   PF05876"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0597"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14300"
FT                   /db_xref="InterPro:IPR008866"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HG5"
FT                   /protein_id="AAS14300.1"
FT                   /translation="MIYATSFSEGLKPDPLLKVSEWANEYRVLAPTAASEPGKWRTERT
FT                   PYLKEIMDSLSPSSPAEKVVFMKGAQIGGTEAGNNWIGYIIDQTPGPMLVVQPTVEMGK
FT                   RWSKGRFAPLIESTPCLKSKVKDPRSRDSGNTVQSKEFPGGIVVITGANSSVALRSMPV
FT                   KYLFLDEIDAYPGDSGGEGDPVLLSIARTNTFARRKIFLVSTPTIHGISRIEKEFEATD
FT                   KQYFFVPCPYCNYYQVLKWSQIKWENNDSRTAHYVCTECSGKIENHQKTEMLERGEWRP
FT                   TNRVKGEKKGFHLSSLYSPVGWYSWTQAVEDFLHAKESEQLLKVWINTTLGETWVDKGE
FT                   VPDWKQLFNRREFFPVGTVPRREVVLTAGVDVQKDRLEVEVVAWGKSRESWSIEYRVFE
FT                   GDTGRGEVWGKLSELLNHHFIGENGLEYMISMMAVDAGYATQEVYNWVRGHQGSGRVMA
FT                   VKGVNKALVPLSSPSRVDITVGGQKLKRGIKLWPVGVSILKSELFQLLNVLKDGEEAPA
FT                   GYCHFPEYAPEYFKQLTAEQLVSKVVKGYTKQEWQKVRERNEVLDCRIYARTASIALGI
FT                   DRWPESKWNSLSEKPESKKSKKIVKSKWISE"
FT   gene            577287..577520
FT                   /locus_tag="WD_0598"
FT                   /old_locus_tag="WD0598"
FT   CDS_pept        577287..577520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0598"
FT                   /old_locus_tag="WD0598"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14301"
FT                   /db_xref="GOA:Q73HG4"
FT                   /db_xref="InterPro:IPR004174"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HG4"
FT                   /protein_id="AAS14301.1"
FT                   /translation="MYNEDYLIQVEEAIKKLQNGERVVSIAYGDHVVRYAEVDINDLLS
FT                   LRQRIKAELKIAGMKPKRKIVFSTNKGVDKIM"
FT   gene            577552..577821
FT                   /locus_tag="WD_0599"
FT                   /old_locus_tag="WD0599"
FT   CDS_pept        577552..577821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0599"
FT                   /old_locus_tag="WD0599"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14302"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HG3"
FT                   /protein_id="AAS14302.1"
FT                   /translation="MNNMDQSQGRLNVNVNFEGEFAQYLTEMAKVQNRTIEEIVKDLVE
FT                   EELEVSKLSEGDEMDEGEIALLELAAKRNVPGAKIIRHEDIKWE"
FT   gene            577812..578093
FT                   /locus_tag="WD_0600"
FT                   /old_locus_tag="WD0600"
FT   CDS_pept        577812..578093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0600"
FT                   /old_locus_tag="WD0600"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to GP:14209913; match to
FT                   PF01919 protein family HMM PF01919"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14303"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HG2"
FT                   /protein_id="AAS14303.1"
FT                   /translation="MGIIYQIGYLEGVDTEDLPSLPKTIRLRVQKAIEKRLTIIPDKVG
FT                   EALSHKWVGYFRLRVGDYRVIYLIDNSEHMVKIAAIGHRKEIYKRSPE"
FT   gene            578196..579613
FT                   /pseudo
FT                   /locus_tag="WD_0601"
FT                   /old_locus_tag="WD0601"
FT                   /note="prophage LambdaW4, portal protein, lambda family,
FT                   authentic frameshift; This gene contains a frame shift
FT                   which is not the result of sequencing error."
FT   gene            579610..580671
FT                   /locus_tag="WD_0602"
FT                   /old_locus_tag="WD0602"
FT   CDS_pept        579610..580671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0602"
FT                   /old_locus_tag="WD0602"
FT                   /product="prophage LambdaW4, minor capsid protein C,
FT                   putative"
FT                   /note="Identified by similarity to GP:6723247; match to
FT                   PF01343 protein family HMM PF01343"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0602"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14304"
FT                   /db_xref="GOA:Q73HG1"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033855"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HG1"
FT                   /protein_id="AAS14304.1"
FT                   /translation="MKNQAIWLNRCVMVEPRSFELLSLQTGKQPIFKNIKHAVRNSERG
FT                   IIPIHGILTKKSEVFDDVLGMTSYEKISEEIEEALIDKEVETIILDIDSPGGEVNGLFD
FT                   LSDFIYQARRKKRIVAIANDDAYSAAYAIASSAEKVLVTRTSGVGSIGVIASHIDQSGF
FT                   DEKQGIKYTTVFAGSRKNDLNPHEPITSESLESLKSEVNRLYGMLVELIARNRNLSVEA
FT                   IKSTEAGLYFGEKAVEIGLADGITILSEFKSINKKGDITMNEKTTNDLETDNLTKYRTE
FT                   VLELIRLCNLSRMPEKIGEFIEQSVSVEQAREVLMELLAERTKKTEILSAIPQNSGEEL
FT                   MMQVAKSRAQSNI"
FT   gene            580746..581117
FT                   /locus_tag="WD_0603"
FT                   /old_locus_tag="WD0603"
FT   CDS_pept        580746..581117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0603"
FT                   /old_locus_tag="WD0603"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to OMNI:NT01MC4224"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0603"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14305"
FT                   /db_xref="InterPro:IPR004195"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HG0"
FT                   /protein_id="AAS14305.1"
FT                   /translation="MISITEGNNLGDLLKYEVSNLYSRDQITVAKGQNLKLGKVVGYDT
FT                   KDGFIKALNPTATDGTQTAIGVIASDVNAKENSKGVIIARGAILADHAVVWPANIIEEQ
FT                   KTAAIKHLEGRGIIIRKGA"
FT   gene            581154..582158
FT                   /locus_tag="WD_0604"
FT                   /old_locus_tag="WD0604"
FT   CDS_pept        581154..582158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0604"
FT                   /old_locus_tag="WD0604"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to GP:6723249"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14306"
FT                   /db_xref="InterPro:IPR005564"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HF9"
FT                   /protein_id="AAS14306.1"
FT                   /translation="MQNPFTNTAFSMTALTNAINILPINYGRVENLNLFPSRSVRFRHI
FT                   TIEEQNGVLSLLPTHLPGAPATVGKRGKRKIRTFTIPHIPHDDVVLPEEVQGIRAFGSE
FT                   SELKALADVITDHLQLMRNKHAITLEHLRMGALKGIILDADGSELLNLYNEFEITPKVV
FT                   NFALGTATTDVKRKCLEVLRHVEDNLSGEYMTGIHALVSPEFFDALISHSKVKEAYERW
FT                   QEGAALRNDMRSGFTFCGITFEEYRGQATDPEGTVRRFIERESGNCFPLGTASTFTTYF
FT                   APADFNETVNTLGQPLYAKQEPRRFDRGTDLHTQSNSLPMCHRPGVLVKVVVT"
FT   gene            582256..582561
FT                   /locus_tag="WD_0605"
FT                   /old_locus_tag="WD0605"
FT   CDS_pept        582256..582561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0605"
FT                   /old_locus_tag="WD0605"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0605"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14307"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HF8"
FT                   /protein_id="AAS14307.1"
FT                   /translation="MQENIKRLLQDCFAHLGKVALYESKDKSYMVQVLKQQPDKLYEIG
FT                   EGQFVGEILLLEVSVFDVLKPMVGDTFSIGSCRYRVHTPPLRDNSGMVWKIQASGV"
FT   gene            583060..584372
FT                   /pseudo
FT                   /locus_tag="WD_0606"
FT                   /old_locus_tag="WD0606"
FT                   /note="reverse transcriptase/maturase, authentic
FT                   frameshift; This gene contains a frame shift which is not
FT                   the result of sequencing error.Identified by similarity to
FT                   GP:12620616"
FT   gene            584564..584674
FT                   /locus_tag="WD_0607"
FT                   /old_locus_tag="WD0607"
FT   CDS_pept        584564..584674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0607"
FT                   /old_locus_tag="WD0607"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0607"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14308"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HF7"
FT                   /protein_id="AAS14308.1"
FT                   /translation="MLFVSILSSNQILRASVSSSMAVTSNFFPLASSTIC"
FT   gene            585069..585422
FT                   /locus_tag="WD_0608"
FT                   /old_locus_tag="WD0608"
FT   CDS_pept        585069..585422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0608"
FT                   /old_locus_tag="WD0608"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14309"
FT                   /db_xref="GOA:Q73HF6"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HF6"
FT                   /protein_id="AAS14309.1"
FT                   /translation="MYFSLNVNILIIFCGSLSGLLSFCCLSYCTLFVFYYYFILSIIIY
FT                   YYYIYIIYKGFRNAESAIMADFRHIITRNTFRNRGQKVRIQAIFSFLVSHYLFSNQGIR
FT                   NIIQPFDVLSLFN"
FT   gene            complement(585537..587732)
FT                   /locus_tag="WD_0609"
FT                   /old_locus_tag="WD0609"
FT   CDS_pept        complement(585537..587732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0609"
FT                   /old_locus_tag="WD0609"
FT                   /product="regulatory protein RepA, putative"
FT                   /note="Identified by match to PF01751 protein family HMM
FT                   PF01751"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0609"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14310"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HF5"
FT                   /protein_id="AAS14310.1"
FT                   /translation="MVQDFLTDVKQKNTLNDEYYDFNNTVEPLEQFDVEEIKRQLLLNI
FT                   RSCLSYLFPRGTFHGDEFRIGDVHGNKGQSLRVALTGGKAGLWQDFATGQKGDVLDIWA
FT                   GAQGKDTKRDFCEVMASISECLGYNKKCAKADEDFEKFITHSWNYYDENGQVIVKIYRS
FT                   DPPKGKKQYKPFDVKQSRYGAPKVRPLYNIPSILKSDKVVLVEGEKCAEALIEQGITAT
FT                   TAMSGANAPIDKTDWSPLKGKHIIIWPDNDEAGNKYAKNAEKKLLEIGVASLAVLEIPR
FT                   GKPEKWDAADCVEEGIDVKEFLASTPLLTIDTPATDTSNMKSLERSTKQPLNILDWSAE
FT                   RFVGPVPEQKFLVEGLFPLGVTSIIAAMGDTGKGMLLLDLALKVASDKDQMCGFGSLVT
FT                   EHGSVVIFSAEDDASEIHRRLERLDPKCERLKHKDKLFIVPLPNVRGSLTILRNVRGKI
FT                   VEVSPEFESVMKQLEEIKDLKLIVFDPLASFIHADINADPAVGDYLMCLLSDLACSTGA
FT                   SIITAHHMRKPKGEKPILTAEQARDAIRGTSALVNGVRCSYAFWPIENTARLEIFKAVG
FT                   ETPRQNALFHGAVVKANGLADRTVRTYLRNQETGLLEDITIQLTVKNASEKDLKICLTD
FT                   AITRSAVAGHPFTHTGSTGVYKQRHRLPEIFHSMGRDRLERIVQELLQAKQLVKGMSTG
FT                   AKEDKWLDIPTGPFACGIGKFTLGAEDFSYRQNLMLG"
FT   gene            complement(588440..591967)
FT                   /locus_tag="WD_0610"
FT                   /old_locus_tag="WD0610"
FT   CDS_pept        complement(588440..591967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0610"
FT                   /old_locus_tag="WD0610"
FT                   /product="helicase, SNF2 family"
FT                   /note="Identified by match to PF00176 protein family HMM
FT                   PF00176; match to PF00271 protein family HMM PF00271; match
FT                   to PF04434 protein family HMM PF04434; match to TIGR01612
FT                   protein family HMM TIGR01612"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0610"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14311"
FT                   /db_xref="GOA:Q73HF4"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022138"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HF4"
FT                   /protein_id="AAS14311.1"
FT                   /translation="MTIYGRTWWGKKWLQSFDGIDYDNRLPRGRTCANTGRAFGIKING
FT                   HIVTAKVHSSGSYPYRGSKPQPYKVKIILNELSSSEQQTIRQIIETSPAILAKLINRQL
FT                   SASLFDKLNDLGIKLFPSNWQEMNASCSCPDWAMPCKHIAAVIYLIAAEIDKNPFMIFN
FT                   IHNCNLSALIDDFGNGKLENAQNILKIDDIFKACSKIRIHNQAILNDIDLSTIPNLFGC
FT                   ISSILTDNPLFFEKNFHNILQIAYKHWQKYPAGRLVYYPASKKELSEEELFIKRWGNIE
FT                   NWQTFQLFIDDQHYLTQVSNGTTNLFRLSGNVLRDVARFLNDIPSSLLHKLNPELRFMH
FT                   MISQFAHMLMEKSALIPQVLQNKRGEVIIRWIPALFNESVKEIHSKISSICPPLLIKYQ
FT                   EIVMEPEEQVNVAISLILLGYIEDNFPASLDKHRDKSIFELFFTGRSYKFTEFSNKEIP
FT                   QAINLWLSRLYLADKPYKLYLMIKDHHEKFELEVQLSLDDEKSFIKLEKALSNQNVKLS
FT                   ILSDLALLSEYIPELEKSIDDNSTLSFNLDNFAPLFLHILPVLRAIGIKVILPKSLQKI
FT                   LKPQLSLNLSTKDKIKEDRESFLTLENLLKFDWKVAIGDKKLSVTEFKKLLKDSRGLVR
FT                   IVDQYVLLDDKEVEALLKKLDKLPDYLSQAELMQAALTGEVNETKVAFDQQLTSLFNKL
FT                   NTYTPVTTPNNLIAQLRPYQERGFSWLVQNIENGFGSIIADDMGLGKTLQVIAAILCCK
FT                   NTGFLDRDRVLVVAPTSILSNWQREMERFAPELKLFVYHGQNRELASDYDVALTSYGLA
FT                   RRDKKELNKIRWFLLVIDEAQNIKNPNTEQTKAIKTIAAKHKIAMSGTPVENRLLEYWS
FT                   IFDFINKSYLGTPKQFKSSFATPIEKARDKTCLERFMKITSPFMLRRLKSDKSIIQDLP
FT                   DKIENNRYCSLTSEQTALYQKVVDTTMEKIEKSEGIERKGLIFKLINALKQICNHPSQF
FT                   GKKKRASIEQSGKMQMLEEILISIGEVAEKSLIFTQYTEMGEIIARLLEERFESEVPFL
FT                   HGGLSRKARDTMINDFQNLFQSNILIVSLKAGGTGLNLTAANHVIHYDLWWNPAVEAQA
FT                   TDRAYRIGQERNVMVYRLLSTGTFEERIDEMIQSKKELANLTISSGESWITEFNNDQLR
FT                   DLVNIKNAL"
FT   gene            592661..593422
FT                   /locus_tag="WD_0611"
FT                   /old_locus_tag="WD0611"
FT   CDS_pept        592661..593422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0611"
FT                   /old_locus_tag="WD0611"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase-related
FT                   protein"
FT                   /note="Identified by similarity to OMNI:NTL01BA00027"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0611"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14312"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HF3"
FT                   /protein_id="AAS14312.1"
FT                   /translation="MDNTLIILAAGKSSRMNSQYSKTLHLVGNFTLLEHIIHNAKPLSL
FT                   KSLSIVINKPFLKELERFSTLKDIIDKYNIKLIIQENITGTGTAVKIALESLERLSDQD
FT                   IVLIQYGDTPFISSDTVMRMTDCLKCNNKNLVLLGFNSQDKQYGRLVIDDNDNVQKVLK
FT                   SEDEILLANSGIMVSYAKDLYTLIKEVKFNDSTNECCLNDIIPIAASNNLRAGYVVADE
FT                   KEAMGVNNKEDLVKAERYFQANRRRQPTLLS"
FT   gene            593554..594513
FT                   /locus_tag="WD_0612"
FT                   /old_locus_tag="WD0612"
FT   CDS_pept        593554..594513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0612"
FT                   /old_locus_tag="WD0612"
FT                   /product="NAD-dependent epimerase/dehydratase family
FT                   protein"
FT                   /note="Identified by match to PF01370 protein family HMM
FT                   PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0612"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14313"
FT                   /db_xref="GOA:Q73HF2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HF2"
FT                   /protein_id="AAS14313.1"
FT                   /translation="MGILITGAAGLIGSALVEKLEKQGYEVISCDIRFRDNPLSFFSED
FT                   IMPLLAKCTGVIHLAAISRVIHGELYPELCQKVNVDGTIQFLEFCKSLPNKPWFIYASS
FT                   REVYGEQKELPVAESASINPINNYAKGKAFIEEQVINLKGSNFNVAILRFSNVYGGLLD
FT                   HSSRVIPALCINALKGDPIRIEGKECVFDFTYLDDVIEGIYLTVKYLQNEKSSLPAIHL
FT                   TTNSPCTLENLAKTILKVTESDSRIDFYPPRNFDVTKFHGDFTRAKELLGWSPKHSLKV
FT                   GLGKFIKSLQNNTQEYPNNIDMVIYENIKSYSWLPSLL"
FT   gene            594470..596806
FT                   /locus_tag="WD_0613"
FT                   /old_locus_tag="WD0613"
FT   CDS_pept        594470..596806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0613"
FT                   /old_locus_tag="WD0613"
FT                   /product="glycosyl transferase, group 1 family protein /
FT                   moaA/nifB/pqqE family protein"
FT                   /note="Identified by match to PF00534 protein family HMM
FT                   PF00534; match to PF04055 protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0613"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14314"
FT                   /db_xref="GOA:Q73HF1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="InterPro:IPR034391"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HF1"
FT                   /protein_id="AAS14314.1"
FT                   /translation="MKILKVIHGYPPYYSAGSEVYSQTLAHELANNNEVQIFTRHENSF
FT                   LPDFHYTIALDCSDSRILLNLINIPTTKYRYKFINEEVNIKFKRIIDNFQPDLIHFGHL
FT                   NHLSITLPEVAFKENIPTIFTLHDFWLMCPRGRFIQRNSEDLLRLCDGQKDQKCATQCY
FT                   KGHFTGDEEFLNSDLNYWEQWVATRMKQTKKVVDYIDYFIAPSKFLMDKFTQDFNVPIN
FT                   KISYLDYGFDLNRLKNRNRVQEKGFIFGYIGTHTPEKGVDLLLKAFSRLSSKAKLRIWG
FT                   AAREETKTLKAIADQFPHAVKERIEWMGSYNNKNIVTDVFNKVDAIVVPSIWGENSPLV
FT                   IHEAQQLSVPVITADYGGMAEYVRDGINGLLFKHRDTNSLSEKMQVLSTDQELYSELTQ
FT                   RGYLYTKNGNVPSISEHTEKLNKIYRNIIENKGKSVATKPGPWRITFDTNPDYCNFACV
FT                   MCECFSPYSKVKEEKKAKGIKPKIMSIETIRKVIKEADGTPLREIIPSTMGEPLMYKSF
FT                   DEIINLCHEFGLKLNLTTNGSFPIKGARKWAELLVPILSDVKISWNGATKETHERIMKG
FT                   SKWEVVTENLKTFLEVRDKYFSDTGERCTVTLQLTFLESNLHELYDIVEMAIKNGIDRV
FT                   KGHHLWAHFKEIKDLSMRRDELAISRWNTEVGRLYELRDNMLLPNGKKIKLENFTILSQ
FT                   EGIKDLAPGGQCPFLGKEAWINNEGKFSPCCAPDELRKTLGDFGNVNEVKLEEIWQSSE
FT                   YLNLQKNYLNYELCKTCNMRKPLVN"
FT   gene            596767..598461
FT                   /locus_tag="WD_0614"
FT                   /old_locus_tag="WD0614"
FT   CDS_pept        596767..598461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0614"
FT                   /old_locus_tag="WD0614"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0614"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14315"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HF0"
FT                   /protein_id="AAS14315.1"
FT                   /translation="MQNMQHEKTISQLMKDSEYLKSIRVSPCERFHQLSENPLYKNRFI
FT                   RVDKFHEPGLAPVYDETGAYHIDAMGEAIYRDRFLKTFGFYCNRAAVEDDTGYYHIDPS
FT                   GCRVYKHSYQWIGNYQEDICVIRKHDKFFHIDLNGNRVYEQEYNYVGDFKDGIAVVHKD
FT                   GKATHINNHGKLVHNKWYKKLNVFHKGFAIAEDKHGWFHIDINGNPVYRQRFKMVEAFY
FT                   NGMAKVETFEGVLGQIDITGNVKFSIFDLDKESQVHKISAELSAFWKTYLANVAIELDL
FT                   LNILPATMPVLSQKLNIIVPNLERLLRALWEIGFIDYDKNKDLWQLSSKGKCFKEIPFL
FT                   PKAAAMWARVAAEKNWLKIADILRQESISSFESFKEKETSEDRKIAFYQALLGYSRFDT
FT                   KEFNSRVNIDGAKNILLFGVHSLFLAYSDIHNKGSIGLYYYNEHKVPRQAVEDLKIKLI
FT                   TQEELSATNYELGVFCRFLQHYDDDKVLSYLKLVKNKGIPRVLVIETILDYYSPVGGSV
FT                   DINVMVETGGKLRTLSDWKRILKQVKGLKVFSIVPLTDYLSVIDIRC"
FT   gene            598465..599454
FT                   /locus_tag="WD_0615"
FT                   /old_locus_tag="WD0615"
FT   CDS_pept        598465..599454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0615"
FT                   /old_locus_tag="WD0615"
FT                   /product="conserved domain protein"
FT                   /note="Identified by similarity to OMNI:NTL02ML5871; match
FT                   to PF05721 protein family HMM PF05721"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14316"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HE9"
FT                   /protein_id="AAS14316.1"
FT                   /translation="MKALQKNGFFIIKNLVPLELITQSLNDIISKISKLSQELGVSTSD
FT                   YLNCTGRWGTSSQVTRIVSQVLDKIIKNYLEKSLQCQILQNKSNVICKTADLIDAVPFH
FT                   QDISYSFNDPYHFSVWLALNNVNKTSGALQVIEDSHNWKIQPLVDFWHPYFLDQYSDNR
FT                   ENYKIKSLPISAGDAIVFDSRLWHGSDKNIDAKDRFAYVTRWVVKDKSLPCVPKPQPSV
FT                   FGILNCGALTEFILREYLSLFRRQESIKTKNMEELIKSWLAFITDTTTNISEVNTAEAK
FT                   RDLYKLLILNQASALHDAGDISGKIYKNLWFSLLVFLNKKVNVVELAL"
FT   gene            599455..601230
FT                   /locus_tag="WD_0616"
FT                   /old_locus_tag="WD0616"
FT   CDS_pept        599455..601230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0616"
FT                   /old_locus_tag="WD0616"
FT                   /product="ABC transporter, permease/ATP-binding protein,
FT                   putative"
FT                   /note="Identified by match to PF00664 protein family HMM
FT                   PF00664; match to PF00005 protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0616"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14317"
FT                   /db_xref="GOA:Q73HE8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HE8"
FT                   /protein_id="AAS14317.1"
FT                   /translation="MNKSRVGSFKYILVFILNILSKFKLNVLVMFLVALVVAIDLSFRK
FT                   YVVKNILDTAVKYQEGNVIENLLLPVSAYVCMALLITTAFRFYGYFVDIRMFTSMRQKI
FT                   ADMSFYRLLQQDHSYYQNNLSGSLVYKVSNLMDSVIELIRLLIDCFFSYSIALILAIYT
FT                   LSLVNIKFAIATFIWVNIFILISVFSFRVLTGLADDHSKQSSQVIAGIADSILNVISVR
FT                   LFSRQAHERHKFFQVCKKKTIAERKLQWAYFWLWFIYGYSFDILQAVNLYFLIHDYQLN
FT                   KIAIGDIALVLGINISIIEFLNHLTRNLTQFSTHFGKVSDALPILTTVPEIQDKENAKK
FT                   LNLLSGRITFNNVSFSYEGQKSLFQDFSVTINPCEKVGLVGYSGGGKSTFINLIIRLFD
FT                   VKKGNIQIDNQVVSEVTQSSLRQQISVIPQEPLLFHDTILANIIYGKLQSTIEEIIRAA
FT                   KLAGIHDFIMTLPDQYETVVGEKGIKLSGGERQRIIIARAFLKNAPILFFDEPTSQLDS
FT                   ITEKTIQMSLFKLMENKTTITIAHRISTLLHMDRILVFNKGKIVQDGKHAELVSKQGLY
FT                   KELWNAQIGCLNGKK"
FT   gene            601232..602281
FT                   /locus_tag="WD_0617"
FT                   /old_locus_tag="WD0617"
FT   CDS_pept        601232..602281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0617"
FT                   /old_locus_tag="WD0617"
FT                   /product="L-allo-threonine aldolase, putative"
FT                   /note="Identified by similarity to EGAD:92942"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0617"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14318"
FT                   /db_xref="GOA:Q73HE7"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR023603"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HE7"
FT                   /protein_id="AAS14318.1"
FT                   /translation="MEKIIDLRSDTTTLQSSNVIHAISNATVGDFAYGEDKSCNDLSEY
FT                   CKQLFKVEEALFATSGMLANRLAIASQTSPGDELITHYNYHVNFFDSAGNAKVNNIVFN
FT                   CIRNNSGILDVAEVEYAINSKPRYKIFAQVSLVSIENSINGFNGKIYPFEKQVELYHFL
FT                   KAHNVNLHLDGARIFNAHVETNIALADYAKYVDTMSFSFTKGLGAPFGSMLMGKREIIE
FT                   RAKKLQVWLGSGYHQIGYCANAAKYVLQNNISRLKEDNKLAKLFADKIKEIPHIKLVLP
FT                   YPETNIVSFSIKALNVTNEVFLSKCQAYGLLLFPWLESHIRAVTHLGTKETDIMKAAEI
FT                   IKEVVLNLI"
FT   gene            602278..603330
FT                   /locus_tag="WD_0618"
FT                   /old_locus_tag="WD0618"
FT   CDS_pept        602278..603330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0618"
FT                   /old_locus_tag="WD0618"
FT                   /product="L-allo-threonine aldolase, putative"
FT                   /note="Identified by similarity to EGAD:91741"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0618"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14319"
FT                   /db_xref="GOA:Q73HE6"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR023603"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HE6"
FT                   /protein_id="AAS14319.1"
FT                   /translation="MRVKIDFFSDSNTDPSAKMREAMAKAKVGNEAACEDPTVNELVAT
FT                   ACKILGKPAGIFLISGTMSNVIAYKVHIQRPGDYLLLDETSHPLIVQSGLIAAQAHATP
FT                   LPIKGTRGIFTGEQIVEFITRPSLRNIPRVGLVSIEQTTNFGGGAVWPLEYIQEISSLC
FT                   KENDVFTHLDGARLFNACAHTKISPKEYASYFDSVFIDFSKGLGAPMGAILLGSEDFIE
FT                   KAWYYKFQIGGGMHQAGIISAACLYALRNNVNSLEEDHKKMQHLIEGLDSIDQVIIDID
FT                   LYKTNIAYFSLRTNCISTQELINVLMTNYGIRMANIKGKIRAITHRDISYEDINTTVSA
FT                   IRKILSNFLH"
FT   gene            603413..604603
FT                   /locus_tag="WD_0619"
FT                   /old_locus_tag="WD0619"
FT   CDS_pept        603413..604603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0619"
FT                   /old_locus_tag="WD0619"
FT                   /product="GlpT/PgpT/UhpT transporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0619"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14320"
FT                   /db_xref="GOA:Q73HE5"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HE5"
FT                   /protein_id="AAS14320.1"
FT                   /translation="MNFVFFQYLLFFCGYMLLYLSRQSIPIALPLLIDTDHVKLSYFFA
FT                   CFSFFYGVSKFVNGIIMDSKNNPLFMFGLCNIATGLLTIGITLSYNNLTLLLLTLILLA
FT                   WTQGLGWPAITKFMVTNSSISSIASSWGVMSASQQLGSCITLIVLPSIIKIYNAKSAFL
FT                   YSGFLCLLFGIYIILKAYYKESANFTTYYKVQKSQIGIKVTSSIWFLCCATFCAYIIKM
FT                   GIFFWFPIILKNKLQISLVQSSLITGVYDLGGILGTLITGRISDMYFFQNRSLLASLYM
FT                   LGIALTFIAMNFGQNIILMNLCAILSGFFIFGVQVLTGVIAVEIAPQNNVCAIVSLTGL
FT                   FGYIASSIFSCVLLGVLVKHCGNSIMFSFFSICSVVALVCFSILSSKDLKKLSKAV"
FT   gene            complement(604621..605928)
FT                   /locus_tag="WD_0620"
FT                   /old_locus_tag="WD0620"
FT   CDS_pept        complement(604621..605928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0620"
FT                   /old_locus_tag="WD0620"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="Identified by similarity to SP:O54068; match to
FT                   PF03721 protein family HMM PF03721; match to PF00984
FT                   protein family HMM PF00984; match to PF03720 protein family
FT                   HMM PF03720"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0620"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14321"
FT                   /db_xref="GOA:Q73HE4"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HE4"
FT                   /protein_id="AAS14321.1"
FT                   /translation="MYITIIGIGYVGLVSCAMLSEQGHNVDCIDINTKKIELLKLGKIP
FT                   IYEPGLADYLENNIKLQRIRFFDSYSQINPNTEVVFVTVDTPSDSLGNANLQNVYNAVS
FT                   EVSERVNQDCLIVIKSTVPPGTAENIYNYLSNKGYNFDLGVNPEFLKQGSAVSDFLYPD
FT                   RIIIGVKTKLARAKLEVIYRSFIDKNIPLIVTDTVTAEMIKYASNAFLATKVAFINEMA
FT                   GLCELLGADIDLLANSMGMDHRIGKEFLKAGPGFGGSCFPKDLSALIRLAEDHNVKLQI
FT                   LNSVKESNYNHITNIAKKVEYVLNGVQNKKIAIWGLTFKSGTDDVRNSPAIDIAQLLVN
FT                   NKAKITAYDPMGMDNARQVLKDIEYADNAIGAARDAEALLLLTEWKEFKNQDFASLKSI
FT                   MAAPNVFDFRNLLDSELLLRYGYHVYSLGKKSIYKV"
FT   gene            complement(605993..606907)
FT                   /locus_tag="WD_0621"
FT                   /old_locus_tag="WD0621"
FT   CDS_pept        complement(605993..606907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0621"
FT                   /old_locus_tag="WD0621"
FT                   /product="membrane protein, putative"
FT                   /note="Identified by match to PF00892 protein family HMM
FT                   PF00892; match to PF00892 protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0621"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14322"
FT                   /db_xref="GOA:Q73HE3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HE3"
FT                   /protein_id="AAS14322.1"
FT                   /translation="MDHRLRAYLLGVTWFILSLLSSVANDTISKYLSLHLQSFEVIFFR
FT                   FLFSTITLVPFMLYYGREAFKTSQISIQITRGVLLFVGITLWTYGLAIFPIVTATIISF
FT                   SIPLFVILLAIPLLNENIIWQRWSVTVIGFVGIAITTKAYSEDFNPKILIFIVSTLIFA
FT                   ILDILNKKLAIKESVISMLFYSALTTTIFSTVPLLFYWHLPSLLELVLLLILGINSNLI
FT                   LFFTLKAFTLADATALAPYRYIELIISAIVTYVMFNELPDKSALYGILILIPSTLFIVY
FT                   SESKVIKKNNVCNARVKIYDSNC"
FT   gene            complement(607391..608302)
FT                   /locus_tag="WD_0622"
FT                   /old_locus_tag="WD0622"
FT   CDS_pept        complement(607391..608302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0622"
FT                   /old_locus_tag="WD0622"
FT                   /product="transcriptional regulator, putative"
FT                   /note="Identified by match to PF01381 protein family HMM
FT                   PF01381; match to PF01381 protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0622"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14323"
FT                   /db_xref="GOA:Q73HE2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HE2"
FT                   /protein_id="AAS14323.1"
FT                   /translation="MFVSVSDISSISYKIGQKIEDSRLMRGHTQVELASEIGLTYQEVN
FT                   SYENGYIPIPIEVLYVIARVLSVNAIDLLPEPVIVREDSYEDEEILYLTKIYENQKLGK
FT                   IVPSLVRFVHISEKINQEEARLEIAKNLVKEGVSVDIISQATGLSIYEYDNTEREICTD
FT                   SIYYRIGQRIREWRLIRRYTQKDLADKVGVTLKEIHEYERGYTTILFDKLYEIAGALSV
FT                   NIKVLLPETRESKKLLSLINEYREPESLDALVKSLSEDMKSGKEKVKKAEKIRVAKNLA
FT                   KAGVAIDIIVRASGLTADECEN"
FT   gene            complement(608328..609236)
FT                   /locus_tag="WD_0623"
FT                   /old_locus_tag="WD0623"
FT   CDS_pept        complement(608328..609236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0623"
FT                   /old_locus_tag="WD0623"
FT                   /product="transcriptional regulator, putative"
FT                   /note="Identified by match to PF01381 protein family HMM
FT                   PF01381; match to PF01381 protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0623"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14324"
FT                   /db_xref="GOA:Q73HE1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HE1"
FT                   /protein_id="AAS14324.1"
FT                   /translation="MVLFVEKSLDYKVGEKLKSWRLERGYTQKDLAEKLGVKYWVILQY
FT                   EKGNRRISIERLYAITEALSISITDLIPISKSCLEDEGEEILNLVREYKKINDQELRKM
FT                   FCLLTNFVQVSEKSSKKAEKIKIAKGLVKAGVSVDIVAKTIGLSADECVEEKGGSIYCQ
FT                   IGKKIKEWRLVREYTQKDLVEKMSTTRDEISNYEQGRTAVPLDKLYEMAEALSINITDL
FT                   LIKEGSKVKNELPDLIKEYKEIESQELRHALIKSLFEGIRICEEKVREIERIKVAKDLV
FT                   KGGISIDIILQIIGLSVDQIA"
FT   gene            complement(609312..610444)
FT                   /pseudo
FT                   /locus_tag="WD_0624"
FT                   /old_locus_tag="WD0624"
FT                   /note="conserved domain protein, authentic frameshift; This
FT                   gene contains a frame shift which is not the result of
FT                   sequencing error.Identified by similarity to GP:6723261"
FT   gene            complement(610545..611201)
FT                   /locus_tag="WD_0625"
FT                   /old_locus_tag="WD0625"
FT   CDS_pept        complement(610545..611201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0625"
FT                   /old_locus_tag="WD0625"
FT                   /product="DNA repair protein RadC, putative"
FT                   /note="Identified by similarity to SP:P25531; match to
FT                   PF04002 protein family HMM PF04002; match to TIGR00608
FT                   protein family HMM TIGR00608"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0625"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14325"
FT                   /db_xref="GOA:Q73HE0"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HE0"
FT                   /protein_id="AAS14325.1"
FT                   /translation="MNKSKEEIEFRILESKGKALLDREIMETFLSAVHESPQAQEIAKN
FT                   LVNTYTGVGRILGREMDDLKVIEGVTDSAVAMIMCVKETLERVLKEKLKSEPIMDLQGI
FT                   VEYLNVSIGHSERECVKILYLNKRRQLIGEESYIGEMEKAPVYIKEITRKALMKNATSI
FT                   IMSHNHPGGSLEPSEEDQAVTKSLAAACSTVSVKLFDHIIITSGGYFSFRENGLL"
FT   gene            complement(611371..612282)
FT                   /locus_tag="WD_0626"
FT                   /old_locus_tag="WD0626"
FT   CDS_pept        complement(611371..612282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0626"
FT                   /old_locus_tag="WD0626"
FT                   /product="transcriptional regulator, putative"
FT                   /note="Identified by match to PF01381 protein family HMM
FT                   PF01381; match to PF01381 protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0626"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14326"
FT                   /db_xref="GOA:Q73HD9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HD9"
FT                   /protein_id="AAS14326.1"
FT                   /translation="MANISIRYKIAQKVRSWRLKRGYTQKDLAGKIGVTYQVVLQYEKG
FT                   TRKISIEKLYAIAEVLSVGIIDLIPVSSEKICLKNEEEEILNLVRKYKTINDQELRKVF
FT                   YLLTKFTRVGEKSSKKAEKVKIAKGMVKAGISVDIVSQAIGLSANECVEEKTGSIYYQI
FT                   GKKIKEWRLVREYTQKDLAEKMDTTRDEISNYEQGRVAIPLEKLYAIAETLSISITDLL
FT                   IEEDEIVESELPDLIKEYKKIESQELRYALIKSLFESIQICEEKVKRAEKMKIAKDLVK
FT                   GGISTDIILQITGLSLGEIQQI"
FT   gene            612412..613308
FT                   /locus_tag="WD_0627"
FT                   /old_locus_tag="WD0627"
FT   CDS_pept        612412..613308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0627"
FT                   /old_locus_tag="WD0627"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to GP:18144083; match to
FT                   TIGR01784 protein family HMM TIGR01784"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0627"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14327"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HD8"
FT                   /protein_id="AAS14327.1"
FT                   /translation="MALSKFLDPKNDISFKRIFGTEKNKDILIHFLNDILGFAGTNAIQ
FT                   DIEFLSTIQDPDIASKKQSIVDVLCRDKNGLQVIVEMQVAKTKGFEKRAQYYAAKAYSR
FT                   QADKGDQYHDLKEIIFIAIADCILFPDKSEYKSKHTIRDEDTNEHDLKDFYFIFIELPK
FT                   FPKTKEDQLSSIVEKWVYFFKYADETSEEELEKIIGSDLIIKKAYEELNRFNWSEKEFI
FT                   AYEQEIKRILDEQAVLAQKLDDATAKGILIGHEKGRKEREIEVAKNLLKAGVSIDIIAQ
FT                   TTGLTANEIKDLSSLDV"
FT   gene            613309..613848
FT                   /locus_tag="WD_0628"
FT                   /old_locus_tag="WD0628"
FT   CDS_pept        613309..613848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0628"
FT                   /old_locus_tag="WD0628"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0628"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14328"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HD7"
FT                   /protein_id="AAS14328.1"
FT                   /translation="MNIFVLDENPEIAAKMLCDKHIVKMLLETAQLLSNVFSIALKVPN
FT                   PLVSITDQNIEVPYKLTHKNHPCSLWARQSKGNFFWLIKYGRELCKEYTWRYKRKHRSE
FT                   EVIDWCDSNKNLLVFQSTDIKPFVQALPDQYKSSHSVKAYREYYLKEKMRFAKWEKGRE
FT                   VPDWLLSRIVRLKSRK"
FT   gene            complement(614551..616932)
FT                   /locus_tag="WD_0630"
FT                   /old_locus_tag="WD0630"
FT   CDS_pept        complement(614551..616932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0630"
FT                   /old_locus_tag="WD0630"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0630"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14329"
FT                   /db_xref="GOA:Q73HD6"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HD6"
FT                   /protein_id="AAS14329.1"
FT                   /translation="MTLTKCVLTSPFSSVQQYLLVLGKVMVVNTKSDQQRAEDDLYTVL
FT                   RFKEKGDFERRIRELLVNDYKKLKKPLSKLLGKLESKIRTDKENNQAARNVYDQIKKSK
FT                   TNEDKLSNLLNFKKQLKAFLKNQDDCSIVLNAIDSASVIPVIEVNGVHPKDSEIKKLKK
FT                   AQPLTSNRQDFEEALGYIESQEKVMGITLEEIMEYKQHSVKIFLLNRVHSCKNGHSQLH
FT                   PDVKEAIAILSNDKLRAFYDEEVKKKTLQPILSYKECEQLYDKINYEKNESHIIIEREE
FT                   LGENVRRVMGVKRFTNQSSREDQKNGISPTGTSTNYRQEQVASSGDRTLYNSDIPSLGR
FT                   SIKSSRSALFMPFGASVDTSTTIKPANPSNLVTTGENYTSNADLSDELNVSEVTKIVER
FT                   KELLSNSLKKIQEIVEKLGNTTLSEEVIVHERHFKKFMDFVGEILVDIGTRLPQSGSKS
FT                   MYLERKLNGLEKMNESLDNSVQELEKKVDKLEKENKDFLAENDELKEKLATAKEEKELL
FT                   FNKKEKMQEVINGLNEDNQRLMQKINGLEDDYKYLLRAEKTKRETEDSCIQVEDADIPE
FT                   GKAELCKDYEIKLVKLEQEIDAKGKQCEELLLENSILRGNIERLKEENKRLEGIEESFS
FT                   IDLSHFCSVKNLHDELILANEQPENIDISIQDEMDSKVATESVGVNVKQGYSKRTSNLS
FT                   RVSEQSSAVKSQFSEARAQSRKQIIYASASLILSGVFAVGTSLTMSHLGISISLALTAL
FT                   TFLTLGCYCSYKASTTLRNIELDRTFKMADHEAVFMVPSL"
FT   gene            617223..618647
FT                   /locus_tag="WD_0631"
FT                   /old_locus_tag="WD0631"
FT   CDS_pept        617223..618647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0631"
FT                   /old_locus_tag="WD0631"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0631"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14330"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HD5"
FT                   /protein_id="AAS14330.1"
FT                   /translation="MPIETKRQAEVLKKLQDVIKHTDRDIAAGRKLAIKRWVETYIEYI
FT                   KLFKDDKLEFLYNVFRDEGCWLGTRLNNTVLGQKLTEEKIGEIDNPLPRYGMASRYCIT
FT                   GKIGDFFNKQFVLSRGQFTSEEVDSQGNPISDQYVRNILLSSMKRNGPVFDFWIDRESG
FT                   ELKKYDAVEGFDSTVKLKWSEGVEYFYNQLEEKDKEKKLTEAIVALSRPQSVKRDAPIL
FT                   DFCVRNIGDKDTLLQKLLQKDKGVYFLLAELIESCFFDTVHDLVQCWCYKGVSAGGDCS
FT                   DKIFSQQDYELFLYSLSNVMLKNPELSVQARSLIMEIWKCERFAEYRETSVNTSNYTVP
FT                   IKSVLGGLIINWKREDVCKPDREIEKEEILDMISFAKGCFPEKFDLFKEVMIENLRICG
FT                   REGKRKGVDYGKFAEELFLQLEKVTLPSVGDGPWNNLRSQSKVSLPLDGSGDGPQSEFE
FT                   APSVSGISGSHKKRRI"
FT   gene            618723..622223
FT                   /locus_tag="WD_0632"
FT                   /old_locus_tag="WD0632"
FT   CDS_pept        618723..622223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0632"
FT                   /old_locus_tag="WD0632"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0632"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14331"
FT                   /db_xref="GOA:Q73HD4"
FT                   /db_xref="InterPro:IPR003653"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HD4"
FT                   /protein_id="AAS14331.1"
FT                   /translation="MDGDLDGFRQEFESFLDQCPFFLYHVSTGRFLPVFFFSMFATAHD
FT                   ANILKANERVYFRFDNHGIDTGGRNRNTGNLKVAVYHDGQQVVRCYSISDRLNSDGLRF
FT                   STRERNALVREIRGQNPNLREEDLNFEQYKVCMHGKGKSQGEAIATVFEVIREKDSQGR
FT                   DRFAKYSASEISLLRHIERNRLNGINAPAPRSLLTVKEIGSIRLNQDQRVQLGHLVNFV
FT                   QVAPGQQGIFSFMEVLASNQKINIERGINEGILPYITRIYRSYLGSLQNDIQNRSQKFE
FT                   SHGFFLGLLANFIHLYTIDIDLDLSPGNSYVAFLICHQAERENIPIVINVTRWRTSSDI
FT                   ALNRARADAKRLHVSSFISIHTESRNAVCIGLNFNLNIDPFSIDTVEFLENRFPLVQRL
FT                   FECLEDEGIRENIRDFLLQHLPNEIPRNAENYNRIFDCITGFAFGNSILEEFRLVNAVQ
FT                   QRVRKYIFRYGDENHALTMVFHTQGSDIVILHIRDNNAVQQGAINLQDLNVDGNNVHVR
FT                   EVSCTLNNQLGLNIHTDNLGLYHNYQNNNANNFLGGNLVQVPNAGNVHNALNQVMNDGW
FT                   QDRFQHQELFRNISAVLMPEDTHGNMIIDVNSKDKFRSILHGTFYASDNPYKVLAMYKV
FT                   GQTYSLKRWQEEEGERVILTRVTEQRLGLLLLRQPTADTHPIGYVLGFADNAEEVEQEQ
FT                   DEARYKITELMSKQRGYLPITSGNEVVLSYAVFNRGAQRAEDFISLPQQAVYVHRLDRR
FT                   GHDSRPEVLVGPESVIDENPPENLLSDQTRENFRRFYMEKRPGQNSIFLLDIDDNLHVP
FT                   FSYLQGTRAQAIETLRSRIRGGGTSTAQGILQQINTILRRNNAREIEDVHNLLALDFAT
FT                   ENQNFRYWLQTHDMFFAARQYTFHDDRSNPTNDRHDFAITSVGVDGNQNDPTGRDLLSS
FT                   NIDNFKQKVDSGEKDRLTAIINVGNRHWVTLVIVHQNGNYYGYYADSLGPDSRIDNNIR
FT                   GALRECDISDDNVHDVSVHQQTDGHNCGIWAYENARDINQAIDQALQGNSNFGEKGEGI
FT                   IGYIRGLLSAGIGNDTRQPQRNEQYFRNRRRNISQLFQNDSLSSPRGRLIQGRPGIQHE
FT                   IDPLLLQFLELQYPQRGGGGALQLGGERVISIDFGPQSVLDEIDGVNRVYDHSNGRGSR
FT                   "
FT   gene            623343..626243
FT                   /locus_tag="WD_0633"
FT                   /old_locus_tag="WD0633"
FT   CDS_pept        623343..626243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0633"
FT                   /old_locus_tag="WD0633"
FT                   /product="prophage LambdaW5, ankyrin repeat domain protein"
FT                   /note="Identified by match to PF00023 protein family HMM
FT                   PF00023; match to PF00023 protein family HMM PF00023; match
FT                   to PF00023 protein family HMM PF00023; match to PF00023
FT                   protein family HMM PF00023; match to TIGR01612 protein
FT                   family HMM TIGR01612"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0633"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14332"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR003323"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HD3"
FT                   /protein_id="AAS14332.1"
FT                   /translation="MDTGSVKYIAESISEQSKHTDEQKLKCDLSAGQEFSEIGSPKTEA
FT                   TGLPVDSYYEFIKRDLFWADRSLIDDKKYLEDLIDEWFIHAPNLGLEESQKKLNQKLLN
FT                   SIIKDFNMGNYDSFSNLKQFLESNEKNKDLKYVLNLKRGHLGTTILNVFLEYDEIIPSL
FT                   LKAGADLNMQDNKGKTLLHDTAIYSSGYEDLGYLLDAKADPNIQDEKGNTPLHYYAAKC
FT                   SDQSRKTMDLLISKGADLSIKNNDGKTPLQVAIDNDNIIGCLLTNSQKKLREQLGKMLL
FT                   ATSSDEDWDNAYDPEVENLRKFLNQYENDNDLKIVLNVKDDSSVLLDSPSRRFPNVKAL
FT                   LLKAGAADFIGKKQDNYEKCDSFLSEIYQINYLAKRNEFLSKVVKAKSMIELQEVVNEI
FT                   IASGMRLNFAKDKDYYFADHVLEKIAQLEGSYGIASDIVCTLISRGAKLKRSESLKVID
FT                   TIELKFKAHKANMISAHLEYVSNTEEFFRIAKAATSGQLYDGKIDNNVFYLEYSEDSII
FT                   DVARITDRTRNLELIQESYRRDIIKIGKSKMEIITENGIRYYTDLTEGSDIVLTFYTSL
FT                   GNIDLRLYPDIQDKSKIIVEVSNREEILEKFKGREEELGNDCALGGYSVYNAIEQGYFE
FT                   RSRKLMRPEVISESNNKWTEREELRRDSMEEIARRHKLLQDLRNIESNIVQKEKNFDIK
FT                   TYLIDIFKTLSRFYEEKGDISKTDLAKAAEKESKKLGLEGKYNWSKIFGLEEEIIEKVE
FT                   KQGDKEQKSNIPDDFYLGHAINNGSCFFDSFRQSLEQQKGIKVTVEQLRNECKRFAQDN
FT                   PPEWFISKIGNDFDEVESELVNRGITCNQYINSIGKNEFWGRSDIEGRVLCDKYGVKLH
FT                   VAESNPLHTIDKQQDPFLHQLIDSSRSKAGKIDYSHNSALHMVNGGHDHFQPLLYRNKT
FT                   LAKQTQEQKDSLCYSSLPSCSMDELKIEKANIRHCL"
FT   misc_feature    625145..634847
FT                   /note="PHAGE05; Putative lysogenic prophage region.
FT                   Putative attL/R=agaaatattagaa."
FT   gene            complement(626650..628119)
FT                   /locus_tag="WD_0634"
FT                   /old_locus_tag="WD0634"
FT   CDS_pept        complement(626650..628119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0634"
FT                   /old_locus_tag="WD0634"
FT                   /product="prophage LambdaW5, site-specific recombinase,
FT                   resolvase family"
FT                   /note="Identified by similarity to GP:6723260; match to
FT                   PF00239 protein family HMM PF00239"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0634"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14333"
FT                   /db_xref="GOA:Q73HD2"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HD2"
FT                   /protein_id="AAS14333.1"
FT                   /translation="MLKEVRCAIYTRKSNEDGLEQKFNSLDAQRVVCEKYIKSREGWVA
FT                   LAKKYDDGGFSGSNLNRPAIKELFEDVKVGEVDCVVVYTLDRLSRETKDCIEVTSFFRR
FT                   HRISFVAVTQIFDNNTPMGKFVQTVLSGAAQLEREMIVERVKNKIATSKEQGLWMGGNP
FT                   PLGYDVKEKELIINEKEAKIIKHIFERYMELKSMAELARELNREGYRTKAKSDIFKKAT
FT                   VRRIITNPIYMGKIRHYEKQYKGKHEAIIEEEKWQKAQELISNQPHRKAKYEEALLKGI
FT                   IKCKSCDVNMTLTYSKKENKRYRYYVCNNHLRGKNCESVNRTIVAGEIEKEVMKRAECL
FT                   YGDGENLSFREQKEAMKKLIKGVMVKEDGIEVCSESEEKFIPMKKKGNKCIVIEPEGKT
FT                   NNALLKAVVRAHSWKRQLEEGKYRSVKELSKKINVGTRRIQQILRLNYLAPKIKEDIVN
FT                   GRQPRGLKLVDLKEIPMLWSEQREKFYGLDL"
FT   gene            complement(628113..628553)
FT                   /locus_tag="WD_0635"
FT                   /old_locus_tag="WD0635"
FT   CDS_pept        complement(628113..628553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0635"
FT                   /old_locus_tag="WD0635"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to GP:6723259"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0635"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14334"
FT                   /db_xref="InterPro:IPR021322"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HD1"
FT                   /protein_id="AAS14334.1"
FT                   /translation="MERKEEIEKKVMNLEKKALEEVRKIWKKVYGEGAPRYSKKYLIPR
FT                   LAYRMQEKAYGEISRKGAKRLEYLADRLEKGKRISSDKLPVEGTELILERGEETHAVKV
FT                   TDKGLIYKEEFYTSLSAVAGKIMGMSYNGPLLFGMRDKEKEC"
FT   gene            complement(628566..629024)
FT                   /locus_tag="WD_0636"
FT                   /old_locus_tag="WD0636"
FT   CDS_pept        complement(628566..629024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0636"
FT                   /old_locus_tag="WD0636"
FT                   /product="prophage LambdaW5, ankyrin repeat domain protein"
FT                   /note="Identified by match to PF00023 protein family HMM
FT                   PF00023; match to PF00023 protein family HMM PF00023; match
FT                   to PF00023 protein family HMM PF00023"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0636"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14335"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HD0"
FT                   /protein_id="AAS14335.1"
FT                   /translation="MSKKEKEDELKELLENSGKNIKGTKKELHYAVDGKTVSLLVEKGA
FT                   NVNAADVEGYTALHLAITEKRLETVRELIKSGGNVNAEEYGSKCTPLHLACMVGKVEIV
FT                   EELVKAGAEIEQADKFGMTAMDYAKNSKEVTEVLKKETDRIEKLFEKL"
FT   gene            complement(629050..629676)
FT                   /locus_tag="WD_0637"
FT                   /old_locus_tag="WD0637"
FT   CDS_pept        complement(629050..629676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0637"
FT                   /old_locus_tag="WD0637"
FT                   /product="prophage LambdaW5, ankyrin repeat domain protein"
FT                   /note="Identified by match to PF00023 protein family HMM
FT                   PF00023; match to PF00023 protein family HMM PF00023; match
FT                   to PF00023 protein family HMM PF00023"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0637"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14336"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HC9"
FT                   /protein_id="AAS14336.1"
FT                   /translation="MHHAVENSDHKTVRLLIEKGAEINARDKNGYTPLHCAVFAKSLEN
FT                   VKVLLRSGAEINATQYVSGCTPLHSACKIGGAGVEIIKELVKAGSEVNQLNKYGSTPMY
FT                   YIWESEKYYLCDREESEKASKFLRAKGGVTKSRKLTCYGIEGLVGEIADKLDRSYMPEL
FT                   KIMEIEEIRKRDKSLIKKECQNLATKIMCQVNEMIDEVVRIKKGT"
FT   gene            complement(629952..631112)
FT                   /locus_tag="WD_0638"
FT                   /old_locus_tag="WD0638"
FT   CDS_pept        complement(629952..631112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0638"
FT                   /old_locus_tag="WD0638"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to GP:6723256"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0638"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14337"
FT                   /db_xref="InterPro:IPR006521"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HC8"
FT                   /protein_id="AAS14337.1"
FT                   /translation="MLLPPNATKKEKALVDAIDYKVDPGCIRGFKFSQGEKVLPWIIEE
FT                   YGLGEILHWVKDKRKAIKKGIKFQRLRGTPASLKIALKWANIEDITIIEEPSGKHFFEL
FT                   QIGIKDVLNDFFVDAVVELAKLSLPARSRLMRIFNDYYNISRFILDESFFGSLLSDYSG
FT                   VKIEKDGPVLSFGRVNFFRSHGPVIRIVENYLRDHYERALSNDIYRLDVAILGETEPHT
FT                   KNYNGIYERNHVWYNFKALYPLPQSLLPKIKFAKAQIVLSDSWNLGEINACFPVTSGEE
FT                   KGSKFLLGSDKLSEQLWNLKHKPILERFSVTHHYKVEDFTNQKVIIFGVAEHNIHFERD
FT                   LNSEQKDSIHEPENYVLVFYPGVLTWHEHRHLNRGWEEKQVICLIY"
FT   gene            complement(631112..631903)
FT                   /locus_tag="WD_0639"
FT                   /old_locus_tag="WD0639"
FT   CDS_pept        complement(631112..631903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0639"
FT                   /old_locus_tag="WD0639"
FT                   /product="prophage LambdaW5, baseplate assembly protein J,
FT                   putative"
FT                   /note="Identified by match to PF04865 protein family HMM
FT                   PF04865"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0639"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14338"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="InterPro:IPR014507"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HC7"
FT                   /protein_id="AAS14338.1"
FT                   /translation="MQQTNIIEPLNFEEIFSRMKEELISRDESFTALVESDSAMKVLEV
FT                   AAWRELLLRQRINEAVKSNLLKFATGEDLDNLAEFYGVERQKEEDDERFRKIIKAKIIG
FT                   WSTGGSKEHYRYHALSADSRVKDALVESPIPGKVQVSILSTELSTLQEELLEIVKNQLN
FT                   REDVRILTDTVEVVSCNMIEIDIHSKISIKRPDIIETMKKKFIEKFGTTKRLGWKVTRS
FT                   WIIANLFMEGVENVELIEPREDIVVKGNECAFLKSLNVELN"
FT   gene            complement(631906..632232)
FT                   /locus_tag="WD_0640"
FT                   /old_locus_tag="WD0640"
FT   CDS_pept        complement(631906..632232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0640"
FT                   /old_locus_tag="WD0640"
FT                   /product="prophage LambdaW5, baseplate assembly protein W,
FT                   putative"
FT                   /note="Identified by similarity to GP:6723254; match to
FT                   PF04965 protein family HMM PF04965"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0640"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14339"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HC6"
FT                   /protein_id="AAS14339.1"
FT                   /translation="MDGKTGKALEGIEHLKQSIIDILTTPIGSRIMMRNYGSRLFELLD
FT                   KPVNRDLTLEIYAATAEALEKWEKRFKLEKVKMTEVKEGKVTLDLEGLYVPMGKKIRFD
FT                   EVVV"
FT   gene            complement(632244..632498)
FT                   /locus_tag="WD_0641"
FT                   /old_locus_tag="WD0641"
FT   CDS_pept        complement(632244..632498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0641"
FT                   /old_locus_tag="WD0641"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0641"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14340"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HC5"
FT                   /protein_id="AAS14340.1"
FT                   /translation="MNKSVVRVGDYCGEATPHFCISGSNNVFVNDFPVCRKGDNFNEGK
FT                   VMIQGSKTVFANGHGVGRVGDSVSCGLKVIKGSKSVFAK"
FT   gene            complement(632506..632970)
FT                   /locus_tag="WD_0642"
FT                   /old_locus_tag="WD0642"
FT   CDS_pept        complement(632506..632970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0642"
FT                   /old_locus_tag="WD0642"
FT                   /product="prophage LambdaW5, baseplate assembly protein V"
FT                   /note="Identified by similarity to SP:P31340; match to
FT                   PF04717 protein family HMM PF04717; match to TIGR01644
FT                   protein family HMM TIGR01644"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0642"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14341"
FT                   /db_xref="InterPro:IPR006531"
FT                   /db_xref="InterPro:IPR013046"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HC4"
FT                   /protein_id="AAS14341.1"
FT                   /translation="MLESNFAISELQRKLANIIRIGLVKEVDYEKARVKVQIGEFLTDW
FT                   LPWITSKAGKDRNWSPPDIDEQVIILSALGELSLGVVLAGIYQEKYPAPENKKEINSVK
FT                   IQDGTRLLYDKEKHHLEIEVVDKITLKAGESSLEMTRSEIKLKADRIELN"
FT   gene            complement(632957..633433)
FT                   /locus_tag="WD_0643"
FT                   /old_locus_tag="WD0643"
FT   CDS_pept        complement(632957..633433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0643"
FT                   /old_locus_tag="WD0643"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identified by similarity to GP:6723252"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0643"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14342"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HC3"
FT                   /protein_id="AAS14342.1"
FT                   /translation="MILIELHKAICRMLKKEIPAIQTCEIYPMIRREIVAPAVFVELSS
FT                   LEQGKDSGTEELALKARFEARIVIDSTIENAAIIVRELAAEVARVVNKNTWNVKNVSPG
FT                   EFISAEIDGFRPELDAYLVWMVDWVHEVHLGRSIWEEGKFMPHKIEIGEINVGK"
FT   gene            complement(633430..633879)
FT                   /locus_tag="WD_0644"
FT                   /old_locus_tag="WD0644"
FT   CDS_pept        complement(633430..633879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0644"
FT                   /old_locus_tag="WD0644"
FT                   /product="prophage LambdaW5, minor tail protein Z,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0644"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14343"
FT                   /db_xref="InterPro:IPR010633"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HC2"
FT                   /protein_id="AAS14343.1"
FT                   /translation="MEKAAVRALNKTALWLKTQAAKEISEEKKIKLTVMRKRLRIFKAK
FT                   TSRLDVLMRANLYDIRVSAIGKMRQTRKGAKVGKHKFIGGFMATMPRGNSGVFRREGRT
FT                   ALPIQEVKLGLEPEASKIIKELVNYETEGIFEKYFERELNYIVKV"
FT   gene            complement(634058..634537)
FT                   /locus_tag="WD_0645"
FT                   /old_locus_tag="WD0645"
FT   CDS_pept        complement(634058..634537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0645"
FT                   /old_locus_tag="WD0645"
FT                   /product="reverse transcriptase, truncation"
FT                   /note="Identified by similarity to GP:12620616"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0645"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14344"
FT                   /db_xref="GOA:Q73HC1"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HC1"
FT                   /protein_id="AAS14344.1"
FT                   /translation="MEIAENKTKIVKFGKKEWYQAEREKRRTASFNFLGFTHYCGKSRN
FT                   GKLMMKQKTSKISLARKIKEIKEWLKMVRSRICLKDWWQKLKAKLTGHYSYFGVSGNYR
FT                   CLIQFYRPVTKLAFKWINRRSQKKSMDWEQFIHYLKVNPLPKPKVYVSLYTGALV"
FT   gene            634725..635105
FT                   /locus_tag="WD_0646"
FT                   /old_locus_tag="WD0646"
FT   CDS_pept        634725..635105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0646"
FT                   /old_locus_tag="WD0646"
FT                   /product="transposase, IS5 family, OrfA"
FT                   /note="Identified by similarity to GP:1256580"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0646"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14345"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IM0"
FT                   /protein_id="AAS14345.1"
FT                   /translation="MRKKYPTDLSEREWSRIEKHFRVSYKKGGRPPKYSKREILEAIFY
FT                   VLRTGCQWRYLPNDFPLWKTVYEQFRQWKKQGIFEKMNYEITKYSRRKIGRNEQPSACI
FT                   VDSQSVKTTEKGGSKAMMEVKK"
FT   gene            635216..635557
FT                   /locus_tag="WD_0647"
FT                   /old_locus_tag="WD0647"
FT   CDS_pept        635216..635557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0647"
FT                   /old_locus_tag="WD0647"
FT                   /product="transposase, IS5 family, OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0647"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14346"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q73IL9"
FT                   /protein_id="AAS14346.1"
FT                   /translation="MRTKYTKVKKMWADMGYQGRNLKNHIKEEYDIDIEIVKRPPCRFW
FT                   VHKDTPPELLPTREQGFKVQPRRWVVERTFAWVNRNRRLSKEYDLLTTSTENFIYLAMS
FT                   RVMLKREYA"
FT   gene            complement(635581..636631)
FT                   /pseudo
FT                   /locus_tag="WD_0648"
FT                   /old_locus_tag="WD0648"
FT                   /note="transposase, IS3 family, degenerate; This gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error.Identified by similarity to EGAD:43417"
FT   gene            complement(636774..638294)
FT                   /locus_tag="WD_0649"
FT                   /old_locus_tag="WD0649"
FT   CDS_pept        complement(636774..638294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0649"
FT                   /old_locus_tag="WD0649"
FT                   /product="secretion protein, HlyD family"
FT                   /note="Identified by match to TIGR01843 protein family HMM
FT                   TIGR01843; match to PF00529 protein family HMM PF00529"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0649"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14347"
FT                   /db_xref="GOA:Q73HB8"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HB8"
FT                   /protein_id="AAS14347.1"
FT                   /translation="MISKLKKLSTGFSLTGLIGHSDNINMQGAKNKKKKYPKFLDKTFA
FT                   LIDAMINFILKRESNNVNEVLRVTWGPLFFGLVVILIFFGIGGIWSAIAPIDGAVHASG
FT                   EVIVSSNRKIVQHLGGGIISKILVKESQAVKKDEPLVLLSDVNEKANLSIIKEKLLSFL
FT                   ATEARLLAIRVDLDTLEFPDEVKKLSHDELVNKAIKNQVKLFNSQRKSILGKTDILQQR
FT                   IKQLNDELAGLNFQLNAAHKQYDLITEELETKRQLLDSGHISKPHILALEKQFAEIEGR
FT                   VGHYRSAISQVQQKIGENELEIINVRNDSQERANAELKEVSTSIADLKERLMVAEDSLA
FT                   RTIIKSPQDGIVTDIRYHTEGGVIQSGVPIMSVVPSDDDLIIDAKIQTRNIEEVLSAQK
FT                   KDSNIVSIDGLEGLKVKVRLSAYSARRLSLISGIVSHISPDALDDPRLGRYYSVRVVIP
FT                   KPELAQFKNVYLYPGMPAEVYIVTQSRTLLSFLFTPIIATVDRSFIER"
FT   gene            638560..639294
FT                   /gene="fabG"
FT                   /locus_tag="WD_0650"
FT                   /old_locus_tag="WD0650"
FT   CDS_pept        638560..639294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="WD_0650"
FT                   /old_locus_tag="WD0650"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="Identified by similarity to EGAD:18311; match to
FT                   TIGR01830 protein family HMM TIGR01830; match to PF00106
FT                   protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0650"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14348"
FT                   /db_xref="GOA:Q73HB7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HB7"
FT                   /protein_id="AAS14348.1"
FT                   /translation="MFGLESRKFLITGASGGIGQAIVKIMHKAGATLCVSGTKKEVLEE
FT                   VAKQYEKNMHVLPCDLSNAEEVNQLVNRASELMEGFDGLVCNAGITQDSLLLRMTDETW
FT                   QKVIDINLSSTFKLSREACRKLIKNNWGRIINISSIIGLTGNAGQANYAASKAGIIAMS
FT                   KSIAKEVASRNITVNCIAPGFIDTKMTEVLNEVQKGKILDNIPMKRMGTGEEIAAGVLF
FT                   LASDEAKYITGHVLNINGGLFM"
FT   gene            639402..639725
FT                   /locus_tag="WD_0651"
FT                   /old_locus_tag="WD0651"
FT   CDS_pept        639402..639725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0651"
FT                   /old_locus_tag="WD0651"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative."
FT                   /db_xref="EnsemblGenomes-Gn:WD_0651"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14349"
FT                   /db_xref="GOA:Q73HB6"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HB6"
FT                   /protein_id="AAS14349.1"
FT                   /translation="MEFFSVFCVVLLFSFSGYAADPDMDDTTKVICNIIGYVWGIGGPL
FT                   MTVVIIGAALLAIFGRMPWPALFALGMFCGVFFGAKTIITKIMPNVSDEAKAVLENCGK
FT                   RNP"
FT   gene            complement(639747..641027)
FT                   /locus_tag="WD_0652"
FT                   /old_locus_tag="WD0652"
FT   CDS_pept        complement(639747..641027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0652"
FT                   /old_locus_tag="WD0652"
FT                   /product="peptidase, M48 family"
FT                   /note="Identified by match to PF01435 protein family HMM
FT                   PF01435"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0652"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14350"
FT                   /db_xref="GOA:Q73HB5"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HB5"
FT                   /protein_id="AAS14350.1"
FT                   /translation="MFRIAKFLTLLFFLAYYNNAYSINIIRDSEVEAIVKELAQPLFSA
FT                   ADIDHDQVKVFVINDSSINAFVINNNSIFIHLGLLRYSAKPYVLLGILAHEIAHISAGH
FT                   ILQMSSAMGYFQSIAMISYMVGLVSSIIINPQVAGAILLSGVALSSRLFFNYSQEQESV
FT                   ADSYALRYLDESGYDNSGMKEIFDYFKSIEHENTEEYFRTHPLSEKRIFAVQNYKVKNN
FT                   VKPIFADKLLKFERVVAKLDSFFAPIHVLSNKYEDNSEYVNAIVCYRQGKIEEAIAKVN
FT                   SLIQESRNDPYLYELKAEMLYKAGNLSEAIKMYEESLRYLSEKNSYLVKLALSHTLLLH
FT                   GDAKKAIFYLEQILNVEPNNAFVWKYLSVAYKCDADTAMHYFALTKKACIEGDLKQFTK
FT                   YAELAVKTLPKDSPHLLQVEDMKRFNG"
FT   gene            complement(641099..641752)
FT                   /locus_tag="WD_0653"
FT                   /old_locus_tag="WD0653"
FT   CDS_pept        complement(641099..641752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="WD_0653"
FT                   /old_locus_tag="WD0653"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase,
FT                   putative"
FT                   /note="Identified by similarity to EGAD:13304; match to
FT                   PF00926 protein family HMM PF00926; match to TIGR00506
FT                   protein family HMM TIGR00506"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0653"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14351"
FT                   /db_xref="GOA:Q73HB4"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HB4"
FT                   /protein_id="AAS14351.1"
FT                   /translation="MVQATYASMSLPGISSVEDVLEDARSGKLFILVDDESRENEGDLV
FT                   VLAEKVKPEHMAFMVRYGTGIVFLAMTKLHMSKLNLEFMRKSNVDEKLTPHTAFTTSID
FT                   ARYGITTGVSAHDRTHTILTAIDEKSTKDDIITPGHVFPIIANEGGVLARNGHTEASVE
FT                   IAKLVGLNHAAVGCELVNDDCSMMRLPQLLKFAEQHKIKLTTIDKLISYVKKLN"
FT   gene            complement(641759..642253)
FT                   /gene="greA"
FT                   /locus_tag="WD_0654"
FT                   /old_locus_tag="WD0654"
FT   CDS_pept        complement(641759..642253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /locus_tag="WD_0654"
FT                   /old_locus_tag="WD0654"
FT                   /product="transcription elongation factor GreA"
FT                   /note="Identified by similarity to SP:P21346; match to
FT                   TIGR01462 protein family HMM TIGR01462; match to PF03449
FT                   protein family HMM PF03449; match to PF01272 protein family
FT                   HMM PF01272"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0654"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14352"
FT                   /db_xref="GOA:Q73HB3"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HB3"
FT                   /protein_id="AAS14352.1"
FT                   /translation="MASSIINKFPMTREGFENMQAELEKLKEEKPSVIQAISDARDQGD
FT                   LSENAEYHAARERLGFIEGRIMEIESKLSHAEVIEVKNLSGDSVIFGATVTLRMLSDNN
FT                   GEVEYVYKVVGEYEADVSKQLISTSSPLGSALIGKKVGEYVEVTVPNGEKLYKIVKIEF
FT                   K"
FT   gene            complement(642263..643804)
FT                   /gene="atpA"
FT                   /locus_tag="WD_0655"
FT                   /old_locus_tag="WD0655"
FT   CDS_pept        complement(642263..643804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="WD_0655"
FT                   /old_locus_tag="WD0655"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="Identified by similarity to EGAD:6327; match to
FT                   TIGR00962 protein family HMM TIGR00962; match to PF00006
FT                   protein family HMM PF00006; match to PF00306 protein family
FT                   HMM PF00306; match to PF02874 protein family HMM PF02874"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0655"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14353"
FT                   /db_xref="GOA:Q73HB2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HB2"
FT                   /protein_id="AAS14353.1"
FT                   /translation="MKNSMNVSEIASIIREKVETFDNPIKRENIGEVISVTDGIALVYG
FT                   LEKAKFGEKVFFASGVEGIVLDLDHNTAGIVVLGNDRDVKEGDVVKCSGDVVQVPVGHE
FT                   LLGRVVNALGHPMDDGGEIRAKNRMDIESKAPGIIDRKSVHEPLQTGIKIIDLLIPIGR
FT                   GQRELIIGDRQIGKTTIALDTIINQKKVNDEVNENQKVYCVYVAIGQKISTVAKVVNKL
FT                   KESGALEYTTVVVASASDCAPMQFLAPYAGCTIGEFFRDNGMHCLIIYDDLSKHAVAYR
FT                   QMSLLLRRPPGREAYPGDIFYVHSRLLERAAKMSDKKGQGSLTALPIVETQAGDVSAYV
FT                   PTNVISITDGQIFLESELFYKGFRPAVNIGLSVSRVGSAAQLKSVKKVAGSIKLSLAQY
FT                   RELEDFAKFGSDLDASVQLSLNKGKYLVELLKQKQHLPMSIEEQVVLMYIFSNLYNQLS
FT                   KIQISNVNKFEHDLVNYFRTVHPGVLKKLSNDMNGDIKGDIFNIVSNFVTQFNCV"
FT   gene            complement(643801..644361)
FT                   /gene="atpH"
FT                   /locus_tag="WD_0656"
FT                   /old_locus_tag="WD0656"
FT   CDS_pept        complement(643801..644361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="WD_0656"
FT                   /old_locus_tag="WD0656"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="Identified by similarity to SP:P22479; match to
FT                   TIGR01145 protein family HMM TIGR01145; match to PF00213
FT                   protein family HMM PF00213"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0656"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14354"
FT                   /db_xref="GOA:Q73HB1"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HB1"
FT                   /protein_id="AAS14354.1"
FT                   /translation="MKKTQYNNLVSSYARVLFHVSGSRLGIIRKEVEFLLAFFKDQRDV
FT                   FVYLSHPMISFAHKKEVMLSINEHLSENLVKFIMVIFANKRSSLLILILEKFLSLAREN
FT                   ENEFEITIKSAETLKESDIKIITESLSFLGKIIKVSNVVDPSILGGFVVRYGFNLIDAS
FT                   LKSYLDRLVDLSKMEILKVRNFV"
FT   gene            complement(644777..645205)
FT                   /gene="rplQ"
FT                   /locus_tag="WD_0657"
FT                   /old_locus_tag="WD0657"
FT   CDS_pept        complement(644777..645205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="WD_0657"
FT                   /old_locus_tag="WD0657"
FT                   /product="ribosomal protein L17"
FT                   /note="Identified by similarity to EGAD:19865; match to
FT                   TIGR00059 protein family HMM TIGR00059; match to PF01196
FT                   protein family HMM PF01196"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0657"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14355"
FT                   /db_xref="GOA:Q73HB0"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HB0"
FT                   /protein_id="AAS14355.1"
FT                   /translation="MKHGIKKRKLSRCTEHRLSTLKNLSISLINHEQIVTTLPKAKELR
FT                   PYVEKFITIAKNKNTLHGRRLLLSRLHNSKLAVDKLLNVLASRYQDRKGGYSRIIKFST
FT                   RKGDCASMAVIELVDRDIAARGKVYSKNKEGGKVVTQS"
FT   gene            complement(645213..646280)
FT                   /gene="rpoA"
FT                   /locus_tag="WD_0658"
FT                   /old_locus_tag="WD0658"
FT   CDS_pept        complement(645213..646280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="WD_0658"
FT                   /old_locus_tag="WD0658"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="Identified by similarity to EGAD:19498; match to
FT                   PF01000 protein family HMM PF01000; match to PF03118
FT                   protein family HMM PF03118"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0658"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14356"
FT                   /db_xref="GOA:Q73HA9"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HA9"
FT                   /protein_id="AAS14356.1"
FT                   /translation="MYYNNDVSLCSNLDKLIKPSSVKVVSDDSSEKSDIVLEPLESGFA
FT                   LTLGNALRRVMLSSLKGSAVYGIKIEGVTHEFTSIQGVREDVTDIVLNMGMLRCKLNGA
FT                   SNKCLNLNAKGPCQVLAGMIETDDQCSIVNKDLLICTLGQNVELNMTIYVASGKGYLPV
FT                   TKYKENELLKLMSEQDLIGFIPVNALYSPVNRVSYRVENSRVGQVTDKDKLILSIETDG
FT                   TISPSQAVDSAARILQEQLQPFISSDVSYKKSQVSSSSGAKDLGYDPVLLRKVDEMELS
FT                   VRSHNCLKNENITYIGDLVQKTEGEMLRTANFGRKSLNEIKAVLTNFGLSLGMNVLNWP
FT                   PKDIDELAKQHTDED"
FT   gene            complement(646302..646688)
FT                   /gene="rpsK"
FT                   /locus_tag="WD_0659"
FT                   /old_locus_tag="WD0659"
FT   CDS_pept        complement(646302..646688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="WD_0659"
FT                   /old_locus_tag="WD0659"
FT                   /product="ribosomal protein S11"
FT                   /note="Identified by similarity to EGAD:12657; match to
FT                   PF00411 protein family HMM PF00411"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0659"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14357"
FT                   /db_xref="GOA:Q73HA8"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HA8"
FT                   /protein_id="AAS14357.1"
FT                   /translation="MKKVKTVSKSKKEFITGVVHIRATFNNTFVNVTDVHGNTLCQTSV
FT                   GACGFSGSRKSTPYAAGKAAESAAKNAMERFGMKVVSVIIRGPGFGTEAAVKAFQSCGL
FT                   TVTSIADKTAIPHNGCRLRKKRRV"
FT   gene            complement(646710..647078)
FT                   /gene="rpsM"
FT                   /locus_tag="WD_0660"
FT                   /old_locus_tag="WD0660"
FT   CDS_pept        complement(646710..647078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="WD_0660"
FT                   /old_locus_tag="WD0660"
FT                   /product="ribosomal protein S13"
FT                   /note="Identified by similarity to EGAD:89881; match to
FT                   PF00416 protein family HMM PF00416"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0660"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14358"
FT                   /db_xref="GOA:Q73HA7"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HA7"
FT                   /protein_id="AAS14358.1"
FT                   /translation="MARIAGINIPVRKCVPFALTYIYGIGIATANVICHACEVDKRKRV
FT                   SELRDEDIEKISGFIRQNYVIEGELRKEVAMNIKSLVEMGCYRGVRHRKGLPVRGQRTH
FT                   TNAKTRKGRSRLPIAGKK"
FT   gene            complement(647138..647779)
FT                   /gene="adk"
FT                   /locus_tag="WD_0661"
FT                   /old_locus_tag="WD0661"
FT   CDS_pept        complement(647138..647779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="WD_0661"
FT                   /old_locus_tag="WD0661"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="Identified by match to PF00406 protein family HMM
FT                   PF00406"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0661"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14359"
FT                   /db_xref="GOA:Q73HA6"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HA6"
FT                   /protein_id="AAS14359.1"
FT                   /translation="MIITIFGPPGSGKGTQSSLLIAKYNLKLISVGDLLRNIISSSSEL
FT                   GKKIKGTVESGNLIQDEIICGLLRDQLALVDDNCLLDGFPRNLNQAHFLTQVLQEKYNR
FT                   DVDIVVELQLDDNIAIDRLKNRLACLDCKNIYSVSSFKSTTCAKCKSTRLEKRIDDADM
FT                   SAINKRISEYHLQMKGLREYYKGKLLTIDANLSVDEVTQEIESKISCNLV"
FT   gene            complement(647776..649104)
FT                   /gene="secY"
FT                   /locus_tag="WD_0662"
FT                   /old_locus_tag="WD0662"
FT   CDS_pept        complement(647776..649104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="WD_0662"
FT                   /old_locus_tag="WD0662"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="Identified by similarity to EGAD:162705; match to
FT                   TIGR00967 protein family HMM TIGR00967; match to PF00344
FT                   protein family HMM PF00344"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0662"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14360"
FT                   /db_xref="GOA:Q73HA5"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HA5"
FT                   /protein_id="AAS14360.1"
FT                   /translation="MGNKSAFNSLDPTLLYKGDLLKRIFFTLIALICYRLGTYVPIPGI
FT                   NLDVINDIFPKDGSGVFGVFNLFSGGALARMTILALNVMPYIMASIIIQLLSSAIKGMK
FT                   EVKNDGESGRRKMNSYIRYLTIVICVFQSIPILVGLEGMNREGVLVVIEPGVMFRTIGV
FT                   FSLLGGTMLLIWLGERISASGIGNGISLIIFTGIISELHSALSSLLTLNKNGSVSLFII
FT                   LFVLVLFFLLLLLVIFVESSYRKVIVQHPKKQFKRLHNDDFTYIPLKINLSGVVPTIFA
FT                   NAILLTPISIANFYKGHAFSDFILNYFMANKVVYIVAYLVLIVFFNFFYTNFIFNPEEN
FT                   ADFLKKNGGFIPGRRPGKHTSDYLQDIVFKLTFIGSAYLVVICTVPEVMRYYYDIPFIF
FT                   GGTSLLIIVNVITDTIMQIQSYIFSNRYDNWIKKYESKTRKVR"
FT   gene            complement(649108..649578)
FT                   /gene="rplO"
FT                   /locus_tag="WD_0663"
FT                   /old_locus_tag="WD0663"
FT   CDS_pept        complement(649108..649578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="WD_0663"
FT                   /old_locus_tag="WD0663"
FT                   /product="ribosomal protein L15"
FT                   /note="Identified by similarity to EGAD:16743; match to
FT                   TIGR01071 protein family HMM TIGR01071; match to PF01305
FT                   protein family HMM PF01305"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0663"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14361"
FT                   /db_xref="GOA:Q73HA4"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HA4"
FT                   /protein_id="AAS14361.1"
FT                   /translation="MNNAVKLNSIFTKLSKKKKPKLLGRGIGCGKGKTSGRGHKGQKAR
FT                   SGVSINGFEGGQQSIYTRLPKRGFKPIRRSIYSIINVGDIQRLMEAKKIVKDSVIDKER
FT                   LYKLGFIKSIKDKIKLLNKGKLSEKFVFHVDFASEAAKKSVASVGGSVEILS"
FT   gene            complement(649582..650094)
FT                   /gene="rpsE"
FT                   /locus_tag="WD_0664"
FT                   /old_locus_tag="WD0664"
FT   CDS_pept        complement(649582..650094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="WD_0664"
FT                   /old_locus_tag="WD0664"
FT                   /product="ribosomal protein S5"
FT                   /note="Identified by similarity to SP:P02356; match to
FT                   TIGR01021 protein family HMM TIGR01021; match to PF00333
FT                   protein family HMM PF00333; match to PF03719 protein family
FT                   HMM PF03719"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0664"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14362"
FT                   /db_xref="GOA:Q73HA3"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HA3"
FT                   /protein_id="AAS14362.1"
FT                   /translation="MAIKNLQNNNDLSELLVSVRRVTTVTKGGRRFSFSILVVVGDEKG
FT                   RVGCGIGKHAEVAEARVKAVNAAKKSMIRVYLREGRTLHHDIKAKFCSGEIVLRTARAG
FT                   TGIIAGGAIRSVFEVLGIKDVVAKSTRSNNPHNVICAVFKAFDSMLSPRQVASKRGKKI
FT                   SEIVGNR"
FT   gene            complement(650107..650478)
FT                   /gene="rpl18"
FT                   /locus_tag="WD_0665"
FT                   /old_locus_tag="WD0665"
FT   CDS_pept        complement(650107..650478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl18"
FT                   /locus_tag="WD_0665"
FT                   /old_locus_tag="WD0665"
FT                   /product="ribosomal protein L18"
FT                   /note="Identified by similarity to SP:P46899; match to
FT                   PF00861 protein family HMM PF00861"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0665"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14363"
FT                   /db_xref="GOA:Q73HA2"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HA2"
FT                   /protein_id="AAS14363.1"
FT                   /translation="MKRSYNFLSNSEKRKLRNRAKLDKSAERLRISIFKSNRHFYVQLI
FT                   NDVKGITLTSASTLDAKIKDVCKGKVNAETIKQVSSLMVERLSGMKLEQQLTFDRGAYK
FT                   YTGLVSQFAEALRSSGFEF"
FT   gene            complement(650484..651029)
FT                   /gene="rplF"
FT                   /locus_tag="WD_0666"
FT                   /old_locus_tag="WD0666"
FT   CDS_pept        complement(650484..651029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="WD_0666"
FT                   /old_locus_tag="WD0666"
FT                   /product="ribosomal protein L6"
FT                   /note="Identified by similarity to OMNI:NTL01BH0150; match
FT                   to PF00347 protein family HMM PF00347; match to PF00347
FT                   protein family HMM PF00347"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0666"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14364"
FT                   /db_xref="GOA:Q73HA1"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:Q73HA1"
FT                   /protein_id="AAS14364.1"
FT                   /translation="MSRIGAAPINIPAGVSVEYNNGSMLIKSAKAEKEVSLIRDVVCQI
FT                   IDNQLLLSVDQDKDNYDKIKPMWGTYRSNINNIINGMVDGFSVNLEINGVGYKAECDGK
FT                   YLTLYLGYSHNVKYKVPKDVEIKCIKPTHLIVSGMDKQKVYMVASDICKIRKYDPYKGK
FT                   GVVIKGKFMLRKVVSKKK"
FT   gene            complement(651046..651441)
FT                   /gene="rpsH"
FT                   /locus_tag="WD_0667"
FT                   /old_locus_tag="WD0667"
FT   CDS_pept        complement(651046..651441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="WD_0667"
FT                   /old_locus_tag="WD0667"
FT                   /product="ribosomal protein S8"
FT                   /note="Identified by similarity to EGAD:8255; match to
FT                   PF00410 protein family HMM PF00410"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0667"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14365"
FT                   /db_xref="GOA:Q73HA0"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73HA0"
FT                   /protein_id="AAS14365.1"
FT                   /translation="MALSDSIGDFLTRIRNAQLAMHRATRVLFSKMNSSILEILKEEGY
FT                   ILDYEKQVVDNLPSFIVKLKYYEKSPVISDIVRVSKPGCRRYSKYKDISKAYNGLGIFI
FT                   ISTPKGVMTDYNAHKLKVGGEVLCRVF"
FT   gene            complement(651463..651771)
FT                   /gene="rspN"
FT                   /locus_tag="WD_0668"
FT                   /old_locus_tag="WD0668"
FT   CDS_pept        complement(651463..651771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rspN"
FT                   /locus_tag="WD_0668"
FT                   /old_locus_tag="WD0668"
FT                   /product="ribosomal protein S14"
FT                   /note="Identified by similarity to EGAD:76730; match to
FT                   PF00253 protein family HMM PF00253"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0668"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14366"
FT                   /db_xref="GOA:Q73H99"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73H99"
FT                   /protein_id="AAS14366.1"
FT                   /translation="MAKKSMIERNLRRIKLCDQYKEKREKLKSIINNKNLSIVERFTAQ
FT                   NKLIKKLPRNSSKTKIRNRCALTGRPRGVYRKFGLCRIVLRDLCSFGQIPGVTKSSW"
FT   gene            complement(651788..652321)
FT                   /gene="rplE"
FT                   /locus_tag="WD_0669"
FT                   /old_locus_tag="WD0669"
FT   CDS_pept        complement(651788..652321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="WD_0669"
FT                   /old_locus_tag="WD0669"
FT                   /product="ribosomal protein L5"
FT                   /note="Identified by similarity to SP:P02389; match to
FT                   PF00673 protein family HMM PF00673; match to PF00281
FT                   protein family HMM PF00281"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0669"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14367"
FT                   /db_xref="GOA:Q73H98"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73H98"
FT                   /protein_id="AAS14367.1"
FT                   /translation="MFKELYKDSIVKSLKDKFNYGNIMQVPKLVKVCINMGVGDAATDS
FT                   KAINEPLDSLYLIAGQKPLSTFAKKSISGFKIRKGATVGCKVTLRRDKMYEFLERLIYI
FT                   ALPREKDFRGFSVKQFDGNGNFSFGIKEHISFLEIDYDKISKIRGMDINIITSAVSDKE
FT                   AKELLLALKFPFFD"
FT   gene            complement(652328..652645)
FT                   /gene="rplX"
FT                   /locus_tag="WD_0670"
FT                   /old_locus_tag="WD0670"
FT   CDS_pept        complement(652328..652645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="WD_0670"
FT                   /old_locus_tag="WD0670"
FT                   /product="ribosomal protein L24"
FT                   /note="Identified by similarity to EGAD:12689; match to
FT                   TIGR01079 protein family HMM TIGR01079; match to PF00467
FT                   protein family HMM PF00467"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0670"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14368"
FT                   /db_xref="GOA:Q73H97"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73H97"
FT                   /protein_id="AAS14368.1"
FT                   /translation="MSAKIKSGDDVIVLTGKDKGKIGKVIKVIARDAKKKVIVSGVNVH
FT                   KRHTKPKAGSSGGILNKELAIDISNVATLDPKYKTPTRVGFKVIDGRKVRFAKVSGEVI
FT                   D"
FT   gene            complement(652645..653004)
FT                   /gene="rplN"
FT                   /locus_tag="WD_0671"
FT                   /old_locus_tag="WD0671"
FT   CDS_pept        complement(652645..653004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="WD_0671"
FT                   /old_locus_tag="WD0671"
FT                   /product="ribosomal protein L14"
FT                   /note="Identified by similarity to EGAD:7021; match to
FT                   TIGR01067 protein family HMM TIGR01067; match to PF00238
FT                   protein family HMM PF00238"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0671"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14369"
FT                   /db_xref="GOA:Q73H96"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73H96"
FT                   /protein_id="AAS14369.1"
FT                   /translation="MIQKNTLLEVADNSGARAVLCIGLLGGRKSASIGDTVIVSTKSIT
FT                   PRGKVEKGKVYRAVVVRVKSPIRKSDGSVIRFSSNAVVLINDQGEPLGTRVFGPVKKLS
FT                   SGSFMKIMSLAVEVL"
FT   gene            complement(653018..653254)
FT                   /gene="rpsQ"
FT                   /locus_tag="WD_0672"
FT                   /old_locus_tag="WD0672"
FT   CDS_pept        complement(653018..653254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="WD_0672"
FT                   /old_locus_tag="WD0672"
FT                   /product="ribosomal protein S17"
FT                   /note="Identified by similarity to SP:P12874; match to
FT                   PF00366 protein family HMM PF00366"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0672"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14370"
FT                   /db_xref="GOA:Q73H95"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73H95"
FT                   /protein_id="AAS14370.1"
FT                   /translation="MPKKVFCGTVTKAKCDKTVKVSVLQVYKDELYKKVIKKYKKYTAH
FT                   DENNSCKEGDKVLIQEHKPISTTKKWVIVNSSH"
FT   gene            complement(653247..653450)
FT                   /gene="rpmC"
FT                   /locus_tag="WD_0673"
FT                   /old_locus_tag="WD0673"
FT   CDS_pept        complement(653247..653450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="WD_0673"
FT                   /old_locus_tag="WD0673"
FT                   /product="ribosomal protein L29"
FT                   /note="Identified by similarity to EGAD:7122; match to
FT                   TIGR00012 protein family HMM TIGR00012; match to PF00831
FT                   protein family HMM PF00831"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0673"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14371"
FT                   /db_xref="GOA:Q73H94"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73H94"
FT                   /protein_id="AAS14371.1"
FT                   /translation="MDIADIESRSSQELHEILVNLRKEFVNLVFQKKLAQCNNISRFSL
FT                   IRKSIARILTTLNKRRREEKNA"
FT   gene            complement(653462..653875)
FT                   /gene="rplP"
FT                   /locus_tag="WD_0674"
FT                   /old_locus_tag="WD0674"
FT   CDS_pept        complement(653462..653875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="WD_0674"
FT                   /old_locus_tag="WD0674"
FT                   /product="ribosomal protein L16"
FT                   /note="Identified by similarity to EGAD:8200; match to
FT                   PF00252 protein family HMM PF00252; match to TIGR01164
FT                   protein family HMM TIGR01164"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0674"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14372"
FT                   /db_xref="GOA:Q73H93"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73H93"
FT                   /protein_id="AAS14372.1"
FT                   /translation="MFIPKKSKYKKVFKGRIKGNTKGGSTLSFGDYGLKAMEAGRIQSK
FT                   HIETARRVISRTLKRSGKVWIRIFPDTPVSKKPADVRMGKGKGSVEFWVFKAKPGRMLF
FT                   EISSDVPMHLARLALEKATAKLPMKCKFVSNHN"
FT   gene            complement(653890..654504)
FT                   /gene="rpsC"
FT                   /locus_tag="WD_0675"
FT                   /old_locus_tag="WD0675"
FT   CDS_pept        complement(653890..654504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="WD_0675"
FT                   /old_locus_tag="WD0675"
FT                   /product="ribosomal protein S3"
FT                   /note="Identified by similarity to EGAD:15155; match to
FT                   TIGR01009 protein family HMM TIGR01009; match to PF00189
FT                   protein family HMM PF00189; match to PF00417 protein family
FT                   HMM PF00417; match to PF00013 protein family HMM PF00013"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0675"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14373"
FT                   /db_xref="GOA:Q73H92"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73H92"
FT                   /protein_id="AAS14373.1"
FT                   /translation="MGNVNPKGFRLKIINTWSSIWYAEKGYKQGLHQDLSIRSYINESF
FT                   KHAGVSKVIIERTIDLVSVIIHSSRPGVIIGKKGSDIEKIKQKIAEKVKNNVEVNVVGV
FT                   KRSEIDAVLISNSIAQQLEKRVSFRRAMKKAIQSCLRMGARGIKVSCSGRLGGAEIART
FT                   EWYKEGRLPLHTLRANIDYAFAEAKTIYGIIGVKVWVYIGN"
FT   gene            complement(654544..654891)
FT                   /gene="rplV"
FT                   /locus_tag="WD_0676"
FT                   /old_locus_tag="WD0676"
FT   CDS_pept        complement(654544..654891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="WD_0676"
FT                   /old_locus_tag="WD0676"
FT                   /product="ribosomal protein L22"
FT                   /note="Identified by similarity to EGAD:6469; match to
FT                   TIGR01044 protein family HMM TIGR01044; match to PF00237
FT                   protein family HMM PF00237"
FT                   /db_xref="EnsemblGenomes-Gn:WD_0676"
FT                   /db_xref="EnsemblGenomes-Tr:AAS14374"
FT                   /db_xref="GOA:Q73H91"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q73H91"
FT                   /protein_id="AAS14374.1"
FT                   /translation="MKNRDVIVKAGSRVLKSTPRKLNLVAGLVRNKKVSFATVQLRFCE
FT                   KKAAGLIRKVLNSAIANAQNYGLDIDNLYIKEILIGKSLTLRRVCPKAMGRANRVSKRY
FT                   SNITVKLGEII"
FT   gene            complement(654897..655181)
FT                   /gene="rpsS"
FT                   /locus_tag="WD_0677"
FT                   /old_locus_tag="WD0677"
FT