(data stored in SCRATCH3701 zone)

EMBL: AE017197

ID   AE017197; SV 1; circular; genomic DNA; STD; PRO; 1111496 BP.
XX
AC   AE017197;
XX
PR   Project:PRJNA10679;
XX
DT   23-AUG-2004 (Rel. 80, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 12)
XX
DE   Rickettsia typhi str. Wilmington, complete genome.
XX
KW   .
XX
OS   Rickettsia typhi str. Wilmington
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales;
OC   Rickettsiaceae; Rickettsieae; Rickettsia; typhus group.
XX
RN   [1]
RP   1-1111496
RX   DOI; 10.1128/JB.186.17.5842-5855.2004.
RX   PUBMED; 15317790.
RA   McLeod M.P., Qin X., Karpathy S.E., Gioia J., Highlander S.K., Fox G.E.,
RA   McNeill T.Z., Jiang H., Muzny D., Jacob L.S., Hawes A.C., Sodergren E.,
RA   Gill R., Hume J., Morgan M., Fan G., Amin A.G., Gibbs R.A., Hong C.,
RA   Yu X.J., Walker D.H., Weinstock G.M.;
RT   "Complete genome sequence of Rickettsia typhi and comparison with sequences
RT   of other rickettsiae";
RL   J. Bacteriol. 186(17):5842-5855(2004).
XX
RN   [2]
RP   1-1111496
RA   Weinstock G.M.;
RT   ;
RL   Submitted (21-NOV-2003) to the INSDC.
RL   Human Genome Sequencing Center, Baylor College of Medicine, 1 Baylor Plaza,
RL   Houston, TX 77035, USA
XX
DR   MD5; a13196e391756971685307b53dacedc3.
DR   BioSample; SAMN02603327.
DR   EnsemblGenomes-Gn; EBG00001005482.
DR   EnsemblGenomes-Gn; EBG00001005483.
DR   EnsemblGenomes-Gn; EBG00001005484.
DR   EnsemblGenomes-Gn; EBG00001005485.
DR   EnsemblGenomes-Gn; EBG00001005486.
DR   EnsemblGenomes-Gn; EBG00001005487.
DR   EnsemblGenomes-Gn; EBG00001005488.
DR   EnsemblGenomes-Gn; EBG00001005489.
DR   EnsemblGenomes-Gn; EBG00001005490.
DR   EnsemblGenomes-Gn; EBG00001005491.
DR   EnsemblGenomes-Gn; EBG00001005492.
DR   EnsemblGenomes-Gn; EBG00001005493.
DR   EnsemblGenomes-Gn; EBG00001005494.
DR   EnsemblGenomes-Gn; EBG00001005495.
DR   EnsemblGenomes-Gn; EBG00001005496.
DR   EnsemblGenomes-Gn; EBG00001005497.
DR   EnsemblGenomes-Gn; EBG00001005498.
DR   EnsemblGenomes-Gn; EBG00001005499.
DR   EnsemblGenomes-Gn; EBG00001005500.
DR   EnsemblGenomes-Gn; EBG00001005501.
DR   EnsemblGenomes-Gn; EBG00001005502.
DR   EnsemblGenomes-Gn; EBG00001005503.
DR   EnsemblGenomes-Gn; EBG00001005504.
DR   EnsemblGenomes-Gn; EBG00001005505.
DR   EnsemblGenomes-Gn; EBG00001005506.
DR   EnsemblGenomes-Gn; EBG00001005507.
DR   EnsemblGenomes-Gn; EBG00001005508.
DR   EnsemblGenomes-Gn; EBG00001005509.
DR   EnsemblGenomes-Gn; EBG00001005510.
DR   EnsemblGenomes-Gn; EBG00001005511.
DR   EnsemblGenomes-Gn; EBG00001005512.
DR   EnsemblGenomes-Gn; EBG00001005513.
DR   EnsemblGenomes-Gn; EBG00001005514.
DR   EnsemblGenomes-Gn; EBG00001005516.
DR   EnsemblGenomes-Gn; EBG00001005518.
DR   EnsemblGenomes-Gn; EBG00001005520.
DR   EnsemblGenomes-Gn; EBG00001005521.
DR   EnsemblGenomes-Gn; EBG00001005522.
DR   EnsemblGenomes-Gn; EBG00001005523.
DR   EnsemblGenomes-Gn; EBG00001005524.
DR   EnsemblGenomes-Gn; EBG00001005526.
DR   EnsemblGenomes-Gn; EBG00001005528.
DR   EnsemblGenomes-Gn; EBG00001005529.
DR   EnsemblGenomes-Gn; EBG00001005530.
DR   EnsemblGenomes-Gn; RT0009.
DR   EnsemblGenomes-Gn; RT0016.
DR   EnsemblGenomes-Gn; RT0036.
DR   EnsemblGenomes-Gn; RT0054.
DR   EnsemblGenomes-Gn; RT0122.
DR   EnsemblGenomes-Gn; RT0149.
DR   EnsemblGenomes-Gn; RT0200.
DR   EnsemblGenomes-Gn; RT0202.
DR   EnsemblGenomes-Gn; RT0227.
DR   EnsemblGenomes-Gn; RT0267.
DR   EnsemblGenomes-Gn; RT0349.
DR   EnsemblGenomes-Gn; RT0369.
DR   EnsemblGenomes-Gn; RT0370.
DR   EnsemblGenomes-Gn; RT0440.
DR   EnsemblGenomes-Gn; RT0454.
DR   EnsemblGenomes-Gn; RT0467.
DR   EnsemblGenomes-Gn; RT0468.
DR   EnsemblGenomes-Gn; RT0504.
DR   EnsemblGenomes-Gn; RT0506.
DR   EnsemblGenomes-Gn; RT0510.
DR   EnsemblGenomes-Gn; RT0545.
DR   EnsemblGenomes-Gn; RT0562.
DR   EnsemblGenomes-Gn; RT0571.
DR   EnsemblGenomes-Gn; RT0573.
DR   EnsemblGenomes-Gn; RT0602.
DR   EnsemblGenomes-Gn; RT0624.
DR   EnsemblGenomes-Gn; RT0654.
DR   EnsemblGenomes-Gn; RT0655.
DR   EnsemblGenomes-Gn; RT0663.
DR   EnsemblGenomes-Gn; RT0690.
DR   EnsemblGenomes-Gn; RT0721.
DR   EnsemblGenomes-Gn; RT0757.
DR   EnsemblGenomes-Gn; RT0801.
DR   EnsemblGenomes-Gn; RT0826.
DR   EnsemblGenomes-Gn; RT0864.
DR   EnsemblGenomes-Gn; RT0868.
DR   EnsemblGenomes-Tr; EBT00001530721.
DR   EnsemblGenomes-Tr; EBT00001530722.
DR   EnsemblGenomes-Tr; EBT00001530723.
DR   EnsemblGenomes-Tr; EBT00001530724.
DR   EnsemblGenomes-Tr; EBT00001530725.
DR   EnsemblGenomes-Tr; EBT00001530726.
DR   EnsemblGenomes-Tr; EBT00001530727.
DR   EnsemblGenomes-Tr; EBT00001530728.
DR   EnsemblGenomes-Tr; EBT00001530729.
DR   EnsemblGenomes-Tr; EBT00001530730.
DR   EnsemblGenomes-Tr; EBT00001530731.
DR   EnsemblGenomes-Tr; EBT00001530732.
DR   EnsemblGenomes-Tr; EBT00001530733.
DR   EnsemblGenomes-Tr; EBT00001530734.
DR   EnsemblGenomes-Tr; EBT00001530735.
DR   EnsemblGenomes-Tr; EBT00001530736.
DR   EnsemblGenomes-Tr; EBT00001530737.
DR   EnsemblGenomes-Tr; EBT00001530738.
DR   EnsemblGenomes-Tr; EBT00001530739.
DR   EnsemblGenomes-Tr; EBT00001530740.
DR   EnsemblGenomes-Tr; EBT00001530741.
DR   EnsemblGenomes-Tr; EBT00001530742.
DR   EnsemblGenomes-Tr; EBT00001530743.
DR   EnsemblGenomes-Tr; EBT00001530744.
DR   EnsemblGenomes-Tr; EBT00001530745.
DR   EnsemblGenomes-Tr; EBT00001530746.
DR   EnsemblGenomes-Tr; EBT00001530747.
DR   EnsemblGenomes-Tr; EBT00001530748.
DR   EnsemblGenomes-Tr; EBT00001530749.
DR   EnsemblGenomes-Tr; EBT00001530750.
DR   EnsemblGenomes-Tr; EBT00001530751.
DR   EnsemblGenomes-Tr; EBT00001530752.
DR   EnsemblGenomes-Tr; EBT00001530753.
DR   EnsemblGenomes-Tr; EBT00001530754.
DR   EnsemblGenomes-Tr; EBT00001530755.
DR   EnsemblGenomes-Tr; EBT00001530756.
DR   EnsemblGenomes-Tr; EBT00001530757.
DR   EnsemblGenomes-Tr; EBT00001530758.
DR   EnsemblGenomes-Tr; EBT00001530759.
DR   EnsemblGenomes-Tr; EBT00001530760.
DR   EnsemblGenomes-Tr; EBT00001530761.
DR   EnsemblGenomes-Tr; EBT00001530762.
DR   EnsemblGenomes-Tr; EBT00001530763.
DR   EnsemblGenomes-Tr; EBT00001530764.
DR   EnsemblGenomes-Tr; RT0009-1.
DR   EnsemblGenomes-Tr; RT0016-1.
DR   EnsemblGenomes-Tr; RT0036-1.
DR   EnsemblGenomes-Tr; RT0054-1.
DR   EnsemblGenomes-Tr; RT0122-1.
DR   EnsemblGenomes-Tr; RT0149-1.
DR   EnsemblGenomes-Tr; RT0200-1.
DR   EnsemblGenomes-Tr; RT0202-1.
DR   EnsemblGenomes-Tr; RT0227-1.
DR   EnsemblGenomes-Tr; RT0267-1.
DR   EnsemblGenomes-Tr; RT0349-1.
DR   EnsemblGenomes-Tr; RT0369-1.
DR   EnsemblGenomes-Tr; RT0370-1.
DR   EnsemblGenomes-Tr; RT0440-1.
DR   EnsemblGenomes-Tr; RT0454-1.
DR   EnsemblGenomes-Tr; RT0467-1.
DR   EnsemblGenomes-Tr; RT0468-1.
DR   EnsemblGenomes-Tr; RT0504-1.
DR   EnsemblGenomes-Tr; RT0506-1.
DR   EnsemblGenomes-Tr; RT0510-1.
DR   EnsemblGenomes-Tr; RT0545-1.
DR   EnsemblGenomes-Tr; RT0562-1.
DR   EnsemblGenomes-Tr; RT0571-1.
DR   EnsemblGenomes-Tr; RT0573-1.
DR   EnsemblGenomes-Tr; RT0602-1.
DR   EnsemblGenomes-Tr; RT0624-1.
DR   EnsemblGenomes-Tr; RT0654-1.
DR   EnsemblGenomes-Tr; RT0655-1.
DR   EnsemblGenomes-Tr; RT0663-1.
DR   EnsemblGenomes-Tr; RT0690-1.
DR   EnsemblGenomes-Tr; RT0721-1.
DR   EnsemblGenomes-Tr; RT0757-1.
DR   EnsemblGenomes-Tr; RT0801-1.
DR   EnsemblGenomes-Tr; RT0826-1.
DR   EnsemblGenomes-Tr; RT0864-1.
DR   EnsemblGenomes-Tr; RT0868-1.
DR   EuropePMC; PMC1428390; 16547041.
DR   EuropePMC; PMC1951237; 17553977.
DR   EuropePMC; PMC2223442; 18025092.
DR   EuropePMC; PMC2258626; 18203862.
DR   EuropePMC; PMC2546805; 18641131.
DR   EuropePMC; PMC2609893; 18826827.
DR   EuropePMC; PMC2609894; 18826840.
DR   EuropePMC; PMC2990048; 21118938.
DR   EuropePMC; PMC3346363; 22407688.
DR   EuropePMC; PMC3735526; 23940746.
DR   EuropePMC; PMC3767692; 24039725.
DR   EuropePMC; PMC3957756; 24371248.
DR   EuropePMC; PMC4111176; 25076014.
DR   EuropePMC; PMC4435010; 25923891.
DR   EuropePMC; PMC4816379; 23735173.
DR   EuropePMC; PMC5062770; 27402519.
DR   EuropePMC; PMC5119731; 27875529.
DR   EuropePMC; PMC516817; 15317790.
DR   EuropePMC; PMC5440275; 28560173.
DR   EuropePMC; PMC5552056; 28831298.
DR   EuropePMC; PMC5875266; 29553921.
DR   EuropePMC; PMC6038764; 29912688.
DR   EuropePMC; PMC6200005; 30334722.
DR   EuropePMC; PMC6413773; 30864621.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01774; rpsL_ricks.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; AE017197.
DR   SILVA-SSU; AE017197.
DR   StrainInfo; 621685; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1111496
FT                   /organism="Rickettsia typhi str. Wilmington"
FT                   /strain="Wilmington"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:257363"
FT   gene            1..822
FT                   /locus_tag="RT0001"
FT   CDS_pept        1..822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0001"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03491"
FT                   /db_xref="GOA:Q68Y01"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026565"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68Y01"
FT                   /protein_id="AAU03491.1"
FT                   /translation="MTKLIIHLVSDSSVQTVKHAANSALAQFTSIKQKLYHWPMIRNLE
FT                   LLNEVLSKIESKHGIVLYTIADQELRKALTKFCYELKIPCISVIGKIIKEMSVFSGIEI
FT                   EKEQNYNYKFDKTYFDTLNAIDYAIRHDDGQMINELSESDIILIGPSRTSKTPTSVFLA
FT                   YNGLKAANIPYVYNCPFPDFIEKNIDQLVVGLVINPNRLIEIREARLNLLQINENKSYT
FT                   DFNIVQRECIEVRKICNQRNWPVIDVSTRSIEETAALIMRIYYNRKNKYHK"
FT   gene            984..1301
FT                   /gene="trxA"
FT                   /locus_tag="RT0002"
FT   CDS_pept        984..1301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="RT0002"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:RT0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03492"
FT                   /db_xref="GOA:Q68Y00"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68Y00"
FT                   /protein_id="AAU03492.1"
FT                   /translation="MVNNVTDISFKNEVLESDLPVIVDFWAEWCGPCKMLIPIIDEISK
FT                   ELQDKVKVLKMNIDENPKTPSEYGVRSIPTIMLFKNGEQKDTKIGLQQKKSLLDWINKS
FT                   I"
FT   gene            1312..2070
FT                   /gene="wzt"
FT                   /locus_tag="RT0003"
FT   CDS_pept        1312..2070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wzt"
FT                   /locus_tag="RT0003"
FT                   /product="O-antigen export system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03493"
FT                   /db_xref="GOA:Q68XZ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XZ9"
FT                   /protein_id="AAU03493.1"
FT                   /translation="MLLNHSKVFIEITDGYVEGIDVHKRAQGLKHFFLKKGVSISPTIP
FT                   ILNNINFSCYEGEKIAFIGSNGSGKSSLLKLIAGIYPLKSGIVKVHGNIAAIIDMGVGF
FT                   EPEQTGRENIKMLMLYNNMLDKYSKKIEKEIIDFSELGSKIDLPIKIYSSGMLSRLAFS
FT                   VSVFQNPQILLLDEIFAAGDSYFIEKSLNLMKNKFKNTPISIIVSHQEEIIKDNCDRCI
FT                   LLKDGNIIGDGTPLEMFKIYKQQSNKEIHK"
FT   gene            2067..2843
FT                   /gene="wzm"
FT                   /locus_tag="RT0004"
FT   CDS_pept        2067..2843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wzm"
FT                   /locus_tag="RT0004"
FT                   /product="O-antigen export system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03494"
FT                   /db_xref="GOA:Q68XZ8"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XZ8"
FT                   /protein_id="AAU03494.1"
FT                   /translation="MIKYFFSKKYWRAIALLVKASIIRQNKDSFLGSLWSLIQPFIHIM
FT                   VISYFFGFLLRQPREFMVMNLVGGIPLWSFIVSSLTICASSLVTRDQIIKKVRISKTFF
FT                   PIADSLGQLYTLICSFSAMYFAFILLFPEKFSWQIIFVPILILPLVICVISGSIAVAFL
FT                   TPYIRDIPQILNVILGVIYWSVPIVYPYSLIPESKKVYFEFNPFFLVIRPVQVLVINGT
FT                   LPDMMLIIKSVIVAFITVFISYLIYRQFSKRVIYYL"
FT   gene            2840..5896
FT                   /locus_tag="RT0005"
FT   CDS_pept        2840..5896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0005"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03495"
FT                   /db_xref="GOA:Q68XZ7"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XZ7"
FT                   /protein_id="AAU03495.1"
FT                   /translation="MKLGFNLDFNELDLTGLKKLDQIFLDYLFKADKSLHKDLMLFRAT
FT                   PFSIIPQDYSKFLLKISPHLDDFLAELFCISKEVTISRLKHKDFDIIYECKRKFIQRVA
FT                   VKKYPLEKIKDIDFEDVYLKITNLIGTNFTSREFAKQIVIWQQDEESFSLELDIAARYA
FT                   AYRVFSCYNSLSSWNKNLFLQNDILFNFQQKLDKTNLIDDKKILKYQKNERLDFDYKDS
FT                   FLNLDEALNNSHYCIYCHKQDKDSCSKGFGVIPHFDRVISVDSLEYKIPWLRYSMTTGC
FT                   PLKQKISEMNYIKAQGFNLAALAIIVIDNPMVAATGNRICNDCSKACIYQKKQDPVNIP
FT                   LIESNILEETLKLPYGLEIYILLTRWNPLNIYAPLPKEPTNYNILVTGLGPAGFSLSYY
FT                   LLRSGHNVTAIDGLKITPLSFNIHKPIKFWHEYKNLLSERIPKGFGGVSEYGITIRWDK
FT                   NNLDILRLILERNNNFKYYDGVALGFNITKEQALDLNFDHVAFCIGAGKPKVLNIENFE
FT                   AKGVKTASDFLMTLQSGGAFLKNSNTNMVIRMPIVIIGGGLTSLDAATESLFYYKKQVE
FT                   EFAKNYIKQDLTEEDQEIAEEFIAHAKLFKEAKNNEELKKVFNKLGGATVYYRGRLQDS
FT                   PAYKLNYEELIYTLALGVDFKENMQPLRINIDKYGHVESVEFSVTTWFDSRTHNIYHSN
FT                   MRPTVKPSGNTALIKTKTVIMAIGIENNTQFDDDKYSYFGDCNPKYFGSVVKAITSAKE
FT                   GYEAINTRLINNVPSFKGSYAYFITQLDYLLTSRINKINILNDKTFEIIIHSPLAAKNF
FT                   KFGQFFRLQNYSKDITKLIEPIALSPVDIDIEKGLISFIVYAVGKSTRLCKTLSENEKV
FT                   VLMGPTGSPLKIPKNKKIIIIDSKYRNVGLLKILKENKNKVIFATYPDIKNHKLTSVDI
FT                   VIINTSPEIAEELQKLKIFGKNTELIVNVNSSMQCMMKGICGQCVQKVKGKQKYIFACS
FT                   GQNQNAEIIDFKSLKARLRQNSLQEKMSN"
FT   gene            complement(6007..6801)
FT                   /gene="lpxA"
FT                   /locus_tag="RT0006"
FT   CDS_pept        complement(6007..6801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="RT0006"
FT                   /product="UDP-N-acetylglucosamine acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:RT0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03496"
FT                   /db_xref="GOA:Q68XZ6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XZ6"
FT                   /protein_id="AAU03496.1"
FT                   /translation="MSNSNIHTTAIIAEGAKFGKNVKVGPYCIIGPEVVLHDNVELKSH
FT                   VVIDGITEIGENTVIYPFASIGQPPQILKYANERSSTIIGSNNTIREYVTVQAGSKSGG
FT                   MITRVGNNNLFMVGVHIGHDCKIGNNLVFANYVSLAGHIKVGDYAIIGGLSAVHQYTRI
FT                   GEYSMIGGLSPVSADVIPFGLVSSKRAVLEGLNLIGMNRKGFDKVDSLTALNAVEEIFL
FT                   GKGNFADRIKQVAEKYKNNSIVTQIIDFLNQDSSRSFCHFKK"
FT   gene            complement(6811..7248)
FT                   /gene="fabZ"
FT                   /locus_tag="RT0007"
FT   CDS_pept        complement(6811..7248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="RT0007"
FT                   /product="(3R)-hydroxymyristoyl-[acyl carrier protein]
FT                   dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03497"
FT                   /db_xref="GOA:Q68XZ5"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XZ5"
FT                   /protein_id="AAU03497.1"
FT                   /translation="MIIAITEIMDLIPHRYPFLLVDRVLKIDPNKSITGIKNVTVNEPQ
FT                   FTGHFPTRPVMPGVLMVESMAQLAAILVAKSLDSTKNKEVFLMSIENTKFRRIVQPGDT
FT                   MHIHSVIDQQRANVWKFSSKVMVECEIAAESKFTAMIKDKM"
FT   gene            complement(7429..8469)
FT                   /gene="lpxD"
FT                   /locus_tag="RT0008"
FT   CDS_pept        complement(7429..8469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="RT0008"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03498"
FT                   /db_xref="GOA:Q68XZ4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XZ4"
FT                   /protein_id="AAU03498.1"
FT                   /translation="MVSSNFYKNLGPRKLTAIIDFLHDIIEPTKIHEDIDIHDIKILQE
FT                   ASPNDISFLSNPKYSEFLKTTKAAACIVPKDFTEESNQNTVLIHAENSYFAYSKLIDFF
FT                   YAPIKSYSTKIMKSAIIADSAAIGKNCYIGHNVVIEDDVIIGDNSIIDAGTFIGRGVNI
FT                   GKNARIEQHVSINYAIIGDDVVILVGAKIGQDGFGFATEKGVHNKIFHIGIVKIGNNVE
FT                   IGSNTTIDRGALQDTIIEDLCRIDNLVQIGHGVKIGKGSIIVAQAGIAGSSAIGKYCAL
FT                   GGQVGIAGHLNIGDRTQVAAQGGVAQNIEEGKIVGGSPAVPIMDWHRQSIIMKQLVKTS
FT                   NNKLKK"
FT   gene            complement(8851..8926)
FT                   /gene="tRNA-Phe"
FT                   /locus_tag="RT0009"
FT   tRNA            complement(8851..8926)
FT                   /gene="tRNA-Phe"
FT                   /locus_tag="RT0009"
FT                   /product="tRNA-Phe"
FT                   /note="codon recognized: UUC"
FT   gene            9295..10278
FT                   /locus_tag="RT0010"
FT   CDS_pept        9295..10278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0010"
FT                   /product="NifR3-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03499"
FT                   /db_xref="GOA:Q68XZ3"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XZ3"
FT                   /protein_id="AAU03499.1"
FT                   /translation="MIKIGNIELSSNVILAPMSNITDLEFRKLVKRFGAGLVVSEMIAS
FT                   RAMIMKSRQSMQKCAIMHDDPTSACVQLAGCEPDVIADAAKMNEDMGAKIIDLNFGCPA
FT                   KKVVGGYAGSALMRDERLATKIFEATVKAVKIPVTVKMRMGWDDNTKNAPTLAVIAASS
FT                   GVQMVTVHGRTRCQFYSGNANWDFIRVVKEAVKIPVIANGDITNFAKAKEALQKSGADG
FT                   IMVGRGVYGKPWLISQIAYYLKTGKEKPAPSIAEQLDIIIKHYDAIIDYYGKSVGVPIA
FT                   RKHIIWYSSGLPSSAEFRCAVNLMNDPIAVKEKIAEFYMSVMDANK"
FT   gene            10275..11348
FT                   /locus_tag="RT0011"
FT   CDS_pept        10275..11348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0011"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03500"
FT                   /db_xref="GOA:Q68XZ2"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR022437"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XZ2"
FT                   /protein_id="AAU03500.1"
FT                   /translation="MKRILSFIFIILFFNSSYTAEKAAVITDYKSVFLPVITKNKKIKI
FT                   AIRSYLKNKESYFVLVDPDSFKTEIVLQELVILPVNKIEKENMLIKLNKTAYIKALNKY
FT                   NFIDQSLRSFKQDEFSNKFTKNVIVHEHKPNSKNSYLSTFMNSTVQQNYGATSSMYKVK
FT                   GQFLTIDMCPSSKNFEEDFFKKLVELSTKLKKTIPITICVSGLWINKHTEEFLWLLKQQ
FT                   ENGYLQITWVNHSFSHPYFKDKPLENNFLLSNKEDFENEVLEVGKILVSYNIAPSPFFR
FT                   FPGLVSDQILIAKLKDFGFIPLGSNAWLAKGEKVQDGSFILVHGNSNEKAGIDLIMPML
FT                   SELKLLPIEKAFLPTNL"
FT   gene            complement(11414..11848)
FT                   /locus_tag="RT0012"
FT   CDS_pept        complement(11414..11848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0012"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03501"
FT                   /db_xref="GOA:Q68XZ1"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XZ1"
FT                   /protein_id="AAU03501.1"
FT                   /translation="MHTLNSEKETKNFAKLFAQNLKPNDIVLLNGDLGAGKTFFCREII
FT                   KHFCGKNTNIISPTFNLLQIYKTPNFNIYHYDMYRIKSPEEIYELGFEEALNGNLILIE
FT                   WSEIIKHLLTPPLIEVNLKILDNNKRLCSIKKENFLFDFL"
FT   gene            complement(11836..12741)
FT                   /gene="znuA"
FT                   /locus_tag="RT0013"
FT   CDS_pept        complement(11836..12741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="znuA"
FT                   /locus_tag="RT0013"
FT                   /product="probable zinc/manganese ABC transporter substrate
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03502"
FT                   /db_xref="GOA:Q68XZ0"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XZ0"
FT                   /protein_id="AAU03502.1"
FT                   /translation="MRTNMLTNHCKDKLKIFMKQSHTILRLLRFFKSLAMTLFFIFFSL
FT                   TSYAKPKIVVSITPISSILAMLVKDKVDIESLAVNNECPHHHNIKPSDITKVRHADIVI
FT                   YINEQFDGFTKKLISNNSQNIIKISDIKSLITIKDNWHIWLDLNNVKILLKEFAQIFIK
FT                   NFPQLQEEINNNLQTALKELNKLQDIKNNEFRTIKDIILLSDSSEYFFLNTNIKTAKLY
FT                   RESQKSLRYISKLEELIKLSNNKCIILSNKQELQLYTKLNAKTKIIILNSENWNVANIN
FT                   SNTFHDQYLQMINQVKKCIH"
FT   gene            complement(12738..13901)
FT                   /gene="pcnB"
FT                   /locus_tag="RT0014"
FT   CDS_pept        complement(12738..13901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcnB"
FT                   /locus_tag="RT0014"
FT                   /product="NTP polymerase"
FT                   /EC_number="2.7.7.19"
FT                   /db_xref="EnsemblGenomes-Gn:RT0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03503"
FT                   /db_xref="GOA:Q68XY9"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XY9"
FT                   /protein_id="AAU03503.1"
FT                   /translation="MQIIYKTLKISSKEYKKILNLLNKKGQSRLIGGCVRDALLEKDTY
FT                   DIDIATNLIPSEVINILSKANIKIIPTGLKFGTITAILNNEKFEITTLRKDIECNGRHA
FT                   KVIFTKDFAEDAARRDFTINALSYCPFKNEIYDYFNGFKDLQQAKVVFIGKAFNRIKED
FT                   YLRILRFFRFSSYYANQLDDDSFKACKALKNGLKTLSRERIKSEIDKIIVSKRVTQILE
FT                   AMFEIGILELIFSIQNYEIKFFERANNFKLELATKYSLLLYNQQNLNLKIFLDWKFSKN
FT                   EAMQILSILNFLNDDEFNIKKIWFEKKNYKEYLLAACIIGKLDYSQVKEFILKYDTLSH
FT                   PKFELNGNDLLNLNIEKKEIGAKLEYLKNFWIEHDFKPSKSELLEKL"
FT   gene            14663..18055
FT                   /gene="sca1"
FT                   /locus_tag="RT0015"
FT   CDS_pept        14663..18055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sca1"
FT                   /locus_tag="RT0015"
FT                   /product="190 kDa antigen precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RT0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03504"
FT                   /db_xref="GOA:Q68XY8"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XY8"
FT                   /protein_id="AAU03504.1"
FT                   /translation="MNKLTEQNLLKKSRFLKYSLLASISVGAVMAMPVEGIAMGIDKKA
FT                   FCTELNTKLLLKFSQSSVNKDTISTTQETNNNLSNNVQSNKSDMTEEVANVTTESLCKV
FT                   SKMQAPEFKASENKFLNTLDFQTLSQELDRNSYTTKPIPQKPEIMLTTSSTTTSMGSNS
FT                   FVNISSASSLKPVTPQQSAPDFKPNYSLGSNTPINIKELSFSSEQQQIAQHSNSTIPLM
FT                   PTTSLVLPVKKSSVEIAPEMVNNISRVDDTVSIKSSEVTEDIKGTKGKKNKKILANQFN
FT                   KSIGSWSKKTGKNKYELNKDSSKIEKFRKDLTTKNKDTDRLSAEIDISETKVSAFQAQQ
FT                   ARIDEAHRDLLNPNQQKAPGKRLEENKTKGKVIKAAVDGVQKIFNNAKKKISRTKLKKL
FT                   QDQVGNHVIIGTSTIPNPLLISKPTMQFSNKLNGTLLEDEDGYLVPCEAQPQIYTVILP
FT                   GQEIENHKSMDSDLLSLSTKTLGKEIDEVHPNIGLSSEKEIEAKLVEDETTYSQDVQNA
FT                   INILNTTNDKNTARLFGQHNNKLTLDLHDNDRKKYYETHKQLSNSIRSPKSDLTTNSSL
FT                   ASSLNIFGSNEDLSWDNAGDIGVGYRYGDEYSCPTPDDKSSSKLIDISDKNTTKVKGLE
FT                   EGITMYDSIDLVADSLKSNAVSFKERNEALKQLSTAISETVISLSESNVQEDAEDILDG
FT                   SILQAMLNSNNDKSIESLSLGSKEQEETEAGIRKAGDKQLLPVPVLLSDCKENEYLSLD
FT                   NYNKGEKNYDSDFKEEEETIEQLSNSDWYKMTKADTAILLEQEAKQEMQTQISENAPTL
FT                   NQAKVINTIVNNMIRNRLDTFINMVVVGAGDEEESNIKRGLWMRAMYGTNNHGRVNNMT
FT                   GYRGINKGATVGFDAKINNNIIGIAYSNVHSVFKFKNSKNNDKELIGSKVISIYGQKEL
FT                   QQNFTLQVLVSASKNFIKDKINYSYGDTKIRSNVKHHNHSYNAEALLNYNYLVKNSIIV
FT                   TPNIGLRYGKSRDGIYNETGINVQKIALTMKENNILSGILGTKVQVSLRDVLKFNNLGL
FT                   TFQAAVEHNFEEKTQRINRVVKIFDNIFKQDYLIPKQPKTSYNLGTGIIFGINNTNISV
FT                   DYNYYLNKHYRSHQGSVKIKVNL"
FT   gene            18164..18238
FT                   /gene="tRNA-Glu"
FT                   /locus_tag="RT0016"
FT   tRNA            18164..18238
FT                   /gene="tRNA-Glu"
FT                   /locus_tag="RT0016"
FT                   /product="tRNA-Glu"
FT                   /note="codon recognized: GAA"
FT   gene            complement(19015..19631)
FT                   /pseudo
FT                   /locus_tag="RTPG01"
FT                   /note="pseudogene of tRNA/rRNA methyltransferase"
FT   gene            complement(19633..20106)
FT                   /gene="ruvC"
FT                   /locus_tag="RT0017"
FT   CDS_pept        complement(19633..20106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvC"
FT                   /locus_tag="RT0017"
FT                   /product="Holliday junction nuclease"
FT                   /EC_number="3.1.22.4"
FT                   /db_xref="EnsemblGenomes-Gn:RT0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03505"
FT                   /db_xref="GOA:Q68XY7"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XY7"
FT                   /protein_id="AAU03505.1"
FT                   /translation="MIVLGIDPALGNLGWALVAKEYTKLKYLASGTIKTHSKDEIHNRL
FT                   AFINSTLEKVILKYQPNIAAIEETFINTNSVTSLKLGYARGAIMSLIGRYNLNMQEFKP
FT                   NTVKKTVTGYGHAKKEQILYMIKHLIPGTDLITNSDEADAVALAYTSLVTKKY"
FT   gene            complement(20165..21052)
FT                   /locus_tag="RT0018"
FT   CDS_pept        complement(20165..21052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0018"
FT                   /product="Era-like GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03506"
FT                   /db_xref="GOA:Q68XY6"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XY6"
FT                   /protein_id="AAU03506.1"
FT                   /translation="MINQIQKTISVCIIGRPNSGKSTLLNRIIGEKLSIVTPKVQTTRS
FT                   IITGIITLKDTQIILYDTPGIFEPKGMLEKAMVRCAWSSLYSADLVLSIIDSLKPLDDM
FT                   AHNILNQFCLLNIVPIFLLNKIDIESKYLNDIKAFLKISHPKSLLFPISALCGKNVDVL
FT                   LKYIKSKAKVSPWLYADDDITNLPMRFIAAEITREQLFLNLQQELPYKLTVQTEKFEEL
FT                   KDKSIKINQVIVISRESYKAIILGKNGTKIKDIGVKSRIQMEQLFCVPVHLFLFVKVHA
FT                   LWENKQEFYQYMKI"
FT   gene            complement(21045..21728)
FT                   /gene="rnc"
FT                   /locus_tag="RT0019"
FT   CDS_pept        complement(21045..21728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnc"
FT                   /locus_tag="RT0019"
FT                   /product="RNase D"
FT                   /EC_number="3.1.26.3"
FT                   /db_xref="EnsemblGenomes-Gn:RT0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03507"
FT                   /db_xref="GOA:Q68XY5"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XY5"
FT                   /protein_id="AAU03507.1"
FT                   /translation="MESFEKLETLLGYSFKNKELLIEALSHPSLRQYHEYKYDKDYERL
FT                   EFLGDAVLNLLITEILFKNFENYKEGNLAKIRSYLVCKETICIVGTKLALKDYIIMTHG
FT                   EEVAGGRDNPNNIENVTEALIAAIYLDSNIEITHNIIEKLWAEFMKVQNLTDYDPKTAL
FT                   QEWAQASSNHLPIYRLIKREGAAHSSIFTVLVKVKDYEQICTGYSIKEAEKKAARCLLH
FT                   RLKND"
FT   gene            complement(21728..22522)
FT                   /gene="lepB"
FT                   /locus_tag="RT0020"
FT   CDS_pept        complement(21728..22522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepB"
FT                   /locus_tag="RT0020"
FT                   /product="Bacterial leader peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /db_xref="EnsemblGenomes-Gn:RT0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03508"
FT                   /db_xref="GOA:Q8L2J7"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8L2J7"
FT                   /protein_id="AAU03508.1"
FT                   /translation="MNRDNTKTNKTVKQEFASFTFVICIALVIRILIMEPFTVPTGSMK
FT                   ATILENDYIFSTKYSYGYSNYSLSFFDFIPLFKGRVFAREPERGDIVVFRPPNDMSVRY
FT                   IKRLIGLPGDKIQLIDDVIYINDKKIERTEVGTYIGEDGIKYLKFKETLPNGRTYFSYK
FT                   LAPIFGIISNDRYSNTGVFYVPEGQYFFLGDNRDRSNDSRVNLGFVPFENFIGKAQFIW
FT                   FSTKITWWDNDIGIINLILKLKPWIESVRLSRIFKNLYNVDE"
FT   gene            complement(22711..23976)
FT                   /gene="nuoF"
FT                   /locus_tag="RT0021"
FT   CDS_pept        complement(22711..23976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoF"
FT                   /locus_tag="RT0021"
FT                   /product="NADH dehydrogenase (ubiquinone) subunit F"
FT                   /EC_number="1.6.5.3"
FT                   /note="Coenzyme Q reductase; Complex 1 dehydrogenase;
FT                   Complex I (NADH:Q1 oxidoreductase); Complex I (electron
FT                   transport chain).; Complex I (mitochondrial electron
FT                   transport); DPNH-coenzyme Q reductase; DPNH-ubiquinone
FT                   reductase; Ubiquinone reductase."
FT                   /db_xref="EnsemblGenomes-Gn:RT0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03509"
FT                   /db_xref="GOA:Q68XY3"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011537"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XY3"
FT                   /protein_id="AAU03509.1"
FT                   /translation="MLKEEDKIFINLYGQQSYDLKSSKKRGDWYNTKALLDKGRDFIID
FT                   EVKKSGLRGRGGAGFSTGMKWSFMPKNSEKPCYLVVNADESEPGTCKDRDILRFEPHKL
FT                   IEGCLIASFAIGANNCYIYIRGEFYNEASNMQRALDEAYTEGLIGKNACGSGFDCNIYL
FT                   HRGAGAYICGEETALLESLEGKKGMPRLKPPFPAGFGLYGCPTTINNVESIAVVPTILR
FT                   RGASWFAAIGKPNNTGTKIFCISGHVNKPCNIEEAMGIPLKELIEKYAGGVRGGWDNLK
FT                   AIIPGGASVPLLPKSLCEVEMDFDSLRTVGSGLGTGGIIVMDRSTDIIYAIARLSKFYM
FT                   HESCGQCTPCREGTGWMWRVMMRLVNGNAKKTEIETLLNVTKEIEGHTICALGDAAAWP
FT                   IQGLIRHFRDEIEERIKNFGIA"
FT   gene            complement(24146..25072)
FT                   /gene="secF"
FT                   /locus_tag="RT0022"
FT   CDS_pept        complement(24146..25072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="RT0022"
FT                   /product="protein-export membrane protein secF"
FT                   /db_xref="EnsemblGenomes-Gn:RT0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03510"
FT                   /db_xref="GOA:Q68XY2"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XY2"
FT                   /protein_id="AAU03510.1"
FT                   /translation="MQIYPLRFVPNKINFDFMNFKKVSYSFSIILSLISLIWIGIYKFN
FT                   FGIDFVGGIVIEVRLDRAPDLPKMRAVLSALGIGEVVLQNFESEHDLSIRFGSSSEENL
FT                   MKNIDIIKTSLRNNFPYNFEYRKVDFVGPQVGRHLIEAGAMAMLFSFLAIMVYIGVRFE
FT                   WYFGFGILIALVHDVILALGFMSITKLDFNLSTIAAVLTIIGYSVNDSVVIYDRIRENL
FT                   RKYHKKNITEIINLSINETLSRTILTVITTLLANLALILFGGKAIHSFSVLVFFGIIAG
FT                   TYSSIFISAPILTIFANRKFNKKVIER"
FT   gene            25145..25381
FT                   /locus_tag="RT0023"
FT   CDS_pept        25145..25381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0023"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03511"
FT                   /db_xref="InterPro:IPR018753"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XY1"
FT                   /protein_id="AAU03511.1"
FT                   /translation="MSAVVVKEQLEQYISKIERLEEEKSDLAQEVKDIFQDAASHGFDV
FT                   KAMKAILKLKKLDKNKLAEQDAMLELYRGTLGI"
FT   gene            complement(25526..25942)
FT                   /gene="rplS"
FT                   /locus_tag="RT0024"
FT   CDS_pept        complement(25526..25942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="RT0024"
FT                   /product="50S ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:RT0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03512"
FT                   /db_xref="GOA:Q68XY0"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XY0"
FT                   /protein_id="AAU03512.1"
FT                   /translation="MNIIDNFEQENISKLTANKKIPDFEAGDTVKVTVKIIDKAIEKDG
FT                   KEKLTERFQAYEGVVIAKRNRGITSSFLVRKISHGEGVERRFMTYSPIVHSIDVVKYGV
FT                   VRRAKLYYLRHRNGKAARIRERHITSAKPKAVKS"
FT   gene            complement(25959..26663)
FT                   /gene="trmD"
FT                   /locus_tag="RT0025"
FT   CDS_pept        complement(25959..26663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="RT0025"
FT                   /product="tRNA (guanine-N(1)-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RT0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03513"
FT                   /db_xref="GOA:Q68XX9"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XX9"
FT                   /protein_id="AAU03513.1"
FT                   /translation="MSILHVTILTVFPEMFPGTLGYSLAGQALHNNIWSYDIINIRDFG
FT                   LTKHKNVDDKAYGGGDGLIMRPDVLGNVIEYALSLNHNTKIYYPSPRGSVFTQSFAKEM
FT                   LKNKNIIFLCGRYEGIDERVIAEYNVKEISVGDYILSGGEIPTLTILDCLIRLLPGVLI
FT                   NQNTLSSESFEKDGEFQGGLECDLYTRPKIWHGRAVPSILLSGNRKLINNWRKEQSRMI
FT                   TKLRRPELLKDL"
FT   gene            complement(27080..28237)
FT                   /gene="ackA"
FT                   /locus_tag="RT0026"
FT   CDS_pept        complement(27080..28237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="RT0026"
FT                   /product="Acetokinase"
FT                   /EC_number="2.7.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:RT0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03514"
FT                   /db_xref="GOA:Q68XX8"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XX8"
FT                   /protein_id="AAU03514.1"
FT                   /translation="MKDVILIANAGSSSLKISIFGIQNKKVKDKIYNIFLEKNNNKILF
FT                   YINQKQESAISIKDNAIEMMINLFEEWWTKQSALNLIATGHRIVHGGKNFNKPVIVNEK
FT                   IIKELRVLIPLSPLHQPYNLQVLDLFFQKYKDISHIICFDTSFHYTNPPITKAFGLPKQ
FT                   YYDKGIMRYGFHGLSYQYVSSHFKEITMEDLPTKTIIAHLGSGSSLCAIKNGLSLTSSM
FT                   GFSVLDGVMMATRTGNLDPGVVLYLINHEKMTMKEITELLYKKSGLLGISGESSDMRTL
FT                   ITNNSHDSKFAVELFVYRIVLEIGKLIAALEGIDCIIFTAGIGQNSAVIREMISGKLSW
FT                   LGIKIDYGKNQKNEHRISTKGSKVKVFVVPTNEELIIAEEVMKFL"
FT   gene            complement(28239..29288)
FT                   /gene="pta"
FT                   /locus_tag="RT0027"
FT   CDS_pept        complement(28239..29288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pta"
FT                   /locus_tag="RT0027"
FT                   /product="Phosphoacylase"
FT                   /EC_number="2.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:RT0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03515"
FT                   /db_xref="GOA:Q68XX7"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XX7"
FT                   /protein_id="AAU03515.1"
FT                   /translation="MKKQHIINETFLDEILAQKLGTTYIPPTGIKDADFEQAAKHFINL
FT                   LLRADGLKPIKTAVVHPIDKESLLGAVRAAQFNVIKPVLIGPQHKIESVAKVNDVDLEN
FT                   YQVINAEHSHEAAKKAVELAKKREVSAIMKGALHTDELMSAVVYKENGLRTERRISHAF
FT                   LMAVATFPKPFIITDAAINIRPTLEDKRDIVQNAIDLMHMIKEDKQVRVAVLSAVETVT
FT                   SAIPTTLDAAALSKMADRGQIMNAIVDGPLAFDNAISLFAAEAKGINSPVSGNADILVA
FT                   PDLESGNLLAKQLKYLGQAVMAGIVLGARVPIILTSRADPIDMRVISCVLASFIYNQTK
FT                   AKLHIQASQ"
FT   gene            complement(29679..33143)
FT                   /locus_tag="RT0028"
FT   CDS_pept        complement(29679..33143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0028"
FT                   /product="VirB6-like protein of the type IV secretion
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:RT0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03516"
FT                   /db_xref="GOA:Q68XX6"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XX6"
FT                   /protein_id="AAU03516.1"
FT                   /translation="MKRNIFIKLLISLLLLSSCTGDTCIDPDDFGFIKFNVSSRYNPEE
FT                   ITSRHEGDQVAPWRDSAYKVNGYPLTIMVRPWNYILGDKNTSGQLSAWCPWYGQKNNTT
FT                   TLAPFCIKLQPCTFWDNTRLDMCTPNPENRNDAMISNPPCIMTDGVGLYFLIAAKNTDP
FT                   NISPDSQRKPQGITRHLGELTSSVGYEFYSISSTGQLLKAGGINYQYNGEDKSKYAQSP
FT                   LYFKIIDKFYDDNSGQYRLVIKSGVSDTRPDPLQFLTDLIKDVLFGKNGIIKKTYQQIV
FT                   DTPGYRISVSAILTLYIMFTGLSFLIGNINLTHVELIIRIFKISIISILLSSDKAWTFF
FT                   HDYLFVFFIDGVQQILQIINEAAATGPGSQSLLGLLISTQTLSKLFSLLFVDWLGFIYI
FT                   ILYLIALYFIFFLIFKATIIYLTALITIGMMIIMGPIFICFMLFNITRSLFENWLRQLI
FT                   SYALQPIILFAGIAFISMIIRTEIYSTLGFGVCKHDFPNLGPINEIFGSFLEDIDPSLS
FT                   NSIFYWWFPVPMKGGINNFHKAKILVPNDHIVVDDSCKNNHDKCKHCAAYECIDERYIE
FT                   LPFLDLVKDSTRINNFINGKFVQLDGILLIFVSIYLLSKFNDTAISTAQFIAGTSGNLT
FT                   DIQKVNQQSYESVSQQINRPLNYVAKTISTPVTSRISAGTAQANMFFAEKFENMMMRRL
FT                   EKQALSSSANKVVQNEVKRKYGIDSKDVNMNAIKDYEDGISRLLNNLPKGNELKVKELS
FT                   QMKFTQLRDKISANKYDVQDYTTLSTEQKTELDKLLKDANLRVLASDANFTKDYQEAYK
FT                   HAHQEMSGRGIGLFGKNIGVLRSWQEMEHSINVKRKLKEEKRIGIGEKIYAGYTGIKRA
FT                   ALTTIVGKDLRDAYEGNLTSAEWHDFEYNDPRLRTYSEKLKDDEKAREREKLRMHINKE
FT                   TLAVQADILSPEYLVKLEKAGRKSDVEYYQELAQRQLIYDVHSKLFEEGEPVMMGDRFM
FT                   REKATDSQMRDMIDNAHKKYVELIDVDRYTRRQEYYDIIYEKAKENLEQTYKEVQDHFK
FT                   RDNISIEEMPALIAQKVKDTNAGSEIDKKITEELNNFNADVKNYEYSTAVLNKIEDRKQ
FT                   TITDVVNVQIDKINKYRENAKMEQYVKPILNEGRKLRTLEDHFKNMK"
FT   gene            complement(33268..35928)
FT                   /locus_tag="RT0029"
FT   CDS_pept        complement(33268..35928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0029"
FT                   /product="VirB6-like protein of the type IV secretion
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:RT0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03517"
FT                   /db_xref="GOA:Q68XX5"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XX5"
FT                   /protein_id="AAU03517.1"
FT                   /translation="MKILKSLVLLVLFIVMPAKAHDTFSWMSTSFSGLKGLFGCLEVPE
FT                   FTSFQESNIGINLSKAGTWQSTGHTVEKGKLLKINWSIAGVTTEPRKYLVLYRIDPRFS
FT                   TPQVFIKTYNYSKLQFEALGFPRFVTNSNSSIPGAIPPDKELDALSFTKMSDSIKYYAR
FT                   NNVKIEVKAGDVVNISLVSKDNFFTSNTLDNILTEELDSSIFAASALYTQSNLGNFDNR
FT                   IIYASAKEVCDIIDPSRDPNKPSGCSGTGATTKYKSINSNEALVGKPMMIGAVHNFMGL
FT                   INSCPEHSGINTRPACYYDQGRGMIIKVGGQVIKGRDQSFVKSGRNSFIYYQATRNGIM
FT                   DFTSDWQVNNMFSNSVLMSDWIRRFLNYPSFIDYINKNDWSANFLYFGRYSMIVEIGNG
FT                   ANSISSDVQQNINLEYLITYDGTLPDPSIRGTPVDYNFSADAPKDGYLWLRVVNPNSNI
FT                   QGVVSVNYANYTGTTWFSDIVYNGAIKPITDQFRTFSKNFYIKLIKNSAVQNIAKGSLT
FT                   LYVIIFGLMFVAGTLKLTAIEVITRICKIAIVAFLIREESWSFFNTYFFSVFTDGIDFF
FT                   ITNVVGATSSRSNIFGFIDPIFDKYTNGRIWGLLFIELLQIHNGLAFIAIITIYSLITY
FT                   FRAILEVIIGYIIAFIGVTVMISLAPFFIILMLFEKTKSLFDNWISTLLSYVVQPTILL
FT                   IFFLLIDQVLSEQLLKVVVRACWDTLIPIKIGLDLTNLSIPINFSFTLPFLPGIPFYVP
FT                   DVPEINRSNIFNNNTNTFLVLFTTALLFYVYCLMSYGLVTFVNIVVGMLTNVTPARISG
FT                   NYQARSDPVGAVMQDIGSVTTPIKNASMVPARIFKDKIIDQNYKAKKLEGGVEFTNKFF
FT                   AKRNDVTKKEEGVRE"
FT   gene            complement(36090..39005)
FT                   /locus_tag="RT0030"
FT   CDS_pept        complement(36090..39005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0030"
FT                   /product="VirB6-like protein of the type IV secretion
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:RT0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03518"
FT                   /db_xref="GOA:Q68XX4"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XX4"
FT                   /protein_id="AAU03518.1"
FT                   /translation="MQSNLLKVLGVLAIVATLVCFIFAALGMIGAVRIGNGCYMRYSKD
FT                   GNGGADSITNTITLNANANYFNISKMLPDGTTKLIPDPNRYGEWLNTQVLVEKNQQVNL
FT                   QVVGQVSLCLAYLPKNNLQFTERTRPGKSNLDDSNQMIPIPRVQDANSPPVSLIMDAKN
FT                   NEWRNIAELYANDKVLVSVSPNFANTDATVDDVFKGVKVTKDCTQGKTSYYPICGKYSI
FT                   YSGKYVTACELKQNYWKGNVHREECYCVFGCIYQEENEQWICDAANSASHCCTSLVCDS
FT                   LPAWINHYSNMPEAYKDDGSFTFSWSDKSGNLLIDYQDLQCSNNVQIPPNGECPDIVDN
FT                   RNPKDKDYIGGVHCTSGICKDGDFQKNRKFWYTADGKGGKGPTGLIYQMNNTGSVSQAL
FT                   PSNLEFAKFVPETEQPPEYKDKNGKYLYKVIYNIPFNSNIEKSYLQYRLWSPTSQDSSK
FT                   NTGGYVLNIKQTKCYRENGNSFKDIFDDRGRVQYIIVQSSENPNTSGKTYAPQGINVDS
FT                   DGKSHFNANEAGYIWMKILNDPSNNLKDYKDSEGSYKVHFSTSLKVGSFTIKVMNPLLQ
FT                   LFKTKVQGAATSIFKNMVCYKSTDNTSCTNFFTYIKAILILYVMTYGAMFLLGFAKINQ
FT                   KELVIRIAKIGMVSGLINGNTFEFFNNYLFDAITNFSDSIIANMSGYSLFTSTNTISNP
FT                   FMFLDAIMSKIFFSQTFIAQLLSLLSLGLSGIIYFIITFIAVCIVIITTLRAIAVYIMA
FT                   FMATCILIGIAPLFISFLLFDFTRYLFDNWVRFTIRYMIEPVVMMAGIIVLTQLFTIYL
FT                   DFVLGYSVCWKCTLPIKIPFIGTILPIALLNVPIFCINWFAPWGMDYMSGMMGVNMQNI
FT                   VALVIIAYGMYGYVEFSGRMVAKLTSAAGPSATQIGDRMSHDAGQKTLSQIGMDYRTRK
FT                   GITSRAKSRLKQRNRTLEHAEQNSKKYMKKIGENTNEGTLK"
FT   gene            complement(39009..41033)
FT                   /locus_tag="RT0031"
FT   CDS_pept        complement(39009..41033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0031"
FT                   /product="VirB6-like protein of the type IV secretion
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:RT0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03519"
FT                   /db_xref="GOA:Q68XX3"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XX3"
FT                   /protein_id="AAU03519.1"
FT                   /translation="MKTLKALKIFIIVYISSVSLESFAGFGESCSNLPITSDGYLETYT
FT                   AYGYIIRSIDMKDPRGNCNPYTSSITFCFKNVEGSTSPCTIYTLNEGDARKISDLSTDN
FT                   NPNLGANTVLKNIVLTVKKFGNDLCLAMPTSRGPMPVACKSLNATPAPTNPKYENCNIG
FT                   KSCYTGANYSQSLINFSGLAVQCLSETLNKIFFTGNSCSSQDQNSRITHLAAFSTFQGY
FT                   LKRIIGAALILYTMFFAFNMALNKEYATTEKITLFIIKFLFVVYFSIGLEPLNFSGGQT
FT                   VKENGMLKYGLPLLTGAAPDFAEMIFNAAGSRGLCQFDNSKYKDGYKFYGLWDAIDCRI
FT                   GYYLGLDLLYNIDKNGILGHSVGNGPGGNNKPIPNFDPDSKKDRPHDLSKAGALRFFTV
FT                   MFGFLMSGHIIILVAGIAFSVIFLSILLYFITHYLVCMITIYVMTYISPIFIPMVLFTR
FT                   TKAYFDGWVKVCISCALQPAVVAGFIALLITMYDSAIFKNCEFLRYDYEKGDIRFSTFE
FT                   LRLPSIDADKCQESFGYKMLKYYAGEGWEEHLLILFPIKSIVRDVVSILAELLCVLVFS
FT                   VIFYYFSKSIGRFAADLTNGPNMDAVTASPTKIVDLVKKGAAFLQDASSVHAQGKSPVE
FT                   DKPDIGSKRKDGVQQGEDSENSSGGELADLASGSGGGKL"
FT   gene            complement(41020..44427)
FT                   /locus_tag="RT0032"
FT   CDS_pept        complement(41020..44427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0032"
FT                   /product="VirB6-like protein of the type IV secretion
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:RT0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03520"
FT                   /db_xref="GOA:Q68XX2"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XX2"
FT                   /protein_id="AAU03520.1"
FT                   /translation="MALFPRGILIALVLSFVLNLGLVTKIHAKDTLDSIIDILSGLTCE
FT                   TQGVGDLMRTEFSHTCIVAPFFTFAVMNLVSPVLYMNTFLKLKINDSDLFNDSNFGNFP
FT                   GGQCTRENRIDPKNPELHFALCSNAKLIVSRAKSVTESALAIAKAVLTWSDPWDDIKQA
FT                   WENKKKEYHIPYRGKPGDDGFAFDVGFPVIYWKVIQDRDRICVSTKGFTGDVPVGCKYM
FT                   KEPFPKSIYNSFIDVEDKNFIKDSTNDTPSDPLALVSCSAAGDGCYQKAYNASKTAIVM
FT                   TSPLIECIRQMIARLLISKDVCSFDNVDQVVNLASRQDSALFQFQVGMHKIVTAFLTLY
FT                   VMFFGFKLLLAGKVPPKSEYINFILKIIFVTYFSIGININPSNGSQYDRLDGMIQWVFP
FT                   FLLNGISGLANWVMNAAPSGLCKFNNISYDKSVSYIALWDALDCRVAHYLGLDILSTLL
FT                   VENSYRSHDFLNFDFFSFSAPPYIYLIIPAIISGNMMLVSLALSYPLLVISVAAFMVNA
FT                   TIMCMISIVILGILAPLFVPMFLFAYTRNYFDSWVKLMISFLLQPMVVVTFMITMFAVY
FT                   DYGFYGKCQYKSKLIHNSIEDKMQGGIKSKRDVLIFYINNDWDDTSQYPDKDSVESCKN
FT                   SLGYMLNNPINTAFNFAKDNISEIVNSKPGETTTDEFLSKFQFLSGVVLGPGMFFMSPK
FT                   VLFEKIKNIFLALITACFTLYLMYNFSSQLAEFAADMTEGVALNNVAIKPQAIFKAAMA
FT                   ALANAGTATKGIDQIASRGGGGGARDLIGAKGLVSDNIASSGGAVGDNIASSGGAVGDN
FT                   IAVSGAASTPTVTTTTASSSIANSMTKTIGDDVRSDIVTPHASTTAVPQHSSINTTIPT
FT                   SVSPNIKSTSLKEIIRDNQENEKEIDNTTRAQEKIKSSSKVSGLIDYSFNLKEHDNPTG
FT                   IKQIRENAEIRDKRVEVEKAWNELVASGGGRIRDQQSEETSEQRTNAEKKWNEFVDSGV
FT                   VTEIREIDNSVNNKLADKLDKSEKSKIEENKNIENNIKVYNTNTLPQEKVNNTDKSSGL
FT                   IDYSFNLKEHDNPTGVKQIRENAEIRDKRVKVEKAWNELVASGGGRVKEQAGGKITERR
FT                   ANAEKVWDDLVKSGVVKEKKDNSSNENS"
FT   gene            complement(44546..46963)
FT                   /gene="virB4a"
FT                   /locus_tag="RT0033"
FT   CDS_pept        complement(44546..46963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB4a"
FT                   /locus_tag="RT0033"
FT                   /product="VirB4 protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RT0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03521"
FT                   /db_xref="GOA:Q68XX1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004346"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XX1"
FT                   /protein_id="AAU03521.1"
FT                   /translation="MKLFRTRTAKELRSKQERPTSHFIPYRCHWDSNTILTKDNSLLQV
FT                   IKINGFSFETADDEDLDIKKNIRNALLKNMASGNIVMYFHTIRRRKAVIFDDTEFTYDP
FT                   TVKVPNDFITYLGAEWRKKHAGAKSFFNELYISILYKPDTGGAAIVEYFLKKLRQKSNK
FT                   TAWENDMKEMKENLQEMSTRVINTFRSYGAKLLGVRQTQSGIYCEILEFLSSLINCGDS
FT                   PGPIALPRGTIDEYLPTHRLFFDSRTIEVRSPFGKKYAGIISILEYGPNTSAGIFDGFL
FT                   QMPFEFVMTQSFVFANRTVAIGKMKLQQNRMIQSGDKATSQIVEINTALDMATSGDIGF
FT                   GDHHLSLLCSAKNIKALEDILSMAAVELSNSGIQPVREKVNMEPSYWGQLPGNMDYIVR
FT                   KSTINTLNMASFASQHNYPLGKIRDNHWGEYVTVLDTTSGTPFYFNFHVRDVGHTLIIG
FT                   PTGAGKTVLMNFLCAEAQKFKPRMFFFDKDRGAEIFIRALNGVYTVIDPGLKCNFNPLH
FT                   LEDTSENRTFILEWLRVLVTSNGESLTAQDNKILSQAVSGNFRLEKKDRRLSNVIAFLG
FT                   IDTPNSLASRIAMWVGKGSHAKIFDNEIDDIDLQRARVFGFDMTELLKDPVSLAPVLLY
FT                   IFHRINISLDGQKTMIVLDEAWALIDNPVFAPKIKDWLKVLRKLNTFVIFATQSVEDAA
FT                   KSSISDTLIQQTATQIFLPNLKATDIYRSAFMLSQREYILIKTTDPTTRYFLIKQGIDA
FT                   VVAKVNLEGMDNIISVLSGRVETVILLDQIRDKYGNDPDKWLPIFYEAVKTL"
FT   gene            complement(47136..47423)
FT                   /gene="virB3"
FT                   /locus_tag="RT0034"
FT   CDS_pept        complement(47136..47423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB3"
FT                   /locus_tag="RT0034"
FT                   /product="probable type IV secretory system protein VirB3"
FT                   /db_xref="EnsemblGenomes-Gn:RT0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03522"
FT                   /db_xref="GOA:Q68XX0"
FT                   /db_xref="InterPro:IPR007792"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XX0"
FT                   /protein_id="AAU03522.1"
FT                   /translation="MSGTLASDLLFVGLTRPPMIFGVSIKFAALNMIMTMIVFIWNNGI
FT                   MILFIAGALHLVAYIICFKEPRFIELYLNKMSRTSQCPNKFYYGANSYNI"
FT   gene            complement(47435..48207)
FT                   /pseudo
FT                   /locus_tag="RTPG02"
FT                   /note="pseudogene of acetylglutamate kinase"
FT   gene            complement(48098..48742)
FT                   /gene="engB"
FT                   /locus_tag="RT0035"
FT   CDS_pept        complement(48098..48742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engB"
FT                   /locus_tag="RT0035"
FT                   /product="probable GTP-binding protein EngB"
FT                   /db_xref="EnsemblGenomes-Gn:RT0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03523"
FT                   /db_xref="GOA:Q68XW9"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XW9"
FT                   /protein_id="AAU03523.1"
FT                   /translation="MINNGKALNNKKSSDYSKLFRHQAKFVAGANHINQIPDFSLPEIV
FT                   FVGKSNVGKSSIINTICNNKSLAKVSNIPGRTRQINFFNIIDKLIIVDLPGYGFANVPI
FT                   SVKEQWEVLITYYLRNSHNLMLVNLLIDSRRGIKENDKKVAELLLANKREFQIIFTKSD
FT                   KVTDRKNLNYEAQNFLATLHYSCNVIYVSSRSKEGTKELKASLAKCIKYQR"
FT   gene            complement(49021..49097)
FT                   /gene="tRNA-fMet"
FT                   /locus_tag="RT0036"
FT   tRNA            complement(49021..49097)
FT                   /gene="tRNA-fMet"
FT                   /locus_tag="RT0036"
FT                   /product="tRNA-Met"
FT                   /note="codon recognized: AUG; fMet"
FT   gene            complement(49208..49444)
FT                   /gene="rpmE"
FT                   /locus_tag="RT0037"
FT   CDS_pept        complement(49208..49444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="RT0037"
FT                   /product="50S ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:RT0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03524"
FT                   /db_xref="GOA:Q68XW8"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XW8"
FT                   /protein_id="AAU03524.1"
FT                   /translation="MKNGIHPEYKKLLIKVGSNIFETMSTHPIGEILMDVDFRKHPAWN
FT                   KDSGNVVNQSNKSVSDFNKRFSGLSFDSKKEAS"
FT   gene            complement(49441..49734)
FT                   /gene="rpmB"
FT                   /locus_tag="RT0038"
FT   CDS_pept        complement(49441..49734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="RT0038"
FT                   /product="50S ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:RT0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03525"
FT                   /db_xref="GOA:Q68XW7"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XW7"
FT                   /protein_id="AAU03525.1"
FT                   /translation="MSRKCELTGVSVLYGNNVSHSQRKTRRRFEPNLRSVKFRSDITDE
FT                   VYRLSVNARCIRSVEKAGGFDEYILKANNDVLSSTARAIKQKIIDIKAVESL"
FT   gene            complement(51017..51268)
FT                   /locus_tag="RT0039"
FT   CDS_pept        complement(51017..51268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0039"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03526"
FT                   /db_xref="GOA:Q68XW6"
FT                   /db_xref="InterPro:IPR035116"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XW6"
FT                   /protein_id="AAU03526.1"
FT                   /translation="MFKNLLLSIIIFLGINQNVYSINSSSYKTDDIIKIVIILGIVALI
FT                   FSPAKLRIIVIGTILGLACAYFTYKYIVPIFIASLNGA"
FT   gene            complement(51270..52028)
FT                   /gene="mkl"
FT                   /locus_tag="RT0040"
FT   CDS_pept        complement(51270..52028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mkl"
FT                   /locus_tag="RT0040"
FT                   /product="ribonucleotide ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03527"
FT                   /db_xref="GOA:Q68XW5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XW5"
FT                   /protein_id="AAU03527.1"
FT                   /translation="MSTKEEFKIKIRSLYKSFANHKVLDGIDLDVKKGSSLVILGASGS
FT                   GKSVLIKNIVGLIKPDKGQIFIDNLEIQDISNKLKFEIMKGVGFLFQGGALFDSLNVRD
FT                   NITFDTKKLSKKEKNDLAGAKLNSVGLSTRILELYPSELSGGMQKRVALARAICNTPSI
FT                   LFLDEPTTGLDPIMANVINELIIKIQEELCATTITITHDMISTEKIAKEIAMIYHGKVQ
FT                   WYGSKEEMRNSDNPYLKQFINGLTTGPIEV"
FT   gene            complement(52034..52813)
FT                   /locus_tag="RT0041"
FT   CDS_pept        complement(52034..52813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0041"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03528"
FT                   /db_xref="GOA:Q68XW4"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XW4"
FT                   /protein_id="AAU03528.1"
FT                   /translation="MLLNIANLVGKHTIKFAQSVGIFALFSFIAISSIIKPPLYLSLIM
FT                   RQLLFIGFHSLPVVAMTTFFSGAVLALQSYTGFSRFSAENSIATVVVLSLTRELGPVLA
FT                   GLIVAGRVGASIAAEIATMKVTEQVDALYTLSTDPIKYLVCPRVIAAIITMPCLVLIGD
FT                   VIGVMGGYLVGIYKLNFNSTAYLTSTFQYLELIDVISGLVKATVFGFIISIISCYSGYY
FT                   SGKGAKGVGRATTSAVVNSSILILISNYLITELLFKV"
FT   gene            complement(52970..54178)
FT                   /gene="alr"
FT                   /locus_tag="RT0042"
FT   CDS_pept        complement(52970..54178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="RT0042"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RT0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03529"
FT                   /db_xref="GOA:Q68XW3"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XW3"
FT                   /protein_id="AAU03529.1"
FT                   /translation="MSLCTLEINLSAIKNNYRLLQDICTTALVGAAVKANGYGIGAMQI
FT                   AKALIEENCQYFFVATSEEGINLRKALNNDITILVLNGVFTHDALELIQYNLTPVLNNL
FT                   KQIEIWQKFSNLKEKILPCYLHFNTGLNRFGLNYDEIEQLINDRDLLKGLDLQYIISHL
FT                   AASEEMDNPYNLAQLNRFKDYLEYFPNVKASLANSGGIFLGQDYHFDLARPGAALYGLN
FT                   SLIEVSYNLSYKEKFERNTPALATTVCINKCADVNTRLTYKVPLKGSYRLQNPVTLKAP
FT                   IIHLQNLTLDSHIGYNMTFTTKRDSIIATLPLGYADGFSRNFSNQGEVFINSRSVPIVG
FT                   RVSMDLINIDVTDLPPSEVFLGQEVEIIGNYCTPDKIASIIGTVGYEVLTSLGSRYKRK
FT                   YIS"
FT   gene            complement(54956..55555)
FT                   /locus_tag="RT0043"
FT   CDS_pept        complement(54956..55555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0043"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03530"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XW2"
FT                   /protein_id="AAU03530.1"
FT                   /translation="MQKIITGLFLLAITFSSYSTEKVPSGLHDYITNLVKDASSILNDS
FT                   KLSEHVKISKARELMSQNLDFEWMAKYTLGRNGIRTLSGLQIQEFIKVYSKYVTKSYTD
FT                   LIKDYKGEHPKIVGVRPLSSTDFLVAMNIISNKEQDPIKVEYLVREMKGNGKGFFKISD
FT                   IITEGVSLIGAQQDEFTDTLKNQGFEVLIKKLANHS"
FT   gene            complement(55575..56330)
FT                   /gene="vacJ"
FT                   /locus_tag="RT0044"
FT   CDS_pept        complement(55575..56330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vacJ"
FT                   /locus_tag="RT0044"
FT                   /product="lipoprotein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RT0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03531"
FT                   /db_xref="GOA:Q68XW1"
FT                   /db_xref="InterPro:IPR007428"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XW1"
FT                   /protein_id="AAU03531.1"
FT                   /translation="MRILIILSIILCSFFARADLEYIDNDIYNYNGGRNENGCLEVYDP
FT                   YEKFNRKVFAFNSVLDHIILRPLAVGYKNITNDYIKARVNSFVSNVYTPLTAVNYGLQL
FT                   NYDKTIKSVWRFLINTTLGIGGLFDVASKVGLQSDRQTFGSTLAHYGVAPGPYLVLPII
FT                   GSTNARDMTDSVITNYAINPLMYYTHNDFDLGILAISKITDRYVVLPFSDYVMKNSTDP
FT                   YVAIRSALHRTREASVQYPENFKCPKPKN"
FT   gene            complement(56335..57345)
FT                   /locus_tag="RT0045"
FT   CDS_pept        complement(56335..57345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0045"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03532"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XW0"
FT                   /protein_id="AAU03532.1"
FT                   /translation="MVVLNKIKYIIKHYYLTIINIPHFIKNQIVEFRNYINDCKYKLSH
FT                   LAETNYQLGFDHLYKGNLNDALFRFKLVNKFFKSNDSKVYYQLGLIYYLKNNYRQATVY
FT                   LEKSNEKYKTIFINFFKNYKYITEIPQEIWEKYRDLIAQYYPTIFNNRKNIHLPYRFVN
FT                   ETLKHISDLSDNYSILELGSNIGLVGYEVQKRFPENFTLTGVEISSCMNDIQATYYQNT
FT                   KIYNHIYNIAIDEFLKQNSSKFDIILSFCGLSFTNNLIKYFNLIYSCLKQQGYFALCLP
FT                   NAVKTQFSVKRKEFIFNLNEVNNFLQKNNFTILTSDEIILAENNKYSIIVCKKIT"
FT   gene            57571..58770
FT                   /gene="aatA"
FT                   /locus_tag="RT0046"
FT   CDS_pept        57571..58770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aatA"
FT                   /locus_tag="RT0046"
FT                   /product="Aspartate aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RT0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03533"
FT                   /db_xref="GOA:Q68XV9"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XV9"
FT                   /protein_id="AAU03533.1"
FT                   /translation="MSIISTRLNSIKPSPTLAVVKKTLELKKAGVNIIALGAGEPDFDT
FT                   PDNIKEVAITSIKDGFTKYTNVDGIPLLKQAIKNKFKRENNIDYELDEIIVSTGGKQVI
FT                   YNLFMASLDKGDEVIIPVPYWVSYPDMVALSTGTPIFVNCGIENNFKLTVEALERSITD
FT                   KTKWLIINSPSNPTGAGYNCKELENIAKTLRKYPNVNIMSDDIYEHITFDDFKFYTLAQ
FT                   IAPDLKERIFTVNGVSKAYSMTGWRIGYGAGSKALIKAMTVIQSQSTSNPCSISQMAAI
FT                   EALNGTQDYIKPNALNFQKKRDLALSILEKVIYFECYKPEGAFYLFVKCDKIFGTKTKS
FT                   GKIIANSNHFSEYLLEEAKVAVVPGVAFGLDGYFRISYATSMQELKEACIRIKQACNTL
FT                   "
FT   gene            58889..59545
FT                   /locus_tag="RT0047"
FT   CDS_pept        58889..59545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0047"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03534"
FT                   /db_xref="GOA:Q68XV8"
FT                   /db_xref="InterPro:IPR007172"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XV8"
FT                   /protein_id="AAU03534.1"
FT                   /translation="MRKALKKFLKNSKCLLSIITILLYWYLRFVYFTSRQKFIFYDNRN
FT                   KEKFLNEQGVIFAFWHNMLALSPVMFTGHRNIYALISPHLDGKILNAIVGKFGCQVIVG
FT                   STNKNSIVALRNIIGKLSQGANIIVTPDGPKGPVYKVNSGITEIAYRYNKKLIPIVSST
FT                   SRYFRLKSWDKLIIPIPFGTIKIIVGSPLALVADKVKNHINLEKQLKSLTESLKK"
FT   gene            59542..60930
FT                   /gene="waaA"
FT                   /locus_tag="RT0048"
FT   CDS_pept        59542..60930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="waaA"
FT                   /locus_tag="RT0048"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /EC_number="2.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03535"
FT                   /db_xref="GOA:Q68XV7"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XV7"
FT                   /protein_id="AAU03535.1"
FT                   /translation="MMLLYYILSFILLPVYFIIIFIRLLIGKEDIRRIQERFAIGKQRQ
FT                   NSLLDLQMSVNQEGFKVDTEHKATSYVYIHRNASLMYKLSLERSYAQSLVWIHAASVGE
FT                   VMTSLTLIHNICKLAPNVRFLITSWTNTSAKILSTKLPKIATHQFLPIDNVIFTRKFLS
FT                   NWKPDLGIFIESELWPCIINEGAKHCKLLLVNARISNKSFKTWLKRKKFFQLIIKNFSK
FT                   IIVQSECDLQKFNALGISDAMNLGNIKFANEKLLVNQEKLSKLSLHLDNRRVVVFASTH
FT                   PEDEEVILPIINNLKEQFVDCYIILIPRHPERVKSILNNCKCHNLLATAKSQNDLPVLS
FT                   DDIYIVDRFGEMGLFFSVATISFIGGSFKQGGHNILEAAYFSNCIIFGPDMSKNTDIAK
FT                   GILQNNAAIQIKNGEDLLNTLKSLLNANNALKLKAYRENALKFVEHNQKILDEYLHVIK
FT                   PFLP"
FT   gene            complement(61590..61776)
FT                   /pseudo
FT                   /locus_tag="RTPG03"
FT                   /note="pseudogene of RP088"
FT   gene            complement(62040..62969)
FT                   /gene="tsf"
FT                   /locus_tag="RT0049"
FT   CDS_pept        complement(62040..62969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="RT0049"
FT                   /product="elongation factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:RT0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03536"
FT                   /db_xref="GOA:Q68XV6"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XV6"
FT                   /protein_id="AAU03536.1"
FT                   /translation="MSEINISAAAVKELREKTGAGMMDCKKALIETSGNFEEAIDFLRK
FT                   KGLAAAVKKFGRIASEGLTAIKINGLTSVVIEVNSETDFVARNEQFQNLVKDIVNLAII
FT                   AQNIDALKISKMQSGKSVEEEIIENIATIGENLTLRRMDILEISNGAIGSYVHNEVVPH
FT                   LGKISVLVGLESNAKDKAKLAALAKQIAVHVAGNNPQSIDTLSLDQALVERERKVFFEK
FT                   SKEEGKPDHIIEKMVEGRIRKFFSEVVLLQQNFLFEPKLTVAEVIKNAEQELGAEIKIT
FT                   KFIRYALGEGIEHEEKNFADEVASITKC"
FT   gene            complement(63126..64013)
FT                   /gene="rpsB"
FT                   /locus_tag="RT0050"
FT   CDS_pept        complement(63126..64013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="RT0050"
FT                   /product="30S ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:RT0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03537"
FT                   /db_xref="GOA:Q68XV5"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XV5"
FT                   /protein_id="AAU03537.1"
FT                   /translation="MSKISPINIKELLDAGVHFGHKTSRWNPKMASYIYGERDDVHIID
FT                   LRQSAALMSVALNAIYETVKKDGKILFVSTKIQASDIIAEYAEKCGQYYVNNRWLGGML
FT                   TNWKTIACSIEKLEKLEKTLESEETRVCYTKKEILDMSRKKDKLLLSLAGIRNLNSKPD
FT                   LLVVIDTNKEHIAINEAVKLNIPIVAVVDTNSNPDNINYPIPGNDDSIRSIRLYCSLFA
FT                   DAALQGLEESMKVSGVDIGTMQEHTDKALTSKTISKLKQTKKFSKTQNIDEETNTEFDQ
FT                   ALSDACENKNSDNT"
FT   gene            complement(64418..65791)
FT                   /gene="cysS"
FT                   /locus_tag="RT0051"
FT   CDS_pept        complement(64418..65791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="RT0051"
FT                   /product="Cysteine translase"
FT                   /EC_number="6.1.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:RT0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03538"
FT                   /db_xref="GOA:Q68XV4"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XV4"
FT                   /protein_id="AAU03538.1"
FT                   /translation="MQLHLYNTLTRTKEVFNPQDHANVKMYVCGPTVYDNPHIGNSRSV
FT                   VVYDLLYRIIIKIFGKKAVKYVRNITDIDDKIIDRAESLGININDLTNKVTREFHINMA
FT                   YLGCMLPSIEPKATEHIDVMIEIIERLIAQDHAYITDNHVYFDVLSAPNYTELSNRNLE
FT                   EMFEGVRIENSKTKKNPQDFVLWKPAKQNEPKNVNFSSPWGLGRPGWHIECSAMSYKYL
FT                   GENFDIHGGGADLIFPHHTNEIAQSRCAFPSSTYAKYWIHNGFLTVNGEKMSKSLGNFI
FT                   TVRDLMDKQIQGEVVRLFLLSSHYRRPLDYNDKAIDDAKKTLDYWYRAIKEINVQKVDL
FT                   PSDFMQSLFDDMNTPLAIKIINDYAKGVFISKTEAERKFNASAIITCANFIGLMRKTQY
FT                   EWFNNDIDKLYINELINKRLKAKKQKNWLLADKIRNQLLEKKIILEDKSDCTTIWRKE"
FT   gene            68152..72603
FT                   /gene="sca2"
FT                   /locus_tag="RT0052"
FT   CDS_pept        68152..72603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sca2"
FT                   /locus_tag="RT0052"
FT                   /product="190 kDa antigen precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RT0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03539"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XV3"
FT                   /protein_id="AAU03539.1"
FT                   /translation="MTITGKLKSVLLTYSFIILINLLTAMSESLASSWNPPPPPPPPPI
FT                   EGLNNFKSLNPPSKHSLGNSSKVEQSQHTNKNCTTSNIQMQFSQSLEVPTPTGEFGKKY
FT                   SKLINPKTSKQNLKIEFPKKIISLVRDELTLKYFTADIERILTLFSKKDDLILSEAKEK
FT                   YKEVIQDPYIAQFTNKNQNTGSFLENKLFEETREEAILRLLSLEQLDAQMKKEILSKQG
FT                   DILEQLKFINANTEILGSYGQTASTDILKKIPKELPKILSKQGDILEQLKFINANTEIL
FT                   NEHSKAILKDKLKELSKQLDEISSNQLVGFILDENKINTNLKNVHFSEKKVRETVSNLN
FT                   NKILEKIFLKDDGTITEQDLTKILQKHQETVLIKNLTKAIVYIDGNKNNATVNKTLEKC
FT                   LEQTTPEQQELILDVLTHNTRIRTVLITKIEREQRQNHNKKLNKNIAGDSFVDALKKAL
FT                   VHRTSNSETILKVVEQRKQETPKNLNVWDRISQNIPNLNNQNVQDENNKEWDESNKNAD
FT                   DLNNTNIYMITKHDLERAVNETITKFSAMSTLLKDKKNAGAYQRYLKEAEDQLALAQEK
FT                   GKELIKNSAQTFKIIPKKYQDDINENWQNYLSPAEMIELTALNEHTNTLKSNKNKSGHF
FT                   RSSEEALQYKAKQHEYYTLLAELKKIGIAKQQEKLVKDYVDEMITNAKQAVEKFERTSL
FT                   EHINQKKENKQISKEILDAQERLENAKQKIEFIKFKYIISNKRQVNSSDEDSDDDADKN
FT                   AIKQKTELENAQKDINQAKKNLEDAKAKYAALQITLNYSPNGMDSKTTEDQEQFKTDNI
FT                   AAESLEDMAVMFKDSEEAAERKEEVTLNYSPNGMDSKTTEDQEQFKTDNIAAESLEDMA
FT                   VMFKDSEEAAERKEEVTLNYSPNGMDSKTTEDQEQFKTDNIAAESLEDMAVMFKDSEEA
FT                   AERKEEVTLDYSPNGMDSKTTEDQEQFKTDNIAAESLEDMAVMFKDSEEAAERKEEVTL
FT                   DYSPNGMDSKTTEDQEQFKTDNIAAESLEDMAVMFKDSEEAAERKEEVTLNYSPNGMDS
FT                   KTTEDQEQFKTDNIAAESLEDMAVMFKDSEEAAEQKEEVNRQHHEEQNRQKQEHNCLDT
FT                   EEEVVHKEKIADLTAETETKVFKKEIALEENEAMDVSFKTETIVEQDEAIQRQQVSDDT
FT                   SRKVAILVKATSTLHKPVHHNILSDRLKVTVIGAGDEKTNINRGLWISGLYGVNKQGSW
FT                   KNIPKYQGRTTGFTIGADAEFINNHDVIGIAYSNLESKIKYNKKLGKTAVYGHLLSIYG
FT                   LKELIPGFSLHTIVSYGYNYIKNKSKNLDKIIGKYQNNNLSFQTLLNYKYCTKYNLHFI
FT                   PSIGFKYDYSRASNYKEYNIDIENLMIQKKSNQSFESSIGGKIVSKPIIITNNTILTLS
FT                   VHGNIERHFNNKNTKVNAKATFKKQTLQETIIIPKQPKFGYNIGNNILMSIKNINVLYE
FT                   YNYYTHKKYHSHQGLIKLKINL"
FT   gene            complement(73210..73512)
FT                   /gene="secG"
FT                   /locus_tag="RT0053"
FT   CDS_pept        complement(73210..73512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="RT0053"
FT                   /product="protein-export membrane protein SecG"
FT                   /db_xref="EnsemblGenomes-Gn:RT0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03540"
FT                   /db_xref="GOA:Q68XV2"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XV2"
FT                   /protein_id="AAU03540.1"
FT                   /translation="MLDILLFVHITISILLIIVILMQRSGSGGISGISGDNNMGVVSAK
FT                   TVGNFLSKSTIILTTLFLINAIILANLSSKKKSNLVSKINEIEENQTDNSLPIAK"
FT   gene            complement(73530..73604)
FT                   /gene="tRNA-Thr"
FT                   /locus_tag="RT0054"
FT   tRNA            complement(73530..73604)
FT                   /gene="tRNA-Thr"
FT                   /locus_tag="RT0054"
FT                   /product="tRNA-Thr"
FT                   /note="codon recognized: ACC"
FT   gene            complement(73744..75000)
FT                   /gene="proP1"
FT                   /locus_tag="RT0055"
FT   CDS_pept        complement(73744..75000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proP1"
FT                   /locus_tag="RT0055"
FT                   /product="proline/betaine transporter ProP1"
FT                   /db_xref="EnsemblGenomes-Gn:RT0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03541"
FT                   /db_xref="GOA:Q68XV1"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XV1"
FT                   /protein_id="AAU03541.1"
FT                   /translation="MNRSKLVFSSSIANTFEWYDYVLFSYFAPIIGAKFFPNDDVNTSL
FT                   LHVFSVFAIGYLARPLGGIFFGVIGDRFGRKVALTSALFCMSAPTVLIGMLPTYNTIGI
FT                   TATIVMICVRILQGLSMGGALTGSISFVIEHTNHKYRGLICSISMSSICSGLLFGSIVF
FT                   YIVKNILTAAQFDNFGWRIPFLIGFFIIFAAFYIKKNTHETPSFKHIRDQQQILQSPLR
FT                   KVVINHWFDILISIFINAPGSIIFYLATIYLVSFFKIIRNFTENEVNNLASICYVIMII
FT                   VTLLSGYLSDIIGRKKIFLINLIIIIVTTPFLLRNFENGDFTSVIISQFILTILAASYI
FT                   GPEPALQAEFYPTNIRNTALSISYNTATSIFGGTTPLIFEYLVQKTGHVTFTVFYVILS
FT                   CIFALFALSFYKNRSLDKI"
FT   gene            complement(74987..75871)
FT                   /locus_tag="RT0056"
FT   CDS_pept        complement(74987..75871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0056"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03542"
FT                   /db_xref="GOA:Q68XV0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XV0"
FT                   /protein_id="AAU03542.1"
FT                   /translation="MNDALKTYLKGICWFLLSLVTSSVNDVISKYLGTRLHSFEVAFFR
FT                   FLFSSIVLLPFVVYYGKSTLKTRHPVIHVLRGLLLFFGMTSWTYGLTIAPVTTATVISF
FT                   SIPLFTLILAVFILNENIIWQRWVVTVVGFIGLVVMLKPHTKDFNPEILYLILAAISFA
FT                   MLDIINKKFVVKESMLSMLFYSAIVTAIVSLPVSMEYWITPSSFELTLLFVLGSSGSFI
FT                   LFFLLKAFTMVDATATAPYRYLELVISAIAAYFIFNEFPDKSTAHGAVIIIPATLFIMY
FT                   SEKKSMSSKHESQ"
FT   gene            76015..76737
FT                   /locus_tag="RT0057"
FT   CDS_pept        76015..76737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0057"
FT                   /product="OmpW-like outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03543"
FT                   /db_xref="GOA:Q68XU9"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XU9"
FT                   /protein_id="AAU03543.1"
FT                   /translation="MLKKLCVILFISSITINSHAKNMYDNVDTATSYDSTYYENEGSLV
FT                   FKMRLGGIFASAKQKGLPTHSSVQPVSVGEIAKNGYGGDASTTIFFNNYLAAELSLGFN
FT                   VLRTKYTSLAAVAHNYGINNVKLGKHKPIYMIPATLTGQFHIAPYGGIRPYIGIGYHGS
FT                   YMLTQATGLKIRNGYNAVGQIGVDFYAKDDTLINIDVRQFFLKPKLEYKSNLVGNKKVT
FT                   SKVKLNPLIVSIGIGFTF"
FT   gene            76866..78263
FT                   /gene="pntB"
FT                   /locus_tag="RT0058"
FT   CDS_pept        76866..78263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntB"
FT                   /locus_tag="RT0058"
FT                   /product="Nicotinamide nucleotide transhydrogenase"
FT                   /EC_number="1.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RT0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03544"
FT                   /db_xref="GOA:Q68XU8"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XU8"
FT                   /protein_id="AAU03544.1"
FT                   /translation="MSLQIIQLLYLLSAVCFILSLKFLSSQKQARLGSSIGILGMVIAV
FT                   GVTFCLPDFTHKLQIITTILVGGIIGGIIALKISMTVIPQLVACFHSFVGLAAVFVSYA
FT                   TVLAPENFSIGISGSLPINSLIEMSIGVSIGALTFSGSIVAFLKLQGLIKSNQFKFYGQ
FT                   QYICLFAAIILVIIVVSFIRSENICLFNLIVLLSLLSGVLLIIPVGSADMPVIVSMLNS
FT                   YSGFAAAGIGFTLSNSLLIITGSLIGSSGAILSYIMCKAMNRSLIKVIFGAFLPQPTGI
FT                   NKDIFDDKIAKISSPEDAAHLLLNASSVIIVPGYGMAVAQSQHSIKEMVDILERSDINV
FT                   RFAIHPVAGRMPGHMNVLLAEANIDYEKVLELDEINRDFAITDVVLVIGANDVTNPSAK
FT                   NDPNSPIYGMPILDVEKARTILFIKRSMSSGYAGIENELFYHNKTFMLFGDAKKVVDEI
FT                   VKFLNED"
FT   gene            78320..78880
FT                   /locus_tag="RT0059"
FT   CDS_pept        78320..78880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0059"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03545"
FT                   /db_xref="InterPro:IPR010421"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XU7"
FT                   /protein_id="AAU03545.1"
FT                   /translation="MNSQKTLPLLPRATAIWLIENTSLTFKQIADFCGIHEFEIKGMAD
FT                   GEVAQSIKGLNPIANGQLTLEEIERCSKDPNTNLQISYSPADELMQNQKKHRAKYIPIA
FT                   RRQDKPDAIYWLLSNYPNIQDHQIIKLIGTTKATIDAIRTRNHWNMHSIRPRDPVLLGI
FT                   CSQIDLNKIVENIKLPQNSIKES"
FT   gene            complement(79064..79882)
FT                   /locus_tag="RT0060"
FT   CDS_pept        complement(79064..79882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03546"
FT                   /db_xref="GOA:Q68XU6"
FT                   /db_xref="InterPro:IPR016428"
FT                   /db_xref="InterPro:IPR029139"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XU6"
FT                   /protein_id="AAU03546.1"
FT                   /translation="MPLSTSLLGKKSTYKDSYDATLLFKIPRINNRNVLGINNNLPFYG
FT                   VDIWNTYEISCLNKNGKPLVGIGTFYIPADSENIVESKSFKLYLNSFNNFIVKSIEELE
FT                   QIILQDLSNVTCAKVTGRIFPINTKIEFGIPSGKNIDNLDIVCNNYGPPDNSLIEYEDV
FT                   LVEEEIHSNLLKSNCLVTGQPDWGTIVIKYKGKKLKYDSFLRYLISFRNCNEFAEQCAE
FT                   RIFIDIKNAINLDFLSIYIVYTRRGGIDICPYRSTDKSYALPSNKRFIRQ"
FT   gene            complement(79886..80599)
FT                   /gene="czcR"
FT                   /locus_tag="RT0061"
FT   CDS_pept        complement(79886..80599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcR"
FT                   /locus_tag="RT0061"
FT                   /product="transcriptional activator protein CzcR"
FT                   /db_xref="EnsemblGenomes-Gn:RT0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03547"
FT                   /db_xref="GOA:Q68XU5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XU5"
FT                   /protein_id="AAU03547.1"
FT                   /translation="MKVLLIEDESEMANLIEITLASEGIVCDKASVGVEGLRLGKIGIY
FT                   DLVILDLMLPDINGFEILLRLRAAKIKTPILILSSLTDTDQKITSFSSGADDYLTKPFV
FT                   REELIARIKAIVRRSKGHAASVFRFDKVSVNLDTRSVEVDGKKIHLTNKEYSILELLII
FT                   RRGTILTKEMFLNHLYSSVDEPEMKIIDVFICKLRKKLSDAAGGRDYIDTVWGRGYMLK
FT                   EYDELQQKELLAQGA"
FT   gene            complement(80782..81240)
FT                   /gene="secB"
FT                   /locus_tag="RT0062"
FT   CDS_pept        complement(80782..81240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="RT0062"
FT                   /product="protein-export protein SecB"
FT                   /db_xref="EnsemblGenomes-Gn:RT0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03548"
FT                   /db_xref="GOA:Q68XU4"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XU4"
FT                   /protein_id="AAU03548.1"
FT                   /translation="MSTINSDTSEAMPHISVNAQYIKDLSLENPSAPSSLAALDQRPQI
FT                   DLSLDINITNLSDENFYEVELNIEAIARNEKYKLFQIELKYAGVFNLINIDSEQHPILL
FT                   SVHCPAMIFPFARKIIASCTQDAGFQPLMIDPIDFGALYHKKMSEHQN"
FT   gene            complement(81429..81995)
FT                   /gene="dcd"
FT                   /locus_tag="RT0063"
FT   CDS_pept        complement(81429..81995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcd"
FT                   /locus_tag="RT0063"
FT                   /product="Deoxycytidine triphosphate deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:RT0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03549"
FT                   /db_xref="GOA:Q68XU3"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XU3"
FT                   /protein_id="AAU03549.1"
FT                   /translation="MTIMSDKWIKDAVIKQSMIRPFAEKQVRVHNKEKIISYGLSSYGY
FT                   DARVSNEFKIFTNINSTTVDPKNFSEDNLVDREVDECIIPPNSFALGRTIEYFKIPRDV
FT                   LVICVGKSTYARCGIIVNVTPLEPEWEGHVTLEFSNTTPLPAKIYANEGACQFLFLKSD
FT                   QICDTSYAERQGKYMKQVGVTLPLT"
FT   gene            82266..83588
FT                   /locus_tag="RT0064"
FT   CDS_pept        82266..83588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0064"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03550"
FT                   /db_xref="GOA:Q68XU2"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XU2"
FT                   /protein_id="AAU03550.1"
FT                   /translation="MKKLLLAASIIYFASVSLAEEKTTPFISNSDTKIKLEGFYLFESG
FT                   YIKQDHLILFDKNVTDNRKKLGFDTEVAFAATITKTIDDVIAGAKIVLQPTTKAKTTAS
FT                   YNGSHIFIETSYGKVELGSPVDASAQLRVTGNKVTAGTGGWYRYALLDGQYMRYNALKP
FT                   DFDTSVNFYLESYSNSFDQVNEKTEKARRLNFFTPKMKGFQAGISYTPDTANTGGNKNI
FT                   NNLTLQSSGRNGISASRTGIKTLSIANGEIMTINQNIRDAFSAGLTYEHAISEDADLKL
FT                   SMTGEYGKPARRLIHAKVDGTTKAIEVLNTYKLSNLKAYNLGAVFTYGNFSCGASYGNL
FT                   GKSLTAKEYYKVGRNTYYYNGAVAYGQGPIKTSLAYLKTSRYKNTVNAVSLATEYKIMP
FT                   GLLPYAEISHFQAKGKPVYYPEAPSKTTRGTVGLIGTKLKF"
FT   gene            complement(84353..86566)
FT                   /gene="parC"
FT                   /locus_tag="RT0065"
FT   CDS_pept        complement(84353..86566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parC"
FT                   /locus_tag="RT0065"
FT                   /product="DNA topoisomerase IV subunit A"
FT                   /EC_number="5.99.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03551"
FT                   /db_xref="GOA:Q68XU1"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XU1"
FT                   /protein_id="AAU03551.1"
FT                   /translation="MKEAKIENIDFGNALSERYLAYALSTIMSRSLPDVRDGLKPVHRR
FT                   LLYAMLQLRLEPNSGYKKCARVVGDVIGKYHPHGDVAVYDTLVRLAQHFSLRYPLIDGQ
FT                   GNFGSIDGDNAAAMRYTESRMTEICMLLMKDIDKDTVDFRSTYDDSDLEPVIMPASFPN
FT                   LLANGSEGIAVGMATNIPPHNLHELCDALLYLIDNPQAGVNDIMNFIKGPDFPTGGIII
FT                   DQTKVINAAYTTGRGSFRVRSRWEKEELSYGTYQIVVTEIPYQVQKSKLIEQIAILLKD
FT                   KKIPLISSIRDESTDIIRLVIEPRDRSCDPQIVMESLFKLTNLESRIQLNMNVIGSNNV
FT                   PRVMNIVEILQEFLVHRQNIITRRSTYLLNKIKQRLEILKVLKIVYLNLDEIIEIIRRE
FT                   DEPKTIIMERFKISEIQVEVILNTRLRALQKLEEHAIIDEHSNLQKQQAILEKILKNHK
FT                   ELWKIVKKEIKSVQTQFGLNTIIGARRTSFEEVDLTNQVIDITAFITKEPITIICSKMG
FT                   WIRLLKGHNTDLSTIKYKEGDAEKFIIEAYTTDKILIISSKGRFFTLLADNISKGKGTA
FT                   VSIKLLVDIGNNDITNILVYKPYQLLLLASSIGKGFLVNSNEVIAQTKAGKQIMNIPEG
FT                   YACITCLPVNGNSIACINESRRLLIFNINEIPEMKKGQGVVLQRFKNAKLLDIKIFNKE
FT                   DGLSWNDGKKIQLEKNIVAFLGKRGSAGTLPPIGFPKNNRFSS"
FT   gene            complement(86701..87348)
FT                   /locus_tag="RT0066"
FT   CDS_pept        complement(86701..87348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0066"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03552"
FT                   /db_xref="GOA:Q68XU0"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XU0"
FT                   /protein_id="AAU03552.1"
FT                   /translation="MINNILCLICISGIYFGYQYYQNSKPVITIYPDDIPPKIRPSIIE
FT                   NNQITSVYSNIYNLIAKDTNIQTVKLLPDPEKPIIIDSSNQSQNDKTFDGMSNLMPLIE
FT                   SNNKNATDLNIIKLAKGIKNKVGNAQNCRSHTSYKVQLGSVKSEAEAMEEGAKIKKKFP
FT                   KILQNVVITTKKVKYDDGKFYYLILAGEYSSLNQAQAVCKKLAHNQQSCVLK"
FT   gene            complement(87419..89149)
FT                   /gene="argS"
FT                   /locus_tag="RT0067"
FT   CDS_pept        complement(87419..89149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="RT0067"
FT                   /product="Arginine translase"
FT                   /EC_number="6.1.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:RT0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03553"
FT                   /db_xref="GOA:Q68XT9"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XT9"
FT                   /protein_id="AAU03553.1"
FT                   /translation="MNIFNQLKQDIIAASQQLYNNQEIANTATIETPKDSFNGDLSSNI
FT                   AMIIASKESIAPREVALKFKEVLVTLPYIASIEIAGPGFINFTIKAESWQAAIKDILQH
FT                   EEKFFEIDIDKNSNINIEYVSANPTGPMHIGHARGAVYGDVLARILQKVGYSVTKEYYV
FT                   NDAGSQINDLVSTVLLRYKEALGEQITIPIGLYPGEYLIPLGEILSKEYGNKLLTMNDV
FT                   ERFKIIKSLAVEKMLDLNRKDLADLGIKHDIFFSEQSLYDKGEIEKTVKLLESMGLIYE
FT                   GTLPAPKGKVHEDWKHKVQKLFKSTNYGDSQDRPIEKADGSWSYFASDLAYAKDKIDRG
FT                   ANHLIYVLGADHSGYVKRIEAIVKALGQEKVKVDVKICQLVNFVENGVPVKMSKRLGSF
FT                   ASVQDVNKKVGKDIIRFMMLTRQNDKPLDFDLVKVKEQSRENPIFYVQYAHVRTKSILS
FT                   KARELMPEAYNSFKEGKYNLSLLSTEEEIEIIKLLAAWTKTLEASVKYFEPHRIAFYLI
FT                   NLASKFHSMWNFGKENSDYRFIIENNQELTLARLALASVIQKVIASGLEVIGVEPMVTM
FT                   "
FT   gene            complement(89158..90312)
FT                   /gene="dgtP"
FT                   /locus_tag="RT0068"
FT   CDS_pept        complement(89158..90312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgtP"
FT                   /locus_tag="RT0068"
FT                   /product="Deoxy-GTPase"
FT                   /EC_number="3.1.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:RT0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03554"
FT                   /db_xref="GOA:Q68XT8"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023023"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XT8"
FT                   /protein_id="AAU03554.1"
FT                   /translation="MLASYASDPLKSRGRLYKEIPTYYRNEFERDRDRIIHTNAFRRLQ
FT                   YKTQVFINHEEGDHYRNRLTHSLEVATVARSVANTLNLSSDLAETIALAHDLGHTPFGH
FT                   VGEKALNECMKEYNGFSHNSQSLKILTLLEKRYAAYNGVNLTWEVLEGIVKHNGPILGA
FT                   INEYVAEYNKQNDLELNTYASAEAQIASLADDISYISHDLEDSIIAKIIDFNNLAELQY
FT                   IDNYVFKLKSKFKDISPSCLIYEIVRKLIHELITDLLLQTKENLKKEKITNINEIRNLH
FT                   YQIVDFTEKTNERINETKKFLHKRVYESNKMIAISIKCTKIVQGLFKIYMDDINLLPTN
FT                   WKILIDSNETYSKARVIADYIAGMTDRFAIQEYNQLCAPKFNKI"
FT   gene            90567..90899
FT                   /gene="iscA1"
FT                   /locus_tag="RT0069"
FT   CDS_pept        90567..90899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iscA1"
FT                   /locus_tag="RT0069"
FT                   /product="iron-binding protein IscA/HesB"
FT                   /db_xref="EnsemblGenomes-Gn:RT0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03555"
FT                   /db_xref="GOA:Q68XT7"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XT7"
FT                   /protein_id="AAU03555.1"
FT                   /translation="MTITITDRAFERIYELIELAQDKNLVLRVSVDSGGCSGLMYNYEL
FT                   VSKDNIEQDDYVFTKHNATIIIDAISQKFMLDCTLDFIEELGSSYFNVSNPHAKAKCGC
FT                   GNSFSV"
FT   gene            complement(92301..93125)
FT                   /gene="kdsA"
FT                   /locus_tag="RT0070"
FT   CDS_pept        complement(92301..93125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdsA"
FT                   /locus_tag="RT0070"
FT                   /product="3-deoxy-8-phosphooctulonate synthase"
FT                   /EC_number="2.5.1.55"
FT                   /note="(pyruvate-phosphorylating);
FT                   2-dehydro-3-deoxy-D-octonate-8-phosphate
FT                   D-arabinose-5-phosphate-lyase;
FT                   2-dehydro-3-deoxy-phosphooctonate aldolase;
FT                   2-keto-3-deoxy-8-phosphooctonic synthetase;
FT                   3-deoxy-D-manno-octulosonate-8-phosphate synthase;
FT                   3-deoxy-D-manno-octulosonic acid 8-phosphate synthetase;
FT                   3-deoxy-D-mannooctulosonate-8-phosphate synthetase;
FT                   3-deoxyoctulosonic 8-phosphate synthetase; KDO-8-P
FT                   synthase; KDO-8-phosphate synthetase; KDOP synthase;
FT                   Phospho-2-keto-3-deoxyoctonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:RT0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03556"
FT                   /db_xref="GOA:Q68XT6"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XT6"
FT                   /protein_id="AAU03556.1"
FT                   /translation="MKKVVKLNNIKIGNDLQFVLIAGPCQIEDEDHALFMAEKLIQLTS
FT                   KLSIPFIYKSSFDKANRTSINGIRGLGIEKGLEILSKVKSEFNCPIITDVHSESQCTDT
FT                   AKVVDILQIPAFLCRQTDLLKAAAKTGKIVKVKKGQFLAPWDMKNVQTKLEAFGAKDIL
FT                   FTERGSCFGYNNLISDMRSLAIMSELNVPVVFDATHSVQQPGGRGGSSGGERKYVELLA
FT                   KAAISVGIAGIYMEVHQDPDNAPSDGPCMIKLDHLESILIKLKKYDKITKEE"
FT   gene            complement(93161..93472)
FT                   /locus_tag="RT0071"
FT   CDS_pept        complement(93161..93472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0071"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03557"
FT                   /db_xref="GOA:Q68XT5"
FT                   /db_xref="InterPro:IPR022718"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XT5"
FT                   /protein_id="AAU03557.1"
FT                   /translation="MSLTQILLSLFVVILVIKPHDLFLIIKKFKTIKAFVIRSFFINTI
FT                   DESLETEQINFYLKRIINLEGYYYGNYDLTTIKEKYYTLIVNNAFIEKESVHDIIEKH"
FT   gene            complement(93475..95142)
FT                   /locus_tag="RT0072"
FT   CDS_pept        complement(93475..95142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0072"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03558"
FT                   /db_xref="GOA:Q68XT4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XT4"
FT                   /protein_id="AAU03558.1"
FT                   /translation="MSYQYVYEMVGLSKIINGKQILKETNLSFLPKAKIGIIGPNGAGK
FT                   STLLKIMAGIDKEFEGKATAKIGTKIGYLPQEPYLDSTKNVFDNIIEGLHEKTKLIDEF
FT                   NDISNKFTDKITDEEMQMLFDKQAELQEKIDNCNGWNLEREIEIAMLALRCPPKAAEIN
FT                   KISGGEKRRVALCKLLLEKPDMLLLDEPTNHLDAESVSWLEDYLKSYEGTVIVITHDRY
FT                   FLDNVTEWILEIDRGNCIPWKSNYSSWLEQKQKKLALESKEDDARKKQLNRELEWIRQT
FT                   PKARQSKNKARITAYQELLNKQQEHKIDLTQIIIPNGPRLGDLVIEAEHIAKKFNNKIL
FT                   LSDFSFKVPRGAIVGIIGPNGAGKSTLFNIITGKVMPDSGAIKIGQTVKLGYVDQLRDH
FT                   LDDNKTIWEEISEGLDELHLGNRIIKSRAYCAAFNFRGSDQQKKVGQLSGGERNRVHLA
FT                   KLLKEGANVILLDEPSNDLDIDTLRALEDAILDFAGCVLVISHDRWFLDRIATHIISYD
FT                   KENNATWFEGNYQDYHKYMLSTNGENILTPKYKHKKLI"
FT   gene            complement(95319..96179)
FT                   /gene="parB"
FT                   /locus_tag="RT0073"
FT   CDS_pept        complement(95319..96179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="RT0073"
FT                   /product="chromosome partitioning protein ParB (Spo0J
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:RT0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03559"
FT                   /db_xref="GOA:Q68XT3"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XT3"
FT                   /protein_id="AAU03559.1"
FT                   /translation="MVKNKGLGRGLSSLLGEEVLPIKSEIVQIINIDKIKPNENQPRKH
FT                   FEYNKIKELADSILNNGLLQPIIVDNNFQIIAGERRWRACKLAQVLEIPVIIKNFDTRE
FT                   SMETALIENIQRTDLTVMEEARGFKYLVDNFNYTVEKLAERLGKSRSHIANLLRLNNLP
FT                   QSIQDKLNENILSMGHARCLINHEYAEEIANHIINHDLNVRQTEALVRQWHKNEYKKST
FT                   NNTNKVGKLCFKDNIIDNDLELLVKALSKKFGIKITIDNCNLGGKLMFHYKDLEELDLI
FT                   LSKLN"
FT   gene            complement(96166..96933)
FT                   /gene="parA"
FT                   /locus_tag="RT0074"
FT   CDS_pept        complement(96166..96933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="RT0074"
FT                   /product="chromosome partitioning protein ParA (Soj
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:RT0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03560"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XT2"
FT                   /protein_id="AAU03560.1"
FT                   /translation="MKIIAIVNQKGGVAKTTTTVNLATAFASVNKKILVIDLDPQGNSS
FT                   TGFGIIQQQRKNTIYQVLTNLIELKDAIISTNIPNLEIITSNTNLSAAELDLTTLKDRE
FT                   YILMKLLEEVKILYDYIIIDCPPSLNLLTVNALVASDEVLIPMQCDFYSLEGLSNLLKT
FT                   IEIVEKKLNPKIKIAGILFTMYDKRNRLTEQVEDDVRKCLGELVFKTVIPRNIKLSEAP
FT                   SYGKPAILYDYKCAGAMAYIELTKEILERYGKK"
FT   gene            complement(96930..97505)
FT                   /gene="gidB"
FT                   /locus_tag="RT0075"
FT   CDS_pept        complement(96930..97505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="RT0075"
FT                   /product="glucose inhibited division protein B"
FT                   /EC_number="2.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03561"
FT                   /db_xref="GOA:Q68XT1"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XT1"
FT                   /protein_id="AAU03561.1"
FT                   /translation="MEVPSEIIQKLDILQNLIKKWNKSINLISDNTIPNFWQRHILDSL
FT                   QLMQYISNKEIHLVDIGSGAGFPGIVLSIAGVAKVSLIEADLRKCIFLEKASKISNNSI
FT                   QIINQRIEKIEIDCNILTCRAFSNLNTIFNCTQNISVREKFLLLKGKNYLTEIVKAKEK
FT                   WLFDYLIHQSITCRSGKILEVNNLTKII"
FT   gene            complement(97489..99354)
FT                   /gene="gidA"
FT                   /locus_tag="RT0076"
FT   CDS_pept        complement(97489..99354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="RT0076"
FT                   /product="glucose inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:RT0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03562"
FT                   /db_xref="GOA:Q68XT0"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XT0"
FT                   /protein_id="AAU03562.1"
FT                   /translation="MLKYGVIIIGGGHAGVEAAAASARLGVHTLLITLKPENLGEMSCN
FT                   PAIGGIAKGTLVKEIDALDGLMGFVIDKAGIHYKMLNETRGPAVWGPRAQADRKLYKKV
FT                   MYQILTNYRNLDILYGKVEDIQIKSSKVEAVILNNGIKIFCQKVVLTTGTFLSGFIHIG
FT                   SMKIPAGRIYEEPSYGLSNTLKRLGFKIARLKTGTPPRIDGRTIDYSKTTLQQGDQIPR
FT                   PFSELTDAIDVPQINCFITKTTAETHDIIRENLDKSAMYSGQIKGIGPRYCPSIEDKIV
FT                   KFSTKLEHRIFLEPEGLEDYTIYPNGISTSLPKEIQYKLIKTIPGLENAQVLRPGYAIE
FT                   YDYVDPREINITLETKKITGLYFAGQINGTTGYEEAAGQGIIAGINAALSVKDQEPFIL
FT                   TRATSYIGVMIDDLTTSGTVEPYRMFTSRSEYRLSLRADNADLRLTELGINIGVVTEKR
FT                   KNIFTKKCNNIEKTKLLLNKLSLTTSKLAKIGIQVAQDGKYKTVLDLFKIPTFNVEQAI
FT                   KIFPILRKQNNNILQLLYIEAKYASYLTRQYADINLFQSEEIQLIPKNIDYFKIPSISL
FT                   EIQEKLSYHKPTTIGVARRISGITPAAIMAIIIYLKTKYSDGSSK"
FT   gene            complement(99358..99780)
FT                   /gene="ndk"
FT                   /locus_tag="RT0077"
FT   CDS_pept        complement(99358..99780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="RT0077"
FT                   /product="NDK"
FT                   /EC_number="2.7.4.6"
FT                   /db_xref="EnsemblGenomes-Gn:RT0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03563"
FT                   /db_xref="GOA:Q68XS9"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XS9"
FT                   /protein_id="AAU03563.1"
FT                   /translation="MTIQYTFSMIKPDVIKRNKIGQVNTYLENAGLKIVAQKMKFLTKY
FT                   EAECFYDEHRARPFFNSLVEYITSGAVVLQVLKGEDAITLNRIIMGATNPAEAKEGTIR
FT                   KDLGESIEANSIHGSDSENSAKREIKFFFSKSEIIE"
FT   gene            complement(99919..101208)
FT                   /gene="glpT"
FT                   /locus_tag="RT0078"
FT   CDS_pept        complement(99919..101208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpT"
FT                   /locus_tag="RT0078"
FT                   /product="glycerol-3-phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RT0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03564"
FT                   /db_xref="GOA:Q68XS8"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XS8"
FT                   /protein_id="AAU03564.1"
FT                   /translation="MTNIESKIKTPRSPYAKKYNSWRIRILYSIVIGYATFYFCRQNFN
FT                   IATPAIREYFGVTKTQIGWILTAASIMYGVSKACNGFISDKVNARVFMVLGLLFVGIIT
FT                   ILIGFSDFLWLIGILWIASNWFQSMGWPPATKMLTHWFAAKELGTKWAIGATSNQLGGA
FT                   LAMISCGYLIDKFDWRAAFFVPGLVACVASLFLYNRLRNSPKEVGLSTVEEYKEYPPEA
FT                   IGNYERLLTTQLLKMVFCNKLIWYVCLANMFVYIIRSGVIYWAPTFLRDLCNISFVNAG
FT                   LQIGLYEMIGIPGALIAGILSDKLFQGRRGPIASICMILLTLLLVLFWKVPIQSELLSI
FT                   VILSLIGFFVSGPQLLVGIAAADFSTRQAVGTANGLSGLFGYLGAAIAGVGVGWISDNY
FT                   GWNGVFIFFSISALLGGGLFALTWNHSAKK"
FT   gene            complement(101278..102774)
FT                   /gene="tlcA"
FT                   /locus_tag="RT0079"
FT   CDS_pept        complement(101278..102774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlcA"
FT                   /locus_tag="RT0079"
FT                   /product="ADP/ATP carrier protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:RT0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03565"
FT                   /db_xref="GOA:Q68XS7"
FT                   /db_xref="InterPro:IPR004667"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XS7"
FT                   /protein_id="AAU03565.1"
FT                   /translation="MSTSKSENYLSELRKIIWPIEQHENKKFLPLAFMMFCILLNYSTL
FT                   RSIKDGFVVTDIGTESISFLKTYIVLPSAVIAMVIYVKLCDILKQENIFYVITSFFLGY
FT                   FALFAFVLYPYPDLVHPDHKTIESLSLAYPNFKWFIKIVGKWSFASFYTIAELWGTMML
FT                   SLLFWQFANQITKITEAKRFYSMFGLLANLALPVTSVVIGYFLHEKTQIVSEHLKFIPL
FT                   FVIMITSSFLIILTYRWMNKNVLTDPRLYDPTLVKEKKAKAKLSFIESFKMIFTSKYVG
FT                   YIALLIIAYGVSVNLVEGVWKSKVKELYPTKEAYTIYMGQFQFYQGWVAIAFMLIGSNI
FT                   LRKVSWLTAAMITPLMMFITGAAFFSFIFFDSVIAMNLTGILASSPLTLAVMFGMIQNV
FT                   LSKGVKYSLFDATKNMAYIPLDKDLRVKGQAAVEVIGGRLGKSGGAIIQSTFFILFPAF
FT                   GFIEATPYFASIFFIIVILWIFAVKGLNKEYQVLVNKNEN"
FT   gene            103201..103580
FT                   /pseudo
FT                   /locus_tag="RTPG04"
FT                   /note="pseudogene of RP052"
FT   gene            104846..105241
FT                   /locus_tag="RT0080"
FT   CDS_pept        104846..105241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0080"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03566"
FT                   /db_xref="GOA:Q68XS6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XS6"
FT                   /protein_id="AAU03566.1"
FT                   /translation="MLKKIIFGIIIPLLSTGCFANSTTSNFSKKDVAKTNDVSTQKIID
FT                   DFSAYAGTIKPEVREEIQKYRVEIVDINKKKRELYNKLSKEAQNFLAEQQKYKQKLSIP
FT                   KLLTENHPNNNANANANSKDNNDKDME"
FT   gene            complement(105249..105804)
FT                   /pseudo
FT                   /locus_tag="RTPG05"
FT                   /note="pseudogene of RP050/RC0076"
FT   gene            complement(105814..106350)
FT                   /gene="pgsA"
FT                   /locus_tag="RT0081"
FT   CDS_pept        complement(105814..106350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgsA"
FT                   /locus_tag="RT0081"
FT                   /product="3-phosphatidyl-1prime-glycerol-3prime-phosphate
FT                   synthase"
FT                   /EC_number="2.7.8.5"
FT                   /db_xref="EnsemblGenomes-Gn:RT0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03567"
FT                   /db_xref="GOA:Q68XS5"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XS5"
FT                   /protein_id="AAU03567.1"
FT                   /translation="MKNLPNYLTIARIMVIPVIILLFYINNSLARKLGALLFVLASITD
FT                   FFDGYIARKYNLVTSFGKMFDPIADKLLVGCVTIMLLKKDNVDEIPCLLILAREFLVSG
FT                   LREFLALVKVSVPVSRLAKLKTFLQMFALSILILGSKGSGIIYLDIVGEIILWIAAFLT
FT                   IITGYSYFKACKTYF"
FT   gene            complement(106350..108026)
FT                   /gene="yidC"
FT                   /locus_tag="RT0082"
FT   CDS_pept        complement(106350..108026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yidC"
FT                   /locus_tag="RT0082"
FT                   /product="60 kDa inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03568"
FT                   /db_xref="GOA:Q68XS4"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XS4"
FT                   /protein_id="AAU03568.1"
FT                   /translation="MNNNIINLIAAIVLSLSIIFGWQYFVIKPEQKKQQQRMAIYKSEN
FT                   LKKQKALAEHTSNITVQEAGQVQRIKIESESLTGSIALKGLRFDDLILKKYKQDLSQNS
FT                   PAVRLFSPANTENAYFAEIGLVSNLSSVKLPNSNTVWNSDSEVLSPEKPVNLFWVNEDG
FT                   IKFLVTITVDKNYLFTIEQTIINNSDKELPVQAYGLINRKYIAVEKAVNILHQGPIGCI
FT                   DENLKEYSYDDIKDQKSAKFALSKVDWIGIADKYWLSSLIPDKSSSYSANFNYALKQGA
FT                   ERYQVDFISPVQVIKPGKNLSIKSRIFAGAKKVDLLDEYEKSYDIKLFDRAIDFGWFYI
FT                   ITKPVFYAMNFFYGYVGNFGVSILIVTVIIKLLMFTLANKSYRSMKKMKNLQPEIDRIK
FT                   NLYNNDKARLNQEIMALYKKSKVNPVAGCLPILVQIPVFFSIYKVLYVTIEMRHAPFYG
FT                   WIKDLSSPDPTTIFNLFGLLPFAPPSFLMIGAWPILMAITMFLHQKMSPELADPIQAQV
FT                   MKFMPLIFLFMFSSFPVGLLIYWSWNNILSIIQQYYINKFN"
FT   gene            complement(108196..109362)
FT                   /locus_tag="RT0083"
FT   CDS_pept        complement(108196..109362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0083"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03569"
FT                   /db_xref="GOA:Q68XS3"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR030192"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XS3"
FT                   /protein_id="AAU03569.1"
FT                   /translation="MQYLMDLYHTSSTELVLLLVMLASLMPVIFLIKRLIFIPIKNYLT
FT                   RHHYDDSERILKKYPIFRYLLHTLLAFYFLCWSNIFHPTSFKAHVLLGIKDTVVILYTS
FT                   ISVTMLLLTLIDAFADLYHNKIKNITKNAPLSLYFQILKIIVIVIAVIITISYILNISL
FT                   SKFLTSLGAAAALLTFVFKDTVLGLLASLQLTTQKIINIGDLVRVGEIEGIVEKITISV
FT                   VTIRNSDQSISTVPTYSLLNSNVTNYRGITESGARRIKRVFNINMATINFCDTTLLKEL
FT                   KKSPYISKDVIDKITLDKEEQDLTNIKLFKLYIQEYLKNNPKVYTEGFTFLVRQLEPTI
FT                   TGLPIEIYIFVKEMNLVNYEHIQDNISEHLISILPEFKLKIFQNVGVV"
FT   gene            109598..110377
FT                   /gene="lgt"
FT                   /locus_tag="RT0084"
FT   CDS_pept        109598..110377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="RT0084"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:RT0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03570"
FT                   /db_xref="GOA:Q68XS2"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XS2"
FT                   /protein_id="AAU03570.1"
FT                   /translation="MILPNINPIIFSIGPFSISWYSLSYVVGILLGWFYATKIIEKFKP
FT                   EITKKHIEDFITYAIIGIIVGGRLGYVLLYNPLKYFANPIEILKTYEGGMSFHGATIGI
FT                   IISAYLFCQKYKINFLSLTDIITTVVPIGLFLGRIANFINCELYGRITNSSFGIIFPNS
FT                   DLEPRHPSQLYEAFFEGLILFCILAYAVFRHDTLKKQGLNSGIYLIFYSLFRIIIEMFR
FT                   EPDIQIGFILDSLTMGQILSAPMLLLGSYLICRLNSK"
FT   gene            110356..111432
FT                   /locus_tag="RT0085"
FT   CDS_pept        110356..111432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0085"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03571"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XS1"
FT                   /protein_id="AAU03571.1"
FT                   /translation="MSVEFKIRQLIDQHGYITCDVLMQEVLSLHPNAYYKQVKSLASEG
FT                   DFVTAPEISQLFGEIIGLWCIREWQRIGCPKSLSLVELGPGRGLLMRDLLRTAKLVPEF
FT                   YNSLSITLIEINKNFIAHQKSNLQDINLPIKHLEFIEEIPQKPTIIITNEFFDTMPIKQ
FT                   YIKVKELWYERIFSVQPVDGSIKYDKISINKRLQEYLLRTHIAAKDGAVLEESYKSIEI
FT                   IKFIAEHLKKVSGSCLIIDYGYDIAPYNRTRYQYNPTLQAVRKHKYCPILENLGEADLS
FT                   AHVDFYSLKTVAKNSKINVIDTISQRNFLIQNGILLRKQALKEKLNDEQVLIIEKQVER
FT                   LILPKQMGKLFKVLQIMH"
FT   gene            complement(111886..112671)
FT                   /gene="sdhB"
FT                   /locus_tag="RT0086"
FT   CDS_pept        complement(111886..112671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="RT0086"
FT                   /product="Fumarate dehydrogenase"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:RT0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03572"
FT                   /db_xref="GOA:Q68XS0"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XS0"
FT                   /protein_id="AAU03572.1"
FT                   /translation="MVELRLPSNSVVKKGRVHKAQQEMLKPRKVQVYRYDPDLNKNPTI
FT                   DSFEIDLSKTGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNIDGTNTLACIKPI
FT                   EDISGDIKIYPLPHMKVVKDLVPDMSHFYTQYESIEPWLKNDNPAPSNSERLQSIQDRE
FT                   KLDGLYECILCACCSTSCPSYWWNSDKYLGPAILLQAYRWIADSRDDNTGARLEALEDP
FT                   FKLYRCHTIMNCTKTCPKGLNPAKAIGRVKSLIAERHGV"
FT   gene            complement(112910..114823)
FT                   /gene="ftsH"
FT                   /locus_tag="RT0087"
FT   CDS_pept        complement(112910..114823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="RT0087"
FT                   /product="cell division protein FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:RT0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03573"
FT                   /db_xref="GOA:Q68XR9"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XR9"
FT                   /protein_id="AAU03573.1"
FT                   /translation="MNNQGRSILAWAALFIFVILLFNVFQSDGLLGVRNNITFSDFLTR
FT                   VDERTINSVKIQGRVIEGTSNDGSTFSTYSPDYPDLVNRLTSNDVNIEVVPLETRMNTF
FT                   LGFLISWFPMLLLIGVWVFFMRQMHGGGKAMGFGKSKARLLSDKGPKITFKDVAGIDEA
FT                   KEELTEIVDFLRDPSKFQKLGGKIPKGCLLIGPPGTGKTLLAKAIAGEANVPFFSISGS
FT                   DFVEMFVGVGASRVRDMFEQGKRNAPCIIFIDEIDAVGRHRGIGMGGGNDEREQTLNQM
FT                   LVEMDGFEANEGVVIIAATNRPDVLDRALLRPGRFDRQIAVANPDINGREQILKVHLKK
FT                   IKYNSTVLARIIARGTPGFSGAELANLVNEAALIAARLGKKEVDMHDMEEAKDKVLMGV
FT                   VRRSIAMSEKEKRLTAYHEGGHALVGLYCPAASPIHKATIIPRGNALGMVQRLPETDEY
FT                   SQNREQMESSIAVYMAGRVAEEIIFGKNKVTSGAASDIKGATNIARAMVTKAGLSDLIG
FT                   PIFHGSSSDDMYGRQQSNEISEATAKLIDAEVKKIITQGYEFAKDILTKHIDQLHTLAN
FT                   ALIEYETLSGQQIKNLLSGRALDSEEENKFPFNDAHTIKIDKEKLHEKTKTTKAQKENI
FT                   AS"
FT   gene            complement(114874..116166)
FT                   /gene="mesJ"
FT                   /locus_tag="RT0088"
FT   CDS_pept        complement(114874..116166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mesJ"
FT                   /locus_tag="RT0088"
FT                   /product="probable cell cycle ATPase MesJ"
FT                   /db_xref="EnsemblGenomes-Gn:RT0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03574"
FT                   /db_xref="GOA:Q68XR8"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XR8"
FT                   /protein_id="AAU03574.1"
FT                   /translation="MLYEKFEYNINNLVGNFGLSKIAIAVSGGSDSVALLYLANIWAEK
FT                   NNIELFIISVDHNLRAQSKQENYYIQSISNNLKRKYYNLSFDHQNNFSNLQARAREGRY
FT                   DLMTNLCLELDVLVLLTAHHEDDYVENFCLRLERNSGIFGLSSSNIHWYNNIQIIRPLY
FT                   NIPKSELVKYLVTNKIKWFEDESNLSDKYRRNIIRQKLFKEENYIKAEISVQQLKTNKL
FT                   IEDELKPELISAIGEAVKIFEYGFTFLDLVKFDKFSNEVKVQIINFLLIMISGQSRSAR
FT                   FYSIAPILKLISQNVNFKKTVHGCVITRIQNELLIYREFGKKLPKSKILLDKSVIWDNR
FT                   FCITKNQETPDCVITYLSLEDYKVIKKQLDLKHLKNLSCKNHNAILFTLPIIKILEKVI
FT                   AIPHISYYDNDMWNFEVSFAPNFVSRFTHFC"
FT   gene            complement(116339..116854)
FT                   /gene="rplI"
FT                   /locus_tag="RT0089"
FT   CDS_pept        complement(116339..116854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="RT0089"
FT                   /product="50S ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:RT0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03575"
FT                   /db_xref="GOA:Q68XR7"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XR7"
FT                   /protein_id="AAU03575.1"
FT                   /translation="MEIILIKPVRKLGKIGDILKVANGFGRNYLLPQKLAIRATKSNKE
FT                   LIVKQKHEFEAKDKQIRAEVEKINTLIKDQQLVFIRQTSDDCKLFGSVTNKDIADKLSK
FT                   NISYNISHSNVILDKQIKSTGIYTVEIRLHAELTAIVTVIVARSDSEAQDYLREQKTEN
FT                   SADLAESE"
FT   gene            complement(116866..117153)
FT                   /gene="rpsR"
FT                   /locus_tag="RT0090"
FT   CDS_pept        complement(116866..117153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="RT0090"
FT                   /product="30S ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:RT0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03576"
FT                   /db_xref="GOA:Q68XR6"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XR6"
FT                   /protein_id="AAU03576.1"
FT                   /translation="MLKSNNASKTATCKVGDKAAKKVFFRRRKGCPLSVPNAPVIDYKN
FT                   PELLIKFVSEGGRMLPSRITNVCAKKQRKLNNAIKIARILALLPFVFQAK"
FT   gene            complement(117178..117543)
FT                   /gene="rpsF"
FT                   /locus_tag="RT0091"
FT   CDS_pept        complement(117178..117543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="RT0091"
FT                   /product="30S ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:RT0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03577"
FT                   /db_xref="GOA:Q68XR5"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XR5"
FT                   /protein_id="AAU03577.1"
FT                   /translation="MSFYESVFIIRQDVSLNDIDKIVDDFTKIIKDNDGTIIKKEYWGL
FT                   RTLAYKIGNNKKGHYYFLGIDITSNIKEELERKMKLNESIIRFLTIKVDSISSEPSPIL
FT                   KNQSTENTPVIDVTINN"
FT   gene            118420..119607
FT                   /gene="aco1"
FT                   /locus_tag="RT0092"
FT   CDS_pept        118420..119607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aco1"
FT                   /locus_tag="RT0092"
FT                   /product="Acyl-CoA desaturase"
FT                   /EC_number="1.14.19.1"
FT                   /db_xref="EnsemblGenomes-Gn:RT0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03578"
FT                   /db_xref="GOA:Q68XR4"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XR4"
FT                   /protein_id="AAU03578.1"
FT                   /translation="MLNKLNKPALFALIFYPILIISLVVKYSFDYGIGLLEIIFIIASY
FT                   YINNITVGIGLHRLWSHNAYKINKYAEFVLVMLSAGTLQGPALSWASNHYKHHAKTDTD
FT                   QDPHSPLKFDNKVLGFLWSHIGWMLVGSGSYKFIDRITWAKLGKNNLLKWQLKYYWKIA
FT                   AFMNIVVPLFTGYLIGGTIQSAYAGFLFIGLGRFLQQQATFSVNSLCHFVGSKKYYRGT
FT                   AGDIWWMALFLLGENWHNYHHAFPSDYRNGVKWYHFDVHKWIIFLMSKIGLASELERTT
FT                   KVRIQAKMQETLSYLSEKQKQKLSLMQTKIDNLLENLCLKSKEIEESSLIIKEQLKKSF
FT                   VEIQESLKNLAEQVSSATQITEKPSEKLLKIVNKKIIDAEQSIYKLYNQLNTLKV"
FT   gene            119725..120888
FT                   /gene="gcp"
FT                   /locus_tag="RT0093"
FT   CDS_pept        119725..120888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /locus_tag="RT0093"
FT                   /product="Glycoprotease"
FT                   /EC_number="3.4.24.57"
FT                   /db_xref="EnsemblGenomes-Gn:RT0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03579"
FT                   /db_xref="GOA:Q68XR3"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022437"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XR3"
FT                   /protein_id="AAU03579.1"
FT                   /translation="MKKILGIESSCDDTAISIITESRKILSNIIIPQNTEHAVFGGVVP
FT                   EIAARSHLSNLDQALENVLTKSNTELTEISAIAATSGPGLIGGVIVGSMFARSLSSALN
FT                   KPFIAINHLEGHALTVRLTDNISYPYLLLLASGGHCQFVAVLGLGKYKILGSTIDDAIG
FT                   ETFDKVAKMLNLSFPGGPEIEKRAKLGNPHKYKFPKPIINSGNCNMSFSGLKTAVRNLI
FT                   MSLKEVNDSVINDIAASFQFTIGAILSSKMLNAIRLYQQILNYYYENVDYTTNLNLKSF
FT                   RQDEFNLNHLQDITRPKSRIYLQNSFRSNLLNDTIVIAGGVAANKYLQEILSNCTQTYG
FT                   YRLIAPPMHLCTDNAAMIAYAGLERYNNKLFSPLNFCPKAKWSLEDI"
FT   gene            complement(121536..124112)
FT                   /gene="clpB"
FT                   /locus_tag="RT0094"
FT   CDS_pept        complement(121536..124112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="RT0094"
FT                   /product="ATP-binding ClpB chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:RT0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03580"
FT                   /db_xref="GOA:Q68XR2"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XR2"
FT                   /protein_id="AAU03580.1"
FT                   /translation="MNIDKFTAHAKSVIANHQSLAIKNDHQQILPLHLLSSLLSEETGI
FT                   IQALINNIGGNIHLLKDQVQLELNKIPKIQVDGGGQIYYSAEDLKVLEKSRSIAKDSGD
FT                   SFVTIERIFEALTYDNTIAGKILTNNGINSKKLAAAILHLRKGKKADTESAENSYDALK
FT                   RYGRDVTELAKNGKLDPIIGRDEEIRRAVQVLSRRMKNNPVLIGAPGVGKTAIIEGLAQ
FT                   RIFNKDVPETLINCRIIELDIGALIAGAQYRGEFEKRLKSVLSEIKESSGEIILFIDEL
FT                   HLLVGTGKVEGAMDASNLLKPMLARGELHCIGATTLDEYRKYIEKDAALARRFQPVYVG
FT                   EPSVEDTISILRGIKEKYELHHAVRISDSAIVAAATLSNRYITDRYLPDKAIDLIDEAC
FT                   SRMKIELSSKPEELDELDRRIIQIKIELAALKKENDEHSKKKITSLTEELKQLDSKSYD
FT                   MNTKWQAAKSKLQQAQKLKEELEQARIDLDRAERDANLAKASELKYGIIPEIMNKLQAA
FT                   ENMDNKGLLKEIVSESDIASIISRITGIPIDTMLSSERERLLVIEQKLSESVIGQDEAI
FT                   KGISDAVRRSRSGIQDINRPLGSFLFLGPTGVGKTELTKALAGFLFDDRNALLRIDMSE
FT                   YMEKHSISRLIGAPPGYIGYDQGGVLTESVRRRPYQVILFDEVEKAHLDIFNIMLQILD
FT                   EGRLTNSQGITVDFKNTIIVLTSNLGAEILVNQQEDEDTYKVKDEVMQYVRAVFKPEFL
FT                   NRLDEIILFHRLNRNNIYDIVKIQLGSLKKILLQQNIILEFNESALNYLAEKGYDPSFG
FT                   ARPLKRLIQREIQNNLAKMILAGKISSGNTVKIAREKEELRIEIID"
FT   gene            125155..125880
FT                   /gene="phbB"
FT                   /locus_tag="RT0095"
FT   CDS_pept        125155..125880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phbB"
FT                   /locus_tag="RT0095"
FT                   /product="acetoacetyl-CoA reductase"
FT                   /EC_number="1.1.1.36"
FT                   /db_xref="EnsemblGenomes-Gn:RT0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03581"
FT                   /db_xref="GOA:Q68XR1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011283"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XR1"
FT                   /protein_id="AAU03581.1"
FT                   /translation="MSEIAIVTGGTRGIGKATALELKNRYLTVIANFFSNYDAAKEMES
FT                   KYGIRTKCWNVADFEECKKAVKEIEEEFKKPVSILVNNAGITKDKMLHRMSNQDWTDVI
FT                   NVNLHSCFNMSSSVMEQMRNQNYGRIVNISSINAQSGQIGQTNYSAAKAGIIGFTKALA
FT                   RETASKNITVNCIAPGYIATEMVSAIPKDILTKIVNSIPKKRLGQPEEIARAVAFLVDE
FT                   NAGFITGETISINGGHNMI"
FT   gene            126004..126468
FT                   /pseudo
FT                   /locus_tag="RTPG06"
FT                   /note="pseudogene of RC0049"
FT   gene            126476..127798
FT                   /locus_tag="RT0096"
FT   CDS_pept        126476..127798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0096"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03582"
FT                   /db_xref="InterPro:IPR020183"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XR0"
FT                   /protein_id="AAU03582.1"
FT                   /translation="MTSIYHILDRIPAIYKQDMEIEYEYLAMQLIKSGKLRIDTNDCCN
FT                   FARFTDPALNISLMVSNEELTRPHLIPETTKLFQSLYKNSASDQKINSIFDNLKKQIQK
FT                   LQPVKQEVTEMLARLFVQSAHPIVIRWLLLNKTEVFLTYSHNIGDMMDIVSWQRVGGNS
FT                   GMQSTNGKDIAIFVSCGGNPFAENNKAHPSYGDGFAAVARLQIIAAQELGHFADIKRDD
FT                   KGRQLTRHAANFSCTKATDKVRLARKSDIIHCNNLFNKLLKAGMKKQLEYETKLKFYNT
FT                   NKISGLKVNAIKFMILIYKFRLLSYSSKNNLIFIRKFKTDKYMALMIETMFKDMQANLS
FT                   PNAEVYKNKNPEIEEAIACIEALARVPQQTIKWGYLTTKEIMHHLYKIYYNEVIPSLIT
FT                   SYNSFTGENYKRDFKKNKSSFFSKINIFNNKKLILKPVREL"
FT   gene            complement(128082..128672)
FT                   /locus_tag="RT0097"
FT   CDS_pept        complement(128082..128672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0097"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03583"
FT                   /db_xref="GOA:Q68XQ9"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XQ9"
FT                   /protein_id="AAU03583.1"
FT                   /translation="MITFFDITIFAIITLFSFFGLYQGIVGFSTIISSIMLGYFLYPYI
FT                   SAQIVKYTANEVISIIITSVISYIISLILCVFIVYKFLAIISFMRNGFIDKFLGLLVGF
FT                   TLGITISLILFLITMIFTSENYFQSKSLKDFVISSKQNKYGGILKFSVTTYYLDKLSRN
FT                   IIVIMPNKIFKSIEIFENKDFKNFLKESNNFND"
FT   gene            128733..129302
FT                   /locus_tag="RT0098"
FT   CDS_pept        128733..129302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0098"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03584"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XQ8"
FT                   /protein_id="AAU03584.1"
FT                   /translation="MCDKIFHNLSGKTLVATPYVITKGIYHKSLIYMLSHTEEGAIGLI
FT                   FNRLVNHVDLKSFFKIKEDKITSQVIVPIYLGGPIEHEKGFFLHSRDYNKNLLLDFHND
FT                   LAVSSNLEISEDIAFGQGPKNSLFIVGYTAWKPGQLEEELEKNLWLVMDCNKEFIFADN
FT                   PENKWHNALKHLGIDEMYFSSQIGNA"
FT   gene            complement(129317..129872)
FT                   /pseudo
FT                   /locus_tag="RTPG07"
FT                   /note="pseudogene of Sco2 protein precursor"
FT   gene            131548..132207
FT                   /locus_tag="RT0099"
FT   CDS_pept        131548..132207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0099"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03585"
FT                   /db_xref="InterPro:IPR020171"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XQ7"
FT                   /protein_id="AAU03585.1"
FT                   /translation="MTNNQFSEETKKIADQIKDSLMGISDNLILESKEVEEIFEELSKN
FT                   EEFDYEIERILAILNEQTMDLTQLQSRIILLIRKYLDKTKNLKFKMDEKLINKNVAEVS
FT                   NYLMHQHSKIVRDANKNLVKPKDKLQSLTKQARMDLKRLIKSFAVYQVYMFMNPKRIAG
FT                   ETKLMNFAYNMIKGGMKLAKKYEGGKEKDIKSYSPRLIKKLEKAHAGFKKNNSISI"
FT   gene            134057..134355
FT                   /pseudo
FT                   /locus_tag="RTPG08"
FT                   /note="pseudogene of rickettsial conserved protein with
FT                   coenzyme PQQ synthesis protein c domain"
FT   gene            134379..135461
FT                   /gene="recF"
FT                   /locus_tag="RT0100"
FT   CDS_pept        134379..135461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="RT0100"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:RT0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03586"
FT                   /db_xref="GOA:Q68XQ6"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XQ6"
FT                   /protein_id="AAU03586.1"
FT                   /translation="MKNIFLHSLNLENYRNFKNLELKIDNIPIILTGENGSGKTNILEA
FT                   ISLFYPGRGLRSSKLTDICKTSEDYCRVKALLQSKLGIADFSTHIKRNSNRRITEYNAS
FT                   KIANNELSKFTSMVWLTPQMEGIFTSSSTDRRKFLDRIVYNFDTKHAELLNKYEYYMHE
FT                   RNKILAEDIRDNNWLKIIEENMANISNIIANNRLKTIRFMQQAIDEIENEFPKADLSID
FT                   GIIEQKILNVEEDIVSFIITELYQTRSKDKLLGRTSFGIHKSDFLVKHQKKNILAKFCS
FT                   TGEQKAILIAIILAEMNSTIKLTKITPILLLDEIFVHLDDKRRQYLMDFFTALNIQLWV
FT                   TATNLDGIENFANKAQLIKL"
FT   gene            135704..137308
FT                   /locus_tag="RT0101"
FT   CDS_pept        135704..137308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0101"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03587"
FT                   /db_xref="GOA:Q68XQ5"
FT                   /db_xref="InterPro:IPR018773"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="PDB:5DOO"
FT                   /db_xref="PDB:5DPL"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XQ5"
FT                   /protein_id="AAU03587.1"
FT                   /translation="MIKKANKISYDEVPYPPFTFSYTYPPYLRTIGKLFGLNPPLLETA
FT                   KVLDIGCGIGVNLLNFAETYPKSQSLGVDLSKTQIELGKKTISDAKINNVELKALSILD
FT                   LDESYGKFDYIVCHGVYSWVSQEVQDKILEVLNKLLNPNGIAFVSYNTLPGWNMQNTIR
FT                   EMMMFHSESFNTSHDKLQQARLLLKFINDSLGNSTTPYANFLRDEAKLISTYDDSYVLH
FT                   EYLGEINTGTYFHQFIEKAQKNHLNYLGDTSIAAMFIGNLPTKAASKLQAINDIVCTEQ
FT                   YMDFITNRKFRSTLLCHQNIPINRKIEFDNLKDFYTTFNIRPISPENKIDLNNEQENIS
FT                   FYYENLPEPFISTTSAIMKAILYVYAENISNPIRLEQVAKEAFKKLGKYRLQDFLATLE
FT                   QHFITLIFQGYLKIFETKPHAIATITEKPKTSQFARYQAKHAHFNNVTNMFSITNRLND
FT                   MIGIPIHEKYILEMLDGTHNIDDIKKSIIEKINSKLLTACDNKGQVVTDPKLLKEFVDY
FT                   VVAVSLEKFRINYLLVG"
FT   gene            complement(137564..138097)
FT                   /locus_tag="RT0102"
FT   CDS_pept        complement(137564..138097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0102"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03588"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XQ4"
FT                   /protein_id="AAU03588.1"
FT                   /translation="MANITQSEHKTEQKSEFKIGQRIVYPAHGVGEITNIEYHTIAGNE
FT                   IKVYVISFSQDKMTLKVPVSRAAVVGLRAVASRKDLDVIYSTLQGKPKQGNRMWSRRAQ
FT                   EYEGKINSGNIVAIAEVLRDLHKNVDNDRSYSERTLYESALNRLAGELAILENIDPTEA
FT                   INKLVEVLREKLVA"
FT   gene            138255..139067
FT                   /locus_tag="RT0103"
FT   CDS_pept        138255..139067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0103"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03589"
FT                   /db_xref="GOA:Q68XQ3"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XQ3"
FT                   /protein_id="AAU03589.1"
FT                   /translation="MKNIFIVLIFLFLSSCAEVKAQDKQHEEQQIIEQEPLQNNETPQE
FT                   ANQESINSANTAKSVLHNHDNNQTESVLTQDLHEQKKTAITTKVTFKIDNNDMVLGNKK
FT                   SNVIVVEYFSPTCPHCAYYHQTIFPALKKKYIDTNKIAYVVREFIATKQDLDAAILARC
FT                   KGDINSFIQFHNIILQQQDKWAYSNKYRELLTDIGQLGGISPEEYKQCLNSDKITETLI
FT                   ANTNLVAKAPKFIGTPSFFVNGVQTENYSIDNISRAVDRALEDETKSK"
FT   gene            139126..139374
FT                   /locus_tag="RT0104"
FT   CDS_pept        139126..139374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0104"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03590"
FT                   /db_xref="GOA:Q68XQ2"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XQ2"
FT                   /protein_id="AAU03590.1"
FT                   /translation="MNTEKLKDIKERIKDFKSYKISNSKMRQEISPFSIALDLVSGTMV
FT                   GLVIGILADKFFHSKPLFLIIFTIIGMIAGFNMIRRK"
FT   gene            139379..140107
FT                   /gene="atpB"
FT                   /locus_tag="RT0105"
FT   CDS_pept        139379..140107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="RT0105"
FT                   /product="ATP synthase"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:RT0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03591"
FT                   /db_xref="GOA:Q68XQ1"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XQ1"
FT                   /protein_id="AAU03591.1"
FT                   /translation="MTNSPLIQFNIKKLIDIKMFGLDVSFTNSSIYMLLASTLALTYFY
FT                   LAFYNRKLIPSRLQVSAEIVYNFVVDMLNQNIGIKGRKFIPLVFSLFIFILFCNLLGMT
FT                   PYSFTATSHIIVTFTLALLIFLTVTIVGFIKHGMSFLTLFLPQGTPVWLAPLMIVIELF
FT                   TYLAKPVSLSLRLAANMMAGHVLLKVIAGFTVSLMIYLKFLPIPLIVILIGFEIFVAIL
FT                   QAYIFTILSCMYLNDAINLH"
FT   gene            140141..140365
FT                   /gene="atpE"
FT                   /locus_tag="RT0106"
FT   CDS_pept        140141..140365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="RT0106"
FT                   /product="ATP synthase"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:RT0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03592"
FT                   /db_xref="GOA:Q68XQ0"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XQ0"
FT                   /protein_id="AAU03592.1"
FT                   /translation="MDIVSLKFIGIGFMAIGMYGAALGVSNIFSSLLSAIARNPSAAEN
FT                   LQRMALIGAGLAEAMGLFAFVIAMLLIFS"
FT   gene            140378..140848
FT                   /gene="atpX"
FT                   /locus_tag="RT0107"
FT   CDS_pept        140378..140848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpX"
FT                   /locus_tag="RT0107"
FT                   /product="ATP synthase"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:RT0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03593"
FT                   /db_xref="GOA:Q68XP9"
FT                   /db_xref="InterPro:IPR003319"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XP9"
FT                   /protein_id="AAU03593.1"
FT                   /translation="MPQFDITTYYSQIFWLIITFGLLYIFVCKFIAPNAEEIFNNRQTN
FT                   IQDNIMQAAMLTEEIEKLDKYYSDAVEKMNTEIDKLKKEKIESIELEFLIKKKNLVQDL
FT                   TKSINQNIEDVNLVAKQFRTNKSEAMIKLAVNIIEKISGTKADMNLLQKNIK"
FT   gene            140853..141356
FT                   /gene="atpF"
FT                   /locus_tag="RT0108"
FT   CDS_pept        140853..141356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="RT0108"
FT                   /product="ATP synthase"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:RT0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03594"
FT                   /db_xref="GOA:Q68XP8"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XP8"
FT                   /protein_id="AAU03594.1"
FT                   /translation="MNFLDESFLLAVSFVIFIYLIYRPAKKAILNSLDTKIIEIQEKVL
FT                   KAKKLKEDAALLFEQTKVQIQKLEALRSQMIEESDKATQKIIQDKTKAMEEFLEQKKAD
FT                   AIQLIQNQKLIASKDLQDEFCDEVITLVSKYFRSVQLSERSIAKNLMDKSDFAHNASHA
FT                   THLH"
FT   gene            complement(143215..144279)
FT                   /locus_tag="RT0109"
FT   CDS_pept        complement(143215..144279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0109"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03595"
FT                   /db_xref="InterPro:IPR009367"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XP7"
FT                   /protein_id="AAU03595.1"
FT                   /translation="MNIWVITDDRTGNTHQAIALAAQLTGKYTIITLKYNFLAKLPNFL
FT                   LQYYPIHIKCELLKDIVDKLPPDMIITAGRRTAVLAFYLKKKFESIKLVQIMQPNLPYN
FT                   IFDAIILPYHDYHHLIYCRPATRLSKNIKSHYKIPDYSLHKHDIPQMVKIIPINGALNN
FT                   ITAQFSDASLELQKHYPNLKQFIAVIIGGNNKRFNFNEDAAILLSSLLNKIYSNQAIPF
FT                   FISFSRRTPQIVKSIIKNNTHSSTMIYDPSKDTDYNNPYIAMLSNAKYIISTADSISMC
FT                   SEAASSGKPLYIFCPPNFNSLKHKIFIEQLVEKKIARIFNESITILEEYNYKPLNEAKK
FT                   VAEMIKFAFKINKS"
FT   gene            complement(144279..145235)
FT                   /gene="mrp"
FT                   /locus_tag="RT0110"
FT   CDS_pept        complement(144279..145235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrp"
FT                   /locus_tag="RT0110"
FT                   /product="ATP-binding protein Mrp"
FT                   /db_xref="EnsemblGenomes-Gn:RT0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03596"
FT                   /db_xref="GOA:Q68XP6"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XP6"
FT                   /protein_id="AAU03596.1"
FT                   /translation="MANLHQQQIIDKIQNITFKDGTFLNEVISDIIIKGNNIGFSIDIS
FT                   GKNKLEAEEIRLKAINELNNIKDVNNITIVFTQKKTIDKKAQKPKHFVENVKKIILVAS
FT                   GKGGVGKSTISALIAQQLSLENYQVGIVDADIYGPSIPHIFGINEIPKTVEGRIIPILA
FT                   QNIQIISIGFFVKAHSAIIYRGPMASKIIYQLLSNTRWNNLDYLIIDMPPGTGDIHLSM
FT                   LENYHLDGVIVVTTPQKISEIDVIRSIDLYRKLGLPILGIIENMIYMLESDRCGHLSKK
FT                   YNIPLIAKIPIIPQIANACDKSLPLTNLLTLPLEKYL"
FT   gene            145336..146370
FT                   /gene="hflK"
FT                   /locus_tag="RT0111"
FT   CDS_pept        145336..146370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflK"
FT                   /locus_tag="RT0111"
FT                   /product="protease activity modulator protein HflK"
FT                   /db_xref="EnsemblGenomes-Gn:RT0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03597"
FT                   /db_xref="GOA:Q68XP5"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XP5"
FT                   /protein_id="AAU03597.1"
FT                   /translation="MLSKKYISIFKKSPWKDFDSEKEDNIFTRPRKNQFTFDKLQFPFN
FT                   FNTKTIILAVTAIVILWLASGIYEIKEGEEAAVIRFGRFVRKGYPGLNYHFPSPFENII
FT                   VEKVKQSRRIEIGYRTNSSLRSGGDKNIIGESIMLTGDENIVSLNCDVMWHISNLEDFI
FT                   FNVQRPEETVKATVESSVREVIGNTPISWVLSDQKQEITYKIEKLAQKILDSYNAGVMI
FT                   EKVQLLKAEPPSEVIDAYRDVQTSKADKEKEINQAQAYNNKILPEARGTAAKIIQEAEG
FT                   YREEVISKAEGDSQRFNAIYKQYATGRQVTRDRLYLEVVEEILGGSNKTIINNALLPHM
FT                   LINR"
FT   gene            146522..147382
FT                   /gene="hflC"
FT                   /locus_tag="RT0112"
FT   CDS_pept        146522..147382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflC"
FT                   /locus_tag="RT0112"
FT                   /product="protease activity modulator protein HflC"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03598"
FT                   /db_xref="GOA:Q68XP4"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XP4"
FT                   /protein_id="AAU03598.1"
FT                   /translation="MQQKIYHVIFTIVFGLMLIASSLFSVDQRQSAVVFQFGEAIRTIE
FT                   NPGLNIKIPFIQNVEFFDKRLLDVEVEAKELTAADGKRVIVNAYAKFQINNPVMFYKTV
FT                   HDYQGVKIRLTRNLESSMRKVIGKISLSSLLSQERSNVMLNILNQVNGEAKSFGIDVVD
FT                   VRILRADLPKENSAAIYRRMQTAREKEATQIRAEGQEESVRIRSKADKESKIILAKAYR
FT                   DAQIIKGDGDEKAAKIYNAAYSVDPEFYKFYRSLLVYKNALKKEDTNFVISPEAEVFKY
FT                   LNLAK"
FT   gene            147398..148954
FT                   /locus_tag="RT0113"
FT   CDS_pept        147398..148954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0113"
FT                   /product="serine protease, HtrA/DegQ/DegS family"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03599"
FT                   /db_xref="GOA:Q68XP3"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XP3"
FT                   /protein_id="AAU03599.1"
FT                   /translation="MVNLKIFFIVIVLMFNNIILAKENSNALKVVDQEVVEQEENEFTS
FT                   INSVPLKVSEAARYSFADIVEPLIPAVVNISTIEYVNDKSENAEKDLLQENKHLGFMSD
FT                   ILEKFNIPLNLEEVAKIPKSIPLGSGFIITPNGLIVTNYHVIANVEKINIKLADNTEFL
FT                   AKLIGSDAKTDLALLKIDSEEPLPFVEFGDSNDARVGDWVIAIGNPFGNLGGTVTSGII
FT                   SSKGRDIDVDTNNIVDNFIQTDAAINNGNSGGPMFNLDQKVIGVNTAIFSPLGTNIGIG
FT                   FAIPSNTAKQIIERLKKDGKVSRGRLGVTIQDLTEEISEVLGFKGTNGVLVSKVQENGP
FT                   GYKAGIKKGDIIIKFGDRLVKNTKKLRVIIADTPINQEVKLKILRDAKELELPIKVTAD
FT                   NAEVINDSTEEINKEVIINKQENNLSITKNNITFSNLTEELREKYDIPQDKIGVVIINI
FT                   DEEESEFKLGDLITNINHDRIDDIRQLEALYDDAKKLEKQNILLLIERGNTSVFVPLSV
FT                   S"
FT   gene            149053..149796
FT                   /locus_tag="RT0114"
FT   CDS_pept        149053..149796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0114"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03600"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XP2"
FT                   /protein_id="AAU03600.1"
FT                   /translation="MNERIAILSAYSFVNIIEPANLIPKFLLIGKKKYIRGTILLANEG
FT                   FNCSFSGSYENVNLVLKQLIELTGSKDVNVKINYSSVHPFQKLKVRLKKEIIAMNVKDL
FT                   NIEVFKGDYIEPKDWDEFITKQNVIVIDTRNEYEIDIGTFKSAINPRTETFKQFPAWVQ
FT                   QNQALLQGKKIAMFCTGGIRCEKSTSLLKSIGYNEVYHLKGGILQYLEDTHNKNNLWQG
FT                   KCFVFDDRRAIMDDLSPAEGYWLHR"
FT   gene            149938..150312
FT                   /gene="sdhC"
FT                   /locus_tag="RT0115"
FT   CDS_pept        149938..150312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhC"
FT                   /locus_tag="RT0115"
FT                   /product="succinate dehydrogenase cytochrome b-556 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RT0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03601"
FT                   /db_xref="GOA:Q68XP1"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XP1"
FT                   /protein_id="AAU03601.1"
FT                   /translation="MTKIKQEIYNKRPTSPHLTIYKPQISSTLSILHRMTGVALFFVVS
FT                   ILVWWLILSKYDNNYLQLARCCIIKICLVAFSYAWCYHLCNGIRHLFWDIGYGFSIRAV
FT                   NITGWCVVVCSILLTMLLWV"
FT   gene            150470..150847
FT                   /gene="sdhD"
FT                   /locus_tag="RT0116"
FT   CDS_pept        150470..150847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhD"
FT                   /locus_tag="RT0116"
FT                   /product="succinate dehydrogenase hydrophobic membrane
FT                   anchor protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03602"
FT                   /db_xref="GOA:Q68XP0"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XP0"
FT                   /protein_id="AAU03602.1"
FT                   /translation="MIYDFKAEIIKSKSSSSSKSGAHHWLLQRVTGVVLALCSFWLIYF
FT                   MFTNKNNDINIIMWEFKKPFNIVILLITVTISLYHSVLGMRVVIEDYINCHKLRNTLII
FT                   IVKLFCILTIVAFIVAIFYSE"
FT   gene            150987..152777
FT                   /gene="sdhA"
FT                   /locus_tag="RT0117"
FT   CDS_pept        150987..152777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="RT0117"
FT                   /product="Fumarate dehydrogenase"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:RT0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03603"
FT                   /db_xref="GOA:Q68XN9"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XN9"
FT                   /protein_id="AAU03603.1"
FT                   /translation="MTKAYNIIHHKFDVVVVGAGGAGLRSAFGMAKEGLNTACITKIFP
FT                   TRSHTVAAQGGISAALGNMGEDDWRWHMYDTVKGSDWLGDQDAIEYMCKNAPDAILELE
FT                   HYGVPFSRTEDGKIYQRPFGGMTTEYGKGKAAQRTCAAADRTGHAILHTLYQQSLKHKV
FT                   QFFIEYFAIDLLMEDGECRGVVAWNLDDGSLHCFRAHNVVLATGGYGRAYFSATSAHTC
FT                   TGDGGGMVIRAGLPLQDMEFVQFHPTGIYSAGCLITEGARGEGGYLVNANGERFMERYA
FT                   PAAKDLASRDVVSRAMTIEIREGRGVGEYKDHVFLHLNHLSPEILHRRLPGISETAKIF
FT                   AGVDVTKDPIPVLPTVHYNMGGIPTNYHGQVIIKDGKNHNSIVNGIMAIGEAACVSVHG
FT                   ANRLGSNSLLDLVVFGRSSALKAAELIKPVSPHKPLKKEILEKIINRFDKIRHANGNVL
FT                   VADLRLQMQRTMQSHVSVFRTQELLDEGARMISEIRNRYKDIKINDKSLIWNSDLVEAL
FT                   ELDNLLDQALVTVYSAAARKESRGAHAREDYPDRNDIDWIKHTLSSIDDSGQIILDYKP
FT                   VTLTTLTDEISTIPPVKRIY"
FT   gene            152913..153569
FT                   /gene="glnP"
FT                   /locus_tag="RT0118"
FT   CDS_pept        152913..153569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnP"
FT                   /locus_tag="RT0118"
FT                   /product="glutamine transport system permease protein GlnP"
FT                   /db_xref="EnsemblGenomes-Gn:RT0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03604"
FT                   /db_xref="GOA:Q68XN8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XN8"
FT                   /protein_id="AAU03604.1"
FT                   /translation="MLKYLIKFYPKILFIIEGTLVTLKYSIIAVILGLVIGMLLAICKV
FT                   NKNCVLRLFANFYTSIFRGTPLLVQLSIIYFAAPYIISIKFSVFMAGVISFALNSGAYV
FT                   SEVIRAGINTIDKGQFEAAEALAIPKFLIMKDIILPQAINNIFPSLVNELINLIKESAI
FT                   ISMLGEMDLMRRAQIVSIETYNYFFPMLIAACCYYILVMLISFIAKIIEKKMIVN"
FT   gene            153730..154119
FT                   /gene="rpsL"
FT                   /locus_tag="RT0119"
FT   CDS_pept        153730..154119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="RT0119"
FT                   /product="30S ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:RT0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03605"
FT                   /db_xref="GOA:Q68XN7"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XN7"
FT                   /protein_id="AAU03605.1"
FT                   /translation="MPTYNQLVRFGRKSKIRKTKSPALESNPFKSGVCLVVKTVTPKKP
FT                   NSALRKIATVRLSNKRTVNAYIPGEKHSVKEHDRVLVRGGQVPDLPGVKYHIVLGAYDI
FT                   AGVKGRKQGRSRYGATRKQVAATKK"
FT   gene            154152..154634
FT                   /gene="rpsG"
FT                   /locus_tag="RT0120"
FT   CDS_pept        154152..154634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="RT0120"
FT                   /product="30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:RT0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03606"
FT                   /db_xref="GOA:Q68XN6"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XN6"
FT                   /protein_id="AAU03606.1"
FT                   /translation="MSRRHVAEKRIILPDMKYNSILLSRFINNIMKAGKKAVAEKIVYS
FT                   AFNKIEKKHSVDPYQTFNNAMHNVKPHLEVTSVRVGGANYQVPTHVDERRGYALASRWI
FT                   INAASKRSEKMMIDKLAEELFEAANNRGVAIKKKEDIHKMAEANKAFSHFSPKKMK"
FT   gene            154647..156746
FT                   /gene="fusA"
FT                   /locus_tag="RT0121"
FT   CDS_pept        154647..156746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="RT0121"
FT                   /product="elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:RT0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03607"
FT                   /db_xref="GOA:Q8KTB2"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8KTB2"
FT                   /protein_id="AAU03607.1"
FT                   /translation="MSKINKLEHIRNIGICAHIDAGKTTTTERILYYTGKSHKIGEVHE
FT                   GGATMDWMEQEQERGITITSAATTCKWQDKVINIIDTPGHVDFTIEVERSLRVLDGAVA
FT                   VFDGVAGVEPQSETVWRQADKYNVPRMCFVNKMDRMGADFYKCVDMIKDRLGAKSLILQ
FT                   LPIGIEENFKGIINLIKMKAVIWKDESLGAEYFEEDIPTDMQDKAAEYRARLLDMTVEL
FT                   DDTIMERYLSGEEITEEEIKILIRKGTIEAKFYPVLCGSAFKNKGVQPLLDAIVDFLPS
FT                   PIDIGIVKGIEVSTSEEKDFPISITEPFSALAFKIMNDPFVGSLTFIRIYSGKITSGAS
FT                   VVNTVKNKREKIGRMLLMHANNREDIKEASAGDIVALAGLKDTSTGDTLSDIDTQVVLE
FT                   RMEFPEPVIELAVEPKSTADQEKMGLALSRLAAEDPSFKVSTDHETGQTVIKGMGELHL
FT                   EIIIDRMRREFKVEANIGAPQVAYRETITTACEIDYTHKKQSGGAGQFARVKIIFEPLK
FT                   DVIDLKDEDKNKTFVFESKIVGGAVPKEYIPGVEKGLNNIRETGIVAGYPMIDFKATLV
FT                   DGAFHDVDSSVLAFEIAAKGAFREGMQKGNPKLLEPIMKVEVITPDEYMGDIIGDLNSR
FT                   RGQIQSMDPRGNAQVVTAYVPLAEMFGYVNTLRSLSQGRAQFSMIFSHYDQVPSQVADI
FT                   IKAKK"
FT   gene            156890..156965
FT                   /gene="tRNA-Trp"
FT                   /locus_tag="RT0122"
FT   tRNA            156890..156965
FT                   /gene="tRNA-Trp"
FT                   /locus_tag="RT0122"
FT                   /product="tRNA-Trp"
FT                   /note="codon recognized: UGG"
FT   gene            157133..157333
FT                   /gene="secE"
FT                   /locus_tag="RT0123"
FT   CDS_pept        157133..157333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="RT0123"
FT                   /product="preprotein translocase SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RT0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03608"
FT                   /db_xref="GOA:Q68XN4"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XN4"
FT                   /protein_id="AAU03608.1"
FT                   /translation="MFREYKMYKFFEQVKQETYKVFWPNRKELIASTLVVVAAVFIFSL
FT                   ICLVLDYSIHNIMQLLLTIGK"
FT   gene            157349..157927
FT                   /gene="nusG"
FT                   /locus_tag="RT0124"
FT   CDS_pept        157349..157927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="RT0124"
FT                   /product="transcription antitermination protein NusG (N
FT                   utilization substance protein G)"
FT                   /db_xref="EnsemblGenomes-Gn:RT0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03609"
FT                   /db_xref="GOA:Q68XN3"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XN3"
FT                   /protein_id="AAU03609.1"
FT                   /translation="MTEQTIDNILPASKNNVKQWYVVHTASGAEKRIKEDILRKIAKQK
FT                   MTDFFEDILIPVFGVSEVKRGKNVKVEKKLMPSYILIKMNMTDKSWHLVKNISGVTGFL
FT                   GSKIVPKALTESEIQNIFNNLEAEAKVAKNSKLYEVGEVVTVTDGPFETFMGTVEEIDK
FT                   ERNRLKVSVSIFGKATPIELNFNQVKKND"
FT   gene            158105..158542
FT                   /gene="rplK"
FT                   /locus_tag="RT0125"
FT   CDS_pept        158105..158542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="RT0125"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:RT0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03610"
FT                   /db_xref="GOA:Q68XN2"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XN2"
FT                   /protein_id="AAU03610.1"
FT                   /translation="MSQKTIKGYINLIIPAAGATPAPPIGPALGQRKVNIAAFCKDFND
FT                   ATNGMEKGVPLPTVITVYDDNSFSFKVKTPPASYFLKKYAKITKGSSATKKEAMVGKVT
FT                   LDACREIAKLKISDLNTKNIEAATKIICGSAASMGLEVVGN"
FT   gene            158545..159258
FT                   /gene="rplA"
FT                   /locus_tag="RT0126"
FT   CDS_pept        158545..159258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="RT0126"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:RT0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03611"
FT                   /db_xref="GOA:Q68XN1"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XN1"
FT                   /protein_id="AAU03611.1"
FT                   /translation="MSNKDIFVKISGSKKIREAREKVKSDTLYNLTSAVERLKSASYVK
FT                   FDPTLEIVMKLGIDPRHSDQIVRGVVNLPAGTGKIIRVAVICKEEREEEAKSAGADLVG
FT                   SINIIDEIKSGQINFDVCIATPDMMSMISSVARILGPKGLMPNPKLGTVTLDIKNAIKN
FT                   AKSGQVEYRAEKAGIIHAGLGKLSFSDQDLLKNLNAFIGAVIKAKPVGLKGSYLKAIYL
FT                   SSTMGASVQIDLTSI"
FT   gene            159348..159857
FT                   /gene="rplJ"
FT                   /locus_tag="RT0127"
FT   CDS_pept        159348..159857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="RT0127"
FT                   /product="50S ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:RT0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03612"
FT                   /db_xref="GOA:Q68XN0"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XN0"
FT                   /protein_id="AAU03612.1"
FT                   /translation="MLRSEKPVAVEDIVNIYKESPSVIITHYHGLTVSQVSSLREALKS
FT                   KEVGFKVVKNTLAKIAAKHTGLDSITDLFAGPSAIVYSKEPVEMARLVVNFANSNDNLK
FT                   IIGGIVDNHILDTYAIKELAKLPSLHELRGKIVGLLQAPATKVVGVLQATSSSIARVIH
FT                   AHAIKH"
FT   gene            160038..160415
FT                   /gene="rplL"
FT                   /locus_tag="RT0128"
FT   CDS_pept        160038..160415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="RT0128"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:RT0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03613"
FT                   /db_xref="GOA:Q68XM9"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XM9"
FT                   /protein_id="AAU03613.1"
FT                   /translation="MADLAKIEEQLSSLTLMQAAELVKILEAKWGVSAVTPIAVASAGV
FT                   ADPVAEAVAEKTEFEVVLTATGDKKVEVIKIIKDITGLGLIEAKKLVDEAPKPIKSNLK
FT                   KAEAEEIKNKLEATGAKVELK"
FT   gene            161240..165364
FT                   /gene="rpoB"
FT                   /locus_tag="RT0129"
FT   CDS_pept        161240..165364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="RT0129"
FT                   /product="RNA nucleotidyltransferase (DNA-directed)"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:RT0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03614"
FT                   /db_xref="GOA:P77941"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:P77941"
FT                   /protein_id="AAU03614.1"
FT                   /translation="MVSLRDNIESQPLSHNRRVRKNFGHINLVADIPNLIEIQKNSYER
FT                   NFLQLNIKDSERKNKGLQSILNSIFPISDSSNIANLEFVKYEFDTPKYDVDECSQRSLS
FT                   YAAPLKVTLRLSIWDIDEDTGTREIKGIKEQEVYMGDIPLMTKNGTFIINGTERVVVSQ
FT                   MHRSPGVFFYHDEGKVHSSGKLLYSARVIPYRGSWLDFEFDAKDVIYFRIDRKRKLYAT
FT                   TLLRAIGMNTEEIMKFYYNSVTYKCIKNKGWSVKFIPQHITAHRLTSDLVDADTGNVLL
FT                   KAGQKITPRLAQKYFSIGLNNILVTHETLIGKYLSEDLRDPESDEILAKIGEMITADML
FT                   QVINDLKIKNVNVLVINPQSGPYIRNTLFADKNQDRETALCDIFRVLRPGEPANIEAAE
FT                   SLFYNLFFDAERYDLSEVGRIKMNSRLELNISEEITVLTIDDIKNIVRILVELKDGKGI
FT                   IDDIDHLGNRRVRSVGELIENQFRIGLVRIEKSVIERMSAGDVDTVMPHDLVNSKILVS
FT                   VVKEFFSTSQLSQFMDQTNPLSEITHKRRLSALGPGGLSRDRAGFEVRDVHPTHYGRIC
FT                   PIETPEGQNIGLINSMATYARINKHGFIESPYRRVKDGYVTDEVVYLSAIEEGKYKIGQ
FT                   ANSKVDQDGKLQGEFINCRVEGGNFVMVEPYEVDFIDVTPMQVVSVAASLIPFLENDDA
FT                   NRALMGSNMQRQAVPLIKTEAPFVGTGVEGVVAKDSGASVLALHDGIVERVDSNRIVIR
FT                   TLEQKVDGSPSVDIYNLLKFQKSNHNTCINQKPLVKVGHYVKKNDIIADGPSTDNGEIA
FT                   LGRNVLVAFLPWNGYNFEDSILISERIVKEDVFTSIHIEEFEVIARDTRLGPEEITRDI
FT                   PNVSEEALRHLDEVGIIYVGAEVKAGDILVGKVTPKSESPITPEEKLLRAIFGEKAFDV
FT                   KDSSLHVPSGVSGTVVEVRIFSRRGVEKDQRAIAIEKQQIEKLAKDRDDELEIIEHFVF
FT                   SWLEKLLVGHVIISGPKQITAGQTITTEMLKGLSKGQLWQLIVEDANVMNEIEQIKIHY
FT                   DEKKHALDKRFATKVEKLQSGDDLPQGALKVVKVFIATKHKLQPGDKMAGRHGNKGVIS
FT                   RIVPEEDMPFLEDGTVVDIVLNPLGLPSRMNIGQILETHLGWASINLAKKISTLVKEYK
FT                   DNNIDIEQIKKFLLELYGKDINYILEGSEEGIISFCNKVSKGVYFATPVFDGAKVQDVK
FT                   DMLKLADQDLSGQVKLIDGRTGEYFDRLVTVGHKYLLKLHHLVDNKIHSRSIGPYSLVT
FT                   QQPLGGKSHFGGQRFGEMECWALQAYGAAYTLQEMLTVKSDDVNGRIKTYDSIVRGENN
FT                   FESGIPESFNVMIKEFRSLCLNVKLEVTASK"
FT   gene            165666..169784
FT                   /gene="rpoC"
FT                   /locus_tag="RT0130"
FT   CDS_pept        165666..169784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="RT0130"
FT                   /product="RNA nucleotidyltransferase (DNA-directed)"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:RT0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03615"
FT                   /db_xref="GOA:Q68XM7"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XM7"
FT                   /protein_id="AAU03615.1"
FT                   /translation="MSVVNFYGQLSNTQQFDQIRINIASPDQVRSWSFGEVTKPETINY
FT                   RTFKPEKDGLFCARIFGPVKDYECLCGKYKRMKNRGITCEKCGVEVTVSRVRRERMGHI
FT                   ELAAPVAHIWFLKSLPSRISTLLDMTMRDVEKILYFENYVVVDPGLSILQKGELLTEEE
FT                   LQKAKDKYGEDAFTASIGAEVIQQMLKELDFSKLKQELYDELHITSSEVKKKKLVKRLK
FT                   LVEDFLESENKPEWMIMDVLPVIPPEIRPLVMLDGGRFATSDLNELYRRVINRNNRLKK
FT                   LIESKAPDIIVRNEKRMLQEAVDALFDNGRRGRAAKNANKRPFKSLSDMLKGKQGRFRQ
FT                   NLLGKRVDYSGRSVIVVGPELKLHQCGLPKKMALELFKPFIYSKLELYGIATTIKAAKR
FT                   MVEAEKPEVWDVLEEVIREHPVLLNRAPTLHRLGIQAFEPLLIEGKAIQLHPLVCAAFN
FT                   ADFDGDQMAVHIPLSIEAQLEARVFMMSTNNILSPANGRPIIVPDKDIVLGLYYLTIAF
FT                   DNEVGEGMMFSDLAEMEHALYNKFITIHTKIKYRRDQLNAEGKMVPVIIDTTYGRLMVG
FT                   ELLPSNPNIEFKCINKQLTKKDISLVIDLVYRHCGQKATVIFADQLMKLGFKYACSSGI
FT                   SFGMDDMVVPESKSTHINETQLEIKEFEQQYSNGLITYGEKYNKVVDAWSRCTDRVAND
FT                   MMKEIATPPINDYPNHQRINAIYMMAISGARGSFQQIKQLGGMRGLMTKSNGQIIQTPI
FT                   ISNFKEGLTEFECFNSANGMRKGQIDTALKTASSGYLTRKLVDVAQDCIITEKDCGTDK
FT                   GIEVKSVIEGGEIIVPLAEKILGRTAAIDIFHPVTNDLILNKGELINESKLEQIESAGL
FT                   DRIMIKSVLTCESSTGICSICYGRDLATGTLVSEGEAIGVIAAQSIGEPGTQLTMRTFH
FT                   IGGAATKGAEVSSVEASYDAKVKIISRNVVINSEERKIVMSRNCELLLLDDNGNEKARH
FT                   KIPYGARLLVDDGDIVIKTQKLAEWDPYTIPIITEKSGKVLFKDMVEGISIRDVTDEAT
FT                   GIPSKVIIESKQYSRGAELRPRIQLLDSKGEVITLSNGLEARYYLPVGAVLSVEDGIQI
FT                   SVGDIIARIPKESTTTKDITGGLPRVAELVEARRPKDHAVIAEVDGRVEFGKDYKSKRR
FT                   IIIHPIDGTLSIEYMVPKGKHVVVNEGDFVKKGDLLIDGNPVLQDILKVMGVEVLANYI
FT                   VKEVQAVYRLQGVKIDDKHIEVIIRQMLQKVEVTDSGGTTLLVGEKIDRHEFDEINEKA
FT                   MKNGLKPAEAQLILQGITKASLQTRSFISAASFQETTRVLTEAAIAGKVDKLRGLKENV
FT                   IVGRLVPAGTGYFMDKMRKAAVKLDEENV"
FT   gene            170817..172319
FT                   /gene="pepA"
FT                   /locus_tag="RT0131"
FT   CDS_pept        170817..172319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepA"
FT                   /locus_tag="RT0131"
FT                   /product="Cytosol aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:RT0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03616"
FT                   /db_xref="GOA:Q68XM6"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XM6"
FT                   /protein_id="AAU03616.1"
FT                   /translation="MLNINFVNEESSTNQGLIVFIDEQLKFDTSLMALDQQHYGLISKT
FT                   IQNKLQFRGNYGQITIVPSVIKSGEVKYLIIVGLGNAEKLTEAKIEELGGKILQHATCA
FT                   KISTIGLKIMSRINRFTPQTFTSLIASGAFLASYRFHKYKTTLKEVEKFAVESIEIFTD
FT                   NNSEAIKLFEVKKLIAEAVFFTRDISNEPSNIKTPQVYAERIVDILEPLGVNVDVIGER
FT                   DIKNLGMGALLGVGQGSQNESKLVVMEYKGGSRDDSTIALVGKGVIFDTGGISLKPSSN
FT                   MHLMRYDMAGSAAVVGAIIALASQKATVNVVGVVGLVENMQSGNAQRPGDVVVTMSGQT
FT                   AEVLNTDAEGRLVLADTVWYVQEKFNPKCVIDVATLTGAITVALGSTYAGCFSNNDELA
FT                   DKLIKAGEEVNEKLWRMPLHDDYDAMINSDIADIANIGNVPGAAGSCTAAHFIKRFIKD
FT                   GVDWAHLDIAGVANSNNASALGPKGAVGYGVRLLEKFIKEYN"
FT   gene            172414..173208
FT                   /locus_tag="RT0132"
FT   CDS_pept        172414..173208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0132"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03617"
FT                   /db_xref="InterPro:IPR015223"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XM5"
FT                   /protein_id="AAU03617.1"
FT                   /translation="MNIINKPYIFVLGNEKGGAGKTTCSMHLIIGLLYQNYSVISIDAD
FT                   SRQSSLTNYLKNRDLYNQQNPTNTVLVPKHFHIFESDVEEQIKSFKQILKNNKDADYIV
FT                   IDTPGSYTTLSQVAHSYADTIITPINDSFLDLDVIAKVDSKDEIISPSIYSQMIWEQKM
FT                   ARASRDGGSIDWIILRNRLSNLDALNKRRVGAVLVALAKRINFKIAEGFSERVIYRELF
FT                   LQGLTLLDLKTARYDRALNSSHVLARQELRNFLIFLDIQAEF"
FT   gene            173310..173744
FT                   /locus_tag="RT0133"
FT   CDS_pept        173310..173744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0133"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03618"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XM4"
FT                   /protein_id="AAU03618.1"
FT                   /translation="MSNVAENISKLPEEQEKINKLVDQYKNLTPQKQKEVDRKLKLYFT
FT                   KDELEQDELKSRMNRIRSNLSQQDQEKLHAGNSTIGEIAKDVLSLVKGIISLVENISKV
FT                   IKNPTGAIYEWFQNELNQVKPQQQNNHQFQSKPKAAAISR"
FT   gene            173816..175633
FT                   /gene="aspS"
FT                   /locus_tag="RT0134"
FT   CDS_pept        173816..175633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspS"
FT                   /locus_tag="RT0134"
FT                   /product="Aspartic acid translase"
FT                   /EC_number="6.1.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:RT0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03619"
FT                   /db_xref="GOA:Q68XM3"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XM3"
FT                   /protein_id="AAU03619.1"
FT                   /translation="MHKYRTHNCNELQLSNVGQEVKLSGWVHRRRDHGNLVFIDLRDHY
FT                   GITQIVFTDQNQHLMDYASNLCYESVITVSGTVVARSEGTINNKLLTGHIEVLAVECIV
FT                   ESASSPLPFVINNEKEAPEESRLKHRFLDLRREKLHNNIILRSQVISHIRHLMIVRGFT
FT                   EFQTPILTSSSPEGARDFLVPSRIHPGKFYALPQAPQQFKQLLMIAGFDRYFQIAPCFR
FT                   DEDARADRSPGEFYQLDLEMSFVTQEDIFNTIEPVLYDLFTKFTDKIVSKPPFVRIPYN
FT                   ESMLKYGSDKPDLRNPIIISDVTEIFRDSNFTIFRENIKKGSVVRAIHAPKAASLPRSF
FT                   FDKMIEFAISEGAIGLSYIQFSETGEVKGPLSKFLTKQQLEILKATSNTSNGDAVFFAS
FT                   DQKDKAAKLCGKVRIKLGEELNLLEKDCFKFCWITDFPFYEFNEETGKIDFSHNPFSMP
FT                   QGGIDALEQAKTTEELLALTAYQYDIVCNGIELSSGAIRNHKPEIMYKAFSIAGYSAEE
FT                   VDKRFGAMIRAFKFGAPPHGGIAPGIDRIVMLLAEATNIREIIAFPLNQQAEDLLMNSP
FT                   SYVDEKALKELSIMLSPTSRKIHKKNTGL"
FT   gene            complement(175887..178010)
FT                   /locus_tag="RT0135"
FT   CDS_pept        complement(175887..178010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0135"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03620"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XM2"
FT                   /protein_id="AAU03620.1"
FT                   /translation="MSKAKTKQELLLQQELFNVLKTHDIEAHAKISRICERIAESVIAL
FT                   ADQQSHTTESSYINYINQAALNTKDLAKVTTTIKNFFPGDHNKKLREIIDTPLLQNLVI
FT                   AGSIERKIGLNDTLYTPDYRKLEEIIDPNDTKKVIDAMLRDKGVAQQDEFEKKGKKTTG
FT                   ISAGYIANDSAGNTFILKHFYKTHAACEKIQDPIEQSHAIDDRRDGVQELIGSTMYQFL
FT                   LHDRAPKEGLVKADAQHPDSLYVRSKFFDNAVTLTEFCGLSGQTRVRVNDKNLKKLEGF
FT                   EKAIAACHMLGDGDYHAGNLMVQNGKTITKIDHGRSFLEFHQDFGSMVQLTAEMFTHPN
FT                   VCYSDAIKAGNLSFNIDKYSEALNQMISQFDVQRMEAIVDQKLDELKKAGFDPDNIPLY
FT                   ININNFDDLKQYYKSSIKQNFINMQEIAKGAEIVKKFSNVLPEFKNGGWLEAFANSPVK
FT                   EPLLYAIKNKITIEGKDAQEWAYENNYQIKTAIGLTKEVIKERQWRKDFEGKWQEKEIE
FT                   VQRDKVEVQLSDPLKSMRIQDKFTAKKFESLIINFTKHTTTKNVTDEEVEKFYDNIMQV
FT                   LKKENYLNEQDIETIKQDLKYHDNIENTTHLLNAKDLKLNSKDTIYYKIGNFCEKIGLR
FT                   SVANHFIKKIAPENLNKIYNTEKVIAESIKIGNILKDNKQEGLQTKRLETVKGIVVSQL
FT                   QAKQGKQQQGKHY"
FT   gene            complement(178110..178820)
FT                   /locus_tag="RT0136"
FT   CDS_pept        complement(178110..178820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0136"
FT                   /product="conserved hypothetical protein (integral membrane
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:RT0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03621"
FT                   /db_xref="GOA:Q68XM1"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XM1"
FT                   /protein_id="AAU03621.1"
FT                   /translation="MIDYTKTLTTTSKNKTFDEGLRRYMLKVYNYMALALLLTGVAAIT
FT                   TISVEPIYHLMFQTGFGTIIMFAPLGIALYFFMGFGRMNLQTAQILFWVYAGLTGMSLS
FT                   YLALIYTGTSIARTFFICSSVFGAMSLYGYSTNRDLTSMGSFFAMGLIGLIIASLVNLF
FT                   LKSSSLSFATSLIGIVVFMGLIAWDTQKIKSMYYIAGNDAAGQKLSIMAAFTLYLDFIN
FT                   LFLNLMRFLGNRRD"
FT   gene            complement(179021..179740)
FT                   /gene="dapB"
FT                   /locus_tag="RT0137"
FT   CDS_pept        complement(179021..179740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="RT0137"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:RT0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03622"
FT                   /db_xref="GOA:Q68XM0"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XM0"
FT                   /protein_id="AAU03622.1"
FT                   /translation="MINIGLSGATGKMGKTIIEIIDQFKDCQISEKFNSTNNLNDLDNL
FT                   CKNSDVIIDFSTPEVLEKLINYALKHNTKLVIGTTGLKKQHFKLLEKAAKTLPILYSAN
FT                   MSIGANLLNYLAKESTKILDDYDVEILEMHHRNKKDAPSGTALMLASTIAGIKELNITF
FT                   NRGNRIKSKKEIGISSLRGGNVHGIHEIFFLDNDEIITLKHEALNKNSFAVGAIKSAIW
FT                   LQDKPSALYSMQDIYKV"
FT   gene            complement(180003..180488)
FT                   /locus_tag="RT0138"
FT   CDS_pept        complement(180003..180488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0138"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03623"
FT                   /db_xref="GOA:Q68XL9"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XL9"
FT                   /protein_id="AAU03623.1"
FT                   /translation="MAGTITEWQFKDAMSRFPQGVTIITANCNNKLFGFTASSFTSVSL
FT                   KPSLILFCMNKNSCSINSFKKSDKFAVSILAENQIDISKHFAKSQPNKFTKIDYKLGHK
FT                   TDCPLINGATCHIECNKYASYNAGDHIIFIGEVINTAIKNNVKPLLYFHKSYTRLHV"
FT   gene            complement(180473..181198)
FT                   /gene="glnH"
FT                   /locus_tag="RT0139"
FT   CDS_pept        complement(180473..181198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnH"
FT                   /locus_tag="RT0139"
FT                   /product="glutamine-binding periplasmic protein GlnH"
FT                   /db_xref="EnsemblGenomes-Gn:RT0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03624"
FT                   /db_xref="GOA:Q68XL8"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XL8"
FT                   /protein_id="AAU03624.1"
FT                   /translation="MKFLKIFLLSFLLVSCEKKETEKTLIVGTAADNPPYEFIQDGEIV
FT                   GIDIDIIKAISQRLNKKIIIKNFDFNGLLAALISENIDVAIAALSVTQERSEYISFSDS
FT                   YAKARFAIIYRTGENIQNSKDLYNKIVGVQLGSVLEKKAQDLSHTMNIKVHALANHLML
FT                   VEELKAKVIDAIISEEFQGKKLKENNSNLETSTLEEFSSDFAIGMSKHSGLINEINSTI
FT                   NLLKKDGTINKIMKKWLGQ"
FT   gene            complement(181363..182814)
FT                   /gene="gatB"
FT                   /locus_tag="RT0140"
FT   CDS_pept        complement(181363..182814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="RT0140"
FT                   /product="Glu-AdT"
FT                   /EC_number="6.3.5.7"
FT                   /db_xref="EnsemblGenomes-Gn:RT0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03625"
FT                   /db_xref="GOA:Q68XL7"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XL7"
FT                   /protein_id="AAU03625.1"
FT                   /translation="MEYIEGNTGKWEYVIGLEIHAQISSKTKLFSGSSTLFAASPNSQV
FT                   SYVDAAMPGMLPVLNKHCVHQAIKTGLALKAKINKYSVFDRKNYFYADLPQGYQISQFY
FT                   YPIVQDGMIEIQTSTGNLKTIRINRLHLEQDAGKSIHDQSPYYSMIDLNRAGIGLMEIV
FT                   TEPDISSPEEAAEFVKKLRNLLRYIGSCDGDMEKGSLRCDANISVRRSGEALGTRCEIK
FT                   NINSIRNIIKAIEFEAKRQVDLLESGEAIIQETRLFNVDSCETKTMRLKEEALDYRYFP
FT                   DPDLLPLVIHDELINELKSSLPELPDQKIEKYTKKFGLSKYDAGIIVSDESIAEYFEKA
FT                   ANECNPKMLTNWLITELFGQLNKASIGISECKITPSDFAKLIKLIENNTISGKIAKTVF
FT                   EIMFATGKAPDKIVEEKGLVQISDNKILNTVIDEVIAENSKSVKCYKSGKDKLFGFFVG
FT                   QVMKKTKCKANPTLVNKLLKEKLDS"
FT   gene            complement(182969..184450)
FT                   /gene="gatA"
FT                   /locus_tag="RT0141"
FT   CDS_pept        complement(182969..184450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="RT0141"
FT                   /product="Glu-AdT"
FT                   /EC_number="6.3.5.7"
FT                   /db_xref="EnsemblGenomes-Gn:RT0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03626"
FT                   /db_xref="GOA:Q68XL6"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XL6"
FT                   /protein_id="AAU03626.1"
FT                   /translation="MTELNKLTVADSVKGLKNKDFTSKELVNAHIKQIEKYKNLNAYVT
FT                   ETFDLALKQAEEADQNYAQNKARTLEGIPFAVKDLFCTKGIRTTACSNILKNFIPHYES
FT                   SVTKNIFDKGGVMLGKTNMDEFAMGSTNITSCFGNVISPWKANDDNSDLVPGGSSGGSA
FT                   AAVSGFMASAALGSDTGGSVRQPASFTGLVGFKPTYGRCSRYGMVSFASSLDQAGIFTR
FT                   SVLDSSIMLEAMMGFDEKDSTSINAKVPELQSAIGSSMKNMKIGVPLSLGEGGIIEHDI
FT                   MKMWHDTIELLKNAGAEIVDITLPHAKYGVAVYYVIAPAEAASNLSRYDGVRYGLRVEY
FT                   ENMTLDEMYEMTRSAGFGEEVKRRIMLGTYVLSSNCMDAYYFKAQKVRRLVANDFNNAF
FT                   TKVNAILLPTAPSAAFKIGEKQNDPTIMYLNDLFTIPASLAGLPCVSVPAGLSARGLPL
FT                   GMQIIGKQLDEYNVLKVASTIETGVKHIKFEPAGF"
FT   gene            complement(184453..184755)
FT                   /gene="gatC"
FT                   /locus_tag="RT0142"
FT   CDS_pept        complement(184453..184755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="RT0142"
FT                   /product="Glu-AdT"
FT                   /EC_number="6.3.5.7"
FT                   /db_xref="EnsemblGenomes-Gn:RT0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03627"
FT                   /db_xref="GOA:Q68XL5"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XL5"
FT                   /protein_id="AAU03627.1"
FT                   /translation="MITKEEAQKIAKLARLKFEKDIVEKFSTQLSTIMNMINILNEIDC
FT                   KDIEPLTSVSNMNARMREDTVTSSDLSNKLFDNVSGNSARLAKEVKYFITPKVVE"
FT   gene            complement(185259..185819)
FT                   /gene="frr"
FT                   /locus_tag="RT0143"
FT   CDS_pept        complement(185259..185819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="RT0143"
FT                   /product="ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:RT0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03628"
FT                   /db_xref="GOA:Q68XL4"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XL4"
FT                   /protein_id="AAU03628.1"
FT                   /translation="MEKNNLKKILQEKMEKAIKVLGNELKGLRTGRASVNFLDSVTVEA
FT                   YGSKVPLAQVASLSTPDARTINVQVWDKSMVSSVEKGITIANLGLTHATDGQLIRLPIP
FT                   SLTEERRKEFVKLAHKYGEETKISLRNIRRDGIEELKKLEKDNIIVKDEYHSLSEQVQK
FT                   LTDEYSSKVDSAIKQKEHEIMTV"
FT   gene            complement(186006..186740)
FT                   /gene="pyrH"
FT                   /locus_tag="RT0144"
FT   CDS_pept        complement(186006..186740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="RT0144"
FT                   /product="Uridine monophosphokinase"
FT                   /EC_number="2.7.1.48"
FT                   /db_xref="EnsemblGenomes-Gn:RT0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03629"
FT                   /db_xref="GOA:Q68XL3"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XL3"
FT                   /protein_id="AAU03629.1"
FT                   /translation="MKMVSDINALKYKKVLLKVSGEALMGNKQFGHEYEVIKKIAEDIK
FT                   EVIDLGLEVAIVVGGGNIYRGINAALVGMDRASADYIGMLATVINALTLQNVMESLGIY
FT                   TRVLSAIPMMSVCEPYIRRKAKRHMEKKRVVIFAGGTGNPFCTTDSAAVLRAIEMNCDI
FT                   LLKATQVDGVYDSDPKKNPNAKKYFTISYKDVITNHLQVMDTAAIAVARENKLPIRVFS
FT                   IKEHGNIARVIQNKGKYTTIEE"
FT   gene            complement(186744..187055)
FT                   /locus_tag="RT0145"
FT   CDS_pept        complement(186744..187055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0145"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03630"
FT                   /db_xref="GOA:Q68XL2"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XL2"
FT                   /protein_id="AAU03630.1"
FT                   /translation="MLMFTKIKFILYFLWLLLEIWKSAFLVIQIIWQNKIEIDPIFEWI
FT                   DASELQGIGVVIYSNSITLTPGTVTLDINNNMLLVHALNKSSITNLKSGKMIKKIKTA"
FT   gene            complement(187039..188598)
FT                   /gene="emrB"
FT                   /locus_tag="RT0146"
FT   CDS_pept        complement(187039..188598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="emrB"
FT                   /locus_tag="RT0146"
FT                   /product="multidrug resistance protein B"
FT                   /db_xref="EnsemblGenomes-Gn:RT0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03631"
FT                   /db_xref="GOA:Q68XL1"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XL1"
FT                   /protein_id="AAU03631.1"
FT                   /translation="MPNNDLKKLPLSKKQLLAFFGMIVGMFMSVLDIQIVASSLSVIAS
FT                   GLAASSNELSWIQTSYLIAEVIIIPITGFLARLLSTRICYFIASLGFTMMSVLCSLANN
FT                   IESMIIFRALQGFCGGAMIPLVFSTVFIIFPASQRPTVTILIGLIVTVAPTLGPTLGGY
FT                   ITEILSWHFMFLLNVIPGIFVCTVVFLYVDFDKPNYQLLKNFDFLGILLMSLTLGLLQY
FT                   VLEEGNKAGWLDNKLILFLSITVALGFILLIIRELTFINPILDLNTFLYKDFTFGCIYS
FT                   FILGIGLYGTVYILPLFLFTIAKYDTLQIGATMMVTGVAQFLSAPLAGRMLGLGIDSRL
FT                   MLTIGLGGFALGCHLNSFLTTDSKFAAFVLPQFIRGFSLMFCFIPINNIALCNMPKEKI
FT                   ANASGLYNLTRNLGGAVGLAIISTILSNDTKIFMQYLSENISYTSIMALTKLDYYTELL
FT                   SWKVLNPEQGAYLLLADKLNNDAFVIAINNIFNMIGLLFIFIMLLIPFTSNIELTGNVN
FT                   VH"
FT   gene            188780..188983
FT                   /locus_tag="RT0147"
FT   CDS_pept        188780..188983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0147"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03632"
FT                   /db_xref="InterPro:IPR024246"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XL0"
FT                   /protein_id="AAU03632.1"
FT                   /translation="MQNPTQKVISFSEHKADIERIKKAIEEGWAIVKLVPNKDRFIGLL
FT                   EKVSDHKDETIYIPPRKKIIVK"
FT   gene            complement(189321..189461)
FT                   /locus_tag="RT0148"
FT   CDS_pept        complement(189321..189461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03633"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XK9"
FT                   /protein_id="AAU03633.1"
FT                   /translation="MKNNTEELIQAVSILKALRILAYSFSKTINIITNLFNNLKSKNDI
FT                   I"
FT   gene            complement(189873..189948)
FT                   /gene="tRNA-Thr"
FT                   /locus_tag="RT0149"
FT   tRNA            complement(189873..189948)
FT                   /gene="tRNA-Thr"
FT                   /locus_tag="RT0149"
FT                   /product="tRNA-Thr"
FT                   /note="codon recognized: ACG"
FT   gene            complement(190091..192397)
FT                   /gene="omp1"
FT                   /locus_tag="RT0150"
FT   CDS_pept        complement(190091..192397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="omp1"
FT                   /locus_tag="RT0150"
FT                   /product="outer membrane protein Omp1"
FT                   /db_xref="EnsemblGenomes-Gn:RT0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03634"
FT                   /db_xref="GOA:Q68XK8"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XK8"
FT                   /protein_id="AAU03634.1"
FT                   /translation="MKIISISKLTILLLTVFYYHISFADDVIRKITIKGNHRIERSTIE
FT                   SYLKFNVGETYNNSKEDEAIKRLYATSLFKNINMYITNDGNLIVNVTETPFISSVVFSG
FT                   NSKIKTNILAKEIYTMSGESLSQAKIELDVKKILEIYKRSGRFSTKVIPKIKNLENNRV
FT                   KVIFDIAEGPKTGIKSIYFSGNEHYSDSELKSIVLTKESRWFRFLENNDTYDPDRVEYD
FT                   KELLREFYQSVGFADFRVISASVELNDTKEYFTLTYSIEEGEKYRFGNVTIDNKLTNIN
FT                   MKYLNKIVNIKQGKIFNMKKVDDIAEKIGEYFTANGYSAVNVYPEIKKNDNHTADIKFI
FT                   IEKGDKVYINKINIINNLKTEDHVIRRAFKIEEGDVINRSYIEKGERNLRNLDYFEKVS
FT                   ISLAKTKAKDKYDVNVEIDEKSTSSIGFDLGYNTAGGLFGRFSFLERNLVGTGKLLNAG
FT                   VQVSKNSTSYYGCITDPHFLDRDLSLSVNAFRNYTGRGASVLNTTDQSYKLHSIGVKIS
FT                   LGYDMKEDLSHEIDYLIKRDILSAPSPSNSIFLNEQMGKLITSAIGHTITYDQTDNKIV
FT                   PKNGYLVSGTQEFAGIGGDNKYIKHEIECKYYKSFIHNKVTLKLSAAGGDMAGLGGKIV
FT                   RISDRFNLGDYSLRGFASGGVGPREKNTNEGLGGEKYYTFSTELNFPTPTPEEFNLTGA
FT                   VFIDLGSVWGVGLNKKQYKTPNGFYNDKSLRASVGFGFIWVTRFAPIRMDWGFPIKKKQ
FT                   YDDTQNFHLRFSTHL"
FT   gene            complement(192627..193700)
FT                   /locus_tag="RT0151"
FT   CDS_pept        complement(192627..193700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0151"
FT                   /product="probable membrane associated zinc
FT                   metalloprotease"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03635"
FT                   /db_xref="GOA:Q68XK7"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XK7"
FT                   /protein_id="AAU03635.1"
FT                   /translation="MLSLIGFIITISILVFIHEFGHYCIARYLDVKVEEFAIGFGKELI
FT                   GITDKKGVRWKLCFIPLGGYVKIYGYDHRMIDQTTEVNKKVTFYARSCLERFAIVAAGP
FT                   LINYLLAVIIFTSFYCYFGKTEIPPIIGDVVASSPAERAGLKEGDKIVKVNDKYVKDFV
FT                   DVQKEILINGFSSSTLTIARKSVKFTVNIRPQEIIISHPAKKKVEKTFRIGIIAKNEPI
FT                   HTKIGLFGGIWEAINTTIDISTLTLKAISQIILGTRPLDEIGGPISIAQESSKSIASGA
FT                   QMYLLFIAMLSINLGLLNLLPIPVLDGGHLIFILYEAVTGRLPNPKTRNILLQLGAAII
FT                   MLLIIISISNDIKNLFY"
FT   gene            193868..194389
FT                   /gene="nusB"
FT                   /locus_tag="RT0152"
FT   CDS_pept        193868..194389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="RT0152"
FT                   /product="transcription termination protein NusB (N
FT                   utilization substance protein B)"
FT                   /db_xref="EnsemblGenomes-Gn:RT0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03636"
FT                   /db_xref="GOA:Q68XK6"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XK6"
FT                   /protein_id="AAU03636.1"
FT                   /translation="MTLDVIVIHNNKNYKFLLSMSTNKINKKSIARIAAVQALYQNILQ
FT                   NNYDMYDIMQNILACYHSNSIDLPKNFKISLSISHFKMLVKSVFENINKLDEIIDNHLT
FT                   NDKDPVHMPILLRALLRVSICELLFCSTTPAKVVINEYTDIANDLLNEHEIGFVNSILD
FT                   KIAQENNKIS"
FT   gene            194386..195069
FT                   /gene="ftsJ"
FT                   /locus_tag="RT0153"
FT   CDS_pept        194386..195069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsJ"
FT                   /locus_tag="RT0153"
FT                   /product="rRNA (uridine-2'-O-)-methyltransferase (23S
FT                   ribosomal RNA methyltransferase)"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03637"
FT                   /db_xref="GOA:Q68XK5"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XK5"
FT                   /protein_id="AAU03637.1"
FT                   /translation="MTNNLSGYRNKIVRVKTAKKRPISSSNWLRRQLNDPYVAKARLEG
FT                   FRSRAAYKLLEIHDKFRLFTPNMKIVDLGAAPGGWSQVASKLIKASDNNLNNKIISIDL
FT                   LKIEPIVGVEFLQKDFFEKDTEELIIHGLDGKADLVMSDMASNTIGHKATDHIRTLLLC
FT                   EQAFEFALKVLKPSCHFIAKIFRGGAETALLNKVKREFRTVKHFKPVSSRSESTEIYLV
FT                   ALNKK"
FT   gene            195647..195811
FT                   /locus_tag="RT0154"
FT   CDS_pept        195647..195811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03638"
FT                   /db_xref="GOA:Q68XK4"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XK4"
FT                   /protein_id="AAU03638.1"
FT                   /translation="MYFGIDSQPCCWIYYFQLKKFLIVLAIICFDELLEKRLNMQLLLS
FT                   LVLTLYSMA"
FT   gene            complement(196020..196154)
FT                   /locus_tag="RT0155"
FT   CDS_pept        complement(196020..196154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03639"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XK3"
FT                   /protein_id="AAU03639.1"
FT                   /translation="MVIDFKNVDMLKRKDSKHINNKKLVYIWLGLASKYFRSLNLEKH"
FT   gene            complement(196185..196379)
FT                   /locus_tag="RT0156"
FT   CDS_pept        complement(196185..196379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0156"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03640"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XK2"
FT                   /protein_id="AAU03640.1"
FT                   /translation="MLDYIVFSITRLVRSGAHTISDIVEFCTNTIDSISYTTHESIEDP
FT                   NLKEQDIEDDLVEVSLIGQ"
FT   gene            complement(196373..197479)
FT                   /locus_tag="RT0157"
FT   CDS_pept        complement(196373..197479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0157"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03641"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XK1"
FT                   /protein_id="AAU03641.1"
FT                   /translation="MEKFEFVNKTEIPTHTINNTSFAHLGVNLAYKTDDISKYLAAALM
FT                   TDGNNLVGTGFEILAASCDSLNTTQYGYKAVAFINKDTKNIHIASAGTKPDINDIWDDA
FT                   LITCHYAPNKLKTAQKFVDKIIAKIGGIEKATEYTFDTSGHSLGAIVADLTGVELHSRN
FT                   LNFNKSVTFDSPGSQEVIKYAINQDLFTGKVITPIEELAKHSEVYNAKPNIINTTNQHA
FT                   GQINLVLPKINNENSESSKAVGWGEYLYNIAGSVVYKVAEYLNINKMFEGINNHKLKHF
FT                   ADLQDSTVIPIANWEEQILENNEYTQKLKAIPSTGNDVYLLETNRITDDEYTSIIGVDV
FT                   FHWAYNDLQQSCAIAAVGQVANLIPILC"
FT   gene            complement(197581..198021)
FT                   /locus_tag="RT0158"
FT   CDS_pept        complement(197581..198021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0158"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03642"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XK0"
FT                   /protein_id="AAU03642.1"
FT                   /translation="MLSFQHTKILPYKPKKLFDLVWDIKSYPQFLPWCAAARIISENNQ
FT                   EVISELVIQLKGLSEKYHSRVINKITDNGIYLIDTVAISGPFEYLKNTWQFIPHSTGTE
FT                   LKFFIDFKMTSVILDKLIGSYFTIATKKMIVAFEKRAREVIK"
FT   gene            complement(198021..198258)
FT                   /pseudo
FT                   /locus_tag="RTPG09"
FT                   /note="pseudogene of conserved hypothetical protein"
FT   gene            198319..199041
FT                   /locus_tag="RT0159"
FT   CDS_pept        198319..199041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0159"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03643"
FT                   /db_xref="GOA:Q68XJ9"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XJ9"
FT                   /protein_id="AAU03643.1"
FT                   /translation="MKYNRIYINSHLAENSKIELVRDNVHYVKTVLRLKINDSLRIFNG
FT                   SDGEFLAHITKIGKNNISVVLTEQLKKAYIEPALTLAVAIIKSDKLMLIINMATQLGIT
FT                   KIIPLITSRCQFKTVNIERLIKCVIEATEQSERLNPPIIEHAITLKDYLKKNNNLILYA
FT                   NEHEKVKNSILRISSLLANDIAIIIGPEGGFTNDELELLALYKNTQSISLGSNILRTET
FT                   AAITVIAQVRLLQCQIAI"
FT   gene            complement(199110..199382)
FT                   /locus_tag="RT0160"
FT   CDS_pept        complement(199110..199382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0160"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03644"
FT                   /db_xref="GOA:Q68XJ8"
FT                   /db_xref="InterPro:IPR007211"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XJ8"
FT                   /protein_id="AAU03644.1"
FT                   /translation="MIILHLIQRSLNMLINTSNNLLITTINLLSSIGAINWGLVGLFNL
FT                   NLVTLLFSSFPIIITIFYIIIGFCGVHSFWYSGKIFCKIGIENVK"
FT   gene            complement(199425..202451)
FT                   /gene="acrD"
FT                   /locus_tag="RT0161"
FT   CDS_pept        complement(199425..202451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrD"
FT                   /locus_tag="RT0161"
FT                   /product="acriflavin resistance protein D"
FT                   /db_xref="EnsemblGenomes-Gn:RT0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03645"
FT                   /db_xref="GOA:Q68XJ7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XJ7"
FT                   /protein_id="AAU03645.1"
FT                   /translation="MLLSTICIKRPVFATVLSLMIVALGGIFFTKLQIRSAPDISVPII
FT                   NVEAHYEGADALYMEQEITTRIEKVLKTVKNLHYITSQSSTGSSSITLSFRLSTDIEVA
FT                   LNDVRSKISDISYMFPQDMKVPSVAKLDPDNFPSLFISVESDQYSDLELTQIISNNLQS
FT                   TLDKLESVGKTQIYGGRKYIMRIEPDFKKLYQYKISLLDIETAIKEQNKDYPAGTIKTK
FT                   SNNFIVTLIGSLSTPEEFGNIIIKEQNGCIIKLQDITKISLTSPDEDIIFRYNGKNSIA
FT                   LGLIKESKANIINLSNEVTKELERIKDSIPKGISISIAYDGAKPLKASIYAVFQTMFEA
FT                   LILVVLVTYLFLASAKISLIPFVTIPVSLIGTFSVMYAFGFSINVFTLLAMILAIGLVV
FT                   DDAIVMLENIFRYNEMGYKPIEASMLASKEIGFAIITMTITLAAVFIPIGFIEGFIGKL
FT                   FIEFAWTLAFCVLFSGFVAVTLTPMMSSHIVTKHNKNFAKFLVRFHDILQFVQNRYIYY
FT                   LKLALDNKKKFVIIILSSCIVLIISFKFTNKTFVPQEDDGFLQVFLKGPEGSSLEFSIK
FT                   VVKEAEQILANYKDILGYLMVIGVGGSENVFGFIQLKDWSERSHSQKTIKNMLNKQFSK
FT                   IPGMSIFAMDPRSMVSMNASSPIEFTIQTNLEYEDLDKISQQFIDIMQTKPIFLNVNRN
FT                   LQSAIPTINIEVNRDKAYLYGMDLANIGKTLEYLLAGRQIGAFRMGNNLYDVILQFNQK
FT                   DRQNISDLSKILIRTKNNNMLPLESIANIKEKISFKSYYHYNNSKSVTISSDLAPNVKI
FT                   NDAINIINKIATQLLDPNNAIIEYIGEIKQMEEIDNNILITFVFSLVFIYLVLAAQFES
FT                   FTDPLLILLAVPFSITGGVLALLITGDSINMYSNIGLITLIGLVTKNSIMIVEFANQIR
FT                   AKGVNVREAIIESSKLRLRPILMTTITAIVGALPLVFADGAGAAARNSIGFVIVGGLSI
FT                   GTIFTIFVIPVIYQTFKKD"
FT   gene            202937..203236
FT                   /gene="hupA"
FT                   /locus_tag="RT0162"
FT   CDS_pept        202937..203236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupA"
FT                   /locus_tag="RT0162"
FT                   /product="DNA-binding protein HU"
FT                   /db_xref="EnsemblGenomes-Gn:RT0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03646"
FT                   /db_xref="GOA:Q68XJ6"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XJ6"
FT                   /protein_id="AAU03646.1"
FT                   /translation="MNKTEFIAYMTEHCHNNKHAAHKTLTKADAEKALNLVIDSVISAI
FT                   KSKHNVNLTGFGSFEIHHRKAREGRNPKTGAKMTIDAYNQPTFRAGRKLKEACN"
FT   gene            203347..204141
FT                   /gene="holB"
FT                   /locus_tag="RT0163"
FT   CDS_pept        203347..204141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="RT0163"
FT                   /product="DNA nucleotidyltransferase (DNA-directed)"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:RT0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03647"
FT                   /db_xref="GOA:Q68XJ5"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XJ5"
FT                   /protein_id="AAU03647.1"
FT                   /translation="MTILKPLIIELLEFHLKYNKLYNSWLIEAGNIEQALQDLEEFIYI
FT                   KLFKSNIMLENNPDYYFVARDNAKNISIGQIRKLQDFLNKTSAISGHKVAVIYTADFMN
FT                   LNAANACLKILEDAPKNSYIFLITSRAASIISTIRSRCFKVNIRAPLPNVRNDLYLQFI
FT                   QPIADNKTLDFINRFTTKDRELWLGFIENLLLLMNRILKKSANFNIDLLDLENKIFNKL
FT                   NKNPSYLLQKFTDIKELIYNTIDYDLDLKTSYILVVNEFFTV"
FT   gene            204694..206043
FT                   /gene="ffh"
FT                   /locus_tag="RT0164"
FT   CDS_pept        204694..206043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ffh"
FT                   /locus_tag="RT0164"
FT                   /product="signal recognition particle protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03648"
FT                   /db_xref="GOA:Q68XJ4"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XJ4"
FT                   /protein_id="AAU03648.1"
FT                   /translation="MFKTLTQNLTKIFDRLVNSGILTENQIDTAMRDVRVALLESDVAL
FT                   PVIKGFIAEVKQKALGQEVIKSVSPGQMIIKIIHEEMINLLASSESTTKLNLNSKPPVN
FT                   LLMVGLQGGGKTTASGKLALLLKNQNKKVLLVSLDTYRPAAQEQLAIIANSVNIDSLPI
FT                   VQGEQPLDIVKRAISEAKIFAYDVVIYDTAGRIQIDNVMMEEALAIKKILNPTETLLVI
FT                   DSMTGQDAVVTARSFSDKLEISGLILSRIDGDTKGGAALSVKYLTQKPIKFLSCGEKLT
FT                   DLEEFDAERLASRILDMGDIISFVKKAASIVDREEAERTAIKLKSGKFDLNDYLKHMRS
FT                   IKKMGGFGSILSMLPGSGKIIDQIDQSKLDSRIIEHQEAIILSMTLKERKNPDIINASR
FT                   RKRIAAGAGMTVQKVNILLKQYKQISAVMKKASKMNPQNLFRSGISKLFS"
FT   gene            complement(206220..208382)
FT                   /gene="ppcE"
FT                   /locus_tag="RT0165"
FT   CDS_pept        complement(206220..208382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppcE"
FT                   /locus_tag="RT0165"
FT                   /product="Post-proline cleaving enzyme"
FT                   /EC_number="3.4.21.26"
FT                   /db_xref="EnsemblGenomes-Gn:RT0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03649"
FT                   /db_xref="GOA:Q68XJ3"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="PDB:4HVT"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XJ3"
FT                   /protein_id="AAU03649.1"
FT                   /translation="MIKIICYLTIILLTFCIDAMEDNNKQIFNPKETKFLEEAEGVEAL
FT                   EWAKERTSKTEKALQAMQEYKQIKKEIETIFYDQRKTPYGVIRKGYVYNFWMDDKNPQG
FT                   LWRRTLVDNYSKDKPNWEVLIDFDKLSKKIGKKVAYRGVSNCFQNPNRYLISMSFGGKD
FT                   EMFFREWDLEKKDFVKNGFEPITNSGKLLEGKFTYPTWINKDTIIFNLVLHKNEITSSL
FT                   YPNSLYIWKRGESIEKAKKLFEVPKEYIYVSAGKLLSDTISSSLIFISANKDFYNYDNY
FT                   ILDTKYKNLKLQKINMPSDATLQGSFKEYVFWLLRSDWKFKSHNIKAGSLVALHFTDLL
FT                   KTESDKTSLKILFTPTANEVFNFISTTKDRVFLATYDNVVAKVVTFTLENEQWTKPVVL
FT                   KLPYQNAIFGMSSYEEEEEALITIENSIVPPTIYLWVKTHELKIIRKALYSFDSENYVL
FT                   EQKEATSFDGVKIPYFLVYKKGIKFDGKNPTLLEAYGGFQVINAPYFSRIKNEVWVKNA
FT                   GVSVLANIRGGGEFGPEWHKSAQGIKRQTAFNDFFAVSEELIKQNITSPEYLGIKGGSN
FT                   GGLLVSVAMTQRPELFGAVACEVPILDMIRYKEFGAGHSWVTEYGDPEIPNDLLHIKKY
FT                   APLENLSLTQKYPTVLITDSVLDQRVHPWHGRIFEYVLAQNPNTKTYFLESKDSGHGSG
FT                   SDLKESANYFINLYTFFANALKLKIN"
FT   gene            208609..209784
FT                   /gene="hemN"
FT                   /locus_tag="RT0166"
FT   CDS_pept        208609..209784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemN"
FT                   /locus_tag="RT0166"
FT                   /product="Coprogen oxidase"
FT                   /EC_number="1.3.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:RT0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03650"
FT                   /db_xref="GOA:Q68XJ2"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XJ2"
FT                   /protein_id="AAU03650.1"
FT                   /translation="MSRVPMRVMTNDLSIYIHWPFCLSKCPYCDFNSHVVSTIDYNQWI
FT                   KSYEKEIEYFKFIIQNKYIKSIFFGGGTPSLMHPLIVEVIINKINNLGIIDNKTEITLE
FT                   TNPTSFEAEKLKAFKSAGINRISIGVQSLKEDDLKTLGRTHDSMQAIKTIEAANTIVPR
FT                   VSFDLIYARNGQTLKDWEEELKQAMSLATSHIALYQLTIEKGTPFYKLFKNGNLILPSV
FT                   DEAAEMYEWTNHYLESKKYFRYEISNYAVLGHECLHNLTYWNYNSYLGIGPGAHSRIIE
FT                   NANSVLAIMMLHNPAKWLDAVRIKNVGIQTHAKLTNQEIIEEILMMGLRLRKGINIPTL
FT                   EQKLSAKLENILDMNNLQHYQNQGLIKLDEHIYLTDKGLMLHNYIVPRLIR"
FT   gene            complement(210637..211836)
FT                   /gene="gltP"
FT                   /locus_tag="RT0167"
FT   CDS_pept        complement(210637..211836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltP"
FT                   /locus_tag="RT0167"
FT                   /product="proton/sodium glutamate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:RT0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03651"
FT                   /db_xref="GOA:Q68XJ1"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XJ1"
FT                   /protein_id="AAU03651.1"
FT                   /translation="MKLWQKVTLGLILGIIFGIYLPQYVNYIKPIGDIFLRLIKMIITP
FT                   LIFFSLVSGITSMNDTSALGRVGMKAVAAFLGTTFFATIFGLTIALALKPGVGIHIDFT
FT                   ALSTTGRTSFNIIDFFVNIIPENAVMAFANGNILQVVFFAIFVGITLNKMKSIDKPITD
FT                   LIHAISKLILKMISFVIQLSPYGAFALTGWIIGMQGFGVMISLSKLVVAVIVAMTCQYL
FT                   VFGLLIYIFCRVSPIPFYKKSFEYQILAFSTSSSKATLATTMQVCREKLGISESSTSFV
FT                   LPIGASINMDGFAINLSLTTIFFAQMMGITLAPHDYLVIILTSTLGSIGGAGIPGASLI
FT                   MLPMVLSSVHLPIEGVAIIAGIDRILDMLRTTINITGDATITMIIDNSEDTLDKKVYLS
FT                   "
FT   gene            complement(211874..212323)
FT                   /gene="cutA"
FT                   /locus_tag="RT0168"
FT   CDS_pept        complement(211874..212323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutA"
FT                   /locus_tag="RT0168"
FT                   /product="probable periplasmic divalent cation tolerance
FT                   protein CutA"
FT                   /db_xref="EnsemblGenomes-Gn:RT0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03652"
FT                   /db_xref="GOA:Q68XJ0"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR022438"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XJ0"
FT                   /protein_id="AAU03652.1"
FT                   /translation="MKHPDTKNNLQEINDSVSRAAVHTKMHGHPKTYKDNIANFLSSSS
FT                   IKDYCLILTTTNDLQIAEKIASILLELNLAACIQIDNIKSYYRWDNKTIIENEHRLVIK
FT                   TKSYNYNAIENKILEIHNYALPQIIKINIDYGYQQYLKWIDQNSK"
FT   gene            complement(212345..212761)
FT                   /locus_tag="RT0169"
FT   CDS_pept        complement(212345..212761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0169"
FT                   /product="6-pyruvoyl tetrahydrobiopterin synthase"
FT                   /EC_number="4.2.3.12"
FT                   /db_xref="EnsemblGenomes-Gn:RT0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03653"
FT                   /db_xref="GOA:Q68XI9"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XI9"
FT                   /protein_id="AAU03653.1"
FT                   /translation="MIKCTRRIDFDAGHRIIGHKNKCQFLHGHHYVLEITIAANKTDKL
FT                   GMVIDFGLIKNLAKKWIDANFDHNLILHQDDKEIGKQIENYTGQKIYYMRNNPTAENIA
FT                   IHLKNEIFPKLFIDQNFFVTSLKLYETQNCFVEV"
FT   gene            complement(212929..214125)
FT                   /gene="sucB"
FT                   /locus_tag="RT0170"
FT   CDS_pept        complement(212929..214125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucB"
FT                   /locus_tag="RT0170"
FT                   /product="dihydrolipoamide S-succinyltransferase"
FT                   /EC_number="2.3.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:RT0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03654"
FT                   /db_xref="GOA:Q68XI8"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XI8"
FT                   /protein_id="AAU03654.1"
FT                   /translation="MSIKIIIPSLGESVTEATIAKWYKKLGDAVKTDELLLEIETDKVT
FT                   LEVNAPCNGTIGKISKTDGANVTVGEEVGEINEIADTDTAWINNKKQEVSQHTSEQLVD
FT                   KPAMASNILAPSVQKLVTENKLDPNNIKGTGRGGRITKYDVLETINTTPITIETHAINK
FT                   TNEERTQRVRMSRLRKTIAQRLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEFEKKHT
FT                   VKLGFMSFFVKATIEALKLIPSINAEIDGDDLLYKNYYDIGVAVGTEQGLVVPVIRDAD
FT                   KMSFADIEQAIGNLAKKAREGKLSISDLSGGTFSISNGGVYGSLLSTPIINPPQSGILG
FT                   LHKTEERAVVIDGKIEIRPMMYIALSYDHRIIDGKEGVSFLVKIKNLIENPEKLLLNL"
FT   gene            complement(214165..216966)
FT                   /gene="sucA"
FT                   /locus_tag="RT0171"
FT   CDS_pept        complement(214165..216966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucA"
FT                   /locus_tag="RT0171"
FT                   /product="Alpha-ketoglutaric dehydrogenase"
FT                   /EC_number="1.2.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:RT0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03655"
FT                   /db_xref="GOA:Q68XI7"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XI7"
FT                   /protein_id="AAU03655.1"
FT                   /translation="MEKYFNKTGYLFAGNAVFVEELYRQYLANPNSVDQTWQEFFADIK
FT                   DNNALLNKSTAKVIRPNPNVTKALLNNNLSYEGLHNLKAKEMISAYRRNAHYLANLDPL
FT                   GLEIRKTKDELKLNIEAFGLDSSQLEENINITDEFIGTWNCKLSELVTKLDKVYTSSIG
FT                   VEFDQIENVEEKNWLYTKLETEITFASEEKRSILNDFVEVECFEQFLHTKFPGAKRFSI
FT                   EGGDSSIVAMNKAIDLSMNQGVEEIVIGMAHRGRLNTLTKVVGKPYKAVIAGFINGNVF
FT                   PDELNISGDVKYHLGYSADRVRANQKIHLSLADNPSHLEAINSIVAGKVRAKQDMLVDT
FT                   KRSKVKAILLHGDAAFCGQGVVAESLSMSPLTAYNVGGILHFVINNQLGFTANAADTRA
FT                   SRYSTEFAKIIAAPILHVNGDDIEAVLKATDIAVEYRQKFSKDVVVEIICYRKYGHNEG
FT                   DEPMYTQSKMYNIIKSKPTPGNIYANELVKSGIIDNNYYAKLKEKFKIKLDKEYEQAKS
FT                   YKQESHFLGGCWKGISRTRGKAAITGVNKKILQDLGTKLCEIPKDFTINPKLVRLFEVR
FT                   KNTLTTDQPIDWATAEQLAFAHLLCSGTNIRLTGQDSERGTFSHRHSILHNQIDDTTYI
FT                   PLNNLSKTQAQYEVANSNLAEYAVLGFEYGYSLASPKNLVLWEAQFGDFANGAQIIFDQ
FT                   FISSSATKWLRMSGLVVLLPHAFEGQGPEHSSARLERFLQLAAEENMYITYPTTPASIF
FT                   HLLRRQILESIRKPLIVMSPKSLLRHKYAVSKLDELGENTTFIPVLDEVTKIDKNNITK
FT                   VILCSGKVYYDLFAKRVHNSNIVIIRLEQLYPFEKTLVASLLKKYNKAQAFIWCQEEPK
FT                   NMGAWNYIAEHLNDALKEAEINNEFKYVGREESASPAVGSLQVHNKQQEKLLMEALGDD
FT                   IIK"
FT   gene            complement(217326..218498)
FT                   /locus_tag="RT0172"
FT   CDS_pept        complement(217326..218498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0172"
FT                   /product="Carboxypeptidase Taq"
FT                   /EC_number="3.4.17.19"
FT                   /db_xref="EnsemblGenomes-Gn:RT0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03656"
FT                   /db_xref="GOA:Q68XI6"
FT                   /db_xref="InterPro:IPR001333"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XI6"
FT                   /protein_id="AAU03656.1"
FT                   /translation="MNSNYTALENEFATSPHFNNILSCDVAVNFPINSSSRTNEIITLT
FT                   SFIHAMIESSIFKELISKAKEKSNNLNKWQDIRKIKKKITDTNCINKQLKKKLVAATTT
FT                   TEHTWSKAIKNNDYNLFKTHLQKVSDYTEEVTKVREAVLNCGLYDSLINLSKKSSKIKQ
FT                   VFSVLKTALPELIKHTSKKELVQNSELASEMRKLIMQHIMQIMQFDLIKARLDEAIHPF
FT                   CVWTAHYARLTTRYKYSFISGLMYIINETEYALYEQNLLEIYKGQQVWLAKGIAFHESK
FT                   SLFMAISRSKKFTEFLAKLLQDEFALKKEEYSAENLYSKTTRVKPDFIRVKAAELTYLM
FT                   HIILRFEIKEILINGDLHLDELPKFWDSKMYESLVNIPVNFNNGCLQDIN"
FT   gene            complement(218612..220276)
FT                   /gene="recN"
FT                   /locus_tag="RT0173"
FT   CDS_pept        complement(218612..220276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recN"
FT                   /locus_tag="RT0173"
FT                   /product="DNA repair protein RecN"
FT                   /db_xref="EnsemblGenomes-Gn:RT0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03657"
FT                   /db_xref="GOA:Q68XI5"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XI5"
FT                   /protein_id="AAU03657.1"
FT                   /translation="MFYSLSVKNFILIDELEIEFNKGLCVITGETGAGKSILLDAILFC
FT                   LGYKTSNNVIKHGKDYTVVNIIFSLNDEIKKFLIQNFIEPEELLLVKCLQKVEGRKNFF
FT                   INNQIVTKTLMKQLANYLFELHGQNNNITLLEASTQRDILDSYGNLLEFRVQLAKCYQI
FT                   WQNTRKEIEEITVKQNEIEQEIDYLSFVTEELTKLNIQIGEEETLTNIRKDLQNKGKNL
FT                   QLIRDIIAEINNPEINISINRACKLLARQDYNDRFNAVVTSLEEAYNNLEVARQELSNI
FT                   LGSFTYEEYNLEETEERLFLIKAISRKYNVPANELGIFLDKSLEQLGILKNKIANSNKL
FT                   QAQEVLLQEQYYKLASDLSAKRLIAAKHLEESLNQELKQLKMENANFKIEVKTRIDPTA
FT                   SGNDDIVFKASTNPGMKIEAINKIASGGELSRFMLALKTSLFDKMIKPSIIFDEIDVGI
FT                   AGEAADKIGDRLKKLSSVTQVIVITHQPQVAGKADLHIKIEKTQLEQETKVKVKALNLA
FT                   ERQTELARMISGKTITAASLKVAKELLHPVAFSHDQK"
FT   gene            complement(220284..221039)
FT                   /locus_tag="RT0174"
FT   CDS_pept        complement(220284..221039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0174"
FT                   /product="probable lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03658"
FT                   /db_xref="GOA:Q68XI4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR017689"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XI4"
FT                   /protein_id="AAU03658.1"
FT                   /translation="MKLTKLLSAFLVIGLILSGCKSKKNSNDIVVPIATLYNEGIILLD
FT                   KKKYKKAAEEFGKIFYQHPGNEMTPQAELMQAYALFLAAQYEEAVDILDMFINLHPANV
FT                   DIAYAYYLKALSYYMLISDVNHDQSRTFLSKDSFEDVITKFPNTKYAIDASLKIDLVND
FT                   HLAGKEMMIGRFYLKKKNPIAAINRFEEVIDNYQTTYHSVEALYRLVESYMMLGLHDEA
FT                   KKYASVLGYNYPDSKWYSYAYRLVKNYQN"
FT   gene            complement(221478..222590)
FT                   /gene="dnaJ"
FT                   /locus_tag="RT0175"
FT   CDS_pept        complement(221478..222590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="RT0175"
FT                   /product="chaperone protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:RT0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03659"
FT                   /db_xref="GOA:Q68XI3"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XI3"
FT                   /protein_id="AAU03659.1"
FT                   /translation="MSQDYYQVLGVSKTASQADIKKAYLKLAKQYHPDTTNAHDAEKKF
FT                   KEINAAYDVLKDEQKRAAYDRFGHDAFQNQQARGGGNNSGFHHDINDIFGDFFSDFMGS
FT                   GRRKQTSSKIRGSDLKYDLTIKLEEAFHGIEKNISFSSEVKCDACHGTGSEKGETVTTC
FT                   DSCGGVGVTRIQQGFFTLEQTCHKCQGNGQIIKNPCKKCHGMGRYHKQRNLSINIPAGV
FT                   ENGTRIRHSGEGEAGIRGGNNGDLYVDIAIKPHDIYKIDGANLHCKLPISFVHAALGGE
FT                   IEVPVIEGGKVKLTIPAGTQNGDQLRLRSKGMSKIRSTIRGDMLTHIHVEVPKNLSKRQ
FT                   RELLEEFKKESINEKENDSSFFNKMKSMWS"
FT   gene            complement(222712..224595)
FT                   /gene="dnaK"
FT                   /locus_tag="RT0176"
FT   CDS_pept        complement(222712..224595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="RT0176"
FT                   /product="chaperone protein DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:RT0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03660"
FT                   /db_xref="GOA:Q68XI2"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XI2"
FT                   /protein_id="AAU03660.1"
FT                   /translation="MGKVIGIDLGTTNSCVAVMEGKEPKVIDNAEGERTTPSIIAFANS
FT                   ERLVGQPAKRQAVTNPRNTIYAVKRLIGRNFTDPMVRKDQGLVPYNIVKADNGDAWVEA
FT                   DNNKYSPSQISAFILQKMKETAENYLGEKVTQAVITVPAYFNDAQRQATKDAGKIAGLE
FT                   VLRIINEPTAAALAYGFEKSSSKTIAVYDLGGGTFDVSILEISDGVFEVKSTNGDTFLG
FT                   GEDFDTRILNHLIDVFKKDSGIDLSKDPLALQRLKEAAEKAKKELSSTSATDINLPYIT
FT                   ADSTGPKHLNIKFTRAELEKLVDDLIEKTIEPCRQALKDAGFKPTDIQEVVLVGGMTRM
FT                   PKVQEAVKKFFGREPHKGVNPDEVVALGAAIQGGVLNKEVTDILLLDVTPLSLGIETLG
FT                   GVFTRLIDRNTTIPSKKSQVFSTADDNQHAVTIRVFQGEREMAKDNKLLGQFNLEGIPP
FT                   APRGVPQIEVTFDIDANGIVHVSAKDKASGKEQKVTIQASGGLSDSEIEQMVKDAEHNA
FT                   DEDKKRKELIETKNAADSLVYSTEKTLREYGDKLSSEEKGAVEEALASLKSALESEDAS
FT                   LIKEKTNNLTAANMKIGETMYKAQTENQHSEANTVNDEKVVDADFQDVDKK"
FT   gene            224874..226367
FT                   /locus_tag="RT0177"
FT   CDS_pept        224874..226367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0177"
FT                   /product="serine protease, HtrA/DegQ/DegS family"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03661"
FT                   /db_xref="GOA:Q68XI1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XI1"
FT                   /protein_id="AAU03661.1"
FT                   /translation="MILQEVKMKKLPILLKLVFIINLVLMNNIVLASSDTNTAIFEKAK
FT                   KAIVTIDTRIAVSAYDDTSSWTGTGFINDKNNGYIITNTHVVGGASIGTYFVTFYNGEQ
FT                   TEAKLIYYDIWQDYAILKVESKDIPVSAMQIAFTSELPKLNQKVFVVGNTEAKGFSFHT
FT                   GYLSDLYHIEGLMPQCTYVINLNTTGGASGSPVLNDKIEAIGVLYGGGKTHSLALHGDY
FT                   VARTLESLKNNKQPSRKHIGIISELYSLNKAVRYHNFPKDEMYKYINKFPDSRNRVISV
FT                   KAVLAGSPAQKSLKAGDIIWAVNDQELGGNLALFDREMDNFKGVTIKLTIFRDGKKLEK
FT                   AVDLYDVNNNKIAKMINFGGAVFFESDDYFSNKSGIPLKALSVASVQAGSSFSSIPTFF
FT                   NKDYKNVYRLQIFEMKDLALNTLDDLIKFLPAITQQKFITVRFRNYQPYYANFGYNELI
FT                   ASHNDMIADITLDSIDTKPYVLKYNTMSHDWDMENIKLQ"
FT   gene            227318..227791
FT                   /locus_tag="RT0178"
FT   CDS_pept        227318..227791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0178"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03662"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XI0"
FT                   /protein_id="AAU03662.1"
FT                   /translation="MHFLFIIISFCLMSSCNLKSVYSEKYSRNNDLEAIKVEPIRTIEG
FT                   AEFYHHLTRILPQKAKAKYLLKAELSATTMPATIEKNSNILREDINQLVRYKLLDIESQ
FT                   NILIEETFCQNTSYNAIFTPYATNVERYGTGIDLAYQAAEEIRSRLILYFIRQ"
FT   gene            227799..228764
FT                   /locus_tag="RT0179"
FT   CDS_pept        227799..228764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0179"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03663"
FT                   /db_xref="GOA:Q68XH9"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XH9"
FT                   /protein_id="AAU03663.1"
FT                   /translation="MKFYFSQIGKLFELIAAGKIKALLLYGPDKGYIEKICTRLVKNLN
FT                   MLLSSIEYEDLNILSFEILLNSHNFFGQKELIKIRSIGNSLDKNLKTILSSDYINFPVF
FT                   IGEDMNSSGSVKKFFETEEYLAAVACYHDDEAKIERIILAKLAKTNKVISKEAITYLKT
FT                   HLKGDHALICSEINKLIYFVHDVHEITLNHVLEVISSEITANGSNLAIYFSKKDYSNFL
FT                   QELDILKKQNINEVLIIRALIRHYLNLYIVLSKVKNGECLELAIKSLSPPIFYHNINDF
FT                   INIAHALSLTECLKTLKLLQQAEVDYKLNPASFDLFQSIL"
FT   gene            228891..229427
FT                   /gene="coq7"
FT                   /locus_tag="RT0180"
FT   CDS_pept        228891..229427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coq7"
FT                   /locus_tag="RT0180"
FT                   /product="ubiquinone biosynthesis protein CoQ7"
FT                   /db_xref="EnsemblGenomes-Gn:RT0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03664"
FT                   /db_xref="GOA:Q68XH8"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XH8"
FT                   /protein_id="AAU03664.1"
FT                   /translation="MPRPDFSNLDKQIHDIIRVNHAGEYGAKRIYQGQLKYIKSQNDRM
FT                   LIKEMLDNEAVHLNFFEKKILERAVRPTVLLSFWHHYGFLLGALSSLIGIKTAMLVTES
FT                   IEEVIAKHYEQQINYLENRNVESELLNNLIKFRLEEIEHKNIAVIYSTNAIFADIISKI
FT                   VKIICHISILLSKKI"
FT   gene            229960..230742
FT                   /pseudo
FT                   /locus_tag="RTPG10"
FT                   /note="pseudogene of cytochrome c oxidase subunit III"
FT   gene            230866..231252
FT                   /locus_tag="RT0181"
FT   CDS_pept        230866..231252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0181"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03665"
FT                   /db_xref="GOA:Q68XH7"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XH7"
FT                   /protein_id="AAU03665.1"
FT                   /translation="MLIFLEVKYMNFHNRKLDEELIDYNISLRILFTILSVAIIMVAFD
FT                   SLATSVSDPVGDALCKLIKVFRGNTAKGIAVVGIIVLGIQTLRGKLQWEVALVVVTAII
FT                   ILFKAPDIVNMVSSDNNSSNCGVS"
FT   gene            complement(231515..232138)
FT                   /locus_tag="RT0182"
FT   CDS_pept        complement(231515..232138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0182"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03666"
FT                   /db_xref="GOA:Q68XH6"
FT                   /db_xref="InterPro:IPR011723"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XH6"
FT                   /protein_id="AAU03666.1"
FT                   /translation="MYITCPNCNTQFIVTSNQIGINGRRVKCSKCKHLWYQKLDYNNSK
FT                   LNDFKDKINTETVTTPTKNHYNTNVPVILPRKKEYKIFPILWSSFIIFCLVILLIDSFK
FT                   FLGKYDQLKIEAINLGEYHHMNGMKIFYKLSNESDYLITNPLIKVRVIDSNNHTLDEYA
FT                   SITKLRTKIHAKQAIYLELNIDKIPVNAKYIDITICNRLGLLFK"
FT   gene            232221..233045
FT                   /gene="dapD"
FT                   /locus_tag="RT0183"
FT   CDS_pept        232221..233045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="RT0183"
FT                   /product="Succinyl-CoA:tetrahydrodipicolinate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /db_xref="EnsemblGenomes-Gn:RT0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03667"
FT                   /db_xref="GOA:Q68XH5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XH5"
FT                   /protein_id="AAU03667.1"
FT                   /translation="MSDIIKEIEEAWQIKENILNDSLKLIKLKSILNESIKSLNQGIIR
FT                   VCEKQGNQWKVNEWVKKAILLYFITTESQLYNNNYNSWYDKVAPKFPADTDKNIFKEAA
FT                   IRKVPGAIVRTGTYIAKNVVIMPSFINIGAYIDEGTMIDTWATIGSCAQIGKNCHISGG
FT                   SGIGGVLEPLQAKPVIIEDNCFVGARSEIAEGIIVEEGSVISMGVFIGSSTKIVYRDTG
FT                   KIIYGRIPAYSVVVPGVLPSPEAGKPGLYCVVIVKQVDKTTRAKVSINDLLR"
FT   gene            233126..233230
FT                   /locus_tag="RT0184"
FT   CDS_pept        233126..233230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03668"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XH4"
FT                   /protein_id="AAU03668.1"
FT                   /translation="MVEENNKLHQVPINDYWSINVDNDNLFLVIVHIC"
FT   gene            complement(234789..237119)
FT                   /gene="pbpC"
FT                   /locus_tag="RT0185"
FT   CDS_pept        complement(234789..237119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbpC"
FT                   /locus_tag="RT0185"
FT                   /product="membrane carboxypeptidase/penicillin-binding
FT                   protein PbpC"
FT                   /db_xref="EnsemblGenomes-Gn:RT0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03669"
FT                   /db_xref="GOA:Q68XH3"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR009647"
FT                   /db_xref="InterPro:IPR011815"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XH3"
FT                   /protein_id="AAU03669.1"
FT                   /translation="MCLKSKLLLITINGIIILYFAITPSPLLEDISFSQRVFDRNNKLM
FT                   RISLSKDDKYRIFTPINEIPTTFIKAVLLYEDKHFYKHFGINPLSLAKAFYSTYVQNNR
FT                   KIGGSTITMQIARLRYGINSSTILGKIHQIIKAIHIELHYSKDHILEAYLNLVPYGSNI
FT                   EGIAAGSYIYFNRDLKDLNLIEILSLVVISQNPLKRGGNYVNILKARKYLFNKWITTHQ
FT                   EDIIYDKLISLPIKFNRHKDLPFIAPHFTLEILANNDNPIIYTTIDKNLQTTIEKQVKL
FT                   YINNQKKYGIYNAAVILIDFTTMEVLTSIGSGDFFNNDICGKINGTKIYRSPGSALKPF
FT                   VYALSFDQSLIHPLTLLKDTPTYYDYYKPENFDSRFAGVLSAKEALIKSRNIPVIFLAS
FT                   KLKNPNFYEFLQQAKISGLRKPENYGLSIVLGTVEMTLEELITLYAMLANFGTYQPLRK
FT                   NLMSSRSLSIGSRNNKFDHIDKIQDNINNVLLSPEASYLTLDILKDTTRPITYNISHNL
FT                   PIYWKTGTSSSFRDALSVGIFGKYVLAVWVGDFKGQTYGTFTGNISAAPLFFNIIEAIT
FT                   RPNKDEDLILSKIHELNITKVKVCADTGDIDNDMCPVKTETLFIKGKSPIKQSDIYKKI
FT                   LIDLKTGMPTCQFFKGQTAYKIINLLPTDILLIYQKAGIHILPKPIPKNNCNKFINWYY
FT                   QKPKIIYPVKNSLHSIKESDTITFSAISNNKTNKIFWFVDNKLIATAKPNEPVIWKAKI
FT                   GEFTISAISDSGKSDSIKIYIKE"
FT   gene            complement(238564..239010)
FT                   /locus_tag="RT0186"
FT   CDS_pept        complement(238564..239010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0186"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03670"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XH2"
FT                   /protein_id="AAU03670.1"
FT                   /translation="MTKNTIFKNILIPIDLNDKKSIKSIFSKALMLAINFQAKLHFMYV
FT                   MPEFGTKMFEDYLPKNWRTEKKEKYQTQIKDIIKQYIPDTIETDDYIGSGAVYDEIIKH
FT                   SNEIKADLIIISAVRLQLKDYMLGPNASKIVRHSDISVLVLRDE"
FT   gene            complement(239015..239956)
FT                   /locus_tag="RT0187"
FT   CDS_pept        complement(239015..239956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0187"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03671"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XH1"
FT                   /protein_id="AAU03671.1"
FT                   /translation="MNNLKLLTIISIFLICSNIYAATKIIKIGTGSILKGYYAIGLDLC
FT                   KTITSDYKNNEHIKCEVVITNGSIENLKLLQQGKIDLALVQANIAVEAYEGIGYYRNQE
FT                   KMQNLRQVLNLHDEFFTVIVRDDNRIKVFADIDGKKITNGPEFSSSNITYDTIRSLYKF
FT                   SNESEELNINYEDSIEKFCNKEIDAIIMMIGHFNPLVNLISHKCKINFVSIENDKITEL
FT                   IKQNRAFNKAILNKSLYPWITDYHTTVKVSAILVTRDEVNSDILDKFIGAFHRNVANFK
FT                   LSNYLLNNLDIHYFVDTKNFVLPKHNAVRSKN"
FT   gene            complement(239961..241028)
FT                   /locus_tag="RT0188"
FT   CDS_pept        complement(239961..241028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0188"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03672"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XH0"
FT                   /protein_id="AAU03672.1"
FT                   /translation="MIRKILLFVFLAFTIIWFSTAYTIKNNVVSLIKNSESDNLRIYYN
FT                   AVKFSGYPFNWKIHITDPKVKLIDHVNSQEFTCKNIVINISFNTKRAALNFGPFIKVDN
FT                   YGDKTFTYNVHSNNDINGIGKFNKPLYKVSQDDSLKEILKSIKFNNKALSIFKGHQEIF
FT                   KINDLAFLIQKHNLASQENISLFLNMHYYSENDILNFKNANVDMATSFKFAKNGKDASI
FT                   LENFNIERFIFICDNDSKVNLNGTLQFFTNKLPKGILSFELENYNAIVDKLLPNNILFS
FT                   KKTIKTIIAKAMNKTSDEQLNTDNNNTNSVYNNIKNAKFDIAFSDKGINIGSINLLELT
FT                   LGEYKAEKNTENNPN"
FT   gene            complement(241025..241378)
FT                   /gene="fdxB"
FT                   /locus_tag="RT0189"
FT   CDS_pept        complement(241025..241378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdxB"
FT                   /locus_tag="RT0189"
FT                   /product="ferredoxin, 2Fe-2S (andrenodoxin-like)"
FT                   /db_xref="EnsemblGenomes-Gn:RT0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03673"
FT                   /db_xref="GOA:Q9AKC4"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR018298"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9AKC4"
FT                   /protein_id="AAU03673.1"
FT                   /translation="MLRKIKVTFIINDEEEKTVEAPIGLSILEIAHSNNLDLEGACEGS
FT                   LACATCHVMLEEEFYNKLKKPTEAEEDMLDLAFGLTDTSRLGCQIILTEELDGIKVRLP
FT                   SATRNINYNGFKK"
FT   gene            complement(241443..243203)
FT                   /gene="hscA"
FT                   /locus_tag="RT0190"
FT   CDS_pept        complement(241443..243203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hscA"
FT                   /locus_tag="RT0190"
FT                   /product="DnaK-like chaperone protein HscA"
FT                   /db_xref="EnsemblGenomes-Gn:RT0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03674"
FT                   /db_xref="GOA:Q68XG8"
FT                   /db_xref="InterPro:IPR010236"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XG8"
FT                   /protein_id="AAU03674.1"
FT                   /translation="MQIIEITEPKQTDCQQKLQIAVGIDFGTTNSLIAIATNRKVNIIK
FT                   SKGDKELIPTTIDFINEDLIIGNNKGLRSIKRLFGKTLKEILNTKTLFALVKDYLDINS
FT                   SELKLNFANKKMRIAEIAAEVFIYLKNQAEKQLKNNITKAVITIPAHFNDTARGEIMLA
FT                   AKIAGFEVLRLIAEPTAAAYAYGLNRNQTGRYLVYDLGGGTFDVSILNIQEGIFQVIAT
FT                   NGDNMLGGDDIDVVITQYICNKFDLPNSSETLQLAKKAKETLTYKESFNNDIISINKQT
FT                   LEQLIFPLVKHTINITQECLEQSGNPNIDGVILVGGTTRIPLIKDELYKAFKINILSDI
FT                   DPDKAVVCGAALQAENLIAPHTNSLLIDVVPLSLGIELYGGIVEKIIMRNTPIPIAVIK
FT                   EFTTYADNQTGIQFHILQGEREMAADCRSLARFELKGLPPMKAGNIRAEVTFAIDADGI
FT                   LSISAYEKISNISHTIEVKPNHGIDKTEIEIMLENAYKNASIDYTTRLLQEEIIETEAL
FT                   ISNIERSIIELTTLLSESEISIINALFDNIKYAVQTRDQTLIKHSIKEFKSKIKNIWIQ
FT                   NIININDLRK"
FT   gene            complement(243194..243694)
FT                   /gene="hscB"
FT                   /locus_tag="RT0191"
FT   CDS_pept        complement(243194..243694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hscB"
FT                   /locus_tag="RT0191"
FT                   /product="DnaJ-like chaperone protein HscB"
FT                   /db_xref="EnsemblGenomes-Gn:RT0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03675"
FT                   /db_xref="GOA:Q68XG7"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004640"
FT                   /db_xref="InterPro:IPR009073"
FT                   /db_xref="InterPro:IPR036386"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XG7"
FT                   /protein_id="AAU03675.1"
FT                   /translation="MQNYFQLLELPQEYNIDLKILEKQYFAMQIKYHPDKAKTVQEKEQ
FT                   NLIIATELNKAYSTLKDALKRAEYMLLLQNINLNDEKIRSLLSPLELSIFWNEMERIEN
FT                   TILFSDLEKIKHKYELMQQQNINSLKQAFEKRNLSDATIHTSKLKYIRTLQNKLQEKIK
FT                   SCK"
FT   gene            243899..244480
FT                   /gene="rnhB"
FT                   /locus_tag="RT0192"
FT   CDS_pept        243899..244480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="RT0192"
FT                   /product="Endoribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:RT0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03676"
FT                   /db_xref="GOA:Q68XG6"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XG6"
FT                   /protein_id="AAU03676.1"
FT                   /translation="MEVNLLQYEQKYHNYIVAGVDEAGRGSLVGPVVASAVIIDKVDII
FT                   SGIKDSKKLSKNKRDILYEQITSNYVWSTAIIEHTEIDDINILEATKKACTIAVANLSL
FT                   KPEKILVDGNMKFSDVRFISIINGDNLSLSIAAASIIAKVTRDRLMLELSAEYPQYLWH
FT                   KNYGYGTREHIEAINTHGLSSYHRKSFKFC"
FT   gene            complement(244545..246533)
FT                   /gene="uvrB"
FT                   /locus_tag="RT0193"
FT   CDS_pept        complement(244545..246533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="RT0193"
FT                   /product="excinuclease ABC subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:RT0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03677"
FT                   /db_xref="GOA:Q68XG5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XG5"
FT                   /protein_id="AAU03677.1"
FT                   /translation="MNNFSIISAYKPAGGQPKAIDEIIAGLNSKKRSQMLLGITGSGKT
FT                   FTMANIIERTNRPTLIMAHNKTLAAQIYLEMKSIFPKNAVEYFVSYYDYYQPEAYIVRT
FT                   DTFIEKDSSINEQIDLMRHSATRSLLERRDVIVIASVSCIYGLGAPDLYYQMTVHLELG
FT                   QSYPRDKLLNDLINLQYKRNDIGFERGCFRVKGDHIDIFPSHYSDKAWRLSFFGNELEY
FT                   IHEFDPLTGEKLTQLDKAMVFGNSHFVMPQKTINNAISSIEVELQKHLDVLKSQDKLIE
FT                   AKRLNQRTQYDLEMLTETGSCKGIENYSRFFTGRNAGEPPPTLFEYLPKDALLFLDESH
FT                   VSIPQIRAMYNSDRARKEVLVEHGFRLPSALDNRPLKFEEWEKFRPQTVFVSATPGPFE
FT                   LEETGGTVVELIIRPTGLLDPECIIKPATNQVEDLISEIQTTITKGLRILVTTLTKKMA
FT                   EDLTSYLQDLQYKTYYLHSNIHTLERIEILRDLRQGNIDILVGINLLREGIDIPECGLV
FT                   AILDADKEGFLRSEVSLIQTIGRAARNSRGKVILYADKMTKSIDKAVSETLRRRQIQQE
FT                   YNKKYGIIPKTINSAIHTLESLEEIHDNKLDKKQTNTLLNNPAKLKSYMDKLKKEMFKA
FT                   ASNLEFEQAAKLRNQLKTLEKAVLELS"
FT   gene            246610..246924
FT                   /gene="grxC1"
FT                   /locus_tag="RT0194"
FT   CDS_pept        246610..246924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grxC1"
FT                   /locus_tag="RT0194"
FT                   /product="glutaredoxin 3"
FT                   /db_xref="EnsemblGenomes-Gn:RT0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03678"
FT                   /db_xref="GOA:Q68XG4"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XG4"
FT                   /protein_id="AAU03678.1"
FT                   /translation="MNKSILHTIIIYTLASCPYCIKAKALLDKKNVIYEEIEVSNFTQE
FT                   EKEAFIKKSGGKNTVPQIFIDNMHVGGCDDLFNLEQDGRLDKLLETQPKNKNSLTVSGA
FT                   "
FT   gene            247019..248797
FT                   /locus_tag="RT0195"
FT   CDS_pept        247019..248797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0195"
FT                   /product="probable ATP binding cassette transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RT0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03679"
FT                   /db_xref="GOA:Q68XG3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XG3"
FT                   /protein_id="AAU03679.1"
FT                   /translation="MPKNNNHKNAFYILLTYLWLKDFDIRLRIVTSLICLVIAKVINIF
FT                   VPIVYKYIIDGLNQNLPLSVIIGVIIGYGVTKILVQIFSELRNIIFSKVGYQATRLVAL
FT                   NVFKHMHSLSMRFHITRKTGGLSRSIERGTKGIEAVLRYSLFNIFPTSLEIILVIGILW
FT                   YLHGVWFAVTVLITMIVYVCYTLLISTWRIAFAREMNKSDNTANNRAIDSLLNFETVKY
FT                   FNNEEYEAMKFNDALQTYEKSATKTTNSLSILNIGQDVIISLGLISLMILSVNAINQNK
FT                   MMIGDLIMVNAYLFQLSIPLSILGFAYREIKNALVNMEDMFKLLDIPAEIQDSVDAKEL
FT                   IISKCEVSFNNVSFAYNKERTILHNITFTIESGKTIAVVGSSGAGKSTISRLLFRFYDI
FT                   NSGSIIIDNQDIRKVKQRSLRESIGIVPQDTVLFNDTIYYNIAYGNNAASYDEVIAASK
FT                   NAHIHEFISVLPEGYATQVGERGLKLSGGEKQRIAIARTILKNPSIYVFDEATSSLDTK
FT                   TEKLIQASLKEISANHTTLIIAHRLSTIVDADEIIVLDNGYIVERGNHKTLLKYQGYYA
FT                   ELWYKQQEECKQDTEL"
FT   gene            250064..252781
FT                   /gene="gyrA"
FT                   /locus_tag="RT0196"
FT   CDS_pept        250064..252781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="RT0196"
FT                   /product="DNA gyrase"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:RT0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03680"
FT                   /db_xref="GOA:Q68XG2"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XG2"
FT                   /protein_id="AAU03680.1"
FT                   /translation="MTDKYSSNLVPVNIEDEMKASYLDYAMSVIVSRAIPDVRDGLKPV
FT                   HRRIIYSMYEAGNHASKPYRKSARIVGDVMGKYHPHGDSAIYDSLVRMTQDFSLRLPLV
FT                   DGQGNFGSMDGDAAAAMRYTESRMSKVAHKLVEDIDKGTVSFNINYDGSEEEPSVLPAM
FT                   FPNLLVNGSGGIAVGMATNIPPHNLGEIIDACCLYIDNNDIEILDLLEVVKGPDFPTGS
FT                   MILGISGIRSAYLTGRGSIIMRGKAEIENIGNSRQAIIITEIPYMVNKARLVEKIAEMV
FT                   KEKRIEGISDLRDESNKNGVRIFIELKKDVVAEVVLNQIYACTQLQTNFGVIMLALKDG
FT                   LPKVMNLKEVIAAFVSFREVVITNRTIYLLNKARDRAHILLGLAIAISNIDEIIYIIKA
FT                   SNDTNLAKQELMDRQWEVLDILPLIKLVDDKVMLNERGKLSFTEVQAKAILEMKLQRLT
FT                   AMEKNKLEQDLKHLATEIAEYLNILDSRTRLLEILKEELIKVKEEFAVPRLTAIEFGEF
FT                   DQDIEDLIQREEMVVTVTLGGYIKRVPLSSYRSQKRGGKGRSGLSMRDEDITMQVFVGS
FT                   THTPMLFFSNIGKVYSLKLYKLPLSNPQGKGRPMVNILPLQENEHITNIMPLPENQDEW
FT                   DHLNIMFATAKGNIRRSDLLDFKKIQLNGKIAIRLDEDDKLIDVKPCKEDEHILLATKA
FT                   GKALRFPVESLRIIKSRISDGVRGMKLAKEDSVISMTVLKGINSTKEDRDAYLTVPWEK
FT                   RLKIAKGEEFNLEALGVHLNADSILEMANSEEFILTVTENGFGKRSSAYGYRITDRGGS
FT                   GIINMDINDKTGLVVGVMPVKMDDELMLITNSGKLIRCKLESVRITGRNTSGVILFKLD
FT                   DDEKVVSVSLIAETSESGEDSELVEDGLESAENM"
FT   gene            253368..253540
FT                   /pseudo
FT                   /locus_tag="RTPG11"
FT                   /note="pseudogene of rickettsial conserved hypothetical
FT                   protein"
FT   gene            254055..254582
FT                   /gene="def"
FT                   /locus_tag="RT0197"
FT   CDS_pept        254055..254582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="RT0197"
FT                   /product="PDF"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:RT0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03681"
FT                   /db_xref="GOA:Q68XG1"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XG1"
FT                   /protein_id="AAU03681.1"
FT                   /translation="MSIYSIVTAPDERLKQKSKPVLECTDQTRKFMHDMLETMYNANGA
FT                   GLAAVQVGVLQRILVIDIKAHDPVERPKDFYPLFIVNPEIIEQSTELVTANEGCISLPE
FT                   QRIEVMRPESVKIRYLDYHGKSQELKANDWLARVIQHEYDHLEGKLMVDYLSNLKRDVV
FT                   LRKLKKLKNNIV"
FT   gene            254594..255490
FT                   /gene="fmt"
FT                   /locus_tag="RT0198"
FT   CDS_pept        254594..255490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="RT0198"
FT                   /product="Formylmethionyl-transfer ribonucleic synthetase"
FT                   /EC_number="2.1.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:RT0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03682"
FT                   /db_xref="GOA:O33582"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:O33582"
FT                   /protein_id="AAU03682.1"
FT                   /translation="MGTPEFAVPTLKKLIIHHEVKAVFTQQPKAKGRGLYLAKSPIHQL
FT                   AFEHQIPVYSPSTLRNDETINLINKVDADIIVVIAYGFIVPKAILEAKKYGCLNIHPSD
FT                   LPRHRGAAPLQRTIIEGDLKSSVCIMRMDSGLDTGDILLKEDLNLEKRITLDELSNRCA
FT                   HLGAELLIQTLANIDNIVPVKQSSNGVTYAHKLTKAEGKINWYESAYSIDCKIRGMNPW
FT                   PGAYFSYNDKIIKILEAEYLNYNHHFIPGTVISNKLEIACGSGILRVTKLQQESKKALN
FT                   IEAFLRGTNILKDTILK"
FT   gene            255711..255851
FT                   /locus_tag="RT0199"
FT   CDS_pept        255711..255851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03683"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XF9"
FT                   /protein_id="AAU03683.1"
FT                   /translation="MSNLKQTKAILKLYTYTYGKSVKSANSNILDKFNKNGYLIINNSN
FT                   L"
FT   gene            256226..258987
FT                   /gene="rrl"
FT                   /locus_tag="RT0200"
FT   rRNA            256226..258987
FT                   /gene="rrl"
FT                   /locus_tag="RT0200"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(258437..258853)
FT                   /locus_tag="RT0201"
FT   CDS_pept        complement(258437..258853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0201"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03684"
FT                   /protein_id="AAU03684.1"
FT                   /translation="MHSAVIPSVLSYPAVPLARQLVHQGYVHLGPLVLKADPLKLPTPT
FT                   ADRDRTVSRRSKPSSRTTLIGEQPNPWDLLQPQDVMSRHRGAKRFRRYGRLEIISLLSP
FT                   EYLLFVERWPFHSGPPDHYDRLSSLLVLSDSQSG"
FT   gene            258881..259212
FT                   /pseudo
FT                   /locus_tag="RTPG12"
FT                   /note="pseudogene of agrobacterium protein"
FT   gene            259213..259313
FT                   /gene="rrf"
FT                   /locus_tag="RT0202"
FT   rRNA            259213..259313
FT                   /gene="rrf"
FT                   /locus_tag="RT0202"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(259503..260576)
FT                   /locus_tag="RT0203"
FT   CDS_pept        complement(259503..260576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0203"
FT                   /product="probable ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:RT0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03685"
FT                   /db_xref="GOA:Q68XF7"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XF7"
FT                   /protein_id="AAU03685.1"
FT                   /translation="MIKCLNSFILNSKQIALLKELKTLAKEVNKSNSLFQFFNKHHLKN
FT                   GIYLYGPVGSGKTLLMKSFFEVINISKTILHYQNFIHAIHKSMHKLQTEKQKDIIPKIA
FT                   KNYAKQTKVLCIDEFEIKDITDAMIISRLFNELIKQNIFIFITSNTLPNNLYKDGLQRE
FT                   SFLPFIKIINNTFYIKYLDNQHDYRFDNKALGAKCSRIIYPLTLENKNKFKEIIIKISD
FT                   NNFVAQNIQVLGRSIPFQKVYKRILVTDYNELFIRELSYIDYVNICQNFNIIIVENINT
FT                   IDANDTNTAVRFINFIDNAYFYKVLLFMSLEDNPNKIYQGLARADEFKRTISRLNEMNS
FT                   EAYLLNNNLRHSLSEIN"
FT   gene            complement(261210..262337)
FT                   /gene="queA"
FT                   /locus_tag="RT0204"
FT   CDS_pept        complement(261210..262337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="RT0204"
FT                   /product="S-adenosylmethionine tRNA
FT                   ribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:RT0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03686"
FT                   /db_xref="GOA:Q68XF6"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XF6"
FT                   /protein_id="AAU03686.1"
FT                   /translation="MKLSDFDFNVPNALIAQYPSSERDNSDLLIAGTKHIKTKFYNIID
FT                   YLKEGDLLVFNNSKVIKAKLHLGKNITINLNKKLSDNCWGAFAKPARKLNIGDEFYFDT
FT                   HKIIITEKLAMGEIKVKFILNNISMIKFLDKYGEMPLPFYIKRTSSVCCSNMALFCDHD
FT                   NTLKITSISHNSNTVNFRSTDSMIDSTNDNDRYQTIYSQIEGSVAAPTAGLHFTKDILD
FT                   KLKTKGINTAFVTLHVGAGTFLPVKTENIHKHKMHTEYCSITAETAEIINKTKQKGRDI
FT                   IAVGTTTLRTLESSCNNGIVKAGNFETDIFITPGFNFQIVDMLLTNFHFPKSTLFILIC
FT                   AFAGFKEMHALYKYAIKEKMRFFSYGDATLLYRKV"
FT   gene            complement(262825..264594)
FT                   /locus_tag="RT0205"
FT   CDS_pept        complement(262825..264594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0205"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03687"
FT                   /db_xref="GOA:Q68XF5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XF5"
FT                   /protein_id="AAU03687.1"
FT                   /translation="MIKYHALSKSTFSLGIYFLKFDKIKITLLTVICILFGIIPAMDSI
FT                   LLQKIIDLIESFSDENAHNLLSSMIYWAIFYALWWESINIAYRAYDYLYLKTMPVIKGK
FT                   ILNELYNYTQYHSHKFFQENLAGHISNRITETARSFEMIISIFGEKLLRKLAIIVFALI
FT                   ALYLVHYAFATIFILWITVFIGLSILFSDKMNQYSLNYARSQSFVAGSIVDAISNINAV
FT                   RMFTAHKFERQHLETRVENAVADEQTMQFFMFKLRYSLGMSCSIMIFIMIYYLSRLRSE
FT                   LSISIGDCVLVLTLCINVADDIWDLTQEIGDMFEQIGAFNQGLSLMAPHIITDIENATP
FT                   LHIEAGIIEFRNVTFKYYNNNNLFYNKSVLIPSKQKVGLVGFSGSGKTTFISLLTRLHD
FT                   IEDGMILIDNQNIKNVTQDSLRKAISLIPQEPVLFHRTILDNIRYGKKDATLDEIIEAA
FT                   KAAHIHDVIDNLPDGYDTMCGERGNNLSGGQRQRIIIARAILKNAPILILDEATSSLDS
FT                   ETESMIQDSMDYLMKNKTVIVIAHRLSTLLNMDRILVFEAGSIIDDGSHTELLKNSKLY
FT                   KKLWNSQIKGLIV"
FT   gene            264771..265040
FT                   /locus_tag="RT0206"
FT   CDS_pept        264771..265040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0206"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03688"
FT                   /db_xref="InterPro:IPR022715"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XF4"
FT                   /protein_id="AAU03688.1"
FT                   /translation="MQEKELSNNFLEENKSKEDNSPFSDIKYICQASLLITDSIRKGYD
FT                   VTQFSNGDINVREIRIVNVHYNWNSEKGKFVKTNQIEFNNNKGV"
FT   gene            265205..266548
FT                   /gene="cydA"
FT                   /locus_tag="RT0207"
FT   CDS_pept        265205..266548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydA"
FT                   /locus_tag="RT0207"
FT                   /product="cytochrome d ubiquinol oxidase subunit I"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03689"
FT                   /db_xref="GOA:Q68XF3"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XF3"
FT                   /protein_id="AAU03689.1"
FT                   /translation="MEFDQVLLSRIQFAFTISFHIIFPTFTIGLASFLAVIEGLWLKTK
FT                   NPVYQEIYKFWVKIFAVTFGMGVVSGVVMSYQFGTNWSNFSDKVGNVIGPLLGFEVFTA
FT                   FFLESSFLGIMLFGFNKVTKKVHFISTLIVAIGTIISAFWILAANSWMHTPAGFELRGE
FT                   GFFYPLNWLAIIFNPSFPYRFLHMVTASYLTTSFVIGGVASFYLLNNRCKQHAKIMLFM
FT                   AVLMALIVSPIQIFIGDLHGLNTLKYQPVKVSAIEGIWNTKKGASFNLIGLPDKEEETT
FT                   KYAIEIPYASSLILTHSLDGEVKGLKEWTKEERPPVAVVFFSFRIMLGIGCLMVFTGIA
FT                   GLYLYLNKRLYTTHWFQYLYILMSPLGFIAVLAGWLVTEVGRQPYIVYNILKTADTVSP
FT                   LLGKYVLISLISFVVVYLIIFGAGIYYIIHLIKKGIESIDNNETYVEH"
FT   gene            266680..267699
FT                   /gene="cydB"
FT                   /locus_tag="RT0208"
FT   CDS_pept        266680..267699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="RT0208"
FT                   /product="cytochrome d ubiquinol oxidase subunit II"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03690"
FT                   /db_xref="GOA:Q68XF2"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XF2"
FT                   /protein_id="AAU03690.1"
FT                   /translation="MLNFGHYIDLPLVCGGLIATAICLYVLLDGFDLGVGILFPFAPTD
FT                   DCRHKMINSIAPFWDGNETWLVLGGGGLFAAFPLAYSILMSALYIPIILMLLGLIFRGV
FT                   AFEFRFKAHIGHRYIWDYAFHFGSMLAVFCQGLMLGAFVQGIVIDGRQFAGGSFDFLTS
FT                   FSVMTGIALIFCYALLGATWLILKTEKKTQDWAYKSALYILFYVALFIGLVSLCTPFLN
FT                   NYINHRWFNIPNIYYLSIILIVIVLIFIKLIKAIKQKKEVTPFVYTILLFLLGYLVLAI
FT                   SIWPYIVPHKITLENAAAAPESQSLLLIGAVIFLPIILGYTFYCYYIFRGKSSPQPLY"
FT   gene            267959..268837
FT                   /locus_tag="RT0209"
FT   CDS_pept        267959..268837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0209"
FT                   /product="glucosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RT0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03691"
FT                   /db_xref="GOA:Q68XF1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XF1"
FT                   /protein_id="AAU03691.1"
FT                   /translation="MKKISTFIITKNEEARIARAINSVKNITDEVIVVDNESTDDTVHI
FT                   AKTLGAKVIVKPWLGYVGQKSFAESMCVNDWVLNIDADEELSQELQDEIEYIFASHNQD
FT                   RYLAYQIKLLIMYRGDQKSRMFAPLNKCIRLYNKKFASFANTINSTTHDSVVFNKDVDF
FT                   IGKIYLLNGIAYHYSGTSIEQLVNKANFYSSEQAKDLVKQGKKFSNFRLATEMIWWFLK
FT                   AFFIRRYFVFGFDGFVDSIIFAFARFLRLAKLRELSLKSRNVIASDNYINYCMDIKSLL
FT                   QKKKRSRYPKK"
FT   gene            268976..270214
FT                   /gene="mpp"
FT                   /locus_tag="RT0210"
FT   CDS_pept        268976..270214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpp"
FT                   /locus_tag="RT0210"
FT                   /product="probable mitochondrial protease"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03692"
FT                   /db_xref="GOA:Q68XF0"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XF0"
FT                   /protein_id="AAU03692.1"
FT                   /translation="MKENFNISKLKNGLTILTYNMPYVHSVAINLIAKVGARYENEEEE
FT                   GISHFLEHMAFKGTKTRTAQQIAEEFDSIGGYFNAYTGYENTVYYVRVLSENCHKALNI
FT                   LADIIQNSIFADEEISKEYQIIMQEIAHHHDNPDDLIYETFYNTVYKDQPLGKSILGTA
FT                   KTLVKFTQEHFLNFIGKHYNAENLYLSIAGNIEHNKIVIIAEELFASLKQGVTSSFIPA
FT                   KYIGGKGFIHKELEQTSLVLGFECTSYINLEKLYQTYLLSIIFGGGVSSRLFQSIREKL
FT                   GLAYVVGSYNSAYFDSGVFTIYASTAHEKLELLYSEIKNEIIKITETVSTEELMRAKIQ
FT                   LRSNLQMAQEQNSYKSEEIGKNYSVFGKYILPEEIIEIITNIKADDIINTANKIFSGTT
FT                   ALAIIGPNDLNGF"
FT   gene            270336..271046
FT                   /gene="purC"
FT                   /locus_tag="RT0211"
FT   CDS_pept        270336..271046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="RT0211"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:RT0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03693"
FT                   /db_xref="GOA:Q68XE9"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XE9"
FT                   /protein_id="AAU03693.1"
FT                   /translation="MKKKLYEGSSKILYSAEEDFLLIMAFSDKAVLETGETVDISGKGV
FT                   LNNSISSFLMGKLEMIGIENHLIEKINMREQLIQYVEVFPIQVIISSVACGRFVKEFGM
FT                   DEGYVFDKPIIDFKVRSREFNYPIVNEYQIFNFGWLTMDEIRTVQAQTLRIYDFLSGLF
FT                   IGIGIRLVECKLEFGRVFNGEESIIMLTDEISPDNCRLWHINSNEKLGFELIENEPNKA
FT                   FESYQLIANRLKEK"
FT   gene            271206..272364
FT                   /pseudo
FT                   /locus_tag="RTPG13"
FT                   /note="pseudogene of rickettsial conserved hypothetical
FT                   protein"
FT   gene            272365..274272
FT                   /gene="thrS"
FT                   /locus_tag="RT0212"
FT   CDS_pept        272365..274272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /locus_tag="RT0212"
FT                   /product="Threonine translase"
FT                   /EC_number="6.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:RT0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03694"
FT                   /db_xref="GOA:Q68XE8"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XE8"
FT                   /protein_id="AAU03694.1"
FT                   /translation="MINISFPDGSVKQFAQNITAFEIANAISMSLAKAAMVVEINGEFK
FT                   DLSTVIEHDCKLRILTAKDYECLEIIRHDAAHLTAAAVKELFPETQVAIGPAIENGYYY
FT                   DFARDKPFSRDDLATIEAKMQELVKKNEKITRELWDRDKAIEFFLSIGEHYKAKIIASI
FT                   PAGEQITLYRQGNFIDLCRGPHAPSTGFVKYFKLMKVAGAYWRGNSRNEMLQRIYGTAW
FT                   ATKEQLDNYLFMLEEAEKRDHRKIGKELDLFHFQEEAQGMVFWHDKGWSIYNTIEQYIR
FT                   KKNRKNGYIEVKTPVLVDKSLWEASGHWAKFRCDMFTLETDDKILALKPMNCPCHVQIF
FT                   KQGIKSYRDLPLRMSEFGLCHRNEASGALHGLMRVRSLVQDDAHIFCAEEQITDETVRF
FT                   CKLLTEVYKDFGFTDIKVKFSDRPEIRAGNDEVWDKAEHALKTAVEKVGFIYTLNPGDG
FT                   AFYGPKLEFVLTDAIGRQWQCGTLQMDFVLPERLDANYIAASGEKKRPVMLHRAILGSL
FT                   ERFIGILIEEYAGKFPIWLAPVQVAIATITNDLNDYALEVQKTLIDNNIRTDINISPDK
FT                   INYKIREFSNQKIPMIAVIGKKEQANKQVTIRKFGTTGQEILSIEQLIAMIKKENSNYL
FT                   "
FT   gene            complement(275036..275173)
FT                   /locus_tag="RT0213"
FT   CDS_pept        complement(275036..275173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0213"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03695"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XE7"
FT                   /protein_id="AAU03695.1"
FT                   /translation="MINIIAKHETHLLKILKISIVRYKKLSIRHNKLSSMLIQTHKIYS
FT                   "
FT   gene            complement(276535..276882)
FT                   /locus_tag="RT0214"
FT   CDS_pept        complement(276535..276882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0214"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03696"
FT                   /db_xref="InterPro:IPR022589"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XE6"
FT                   /protein_id="AAU03696.1"
FT                   /translation="MYTKIVAHKKNILPAKGNNIDDSQNVALNSQKPENKKLTLQEKIE
FT                   LSWKFLYDITEIILNKFSKEDVAQVNKCGQILFENGVRYGHVVDIVIPHVRSHTQSVEQ
FT                   EQSKSKKALRM"
FT   gene            complement(276935..278131)
FT                   /locus_tag="RT0215"
FT   CDS_pept        complement(276935..278131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0215"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03697"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XE5"
FT                   /protein_id="AAU03697.1"
FT                   /translation="MYIINFSSFHRFNIAQQATLKRLLIKLGVFTKSLKKNVTDLENNL
FT                   FYILQNSLDELLHTENIDTEKIITLFNITLQESLTILSKELERTYQAHLETRDIFLFNV
FT                   IIIEKCLNVLAQVLKFQKELDTLYPRASQKIINALESIIVMIIASQIPVLGIFIQISET
FT                   LKKVNNLIDYKKLLPKITRLHNEITEIIRDVTYNKQLKNCFEKATTVATILEISKESAR
FT                   KIIEIANKNPNNRVSLENIVKAAKTIPKTKDEVEEKIAKLKSNIESAIPKNINIDKLNS
FT                   INNTISYNINGAKTELLKILDPEASFGDKIESLCKAAKKATTITSDIKKILGVVPGGKQ
FT                   LATVISLAIKSNLLPPQVFAIIKLAPDITKLVNIGKAVIIMLSKTHNLTQQHGRANSV"
FT   gene            278361..279725
FT                   /gene="tolC"
FT                   /locus_tag="RT0216"
FT   CDS_pept        278361..279725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolC"
FT                   /locus_tag="RT0216"
FT                   /product="outer membrane protein TolC precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RT0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03698"
FT                   /db_xref="GOA:Q68XE4"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XE4"
FT                   /protein_id="AAU03698.1"
FT                   /translation="MSKLTTFITTLLLTGSVIAVDLEQALTEGYKNNEELKAARIKFLN
FT                   AIEQLPQAFSGFMPNVGLQINRQNSKTRYNKKYANRLGITSRDTDSTQGILTIEQSLFS
FT                   GGASIAALKAAQSGFRASRSEYYACEQKILLNLITAYLDCFESKEKYDISESRVRTNIQ
FT                   QVKTVEEKLRLGEATAIDIAAARAGLAAAETNKLAAYADFQGKKANFIKVFGIEANDIT
FT                   MPDLPDRLPTSLDEFTRKAAKLNPDINSARHNVSVAKALEMVQKGKLLPQVSVKLLSGR
FT                   TNYNPQEPVIQNINNRIYTTTLAVNIPIYPEGGAQYSRIRSAKNQTRNSVVQLDSAIKQ
FT                   IKAGVVSVWEGFETAKSRIVAANQGVEAAQISYNGIVQEEIVGSKTILDVLDAEQKLYE
FT                   AKITRVDAYKNSVLASYQMKLLAGELTAKSLKLKVKYFSPEEEFNSLKKKMFIGF"
FT   gene            279727..280140
FT                   /locus_tag="RT0217"
FT   CDS_pept        279727..280140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0217"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03699"
FT                   /db_xref="InterPro:IPR019632"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XE3"
FT                   /protein_id="AAU03699.1"
FT                   /translation="MSKENKKNQDMSIEEILKSIKGIINEHKNPVYENYSADEDILELT
FT                   DIVNQDEEEKLISTKSASEVEEIFKNFTDTIKDKKLNNNFSSKNALEELVIEMLKPELK
FT                   VWLDKNLPILVKELVEIEIKKLVQYSKRDGSNY"
FT   gene            280273..282033
FT                   /locus_tag="RT0218"
FT   CDS_pept        280273..282033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0218"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03700"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XE2"
FT                   /protein_id="AAU03700.1"
FT                   /translation="MLNKLCEILFLINLLLVTGQGYASPPPLPQSLPIVAIDTPDKEDK
FT                   DVSTNFNISFFEKLKQFFSKQKKTNISSQQEKGQTKAIHKESQQIDPRELNENEQSEPF
FT                   IDVGSVILPSVANIHSKFEYENSTNLASNYNTQDMQVTQQELNSTEASESFIDIGNTKF
FT                   ISATNNEMYKEAVLPNDYKKTNLDFNIITLNVLKPVIPTSQDMMDVVPLQQPVQIYKPT
FT                   NLTSIPKLFNHDTNLNNVEKNLESTMSNMTTISPNMLSVPTTQDTIPTTLNITVPTTPT
FT                   TETHVNVPSSTMMHSNNHSTQPITTISINTPVDTSSTVVTATESSMAINNSQERFVSTS
FT                   EATKKQDWYTPIIPVLVVDPNKSRPNSLALEKKIDNDQIINNQAKSYPVSSSNVTLQKQ
FT                   NDKVNNETSELAKEFVKNETQMLFLPDDDIVLGKLTEHATLEQMDMYGYIKLFQKKEGW
FT                   IASMGKRKLVESFIKYDIDINKNKDIYSNLSYYSAVDNAFRAVARNNLFELRALLDVYP
FT                   ILQEKNSTGETLLTAAIYNDNYYLAKFLVIRGIKTSVLKKDECKYPLDIASSQGNTNIV
FT                   CMLMKAKGYN"
FT   gene            282215..284206
FT                   /gene="parE"
FT                   /locus_tag="RT0219"
FT   CDS_pept        282215..284206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parE"
FT                   /locus_tag="RT0219"
FT                   /product="DNA topoisomerase IV subunit B"
FT                   /EC_number="5.99.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03701"
FT                   /db_xref="GOA:Q68XE1"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005737"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XE1"
FT                   /protein_id="AAU03701.1"
FT                   /translation="MSDLFSFNNKEKKNKIIYTNYSAKDIEVLDGLEPVRKRPGMYIGG
FT                   TDSNAMHHLVSEVLDNAMDEAVAGFASIIMIKMHQDHSITIFDNGRGIPIDNHPKFPNK
FT                   SALEVILTTLHSGSKFSNNVYHTAGGLHGVGISVVNALSKHLKIEVYQQGKLYSQSYSK
FT                   GEKLTDLISTEVSKRLRGTSINFTPDPEIFSETLHFNPKKIYEIARSKAYLYRGVSIEW
FT                   ECEVEVPSDIPKKALINFPNGLKDYLSSKISLDNLVIPEIFSGNIESTMDAIKLEWAIC
FT                   WQNNDTSAFMKSYCNTVPTPQGGTHEQGLKSAILRGLKAYSEMIGNKKSANLTIEDIFE
FT                   TASVVLSVFIVEPSFQGQTKEKLVSNGVSKLVENIIKDHFDHFLSSDKVLATHLLEHVI
FT                   AISEFRRNKKNERNISRKNATQKLRLPGKLADCTRTSAEGTELFIVEGDSAGGSAKQAR
FT                   NRETQAVLPLWGKVLNVASSTLEKIINNQAIQDLEIALACGSLKNYKKENLRYEKIIIM
FT                   TDADVDGAHIASLLMTFFFLRMPQLVKEGHLYLAKPPLYRLTQSNKIYYACDEEEKIKL
FT                   TYKLSKTSKAKIEVGRFKGLGEMMPAQLKETTMHPEKRSLLKVTLEDVQNVDKIVDDLM
FT                   GKKPEKRFQFIYEQALVKMDQIINKLDI"
FT   gene            284315..285643
FT                   /gene="ctp"
FT                   /locus_tag="RT0220"
FT   CDS_pept        284315..285643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctp"
FT                   /locus_tag="RT0220"
FT                   /product="tail specific periplasmic protease precursor"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03702"
FT                   /db_xref="GOA:Q68XE0"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XE0"
FT                   /protein_id="AAU03702.1"
FT                   /translation="MLLRFIIALFFSINCVVEGKETENKISNQEAYKQFQDVFERIEKD
FT                   YVQVPDRQKMIDEAINGMLNSLDPHSNYYTDEDLEDIFTFTKGEFGGIGVEIMYDSGAI
FT                   KIISSIDDLPAFKAGLKGGDYIVGVNDELVSTLGPNKAIKEMRGTPGTKVRLLIIKEEE
FT                   AKPQELELTREIVKIKPIKAHLEKNNIAYIRITTFNESTISELKAAVKKLKTESKDNLK
FT                   GIILDLRNNAGGILDQAIAVSDYFIDSGVIVTTKGRTTSSNSETKANEFSLKAPRVPMI
FT                   VLINGNSASASEIVAGALQDHKRAIILGTKSFGKGSVQALTQINSRAAVKLTISKYYTP
FT                   SGRSIQAEGIEPDILIEPAKVEYPEVKKIDKRFSESSLKNYLKNDNEKNKDSKKETKAK
FT                   NNKQEESELSELYKKDYQFARAYDVITGLIINMNLETQENAKQ"
FT   gene            285869..287365
FT                   /locus_tag="RT0221"
FT   CDS_pept        285869..287365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0221"
FT                   /product="histidine kinase sensor protein"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03703"
FT                   /db_xref="GOA:Q68XD9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XD9"
FT                   /protein_id="AAU03703.1"
FT                   /translation="MNHNKYIVRLSFIILFLNIIINMLFYRYFMIKEMIMKQVALEHTK
FT                   IVELYTDNIWNIHKNVISKLHQFDYLKLLQDQDFINFVKITAQWFTNLNINISLYDLKG
FT                   NKFITSNMLHMYSVDNYKNDSLIEIVIAKIDKIFLKSFTSEAPLRDAFRGITSHILLPK
FT                   VVIENESDLTIEHASFITSYIPVIDHNLDFSVDAVFEINTNITSQWKNITSLEQKVFIT
FT                   FIIIFIIFCTIIISNTNYARQIIEEQLATNRNLKAQIVKVEKTSSSNTKFFANISHELR
FT                   TPLNAIIGFSEILMSERDTEKSKNYIKDIHDAGKHLLSMINDILDLSKASADKLKVDNI
FT                   DLDLNKLISSSLILIKPRADQAEVELISRLPKEHIVINADPKRLKQVLLNLLSNAVKFT
FT                   NTGGSVTIALEKDELAKLVYIKVIDTGIGIEEKDIPKTLSEFGQIDSELSRKYEGTGLG
FT                   LPLTKKLVELMNGKFDLQSQINKGTTVTITFVYDGSINCS"
FT   gene            287565..288293
FT                   /locus_tag="RT0222"
FT   CDS_pept        287565..288293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0222"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03704"
FT                   /db_xref="GOA:Q68XD8"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR014162"
FT                   /db_xref="InterPro:IPR034706"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XD8"
FT                   /protein_id="AAU03704.1"
FT                   /translation="MKFIILLLTFLFSLGKSEILQGRPLKYAVNNDFENRLDEQEQAIR
FT                   KLISEVEILQHKIDLLKQNLNMPNQEENIEVLETHNLNKQDIFDIALLKDIHDNTPKKN
FT                   FDVNKDIAPYKQAYDLALAAYKDNKLTEAKDKFKNFIQKYPNSPLISNAYFWYAECFFK
FT                   QKDYNGAAINYLKCYQESPKGAKSSDGLLKLALSLGELKKMQEACNVLVTLDKEFPIHR
FT                   TSVSKKMAEDAKIKFGCKNK"
FT   gene            288306..288968
FT                   /locus_tag="RT0223"
FT   CDS_pept        288306..288968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0223"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03705"
FT                   /db_xref="GOA:Q68XD7"
FT                   /db_xref="InterPro:IPR022588"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XD7"
FT                   /protein_id="AAU03705.1"
FT                   /translation="MTDILDEVLSDQNEEKRLIFFKKLVLIIIIISIVAITIMVIINNN
FT                   KDNRIKNNKKNGDILVKTIGLDTTKANNELAFNTLENLVTSSNTKIKEIAALEQVALKI
FT                   SEKKYLEAKELLNKIIENKEYSEISTSYARISWCCIVLDDQNLDIQDKEKLQKYLDYFD
FT                   DEKKPFWATATIIKSILDIKHNMKTQAEKNLKNLLASNNVSDLLKDQAKALLVNLSK"
FT   gene            288968..290254
FT                   /locus_tag="RT0224"
FT   CDS_pept        288968..290254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0224"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03706"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XD6"
FT                   /protein_id="AAU03706.1"
FT                   /translation="MICTSGQTNMEKKIVLLLLPFILISCNGLGSKRVKNIVELTPKLE
FT                   IQTNEPIYLDSNAKVYQFNVNMLKNKQYSFAKSKIITEPVFIGDMIYVLDIRSNISAFS
FT                   IEKNKVIWSYNLSKHKKDNYIGGGILYHNGKLYITYGARLLIVLDAKSGYEIIRKELPD
FT                   IIRIKPIALNNNTILVQTISNQTIALDSATLKTLWDHESIAEILSASYSMIPIVQHDNV
FT                   IVTYNTGQVIALNIKNGEVRWSFEFTNLNDHTAIPNFDAASILCAPVHDNMNLYIATGL
FT                   GKLIKLNLLTGSVLWQINADDIQSMALIGNNLFIINNARQIAALNPETGQVQFVADLNY
FT                   EKDDKRLKPTTFLVPFVGVDNNNQQSLNVISVNGILYSFNIDNNVLKMNPNIIQIMKNI
FT                   RYYGLRSNNTLYFSTDRKVIFGSKINMHR"
FT   gene            290453..290920
FT                   /gene="rplM"
FT                   /locus_tag="RT0225"
FT   CDS_pept        290453..290920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="RT0225"
FT                   /product="50S ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:RT0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03707"
FT                   /db_xref="GOA:Q68XD5"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XD5"
FT                   /protein_id="AAU03707.1"
FT                   /translation="MKTYSAKPSEIEKKWWVIDAKNIVLGRLASRVAIMLRGKHKPSFT
FT                   PHLDCGDNIIIINAEHIKLTGKKLNHKDGKVYYRHTGFPGGIKDTTAGKILSGKYPERV
FT                   IKMAVKRMITRNVLGAKQMSNLYVYANCEHPHMAQQPTVYDFASKNPKNKK"
FT   gene            290927..291412
FT                   /gene="rpsI"
FT                   /locus_tag="RT0226"
FT   CDS_pept        290927..291412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="RT0226"
FT                   /product="30S ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:RT0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03708"
FT                   /db_xref="GOA:Q68XD4"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XD4"
FT                   /protein_id="AAU03708.1"
FT                   /translation="MTELKIKTEKVVKQLTKESLKPVLKVPKAKIDNASQFYATGKRKN
FT                   AIARVWLKVGKGKIVVNNKILNQYFPSETYIKTILQPFLLTKTIDQYDVICTVRGGGIS
FT                   GQKGAILHGISKALDKSAPCFHAILRKGGLLTRDSRVVERKKYGQRKARKKTQFSKR"
FT   gene            291448..291524
FT                   /gene="tRNA-Met"
FT                   /locus_tag="RT0227"
FT   tRNA            291448..291524
FT                   /gene="tRNA-Met"
FT                   /locus_tag="RT0227"
FT                   /product="tRNA-Met"
FT                   /note="codon recognized: AUG"
FT   gene            complement(292889..293374)
FT                   /gene="nudH"
FT                   /locus_tag="RT0228"
FT   CDS_pept        complement(292889..293374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudH"
FT                   /locus_tag="RT0228"
FT                   /product="dinucleoside polyphosphate hydrolase, invasion
FT                   protein A"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03709"
FT                   /db_xref="GOA:Q68XD3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XD3"
FT                   /protein_id="AAU03709.1"
FT                   /translation="MKNSSNKYLDLPYRPGVGMMILNADNQIFVGKRIDTKISAWQMPQ
FT                   GGIVPGETPSIAAMREMLEEIGSNKGYIIAESKCWYSYDVPSFLIPKLWNGNFRGQKQR
FT                   WFLIRFTGNNKDINIHTSNPEFDQWRWTSLDELLSIIIPFKRKLYQAVVKEFESLIQ"
FT   gene            complement(293404..294756)
FT                   /locus_tag="RT0229"
FT   CDS_pept        complement(293404..294756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0229"
FT                   /product="response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03710"
FT                   /db_xref="GOA:Q68XD2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XD2"
FT                   /protein_id="AAU03710.1"
FT                   /translation="MTTILVVDDIETNIKLLTAKLLKEYYTVLTANSGKEALSILKKEK
FT                   IDTILLDVMMPEMDGFEVCKIIKTDPGTTHIPVVMITALSDIDDRVKGLEAGADEFLIK
FT                   PINDTALFVRLKSLSRMKSLIDELKLRNSTNALLGVTNIEIHDNLTDKKILLINDDVVQ
FT                   AKNIKQILVKLTKYVKVISNSDELDIINEYTPDLVIISSTLENEDPLRISVILRGKAEI
FT                   SGVVIILQIDEDGMPLVVKGIELGINDYFIYPIEENELLARIRTQLRRKQYQDNLRNDL
FT                   EQSVNLAAKDGLTGLFNRRYFDIHLKQMIEKANKENIKLYLLMCDIDNFKHVNDTYGHQ
FT                   AGDKVLTIVSRILKNTLRVTDLIARFGGEEFTILLTDIDISKAIETAERIRVKIEYMDF
FT                   YIEGQIEPLKKTISIGVTEYKKEESIESIIKRADKAMYKAKTTGKNKVVQL"
FT   gene            294831..295397
FT                   /gene="efp"
FT                   /locus_tag="RT0230"
FT   CDS_pept        294831..295397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="RT0230"
FT                   /product="elongation factor P"
FT                   /db_xref="EnsemblGenomes-Gn:RT0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03711"
FT                   /db_xref="GOA:Q68XD1"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XD1"
FT                   /protein_id="AAU03711.1"
FT                   /translation="MKISANSIRTGNILVYNNDLWVVSKTPEHTQPGKGGAYVQVEMKN
FT                   LKTGTKRNGRFSSSDYLEKAELEQKDCQFLYFEGNNLVLMDTKHFDQINVPKEILEAKL
FT                   PFLTENMIVKVEFYNDKPLTIVLPPTVILAISETDPVIKGATVTSSYKPAILENGIKVK
FT                   VPQYLAIGEKIVVKTDDMTYVERAK"
FT   gene            295407..296144
FT                   /gene="suhB"
FT                   /locus_tag="RT0231"
FT   CDS_pept        295407..296144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="suhB"
FT                   /locus_tag="RT0231"
FT                   /product="extragenic suppressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03712"
FT                   /db_xref="GOA:Q68XD0"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XD0"
FT                   /protein_id="AAU03712.1"
FT                   /translation="MQPITNLLMNAMRKAVKFLNRDFLELEMLQKNSVRNEEFCQRSYL
FT                   KLKTLLCKELQRHTQYLFFPEDIFDLNDNYESIILINPIDSTNNFCRSIPFFAISVTYL
FT                   KRNQDALTTASTVIYFPVLNEIYYAEKGKGAWIEKNNFNSNYHGLRLRVSDNADLKNCL
FT                   AIVEGLSYDNFEEIKRDNIRSFGSPCYGAALVSLGKVDLICLSLLNFTLYYAFELLIKE
FT                   AGGIIIDSSDKFICANRYLAKKL"
FT   gene            296355..296678
FT                   /locus_tag="RT0232"
FT   CDS_pept        296355..296678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0232"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03713"
FT                   /db_xref="InterPro:IPR021277"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XC9"
FT                   /protein_id="AAU03713.1"
FT                   /translation="MASYKEFEFDCDFGGQRAKFKFYIGTPQEGHHPLQFQAKWLSDER
FT                   GGTIPDEVMKAISQLNDLAKKNSVPLPDLCVYALGSAQEAKASTHEEDADDLENQDDNA
FT                   EPV"
FT   gene            296712..297407
FT                   /gene="psd"
FT                   /locus_tag="RT0233"
FT   CDS_pept        296712..297407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="RT0233"
FT                   /product="PS decarboxylase"
FT                   /EC_number="4.1.1.65"
FT                   /db_xref="EnsemblGenomes-Gn:RT0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03714"
FT                   /db_xref="GOA:Q68XC8"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XC8"
FT                   /protein_id="AAU03714.1"
FT                   /translation="MKQYNDLFKIIHREGYIFIASFALVSFLLASFNEKLGCIGFIATI
FT                   WCIYFFRNPDRFVPISDDLVISPADGIIQEIKEASPPPELGLGDLEMIRVSIFLNIFNI
FT                   HVNRIPANGKILALHYNPGKFFNASLDKASLYNERQSVLMETDQGQKIVFVQIAGLIAR
FT                   RIVCDLEEDNEVKMGERYGIIRFGSRVDVYLPLKTALLVSKGQTAIGGETIIADFGRKK
FT                   TEEFKFERK"
FT   gene            297543..298307
FT                   /gene="pssA"
FT                   /locus_tag="RT0234"
FT   CDS_pept        297543..298307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pssA"
FT                   /locus_tag="RT0234"
FT                   /product="CDP-diglycerine-serine O-phosphatidyltransferase"
FT                   /EC_number="2.7.8.8"
FT                   /db_xref="EnsemblGenomes-Gn:RT0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03715"
FT                   /db_xref="GOA:Q68XC7"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR012616"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XC7"
FT                   /protein_id="AAU03715.1"
FT                   /translation="MLKIRRSIITKPVPLIKLIPNFITLLGLVIGMSSIKFALDSRWEL
FT                   AVYCIIVAAIIDGIDGRIARILNAASPFGAELDSLCDFANFGIAPAYLIYLWSFQQYEY
FT                   KVFSSAVMLLFIVCMALRLARFNVGIYQLKHDKKTEDFFTGVPAPCGALLALTPVMIDF
FT                   EIGTLLNINTRTHTITINIYLAIVAFLLASRLPTISTKNLSIKPEYLSLAMILVAIVII
FT                   NLIIYPWYSLPLIAMIYVLSIPICYFLKHRVD"
FT   gene            298319..299371
FT                   /gene="emrA"
FT                   /locus_tag="RT0235"
FT   CDS_pept        298319..299371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="emrA"
FT                   /locus_tag="RT0235"
FT                   /product="multidrug resistance protein A"
FT                   /db_xref="EnsemblGenomes-Gn:RT0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03716"
FT                   /db_xref="GOA:Q68XC6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XC6"
FT                   /protein_id="AAU03716.1"
FT                   /translation="MFSVLQQVIYKYKYHSFIKYVIIIVLIVFTYFGYRIYVWANTQST
FT                   DNAYIDADISNVSTEVSGVLTKLFVTNNTRVNKGDLIGEIDDRDYKARLAALDASIQAC
FT                   IKNIEIIEKKISIGQMRLEQVTEKLKLTKISFDIISIDLTRVQALSNAKFVSSKTLDDS
FT                   KNGYQKVKTEYKQAQLDLDISKHNLQLLELEKAAAQEKLKELIENKKVTLRSLQNTKII
FT                   AMVPGIFSNSNLAIGNYIVKGKVLFSIVQDNTMYIKANFKETQIKNFKSGMKVKIVFDA
FT                   LPAKVIYGKIRNIAPATGAKFSLIPPDNATGNFTKIVQRVPVLIDFAPTNDTLVPGMSA
FT                   RVSIRTDQST"
FT   gene            complement(299989..300192)
FT                   /locus_tag="RT0236"
FT   CDS_pept        complement(299989..300192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0236"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03717"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XC5"
FT                   /protein_id="AAU03717.1"
FT                   /translation="MKTNNILKVAVGASSVAQKALNSIANKSYSIIEDKILKGHYITRA
FT                   EFEKLQTLVIKLKKELTELSGK"
FT   gene            complement(300189..300431)
FT                   /locus_tag="RT0237"
FT   CDS_pept        complement(300189..300431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0237"
FT                   /product="BolA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03718"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XC4"
FT                   /protein_id="AAU03718.1"
FT                   /translation="MSRIKRMQEKLSVLKPYFQEIIDESYKHASHYDGIHSHIKIRISA
FT                   ETLQEQSLISYHRTINNLLADEFNNGLHALSIEVL"
FT   gene            300486..301709
FT                   /locus_tag="RT0238"
FT   CDS_pept        300486..301709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0238"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03719"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XC3"
FT                   /protein_id="AAU03719.1"
FT                   /translation="MIKIAMSELITDYKNLQYEIDKLQKGVCFACRLINYDEIEFIEQD
FT                   KHFIIQDLDQIIKNVSKELNIFATFKIINEDRILFILNTTDSDLIKNFARKLYLLSQLY
FT                   INEERPAIYMNCYIASIKFTTVMNNAESIAKALNMLLSQNNNYYYREYSSTAHDLENIR
FT                   KSNLQLNLLRKALVKKTMRFAYQPIINRNTMKIHYYECLLRIPDENGVYISVGQIIPIA
FT                   ENKGLIFIIDQIVLEMTINELARNPNLMLAVNISNIGTSDEALCEIAENLLKVHNVRDR
FT                   LIIEITETSFNENYDKITLFINKLRKYGCKFALDDFGSGFTSFKQLQSLPIDIIKIDGK
FT                   YVRSITSDVQSRYFVERLIRISEDLGIATVAEFVENGEIAQFLIDLKVSGLQGNFYSEA
FT                   KFDRVDEV"
FT   gene            301873..303369
FT                   /gene="murC"
FT                   /locus_tag="RT0239"
FT   CDS_pept        301873..303369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="RT0239"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="Alanine-adding enzyme; L-Ala ligase;
FT                   L-alanine-adding enzyme; MurC synthetase;
FT                   UDP-MurNAc:L-alanine ligase; UDP-N-acetylmuramoyl-L-alanine
FT                   synthetase; UDP-N-acetylmuramoylalanine synthetase;
FT                   UDP-N-acetylmuramyl:L-alanine ligase;
FT                   UDP-acetylmuramyl-L-alanine synthetase; UDPMurNAc-L-alanine
FT                   synthetase; Uridine
FT                   5prime-diphosphate-N-acetylmuramyl-L-alanine synthetase;
FT                   Uridine diphosphate N-acetylmuramate:L-alanine ligase;
FT                   Uridine diphospho-N-acetylmuramoylalanine synthetase;
FT                   Uridine-diphosphate-N-acetylmuramate:L-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RT0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03720"
FT                   /db_xref="GOA:Q68XC2"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XC2"
FT                   /protein_id="AAU03720.1"
FT                   /translation="MLLLELKKTNQTLGTIHFIGIGGVGMSGIAEILHNLGYKVQGSDL
FT                   VENYNTKRLESYGIKIFLGHAKQNIKNVSYVVISSAIHQNNPEIKEALERKIPIIRRAE
FT                   MLAELMRLKCSVAVSGSHGKTTTTSLIACLFEAAGLYPTVINGGIINNKSTNAYLGSSN
FT                   YLIAEADESDATFIHIPSTIAIITNIDPEHLDYYQDFEILIGAFRSFITNLPFYGFAVC
FT                   CIDHKIVRKLVDDITERKIITYGIDAEDAHIIAFNINTDIASSTFDVKISLPNVLGTTI
FT                   IEKITIPTPGRHNILNSLAAIAVGIELDFGIKAIKNGFNNFKGVKRRFTKVAEYNQAVI
FT                   IDDYAHHPEEIKATLATAKNIANQQNGKVIAIFQPHRYSRIKYLFDDFMLCFADADILY
FT                   ITNIYAAGEKPIEGITGQSLVDKMTQNKYHDKANFLAELDDVVSVIIDHAASGDMIIMM
FT                   GAGNISSFANELDRRLLSQEILASSQNTDFDTSSYDKVIR"
FT   gene            303380..304267
FT                   /gene="murB"
FT                   /locus_tag="RT0240"
FT   CDS_pept        303380..304267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="RT0240"
FT                   /product="UDP-GlcNAc-enoylpyruvate reductase"
FT                   /EC_number="1.3.1.98"
FT                   /db_xref="EnsemblGenomes-Gn:RT0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03721"
FT                   /db_xref="GOA:Q68XC1"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XC1"
FT                   /protein_id="AAU03721.1"
FT                   /translation="MSILPIIKGEYKKDYNLKHLTWFKVGGNAEIFFKPFDSADLKSFL
FT                   IQNNKKLPITTFGSGSNIIIRDGGIEGVVIKLGKNFNNIEFLDNHLIVGSSCLNYNLAK
FT                   FCQANAISGFEFLVGIPGTIGGGVVMNAGAYGSAFQDIIVQIEALDFLGNFLTFTNKEI
FT                   GFKYRGNNLPKDLILLKAIFKANKGDSQNILLKMNKINTTRSSTQPIKERTGGSTFKNP
FT                   VGCKSWELIDKAGLRGYRIGGASMSELHCNFMINNGNATAKDLEDLGNFVRQKVFEDSG
FT                   VELNWEIKRIGKYV"
FT   gene            304379..305344
FT                   /gene="ddlB"
FT                   /locus_tag="RT0241"
FT   CDS_pept        304379..305344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlB"
FT                   /locus_tag="RT0241"
FT                   /product="Alanine:alanine ligase (ADP-forming)"
FT                   /EC_number="6.3.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:RT0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03722"
FT                   /db_xref="GOA:Q68XC0"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XC0"
FT                   /protein_id="AAU03722.1"
FT                   /translation="MNKYQTHLLEHSVVKILSGTGKKHIALVAGGMSAEREVSLISSVG
FT                   VSKALIELGYKVTFIDMGADIAVKLQEINPDIVFNCLHGTYGEDGCLPGLLNIMRIPYT
FT                   HSGVLSSALAFDKIHSRSCFLKNNINMADSIVVSKSDHINTDPMKRPYVIKPLKQGSSI
FT                   GVEVIFEEDDFHFIDYDFPYGEDIIIEQYIQGQELQVALLNGKALGVLEIKLLKNRFYD
FT                   YETKYNKGFAKHVCPAQLPANLYKKLLIESEKIYKTINCKGPVRAEFILEEQTNKLYVL
FT                   EINTHPGMTPLSIVPEIAAYAGISFTNLIEEIIKMASFES"
FT   gene            305341..306141
FT                   /gene="ftsQ"
FT                   /locus_tag="RT0242"
FT   CDS_pept        305341..306141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="RT0242"
FT                   /product="cell division protein FtsQ"
FT                   /db_xref="EnsemblGenomes-Gn:RT0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03723"
FT                   /db_xref="GOA:Q68XB9"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XB9"
FT                   /protein_id="AAU03723.1"
FT                   /translation="MRQKTSSNKKKQKNTNNISLRRKLGLMYKKAILGLKIVLMIFVCL
FT                   FVFTKYFTSIKTYLITNIYQITTKLGFRLENVIIEGQQNVDELTILKVLNANKRSSIFA
FT                   LKLDEISNNLKKSKWIKEVYVSRRLPNTVYIKLFEREPIAIWQINNQLFLVDEEGYKIS
FT                   KDIQPFSHLLHVVGEGANIYASQLVLELKKYPALLNKTLVAIRVGDRRWDLNLKGNISI
FT                   KLPEKEFEAALKYIDALNKNNRLFNQNYKALDLRDRNKYYIQKY"
FT   gene            306331..307566
FT                   /gene="ftsA"
FT                   /locus_tag="RT0243"
FT   CDS_pept        306331..307566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="RT0243"
FT                   /product="cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:RT0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03724"
FT                   /db_xref="GOA:Q68XB8"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XB8"
FT                   /protein_id="AAU03724.1"
FT                   /translation="MKEKISNFVTLDFGSSKIAVIAAYISKKGEIKVAGQNLHHSKGIK
FT                   SGVILDLKNAETSILTAIYALEKDCGKNIKKVILSLSGAETKSYYINYTIKINGQTVTQ
FT                   QDIKKLLQKALVEFKFKNQEIIHYFPLEFTLDNNSVENPIGMYGRALSCELHIIAASSN
FT                   LLSNIVQCFAKCHVEVTNITLAIYASAISCLTNDEKNLGALIIDMGDKTTSCGIFFADK
FT                   LIYTWYLNIGSFHISLDIAKVFGIDFVTAEKLKILYGNAIIPLFEKDSIINIDDFQVDT
FT                   PNNLNISLTIYRLAEVISARAEEILSMVKAEYDKATKGQLEVFRVVITGGGSQLRGLKE
FT                   LSNKIFEKQIRIGKPEIIAGFTEDYNPAMYSAAIGMLKIHALKQQKALSHIRLDENINF
FT                   FKKAFDWFKENV"
FT   gene            complement(307688..308194)
FT                   /locus_tag="RT0244"
FT   CDS_pept        complement(307688..308194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0244"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03725"
FT                   /db_xref="GOA:Q68XB7"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XB7"
FT                   /protein_id="AAU03725.1"
FT                   /translation="MINNSLNEIWLIIGIICILVECYIVQNIGFLFLGLGALSNSLVVY
FT                   NNPLVTLINQITFFGVFSLLWFCILYFPLKKYIYNKTNRTQNYSDMIGKTVEVYSPTVS
FT                   ANTIGQVKWSGTIMNAYLAPNEIDAKAGEQLFITRVKGNILICSKHRLNNNSYNNINAN
FT                   LYKKL"
FT   gene            complement(308184..308711)
FT                   /gene="cycM"
FT                   /locus_tag="RT0245"
FT   CDS_pept        complement(308184..308711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cycM"
FT                   /locus_tag="RT0245"
FT                   /product="cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:RT0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03726"
FT                   /db_xref="GOA:Q68XB6"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XB6"
FT                   /protein_id="AAU03726.1"
FT                   /translation="MTGKELNKIVAAILFASLIAMIVRFVANILYKPNLQVLNRGYSIA
FT                   IQESSVNTNATVIVQEPVNIPEVMKTANANHGREIVKKCLMCHSLDKDGPNKLGPHLWN
FT                   IVGRSKASITDYKYSFAISKLGGVWDDENLFAFLHKPSSYAPGTKMSFAGISKPQDIAD
FT                   VILFLKNYVHDK"
FT   gene            complement(309632..310501)
FT                   /gene="lpxC"
FT                   /locus_tag="RT0246"
FT   CDS_pept        complement(309632..310501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="RT0246"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03727"
FT                   /db_xref="GOA:Q68XB5"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XB5"
FT                   /protein_id="AAU03727.1"
FT                   /translation="MQQSTLLKPVSCYGIGVHTGKRTQLTIEPAKENTGIIFIRTDISS
FT                   ENNYIEASYYNVSDTLLSTTISNNHKIQVSTIEHLMAALWGCSIDNAVIKIDGPEVPIM
FT                   DGSSKPFVFMIECAGKKLQNAPKKYLKILKEIKVVNKDCELYCTPSEHITVDLTIDFSS
FT                   KAIGKQNLNFGVQESFTKNIADARTFGFIKDVEYLKSKGLAQGASFENAIGIDEHDKVL
FT                   NPSGLRYADEFVRHKLLDLFGDLYTSGISIVSAIKGYKTSHAFNNELLHKIFSDTTSYK
FT                   FVTSNELS"
FT   gene            complement(310675..311820)
FT                   /locus_tag="RT0247"
FT   CDS_pept        complement(310675..311820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0247"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03728"
FT                   /db_xref="GOA:Q68XB4"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XB4"
FT                   /protein_id="AAU03728.1"
FT                   /translation="MTLKNDYKTIFFSLFGIFIFSCINAINFYNFKIFLLIKNLGGEQI
FT                   NNINQTKFIGSIIAGFSLTQLINKLSNKIIILISLSLLIICTINLIILNNYTLIKINFI
FT                   LINFGIFSYFTSITLDIIEISKDKKYLFLACIILLWACGNLMIDLLNPFIKLTNNTMVI
FT                   CALLYCINILTEFRHDNHTSNKLHLNFKFSSLIKNIELQLLTGFIVSYITLNILWYYEA
FT                   FALKKQLALINLKLILKYIFLAICFSIIPICYILNKINKYFANLALNTILLICFILLPI
FT                   HGTNKNLNILYIILIGNCLGAIFICNILILIAKFRDYELRTALLSYFSMCSIGIYAGAL
FT                   SSHIPYGTINGSDVLFSVFSIIGSFVTYHFWYFIKYKLYRF"
FT   gene            312244..314295
FT                   /gene="rne"
FT                   /locus_tag="RT0248"
FT   CDS_pept        312244..314295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rne"
FT                   /locus_tag="RT0248"
FT                   /product="ribonuclease E"
FT                   /EC_number="3.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03729"
FT                   /db_xref="GOA:Q68XB3"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XB3"
FT                   /protein_id="AAU03729.1"
FT                   /translation="MHKKIIIDANFPSETRVVLLGQSNNIEDIEFQTTVRQQNKGNIYL
FT                   AKVTRIEPSLQAVFIEYGMDKSGFLPFSEIHPNYYNLSITESTFPVNAFPEIALANITI
FT                   EDDQEKPPVIYDSLIDSEEIDLKTIEDLVDSKFQSEFNLESADDIEIIQSCTTELNIPQ
FT                   YKPYKVQDVIRKNQVLLVQVTKEERGNKCAAFTTYISLAGKYCVLMPNKSSQNGISRKI
FT                   SNGEERKRLKDILNKIVSIQKNTYSVIVRTAGRGSSTLDLKKDYNYLARLWNKIRKSTI
FT                   KFSAPCFIHEEDSIIRKTIRDMCDHNVKEVVIQGQEAYEDASKFMQDLLPSELTKLKEH
FT                   KNKTPIFTQFQVEEQLVKLYQPIVTLPSGGYIVINPTEALISIDVNSGKSTSEKNIEET
FT                   ALKTNLEAAKEVAKQVKLRDLSGLIVVDFIDMSEAKNRKIIERSFKEFLSRDRARIQTG
FT                   NISQFGLLEFSRQRLRSSFLETNSEVCFHCNGKGVIRASDANAMLILRTIENEIFEERI
FT                   DIINVFTNIVSVIYLLNNKRAEIKFIEEKYNIKLNFYSDPNATSDSYSIEKVKLFKKQN
FT                   NSVNTVKPVIQNHSADYTEEEPKKEQLRKNKHKWKTANNNIVNAVKDQSVEQTVNIVEE
FT                   MKVIENNGISLEETQVTPKNAKRKYRNKNLNKKRLADSIVDGENGAES"
FT   gene            314921..315914
FT                   /pseudo
FT                   /locus_tag="RTPG14"
FT                   /note="pseudogene of cytochrome c oxidase assembly protein
FT                   CoxW"
FT   gene            316021..316932
FT                   /gene="rluC"
FT                   /locus_tag="RT0249"
FT   CDS_pept        316021..316932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluC"
FT                   /locus_tag="RT0249"
FT                   /product="Pseudouridine synthase"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:RT0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03730"
FT                   /db_xref="GOA:Q68XB2"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XB2"
FT                   /protein_id="AAU03730.1"
FT                   /translation="MIIDVNTPIPFRLDKYLKRLYPSLTQGVIEKALRQKQVTVNFQKA
FT                   EANLRVKEGDTIFINDYFNLPVTQHETLVFADAEIKLAKKILTDYLIYEDDHLIAINKP
FT                   ASLATQGGSKINLSIDSALKYLNYQGADFKLVHRLDKETSGLLLIAKNYLSSVKLHDAF
FT                   KEKLVIKKYFAITYGRPVKNVGIVKSNIGKSKGRMFKITDIDSDNGKLAITYYKLLKSL
FT                   NNNLFLIEFMPVTGRMHQLRLHAQLLGCPILGDDKYGNKEVMPYSKYMFLHANNIYLSE
FT                   SIVGKEIKLEAKLPFYFTRRLT"
FT   gene            317009..318262
FT                   /gene="pbpE"
FT                   /locus_tag="RT0250"
FT   CDS_pept        317009..318262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbpE"
FT                   /locus_tag="RT0250"
FT                   /product="penicillin binding protein 4*"
FT                   /db_xref="EnsemblGenomes-Gn:RT0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03731"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XB1"
FT                   /protein_id="AAU03731.1"
FT                   /translation="MKIFLYYRTFVNCILISLWSLEFMMSRCFLLLFFLITNCFYCFAD
FT                   IQQRMHEVEKEYLNNRFLNTVFMFADDYKPLLTGAKGIFALNGEQLKANEMMPIASATK
FT                   PFTAAGILKLQEQELLNINDKICKYLDPEMWGGKVPDWAYKISIHNLLTHSSGIAEYFS
FT                   FVKLDLNMSKQEVHKKILQFVSSKPLEISIGKKFKYSNTNFVILGMIIEKVAKKDLANF
FT                   FYDEFFKPLNMKSTSFASYSEAARIQKNVVSSNYPVRYFVTPNNSNKPIFTPVTADFLA
FT                   VPCADGGIISTPNDLVKWYRALNEGKILSKKSYKLMTTKYFVAQGIESRKSYTGYGIFL
FT                   TDLDSKHLMIHHTGKALGIQSAAGYILPNNLYYAILSNTMIKIPEEEKEKIDMKNPFNQ
FT                   LGIIYFRDAIIGAAIKKD"
FT   gene            318271..319056
FT                   /gene="xthA1"
FT                   /locus_tag="RT0251"
FT   CDS_pept        318271..319056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xthA1"
FT                   /locus_tag="RT0251"
FT                   /product="E.coli exonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /db_xref="EnsemblGenomes-Gn:RT0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03732"
FT                   /db_xref="GOA:Q68XB0"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XB0"
FT                   /protein_id="AAU03732.1"
FT                   /translation="MKIVTWNINSLRLRIELLRKLAYEYQPDIILLQETKVANSLFPLE
FT                   VIKNIGYEHVIYSGQKSYNGVAIISKLPLNNVFSLELYNDDKRHIAAIVHGLEIHNFYV
FT                   PAGGDIPDIEVNLKFKHKLEYVRLMKEWFTTNRTKNDKIIIVGDLNIAPHEHDVWSSKQ
FT                   MRNVISHTDIERSLLVELQNSLGFIDSNRYFISLDKKCYTWWSYRNVDWKKSNRGRRLD
FT                   HIWVSDNLKDALFSMNVLSEARDWLRPSDHVPYFVTLHF"
FT   gene            319148..320128
FT                   /gene="pdhA"
FT                   /locus_tag="RT0252"
FT   CDS_pept        319148..320128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhA"
FT                   /locus_tag="RT0252"
FT                   /product="Pyruvate decarboxylase"
FT                   /EC_number="1.2.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:RT0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03733"
FT                   /db_xref="GOA:Q68XA9"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017597"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XA9"
FT                   /protein_id="AAU03733.1"
FT                   /translation="MNIKPKKYKPIKEEYIKSFKDMLLLRRFEEKCGQLYGMGEIGGFC
FT                   HLYIGQEAVISAVELIKKKGDSTITSYRDHAHIILAGTEPKYVLAELMGRATGCSKGKG
FT                   GSMHLFDIPNKFYGGHGIVGAQVPIGTGLAFAEKYNGTNNICFTFLGDGAVNQGQVYEA
FT                   FNMASLWGLPVVYIIENNEYSMGTSVSRSTFMRDLYKKGESFGIRGFQLDGMDFEEMYN
FT                   GTKQVAEYVRENSFPVILEVKTYRYRGHSMSDPAKYRSKEEVAKYKERDTLVRIRQIIL
FT                   DNKYATEEDLKAIERSVQEVIKVAVEFSENSPLPSEDELYTDIYV"
FT   gene            320299..321279
FT                   /gene="pdhB"
FT                   /locus_tag="RT0253"
FT   CDS_pept        320299..321279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhB"
FT                   /locus_tag="RT0253"
FT                   /product="Pyruvate decarboxylase"
FT                   /EC_number="1.2.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:RT0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03734"
FT                   /db_xref="GOA:Q68XA8"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR027110"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XA8"
FT                   /protein_id="AAU03734.1"
FT                   /translation="MQITVREALRDAMQEEMLRDDKVFVIGEEVAEYQGAYKVTQGLLE
FT                   QFGSKRVIDTPITEYGFAGLAVGAAFAGLRPIVEFMTFNFAMQAFDHIVNSAAKTHYMS
FT                   GGQVKCPIVFRGPNGAASRVAAQHSQNYTACYSHIPGLKVVAPYSAEDHKGLMLTAIRD
FT                   DNPVIFLENEILYGHSFDVPDIIEPIPFSKAKILKEGSNVTIVTFSIQVKLALDVVNIL
FT                   QNDNIDCELIDLRTIKPLDTNMIIESVKKTNRLVIVEEGWFFAGVGASIASIVMKEAFD
FT                   YLDAPIEIVSGKDVPLPYAVNLEKLAMPSANDLIEAVKKVCYYTI"
FT   gene            complement(321762..323579)
FT                   /gene="typA"
FT                   /locus_tag="RT0254"
FT   CDS_pept        complement(321762..323579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="RT0254"
FT                   /product="GTP-binding protein TypA (tyrosine phosphorylated
FT                   protein A)"
FT                   /db_xref="EnsemblGenomes-Gn:RT0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03735"
FT                   /db_xref="GOA:Q68XA7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XA7"
FT                   /protein_id="AAU03735.1"
FT                   /translation="MTSIRNIAIIAHVDHGKTTLVDNMLKQSGTFRANQTVAERAMDSN
FT                   ELERERGITILAKCTALMWNEIRINIVDTPGHADFGGEVERILSMVDGVVLLVDASEGP
FT                   MPQTKFVLSKALNLGLKPIVVINKIDRDDQRIKEVIDEVFELFVALEANNDQLDFPIVY
FT                   ASGRAGTASLNFDNKINPLDNLSPLFNLIVTHVPTPSADNKAPFSMLVTTREYNPFFGR
FT                   VLTGRIQSGTVKINQNVKVLNHENKVLETGRITKILAFRGLERIAIDHATAGDIIALAG
FT                   VENANVADTICAPEVTEAIPSLPIDPPTLSMTFSINDSPLAGSEGTKITSSLIGARLMR
FT                   ELESNVALKVTETANKNAFQVAGRGELQLGILIETMRREGFELSISRPEVLYHTDKTGN
FT                   KQEPIEEIQVDVDDDYIGVVVKSLALRKAEMTNMRPSGGGKSRITFIGPSRGLIGYYNQ
FT                   FLTETRGTGIINRIFYGYTDYKGPIEGRRKGVLISNCDGAAVAYALWNLEERGKMFINP
FT                   GDKVYRGMIIGEHNRDNDLDVNPLKAKQLSNVRAVGKDEAIRLTPPMLLTLEQAISYIQ
FT                   DDELVEVTPKSIRLRKVLLNPNDRKRAAQ"
FT   gene            324421..324927
FT                   /locus_tag="RT0255"
FT   CDS_pept        324421..324927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0255"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03736"
FT                   /db_xref="GOA:Q68XA6"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XA6"
FT                   /protein_id="AAU03736.1"
FT                   /translation="MITEAQNVAIKGDNFKVRVAVADVQSILEGSIAIKDLRNKIEKLN
FT                   HKIQEDIAAKEAEFKPLEEKLLNERSNLSNDEFENRVNEFNAKVSYVRKEIQIRKTKLE
FT                   QAHAEAMSRVHETTITIISELAEKYNLNLVIPSAQVLYAKNNLNITSEVTFMLNERLKE
FT                   VSINY"
FT   gene            325036..326487
FT                   /gene="icd"
FT                   /locus_tag="RT0256"
FT   CDS_pept        325036..326487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icd"
FT                   /locus_tag="RT0256"
FT                   /product="IDH"
FT                   /EC_number="1.1.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:RT0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03737"
FT                   /db_xref="GOA:Q68XA5"
FT                   /db_xref="InterPro:IPR014273"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="InterPro:IPR040978"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XA5"
FT                   /protein_id="AAU03737.1"
FT                   /translation="MAEFTPITIAYGDGIGPEIMDAVLYILRQAEARISLETIEVGEKL
FT                   YKKHYTSGISEESWNVIQRTGIILKAPITTPQSGGYKSLNVTIRKTLQLFANIRPAVSF
FT                   HPFTRTLHPNLNLTIIRENEEDLYSGIEYRQTHNMYESLKLISHTGCKKIIRYAFEYAV
FT                   KNNRKKVTCLSKDNIMKFSDGIFHRVFNEIAKEYPQIDNEHYIIDIGTAKLATTPEIFD
FT                   IIVTSNLYGDIISDVAAEISGSVGLAGSANIGQHYAMFEAVHGSAPDIAGKGIANPSGL
FT                   LNAAIMMLVHIGQGDIASLIENAWKKTIEDGVHTFDIYSEHSSSKKVCTKEFAEEVIKR
FT                   LGQLPMTLPKASYPLIVKKQESKIEYKIDTTEVKKLVGTDIFINIHVFSAHDIADKINK
FT                   LDIGNFELKTISSKGLKLWPHDLRFEIISDHWCCRFMNKDGTEIKHLDIIILLQALSKA
FT                   NIDFIKVENLFEFDGVACYSLAQGE"
FT   gene            326584..326904
FT                   /locus_tag="RT0257"
FT   CDS_pept        326584..326904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0257"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03738"
FT                   /db_xref="GOA:Q68XA4"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XA4"
FT                   /protein_id="AAU03738.1"
FT                   /translation="MILYYIGILVIIIGVFAIFSGIIGFFRFPDFYTKLHAASVIESFG
FT                   VPICLIGFALIESDIVNSIKLILAALLILLLNPVATHALGKASLLMKNRTYHTVLLKKI
FT                   RK"
FT   gene            327004..328050
FT                   /locus_tag="RT0258"
FT   CDS_pept        327004..328050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0258"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03739"
FT                   /db_xref="GOA:Q68XA3"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XA3"
FT                   /protein_id="AAU03739.1"
FT                   /translation="MAVKTALNFDLGNYLLNLIVFLLVLVSIKIIFAKDLLNAIISSSV
FT                   FSILICVSELIMDAPDVAMTEAALGACLSTCVYLNLLRKLPANLKNIKITNIIPSSVIC
FT                   ILFVVTLTYLGLELPSYGDNNTPIHMYSSKYYVENTSRDIGIPSFVAAILASYRGYDTL
FT                   CETSVILIAGIAVLLVFSKKSNDSIPLFDHYSSYSNTQYKIQFSRHGMIHLKLYPIIKY
FT                   VTNFIIPYIILYSIYIQINGEFSPGGGFQAGVIFASGLVAYNMIYGEQFFQENILITVA
FT                   VLGVAIYAIVGIISLFLNDNYLDYYSLTHFIDDKLVAQHIAIFIVEIGIGLTVAAIMSL
FT                   IYNVFNYE"
FT   gene            328031..328690
FT                   /gene="ccmB"
FT                   /locus_tag="RT0259"
FT   CDS_pept        328031..328690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmB"
FT                   /locus_tag="RT0259"
FT                   /product="heme exporter protein B"
FT                   /db_xref="EnsemblGenomes-Gn:RT0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03740"
FT                   /db_xref="GOA:Q68XA2"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XA2"
FT                   /protein_id="AAU03740.1"
FT                   /translation="MCLIMNNLFVLIKHEFILQHRINNIIKYIVIFFLFYIISTVLINS
FT                   ERDISKFGLIFSVICLLISLISFSTVIFKSDVEDGSLELLLSIVSCEKIIFAKFIAIFS
FT                   CTTVGLLFVLPIIYIFFDQILFDIALFFISVWMIFILSSSLVVLSGSMQCYFKKNTNFV
FT                   GTFIMPLLIPNIIMTGLILQDHNLQLIFIIIGINLIFLPVSFCLSAYLIKNIYNIT"
FT   gene            328758..329216
FT                   /locus_tag="RT0260"
FT   CDS_pept        328758..329216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0260"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03741"
FT                   /db_xref="GOA:Q68XA1"
FT                   /db_xref="InterPro:IPR022714"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XA1"
FT                   /protein_id="AAU03741.1"
FT                   /translation="MWRALRRLIAANPMGFFLWSIITKWYLIIAVASLITLYYTVLGLK
FT                   KIGFIDYFGRETEDILSQSKAVAQNCIPKLKLVNGKLPLREFWNCLSDPGEYQHEEVTG
FT                   AKVLEDEINKFMQKQADSISDTVPPIINPYEKLENQNNLNNALNDNNR"
FT   gene            329233..329766
FT                   /gene="petA"
FT                   /locus_tag="RT0261"
FT   CDS_pept        329233..329766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petA"
FT                   /locus_tag="RT0261"
FT                   /product="Complex III (mitochondrial electron transport)"
FT                   /EC_number="1.10.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:RT0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03742"
FT                   /db_xref="GOA:Q68XA0"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019470"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XA0"
FT                   /protein_id="AAU03742.1"
FT                   /translation="MSDTEDNRNKQTTRRDFIVLTASSVAAVGAACAFWPIIDSLNPST
FT                   DVLALSSIEVDLSSIAIGQTVTVKWQGKPIFITNRTPDGIASARAVKMSELIDPEKDEV
FT                   RVKAGHDNWLVTIGICTHLGCVPLSNQGEYNGWFCPCHGSQYDSSGRVRKGPASLNLVV
FT                   PPYIFISDTKIRIG"
FT   gene            329773..330969
FT                   /gene="petB"
FT                   /locus_tag="RT0262"
FT   CDS_pept        329773..330969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petB"
FT                   /locus_tag="RT0262"
FT                   /product="Complex III (mitochondrial electron transport)"
FT                   /EC_number="1.10.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:RT0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03743"
FT                   /db_xref="GOA:Q68X99"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X99"
FT                   /protein_id="AAU03743.1"
FT                   /translation="MNKEMTHKKSNGIIEWIDYRLPIFSFFKHFSYYQTPKNLNYLWTL
FT                   GSIAGIALVIQIITGVILAMHYTPHVDHAFESVERIMRNVNYGWLLRYTHTVGASMFFA
FT                   TIYLHIARGLYYGSYKTPRELLWHIGIIIFLIMMATAFMGYVLPWGQMSYWSATVITNL
FT                   FSAIPLIGEPIVIWLCGGFSVDNPTLNRFFSLHYLFPFIIVALVILHLLALHQHGSNNP
FT                   KGIDVKSTKDTIPFHPYYTVKDFVGFGVYFIIFAYFIFYEPNYLGHPDNYIPANPLVTP
FT                   AHIVPEWYFRPFYAILRAVPSKLAGVFLMFGSIFVLFLLPWLDTSKIRSGNYRPIYRIA
FT                   FWIFMADCLFLGYLGSKPPAEPYIIISRFSACYYFCHFLVVLPLIGKYEKPLPLPNEL"
FT   gene            331424..332179
FT                   /gene="fbcH"
FT                   /locus_tag="RT0263"
FT   CDS_pept        331424..332179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbcH"
FT                   /locus_tag="RT0263"
FT                   /product="cytochrome c1 heme protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RT0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03744"
FT                   /db_xref="GOA:Q68X98"
FT                   /db_xref="InterPro:IPR002326"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR021157"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X98"
FT                   /protein_id="AAU03744.1"
FT                   /translation="MNTKLLIFIILFVTSSLSIANTEALHLKKMKWSFDGIFGTVNREA
FT                   AQRGFQVYKEVCSVCHSLNNLYYRNLKDIGFSDDEIKEIAKGYTVKDGPNDDGEMFERP
FT                   ALPYDRFVQPYPNEQAARKANNGANPPDLSLIIKARYDGANYIYSLLTSYTDPPAYFKM
FT                   MHGAHYNPYFPGAQIVMPPPLTDGQVTYMDGTNASVEQMSRDVTVFLQWAAEPEMEHRK
FT                   SIGLKVMMFLIVFTILFYIAKNRIWSNLK"
FT   gene            332686..333177
FT                   /locus_tag="RT0264"
FT   CDS_pept        332686..333177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0264"
FT                   /product="HSP22-like heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03745"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X97"
FT                   /protein_id="AAU03745.1"
FT                   /translation="MLKYIPAIFAIILSSNIAIASKNYDYINATPLRQVADLIDSHITN
FT                   IDHLFNNRLMFYESSSIKSKFITKDKQYVIIMEVPGFDKNQIKVKLNGKKLFIAGNIEE
FT                   KNKANDSDNYMNKNFNYVISLYEDVDQTNISARLKNGILTIILPRIEVKEQDAKEITIN
FT                   "
FT   gene            complement(333479..334501)
FT                   /gene="prfB"
FT                   /locus_tag="RT0265"
FT   CDS_pept        complement(333479..334501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="RT0265"
FT                   /product="peptide chain release factor 2 (RF-2)"
FT                   /db_xref="EnsemblGenomes-Gn:RT0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03746"
FT                   /db_xref="GOA:Q68X96"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X96"
FT                   /protein_id="AAU03746.1"
FT                   /translation="MRLTELEELTADPSLWNNNANAQILLREKTNIEEKLNVFNNLKSN
FT                   FEDILELEAMAEVENDFETLNQIEQDFKKLSIIAAKLETECLFSDESDYNNCFLEINAG
FT                   AGGTESHDWASIMMRMYLRFAERLGFKTQIINMINGEEVGIKSCTIRIIGKRAYGWFKT
FT                   EAGVHRLVRISPFNAAGKRMTSFASSWVYPEIDDDIAITIEDKDLRIDTFRASGAGGQH
FT                   VNTTDSAVRITHIPTNTVTQCQSDRSQHKNKAQAMKMLQAKLYKLEMQKRTDSVDKQNA
FT                   NKTDNSWGHQIRSYVLQPYQIVKDLRTDYETSDTKGVLDGNLENFVSASLAMNASGNKK
FT                   "
FT   gene            334763..336565
FT                   /gene="lepA"
FT                   /locus_tag="RT0266"
FT   CDS_pept        334763..336565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepA"
FT                   /locus_tag="RT0266"
FT                   /product="GTP-binding protein LepA"
FT                   /db_xref="EnsemblGenomes-Gn:RT0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03747"
FT                   /db_xref="GOA:Q68X95"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X95"
FT                   /protein_id="AAU03747.1"
FT                   /translation="MNNQKYIRNFSIIAHIDHGKSTLADRLIEHCGGLNAREMSQQVLD
FT                   SMDIEKERGITIKAQTVRLVYKAKNGNTYYLNLMDTPGHVDFSYEVSRSLAACEGSLLV
FT                   VDSTQGVEAQTLANVYQAIANDHEIVPVLNKIDLAASEPEHVKKQIEDIIGIDASEAVL
FT                   ISAKNGIGIDSVLEAIINKLPSPKESSTDTLKALLVDSWYDPYLGVVILVRIIDGTLRK
FT                   NMRVKMIGTNSVYTVEHVGFFTPKKHISDVLYAGEIGFFTASIKRVSDCKVGDTITDEK
FT                   KSCEQALPGFKPNIPVVFCGFYPTDSAEFEHLKDSLAKLRLNDASFEYEMESSSALGVG
FT                   FRCGFLGLLHLEIIQERLSREFNLDLITTAPSVIYKIYMLDGESLEIHNPADLPDLQKI
FT                   ASMEEPWIKATIMVPDEFIGTVLSLCKEKRGIQLDHSYISNRAKIVYKLPLNEIVYDFY
FT                   DRLKSCSKGYASFEWQMDVYELSDLVNLRILVNGEVVDALSTIVHRSRAEQRGRALCVR
FT                   LKDLIPRQQIDIAIQASVGNRIIARETIKALRKDVLSKCYGGDISRKRKLLEKQKAGKK
FT                   KMRQYGNIEIPQSAFIAALQIGGE"
FT   gene            336968..337042
FT                   /gene="tRNA-Asn"
FT                   /locus_tag="RT0267"
FT   tRNA            336968..337042
FT                   /gene="tRNA-Asn"
FT                   /locus_tag="RT0267"
FT                   /product="tRNA-Asn"
FT                   /note="codon recognized: AAC"
FT   gene            complement(337676..338362)
FT                   /locus_tag="RT0268"
FT   CDS_pept        complement(337676..338362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0268"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03748"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X94"
FT                   /protein_id="AAU03748.1"
FT                   /translation="MPFRYKRINIEKHNKSDFKSLDMMLNQNYFYQNKFEEIRESYLAD
FT                   RKVQENPKYLSDPQLRAKVEKYFEKTAWDLLLNYIVGVKEAAFYLASSYINGYGVDQDE
FT                   FLSNLTLAVGVKLGDKRSIKMLDGEAPLPTYIQKFADRCIKEIKKHKKEVQNRDVSCEE
FT                   IMARAKAFDYFVKTNTKHSYYDTIHEKNNASMKHFAYYVEPIIENNSQDQLEAIGQLTK
FT                   FHCEIC"
FT   gene            complement(338385..339527)
FT                   /locus_tag="RT0269"
FT   CDS_pept        complement(338385..339527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0269"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03749"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X93"
FT                   /protein_id="AAU03749.1"
FT                   /translation="MIKLLKIIQMSDYKDDAQIKNTLGAIKTQLTATANPSELARLASA
FT                   TADLALSTNNSELLEQIKGVQAAIAKKEETAEHNISSKIASENFEKQQINNEVLHTQHE
FT                   SEAREARLKGNYIQYDTVEEALYSLLQKEADLIKKANNIPESLTHDDLRKLKGENLTPE
FT                   EQEDERKKLEYLSILGSIIDDTKKSNEHYDKRANEIDEQLNNTIRNEEFRKNLEQEKKK
FT                   IEKKKAQTNEALNKKLKPIYKQMDEEREELFKLAETLPQYAKVNIDKHTKLYAKQYQTK
FT                   IENDPNYKELKKLQEIANKIEYRKKSKTNEIHITNNPNPTVVENLLEEKIDEISSKEIR
FT                   EAINVIKQEVNVNTKPCTTPLTPSRSPSMQRLANKTKGIE"
FT   gene            341040..341273
FT                   /locus_tag="RT0270"
FT   CDS_pept        341040..341273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0270"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03750"
FT                   /db_xref="GOA:Q68X92"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X92"
FT                   /protein_id="AAU03750.1"
FT                   /translation="MGNQEDKMLTLESYIDEEVDKRLNAKNARKELKLILITFAIILTS
FT                   FLTFTYFFLDYIEEKASSYKLQHKQKEMNKTK"
FT   gene            complement(342450..343550)
FT                   /gene="rodA"
FT                   /locus_tag="RT0271"
FT   CDS_pept        complement(342450..343550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rodA"
FT                   /locus_tag="RT0271"
FT                   /product="rod shape determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03751"
FT                   /db_xref="GOA:Q68X91"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X91"
FT                   /protein_id="AAU03751.1"
FT                   /translation="MHKNYLEQLQKLPITLIVLIIVICCIGFIVLYSAANSNLQPWAYK
FT                   QIINFCIFLPLAIIIALIDLRIIFRLSYIFYFCALALLIAVELFGSTAMGGKRWIDLGI
FT                   VKLQPSEPIKISIVLMLARYFHRSTSDDLTKLYKVIIPIIGILTPAFLIIREPDLGTGM
FT                   IVLIVAAIIFFAAGFRIKYFIILALAALISMPIAWNMMYDYQKKRVMVFLDPEHDPLGA
FT                   SYNIIQSKIAIGSGSLFGRGLNQGSQSHLDFLPEHQTDFIFATFAEEFGFIGGMFLLIL
FT                   YFALITISLLIGVNCREIFSKLMVIGITSILFSHVFINIAMVMGLLPVVGVPLPFISYG
FT                   GTMIASMLIGFGLVMNAQIHGHATLN"
FT   gene            complement(343648..345702)
FT                   /gene="ptrB"
FT                   /locus_tag="RT0272"
FT   CDS_pept        complement(343648..345702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptrB"
FT                   /locus_tag="RT0272"
FT                   /product="Protease II"
FT                   /EC_number="3.4.21.83"
FT                   /db_xref="EnsemblGenomes-Gn:RT0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03752"
FT                   /db_xref="GOA:Q68X90"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X90"
FT                   /protein_id="AAU03752.1"
FT                   /translation="MKPPIANKQNYSFEIHKQTIKDDYNWLRDPNWPNVEEAKILDYLK
FT                   AENKYTENFFLDLKKDKKKIFEELKGRIKLDDESVYIKKKDYYYYHRVERDKNYPIYCR
FT                   KHNSLKATEEIILDVNLLATKGGFTDIGTIAMSPDQNLMAYSVNFTGNEQYNIKIYNLK
FT                   KQQYLSNEVQDVAPVIIWHARLNGFFYITINENQRWDRVIFHSLDGDITQDRLIFEVKN
FT                   PIHFISCKKSASHEYIFINSGDHNENEIYVISMQDDSFTPKLVRVAENKVFYEIEHNGN
FT                   YFYIKTNYKAKNFHIIKVPINNFENANWNDIYIQEEQDKYLKSFDVTQNYLILNYRYNG
FT                   LPLIKIKQFQDQHENIIHFPDVSFQANSFSTNFEEDNIRIDYSSLARPNTTYSYDFDKN
FT                   KLIILKSQEIPSGFNPDEYKVERIFADNEGVKVPITLFYKKSLFKKDGSNPLYLIGYGA
FT                   YGITIPVNFRNIAVTLTNRGFIYAIAHIRGGDDLGHDWYEAAKFLTKKRTFEDFIACSR
FT                   TLIKEKYTNNHNIVIAGGSAGGMLIGYVLNEKPEMYRAAIAHVPFVDVLNTMLDESLPL
FT                   TLLEYNEWGNPKEREYFDYIKSYSPYDNVKTQNYPALFITCGISDPRVGYWEPAKWVAK
FT                   LRKLKTDNNPLLLKINMDTGHQGAAGRFDYLQEITDELVFIFKIFDVEI"
FT   gene            complement(345773..347314)
FT                   /locus_tag="RT0273"
FT   CDS_pept        complement(345773..347314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0273"
FT                   /product="HyfB domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03753"
FT                   /db_xref="GOA:Q68X89"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X89"
FT                   /protein_id="AAU03753.1"
FT                   /translation="MFIQNTKFTFPFTNFNLIFDFNPQNQLIALSFIIITTILNLYTIS
FT                   KKRKLECLIGSLYCLSSIVCVFAADFISMIISIEFMTIFTCIIIFCEQLKIQPLRQYFI
FT                   THLFSSGLILIGMTLQITTISNTAFISLTESVNHFKLPSILILTGCLINAATIFVNGWV
FT                   VNCYPAASSSGVVYLISFTTKVSLIIILKLFSGLEILKLFGISMMIYGLVLSLIEKNLK
FT                   RLICYLTISQLGFILAAISINTPNIAYLITSFIFMHILYNGLFALYFTYIEDEYGIKNY
FT                   QDLHKSSINLNLLIGFVISILIYISILPMRSSYIKNAIANILNEENIMLFFKIITCTVL
FT                   FELLLESLHLLYRRASRICNTNIKPFSIIEYFLNNALKTRHDIITILYLHCCIITLFLC
FT                   LLYPIQISHNTNSNQLIIITISLLLALIFRKIPRISTENINLDLYQYIEKLIFFIVDKY
FT                   TEKYDKKNVEAHINLKAILDNILSKISAWHNQQTAIFIVLFLLISFILTLYYTST"
FT   gene            complement(347967..349424)
FT                   /locus_tag="RT0274"
FT   CDS_pept        complement(347967..349424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0274"
FT                   /product="HyfB domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03754"
FT                   /db_xref="GOA:Q68X88"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X88"
FT                   /protein_id="AAU03754.1"
FT                   /translation="MIMQFSTTNLLILSTLLVGALNLTSPYATKKDSFIRNFLLITIAI
FT                   FFYGNILIIDFLFLKGIRAEFEFNIFGNYSIGFHLEPLGLIFLSLIGFLWICALLYTPK
FT                   YLAINNIEHSSRFLFFFNLTILIGILIALSSNLLTMFICYELLTISTAFLIGHTRNNIV
FT                   LSGLYKYLKILMISAMLLFLPAVIIIYTKTGNGNFESCSIVNYFTKKQSIILLLMFIFG
FT                   IAKTAIFPVHSWLPAAMVAHYPVSSLLHAVIVVKTGLFCIYKILLYIFGLSYLQIIFAE
FT                   FNWLIFIPIVSIFYSSIKALRTDNIKKILAYSTMNQLSLALLSAFMLTPKALGAAILHL
FT                   VSHSFTKICLFYSMGSIYSVKKTDQVQNLHGIYKELPLIALIISISSLSLIGIPIFSGF
FT                   ISKFSILLAASEQNQIIVMIVVIASSIFSSIYLLKILSAIYKPSALEYSVTKPLPYSIH
FT                   ISIIICALAITLFYFIQILIREFIYIT"
FT   gene            complement(349476..350768)
FT                   /locus_tag="RT0275"
FT   CDS_pept        complement(349476..350768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0275"
FT                   /product="HyfB domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03755"
FT                   /db_xref="GOA:Q68X87"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X87"
FT                   /protein_id="AAU03755.1"
FT                   /translation="MILTKHFPIIQILFPLFGALLSIISFRFIIFARVITIICILSSLL
FT                   VSIYGYNIIQNTELSYTIGGWTSNIGIEYHLNPLNQATTIYLNLVLLFFLVCCHKITNR
FT                   TILQYINNNRKSLFYGILLFAHTGYLGMISTNDFFNLYVFIEMSALSSYVLIASGNNPK
FT                   SLVGAFDYLIMGSIGATFILIAIGFLLSITGSLNMYDIAAYLKEYTKPRIITIVIGFFL
FT                   IGSILKTAFFPMHFWMIRAYNNTASIILVYLAGISTIIGIYIIYKFTYIIIGYETIKTA
FT                   ITNFIRPIALASLIIAPYFAYQAKDFKNIIIYSCFTQIGYIFLLYSTKNCIIMLPSLLL
FT                   IDSINKMSLFLIAAYNESYKKAPNKILTIIIIICSCGLPISPLFFIKINILEILLAQSL
FT                   LLDFVIILLSSVVSLFYHYKMILLSLTQKYA"
FT   gene            complement(351086..351421)
FT                   /locus_tag="RT0276"
FT   CDS_pept        complement(351086..351421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0276"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03756"
FT                   /db_xref="GOA:Q68X86"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X86"
FT                   /protein_id="AAU03756.1"
FT                   /translation="MHLLIYFLTLILFTSGLFIMLTSHNYIHKIIGLGIFQSPVLLFFL
FT                   SIGKIKTGGVPILQDGINTYTSPLPHVLILTAIVVGFATLSVALSLIYQIYKHYGTVSA
FT                   NEVNVDK"
FT   gene            complement(351539..352291)
FT                   /gene="trbG"
FT                   /locus_tag="RT0277"
FT   CDS_pept        complement(351539..352291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbG"
FT                   /locus_tag="RT0277"
FT                   /product="probable VirB9-like conjugal transfer protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RT0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03757"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR014148"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="InterPro:IPR038161"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X85"
FT                   /protein_id="AAU03757.1"
FT                   /translation="MKPLIIFCTFIILTLDVFALTMSRPLGRDPRLRVMIYNPDDVFKF
FT                   TGYYGYQASIELAKEEEIVSISMGDTTSWQIVPAGHRIFIKPMEPDATTNMTLITNKRT
FT                   YFFELYAAETLDIRDPEMVFNVKFLYPDDENDNMSGHMQTFSTALASPDLTHPEKYNFN
FT                   YYISGSEEIAPIKIFDDGEFTYLQFRDKNAEISGIFAVDDSLRESLVNYRLAQDNPNMI
FT                   ILEQVFPKLAIRKGKKVTCVFNHSFKAY"
FT   gene            complement(352293..352991)
FT                   /locus_tag="RT0278"
FT   CDS_pept        complement(352293..352991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0278"
FT                   /product="VirB8-like protein of type IV secretion system"
FT                   /db_xref="EnsemblGenomes-Gn:RT0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03758"
FT                   /db_xref="GOA:Q68X84"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="PDB:4O3V"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X84"
FT                   /protein_id="AAU03758.1"
FT                   /translation="MDQLTNAIKEYIKSGEYFIDARKWYNFKYILPLSHRSFLLLTCTI
FT                   FTLLLTLIGVNINILLPIQKKVGYLIKDDSEKQATITNTKYSTLANPYISVANIMLQNY
FT                   VKQREKYNYDTLKEQFTFIKNASTSIVYMQFANFMNIDNSLSPVIRYQKLYRRSINIIS
FT                   INNINNNEATVTFESLAQNNTGEILENMLWEAKIGFIMDSISTSTLHNMPFHFIVTSYK
FT                   LKLLRNKNQQ"
FT   gene            353439..353618
FT                   /locus_tag="RT0279"
FT   CDS_pept        353439..353618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0279"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03759"
FT                   /db_xref="InterPro:IPR024444"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X83"
FT                   /protein_id="AAU03759.1"
FT                   /translation="MLKSLKFLLVFIMIAQLLSCTPSAPYEIKSPCVSADIDDNSNLSV
FT                   NPCIRRPINALNIV"
FT   gene            353669..354400
FT                   /locus_tag="RT0280"
FT   CDS_pept        353669..354400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0280"
FT                   /product="VirB8-like protein of the Type IV secretion
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:RT0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03760"
FT                   /db_xref="GOA:Q68X82"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR026264"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X82"
FT                   /protein_id="AAU03760.1"
FT                   /translation="MNNIFGFFKSSNNTQSGSGGKQNHESIKSTNPLKISQNWYEERSD
FT                   KLIVQRNLLIILIILLTIFMVISTLVIAFVVKSKQFDPFVIQLNSNTGRAAVVEPISSS
FT                   TLTVDESLTRYFIKKYITARETYNPVDFATIARTTVRLFSTSAVYYNYLGYIRNKDFDP
FT                   TLKYKADNTTFLVIKSWSKIAEDKYIVRFSVNETSGSQLVYNKIAVVSYDYVPMQLTDS
FT                   ELDINPVGFQVNGYRVDDDNS"
FT   gene            354387..354863
FT                   /gene="virB9"
FT                   /locus_tag="RT0281"
FT   CDS_pept        354387..354863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB9"
FT                   /locus_tag="RT0281"
FT                   /product="VirB9 protein precursor of the type IV secretion
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:RT0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03761"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X81"
FT                   /protein_id="AAU03761.1"
FT                   /translation="MTIVRFYFLAFLLLSGFTAQRACPVVDDSFNSISNNYVDDLSLTK
FT                   DNRIRTYIYNPNEVYLLVLHFGFQSHIEFAKNEEIQNIILGDAYAWKITPLANRLFIKP
FT                   LEKDIRTNMTIITNKRTYEFDIASTELMIGNERDLVYVIKFYYPKKNSNYMARF"
FT   gene            354946..356397
FT                   /gene="virB10"
FT                   /locus_tag="RT0282"
FT   CDS_pept        354946..356397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB10"
FT                   /locus_tag="RT0282"
FT                   /product="VirB10 protein of the type IV secretion system"
FT                   /db_xref="EnsemblGenomes-Gn:RT0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03762"
FT                   /db_xref="GOA:Q68X80"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X80"
FT                   /protein_id="AAU03762.1"
FT                   /translation="MVAEQNNNNNTDSLSGTDLPEVQRELSKVSVSFNKNIAIVVVICA
FT                   ILIYIFYTLFFDMRKEEIPETKIPSNIVTPVTDVNDIIPEIPKLPDPPKLERPTVLQPP
FT                   PPPPPVVEVPPVLPPISIEGNKEQTLQLPPVSLPTTSSTLVESDAEKQRREAKRKSAIV
FT                   LVGGVEPKKTPEQITEAVTFKDRGDMFLLLGRGKLIDAVLETGINSDLGGEIRAIISRD
FT                   VFSEKGKVILIPKGSKIFGKYATSTSSDSYGRVSIIWDRVDLTNGYTIEFDSPAVDNLG
FT                   RPGLQGRVDNKYKEQFANAVLQSGFNIGLAKILDKLVPPPIDSQAAATNSATATQILNI
FT                   AQTISSNTAIDVNTRIVTICTNILAAITDKTSIAYTTMTQACATAQNASSANTSEQRLQ
FT                   TLVQAVNTAASNLLTTTSIASTPTQAQQASTQAFTDVTNVVQNMITQQHFKPTTTVNQG
FT                   TPIRIYVNKDYKFPRTVLLKSKVMK"
FT   gene            356394..357398
FT                   /gene="virB11"
FT                   /locus_tag="RT0283"
FT   CDS_pept        356394..357398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB11"
FT                   /locus_tag="RT0283"
FT                   /product="VirB11 protein of the type IV secretion system"
FT                   /db_xref="EnsemblGenomes-Gn:RT0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03763"
FT                   /db_xref="GOA:Q68X79"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR014155"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X79"
FT                   /protein_id="AAU03763.1"
FT                   /translation="MNEEFAALETFLLPFKNLFAEDGINEIMVNKPGEAWVEKRGDIYS
FT                   KQIPELDSEHLLALGRLVAQSTEQMISEEKPLLSATLPNGYRIQIVFPPACEIGQIIYS
FT                   IRKPSGMNLTLDEYAQMGAFDNTATESLVDEDADILNNFLAEKKIKEFIRYAVISKKNI
FT                   IISGGTSTGKTTFTNAALTEIPAVERLITVEDAREVVLSSHPNRVHLLASKGGQGRANV
FT                   TTQDLIEACLRLRPDRIIVGELRGKEAFSFLRAINTGHPGSISTLHADSPAMAIEQLKL
FT                   MVMQADLGMPPEEVKKYILSVVDIVVQLKRASGGKRYVSEVYYKKNKNSESML"
FT   gene            357721..359496
FT                   /gene="virD4"
FT                   /locus_tag="RT0284"
FT   CDS_pept        357721..359496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virD4"
FT                   /locus_tag="RT0284"
FT                   /product="VirD4 protein of the type IV secretion system"
FT                   /db_xref="EnsemblGenomes-Gn:RT0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03764"
FT                   /db_xref="GOA:Q68X78"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X78"
FT                   /protein_id="AAU03764.1"
FT                   /translation="MEWHKILKVTRNIFGHAIIHPVVIFCTIWISGVFIAIFTNEIGAL
FT                   GADINAINITYKWAYWLINVWRQLKIADYNYLKLKLIISLLGPAIIVIIFYIKNFQRIK
FT                   SLQFFEQPEKVYGDASWANQSDIEAAGLRSKKGMLIGVDAGGYFVADGFQHALLFAPTG
FT                   SGKGVGFVIPNLLFWTDSVVVHDIKLENHNLTSGWREKQGQKVFVWEPSNPDGITHCYN
FT                   PIDWVSTKPGQMVDDVQKISNLIMPEKDFWNNEARSLFLGVTLYLIADPTKTKSFGEVV
FT                   RTMRSDDVVYNLAVVLDTLGGVIHPVAYMNIAAFLQKADKERSGVISTMNSSLELWANP
FT                   LIDSATASSDFNIQEFKKVKTTVYVGLTPDNIQRLQKLMQVFYQQATEFLSRKMPDLKE
FT                   EPYGVMFLLDEFPTLGKMDTFKAGIAYFRGYRVRLFLIIQDTQQLKGTYEDAGMNSFLS
FT                   NSTYRITFAANNYETANLISQLVGNKTVEQRSFSKPLFFDLNISTRTQNVSQVQRALLL
FT                   PQEVIQLPRDEQIVLIESFPPIKSRKIKYYEDKFFTSRLLPPTFVPTQVPFNHVSNNSD
FT                   ASKETETTTAIENNE"
FT   gene            359505..360917
FT                   /gene="gppA"
FT                   /locus_tag="RT0285"
FT   CDS_pept        359505..360917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gppA"
FT                   /locus_tag="RT0285"
FT                   /product="Guanosine pentaphosphate phosphohydrolase"
FT                   /EC_number="3.6.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:RT0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03765"
FT                   /db_xref="GOA:Q68X77"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X77"
FT                   /protein_id="AAU03765.1"
FT                   /translation="MRSAIIDIGSNALRAVVYESDELGAPEIFNYKFRNYLTNLLNLDN
FT                   LDVKHQTYLSIQYLIHVFTKLSVTNIKCVATAILRGHPKADEFKTIIKKRFNIDIEIIS
FT                   GEREAYLTAAGLISGISDAFGIVADLGGGSLELAHICNKKVGKLKSLPLGTKIITNSNV
FT                   GDVGLITKMLEEEFGVAHYPNLYLIGGALRLMSRIYMESINYPLKNLHNFEINRVEFEL
FT                   YLEKLSQIDKLKLSYYEQKAINYNAVLVIKAMLKVFSPEKIIISNYGLKEGVRFDSLPY
FT                   HETEKDIIYERVKRLVNFDKNICKIEKYIEALQYLLINSDATTLIIIELAIMLAQYNKN
FT                   IDKTLRANFVSEFILSSDIPFSQRQRLMLGIALTVTYTAKTDMQINKIAKKMISKSDYY
FT                   NSHIIGYYIKIAREIDGPEFQEPSFSIKLKDDKFLQINASNILPKQVFDKVCERLKDIS
FT                   SARKNISYNFSD"
FT   gene            362555..363442
FT                   /locus_tag="RT0286"
FT   CDS_pept        362555..363442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0286"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03766"
FT                   /db_xref="InterPro:IPR022565"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X76"
FT                   /protein_id="AAU03766.1"
FT                   /translation="MFRKFLFIPLLIVTSLVKAEIIEVDSLSKITQDFKVNYNKNYLPQ
FT                   DLLVVTVLDKFLFKPFGIPIGEYIDQRRYLELAPLFSQINKNSKIIYIAQLILTNDSYK
FT                   KELQESDFPSFVNEISNSQIPIIAVNNGFTGNFNNIPKFEIWFADYLKKNFYIDFSKSF
FT                   PNNNYIIFNNLDSFANTYPVFYKGILTSNNISVAQVILNFLIQINFIPKCFILISSNRE
FT                   LIRSMEFQLNNHSSNILFIGYHYNNKTISAHKDIVYYTKMINDLIPQINKLKRNNPPLK
FT                   NNNAKSKNSYETHK"
FT   gene            363426..364250
FT                   /locus_tag="RT0287"
FT   CDS_pept        363426..364250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0287"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03767"
FT                   /db_xref="InterPro:IPR022565"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X75"
FT                   /protein_id="AAU03767.1"
FT                   /translation="MKRINKVLLSLLCLVIAYAGYSQIIPTYSVDSVTIQNLLPQVDAD
FT                   TLVLINIDNTIITPKSKLFRYQDNAYINFTKYLYSLAAHNASVNKTIAKLIVQRQMMLV
FT                   ESQWVDLINKMKNQGATVLGLQEITAPCNLIENYEGWLYTILYGLNINFTRKVNDKEVF
FT                   RFNPSDAEAPIFYLGIIFTGNLNKVNTLIEFLNIIPIPPKKIVIFANNKKDLENIDSYL
FT                   SMVDIGYYGIEYFGWQMLPGSPDNQIAEFQQSTFLNTGQWLEDDTAAKMLNK"
FT   gene            364253..365029
FT                   /gene="cysQ"
FT                   /locus_tag="RT0288"
FT   CDS_pept        364253..365029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysQ"
FT                   /locus_tag="RT0288"
FT                   /product="3prime(2prime),5prime-bisphosphonucleoside
FT                   3prime(2prime)-phosphohydrolase"
FT                   /EC_number="3.1.3.7"
FT                   /db_xref="EnsemblGenomes-Gn:RT0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03768"
FT                   /db_xref="GOA:Q68X74"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X74"
FT                   /protein_id="AAU03768.1"
FT                   /translation="MNDNLINALKDLIINTGKVALDIKKTGILIDTKSDGSVVTNADQE
FT                   ISKIIYQTLQSLTSQIAIVCEEQPLPILNSDTFWLIDPIDGTRSYVDGKNTYTVNIGLI
FT                   ENGFPTIGLIYHPETAKLYYTDVNGRLKIEQNSQEIFVKHAPKHKEPNAVVGFYNSNKA
FT                   TKEFLRSYSFGKINTISSSIKLCLIAEGEADIYPKFGQTMEWDIAAGHALIKASGGNIL
FT                   DCDGQEVTYGKVNFANPHFFACSKYWLEMDYIFCIR"
FT   gene            complement(365136..367811)
FT                   /gene="mutS"
FT                   /locus_tag="RT0289"
FT   CDS_pept        complement(365136..367811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS"
FT                   /locus_tag="RT0289"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /db_xref="EnsemblGenomes-Gn:RT0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03769"
FT                   /db_xref="GOA:Q68X73"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X73"
FT                   /protein_id="AAU03769.1"
FT                   /translation="MTLCNMNLYEFRQKYNYDVATKMMQQYLDIKFAHLDCLLLFRMGD
FT                   FYELFYEDAILASNILGIALTKRGKNCEEEIPMCGVPYHALEHYLTKLITENYKVAICD
FT                   QLETPEEAKKRGGYKAVVTRDVTRIITPGTIIEENLISAAEPNYLTSLVMTKNKKTASI
FT                   CYVDLSTSKIFIVNVPETEILNELARLKSREILLSENLKSSNLADSILKQFNCRITYQV
FT                   DSFFAINKCEKIILDFYKIRDIKGIGEISSSQICAIGSILEYLSLTQKQNIPNLPIPKI
FT                   INFHSYMTIDFSTRRNLEIVTNIQGNLHGSVLNTLNHTVTKQGGRLLYHFLSSPLTNIA
FT                   KINRRLNITEFFYSNLGIVTRIRELLKNTSDIERCLTRITMNRSSGRDLLSIKYTLETA
FT                   KIINGLFSESHSLNLPNFIGKIIKPLSGDAELYNLIDMSIREDAPNNLNDGGIIKHEFH
FT                   PKVAQLNDLINNGKLHVEKLKDQYRKETGIDSLKISHNNVLGLFIDITAKNVNKILDPK
FT                   FIHRQTTVNSVRYTTYELQNLENELVNAQTLVISLEKELYTDICRKVIEKSSYLRILAN
FT                   SLSGLDVFCNFAYIADEYNYTKPEFTNDLSFDIVKGRHPVVEAALLKTSKSFVYNDCHL
FT                   SEAERICLITGPNMAGKSTYLRQNAIITIIAQIGSFVPAKSAKIGVVDKIFSRIGAADD
FT                   LIKGQSTFMAEMLETSAILAQSTKNSLIILDEVGRGTSTYDGVSIAWSVLEYIHDKLKC
FT                   RCLFATHYHELTVMKNFLPALQNYTIAIEESGKDILFLHNIILGTSNKSYGLHVAALAG
FT                   LPTSVINRAAQILLKFEKISISKGKNIVSTASNNLSLFNFEPQKHISNSKLDEEFKTID
FT                   PDKISPKEALELIYKFKKLV"
FT   gene            complement(368030..368464)
FT                   /gene="rpiB"
FT                   /locus_tag="RT0290"
FT   CDS_pept        complement(368030..368464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiB"
FT                   /locus_tag="RT0290"
FT                   /product="5-phosphoribose isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:RT0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03770"
FT                   /db_xref="GOA:Q68X72"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X72"
FT                   /protein_id="AAU03770.1"
FT                   /translation="MKTYNIVIASDHSGYELKSKIINYLEQKCLNIYDCGTQDTQTVDY
FT                   PDYAKKVVDIIIEKAAPIGILISDTGIGMSIAANRSSEIRAALCNDILTAENAKAHNDA
FT                   NILILGAKSVDNKIVFNIIDKFLTTKFEGGRHSTRLSKIK"
FT   gene            368701..369333
FT                   /gene="nlpD"
FT                   /locus_tag="RT0291"
FT   CDS_pept        368701..369333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nlpD"
FT                   /locus_tag="RT0291"
FT                   /product="outer membrane antigenic lipoprotein B precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RT0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03771"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X71"
FT                   /protein_id="AAU03771.1"
FT                   /translation="MKYTVVLIVVVCFCLVSCVDQSPAPIDYKVGDVTENNYLTELDYD
FT                   PGMIVQRNIEDTSISGKVSDKLEERKAKIIEDDYDYIEMSMYRNEDEAMIEQLNFVTPL
FT                   HGVIINDFKVGKSQGIDIAVQEYSAVKSIAAGTVIYSGYNKQFGNLVIVKLDANDLEVA
FT                   YAHLDDLLLKKGDKIAKGSIIGHVEHQLYFAMRKNKIAIDPNKYIEF"
FT   gene            370026..370910
FT                   /gene="thyA"
FT                   /locus_tag="RT0292"
FT   CDS_pept        370026..370910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /locus_tag="RT0292"
FT                   /product="thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:RT0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03772"
FT                   /db_xref="GOA:Q68X70"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X70"
FT                   /protein_id="AAU03772.1"
FT                   /translation="MHNTTKRVTVPALEAMLYETIKVLDHGFIRVIDYMGDDSSIVQAA
FT                   RVSYGKGTKQLNQDKGLINYLLRHYHTTPFEMCDIKFHIKLPIFIARQWIRHRTASVNE
FT                   YSARYSILGNEFYLPEPTDIASQSAINKQCRAGDSLPKKVSEKVLAILEEDARRCYMHY
FT                   KELMNADEDGNIIDENVAGIARELARMNLTLNYYTEWYWKINLHNLLHFLRLRTDSKAQ
FT                   YEIRVYAGKILDIVKAWVPFTYEAFEEYRLQGANISRKGLEVIKRMIQGEKVIHETSGM
FT                   NKREWEELVKIFR"
FT   gene            371082..372413
FT                   /gene="tolB"
FT                   /locus_tag="RT0293"
FT   CDS_pept        371082..372413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolB"
FT                   /locus_tag="RT0293"
FT                   /product="TolB protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RT0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03773"
FT                   /db_xref="GOA:Q68X69"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X69"
FT                   /protein_id="AAU03773.1"
FT                   /translation="MRNIVYFILTLFSLTGYALETINIEHGRVDPTPIAVNKFNADSSN
FT                   NDLVGNAVVKVISNDLKISGLFRPISSASFIEEQTGINYKPLFAAWRQINASLLVNGEV
FT                   QTLESGKLKISFILWDTFLEKQLIGALFEVPTKLWRRAAHKIADKIYEKITGDPGYFDT
FT                   KIVYVSESTALPKIKRIALMDYDGANNKYLTNGKSLVLTPRFAHSADKIFYVSYATKSR
FT                   ALVYEKDLKTGKESVVGDFVGISFAPRFSPDGKKAVMSIAKNGSTHIYEIDLATKQLNK
FT                   LTDGFGINTSPSYSPDGKKIVYNSDKNGVPQLYIMNSDGSDVRRISFGGGSYASPSWSP
FT                   RGDYIAFTKITRHDGEKIFNIGIMKAYPQDHENSERIITSGYLVESPCWSPNGRVIMFS
FT                   KGWPSRAKAPGKNKIFTIDLTGHNEREVITPAGASDPEWSDVLN"
FT   gene            complement(372552..373433)
FT                   /gene="rpoH"
FT                   /locus_tag="RT0294"
FT   CDS_pept        complement(372552..373433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH"
FT                   /locus_tag="RT0294"
FT                   /product="RNA polymerase sigma 32 subunit (heat shock sigma
FT                   factor)"
FT                   /db_xref="EnsemblGenomes-Gn:RT0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03774"
FT                   /db_xref="GOA:Q68X68"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X68"
FT                   /protein_id="AAU03774.1"
FT                   /translation="MTNNINALAISSESGFYSYLQKINKIPSLTQEEEFLLAKSYLEEN
FT                   DLQAAHKLVTSHLKLVAKIASGYKTYGLPITELVSEGNIGLMQAVKKFNPELGFRLSTY
FT                   AMWWIKASIQEYILKSWSLVKMGTTAAQKKLFFSLNKVKHKITNLYSRAITTDDFAQIA
FT                   DELGVSVHEVSEMNTRISGPDLSLNNSINSDDVESGELIELLPETRPTPEAMAINKQNY
FT                   TSKRKLLSNAMQILNDRELRILKDRKLTDTPKTLDILSSEYNISKERIRQIENTAFEKI
FT                   KKFILNNNREIA"
FT   gene            373523..374000
FT                   /pseudo
FT                   /locus_tag="RTPG15"
FT                   /note="pseudogene of cytochrome c oxidase assembly protein
FT                   CtaG"
FT   gene            complement(374074..375039)
FT                   /locus_tag="RT0295"
FT   CDS_pept        complement(374074..375039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0295"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03775"
FT                   /db_xref="GOA:Q68X67"
FT                   /db_xref="InterPro:IPR008630"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X67"
FT                   /protein_id="AAU03775.1"
FT                   /translation="MLFKIFYKTIIVYFVLIILEYAHQGFINDLSLQKVDLYIQHSIKE
FT                   PIYLVSYADGPEYVYRNQNTTTHYAINKGIDFIFNYKKKYINQLFITKHQEIFNEPVGA
FT                   GLWLWKPYIILETMKSAPEGAIIIYLDSAFVINKHIRNLTNLLGDNDVLLVHDRNRKNG
FT                   SFIKGETFALMECLTDECRNDNHIWSAVIIVRNTELSRVFIEKWLKSCEDIRILSGKNY
FT                   NIYPNYAEYKWHHYDQSVLSIIYHKNPQSVKVIEYDEITDVLSWFHRKYSNSSPSKPWY
FT                   SIYGINPIINFNTNGKVLPSTALINTPPIVRLRKWILKHQ"
FT   gene            375269..376345
FT                   /gene="trmU"
FT                   /locus_tag="RT0296"
FT   CDS_pept        375269..376345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmU"
FT                   /locus_tag="RT0296"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:RT0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03776"
FT                   /db_xref="GOA:Q68X66"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X66"
FT                   /protein_id="AAU03776.1"
FT                   /translation="MATIVVAMSGGVDSSAVAAMLHEQGHHVIGITLQLYDYGIAVGKK
FT                   NACCAGKDIYDAKMVANKLGIPHYVLDYENKFKESVIDNFVNSYLHGETPLPCVQCNKL
FT                   VKFRDLINTAKELGADKLATGHYVRKINGYNGAELHTGLDAAKDQSYFLFTITREQLEY
FT                   LIFPLGGFTKYETRKLASKFGLDVADKPDSQDICFVPDGNYKTVINKIRPEASTSGKIV
FT                   HINGFELGEHSGIINYTIGQRRGLGIAYNEPLYVVKIDPSNNIVYVGQESALHVHEFII
FT                   KDVNWLADEIKDNEKLAVDVKIRSTRPPCHAEISKLCNDKIKVQFLSAEKAVAPGQACV
FT                   IYAGERVLGGGWITRNIR"
FT   gene            376475..377881
FT                   /locus_tag="RT0297"
FT   CDS_pept        376475..377881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0297"
FT                   /product="AtrC1-like cationic amino acid transporter
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03777"
FT                   /db_xref="GOA:Q68X65"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004758"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X65"
FT                   /protein_id="AAU03777.1"
FT                   /translation="MSFLRKKSFESVKEIGSSSGLSKTLGAFDLILLGLGAMIGTGVFV
FT                   VTGIIAAKFSGPAVMISYMIAGITCIFVALVYTELAAMLPTSGSIYTYSYVAFGEVFAW
FT                   MIGSVIILELGVSAGIVAAGWSGYVQGILEAGGIYLPKVLTTVPSNGGVINLPAFLISA
FT                   FIGFILFLGTKDSKKINAILVFIKMAAIFAFVLASAPHFDATNWSNFMPFGFGSVVMGS
FT                   SILFLAFTGFGTIATAAEECKNPKRDILIGIIGSLILTTLVYVIMSGLVTGIAPFDQLN
FT                   NDRPLAYALTINNSKIGSAIVSTGAVCGMMTVLMMNIYGTSRIFYAIARDGLLPKSFAK
FT                   LHPKYDSPYITIIIFSALAAFLGGFCPTEIITQLTSMGALIDYIVVAIIVMMFRIKLPT
FT                   AQRSFKCPIVFIIAPFILLACIYLLLTQMYGDEIYKGNFNLLTSGRVLIYWFITIFVLY
FT                   LIRSFFMKKE"
FT   gene            377945..379183
FT                   /gene="hisS"
FT                   /locus_tag="RT0298"
FT   CDS_pept        377945..379183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="RT0298"
FT                   /product="Histidine translase"
FT                   /EC_number="6.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:RT0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03778"
FT                   /db_xref="GOA:Q68X64"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X64"
FT                   /protein_id="AAU03778.1"
FT                   /translation="MIDNLQPLRGMKDLLPDDYQVHNYIINKARDVGVLYGYKQMSTPI
FT                   LEYTRVFNRCMGDSSDVISKEIYSFVDKSNNAIALRPEFTSGIIRSFISNGLHHKLPLK
FT                   LFSTGPVFRYDRPQAGRQRQFHQLNYEYLGAKGAITDAETLKLAVDILKALEIEEDTTL
FT                   ELNSLGCSESRIVYQQKLVEYLNDFKDKLSGESKIRLNKNPMRILDSKSEIDQKIIANA
FT                   PILSDYHTNESKKYFDELLKYLDILGIKYSINPRLVRGLDYYCHTVFEFTTQKLGSQAT
FT                   ILAGGRYDMLSRIMGNYDVHAIGFAAGIERIALMKKYNIFVIKPVFVLPIGKNNICYAL
FT                   DIVDKLRLHNIISIIDPIGKIAKRIQRVLNEDAKFIIFVGDEEKMNNNLKFKDLKNQKE
FT                   YIIDLEKVLELLK"
FT   gene            380949..381674
FT                   /gene="tolQ"
FT                   /locus_tag="RT0299"
FT   CDS_pept        380949..381674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolQ"
FT                   /locus_tag="RT0299"
FT                   /product="TolQ protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03779"
FT                   /db_xref="GOA:Q68X63"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014163"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X63"
FT                   /protein_id="AAU03779.1"
FT                   /translation="MSADTNINDRLEIVMQDHFSILSLIGSSDFIGKSVMLMLLIASIW
FT                   SWSIILHKIFSLAQVQRRIQSFENVFWSGCVLEQLYESIKKSVNNPLALIFVSAMDECN
FT                   SLNTKGFSEALKNNHKERIMSAMYLAQNREIEKLEKYLNVLATVGSSAPFVGLFGTVWG
FT                   IMHSFQSIALSKNTSLAVVAPGIAEALLATAIGLFVAIPAVIFYNYLMSRITLINNKIE
FT                   DFISELNSILSKAIDQEKM"
FT   gene            381674..382105
FT                   /gene="tolR"
FT                   /locus_tag="RT0300"
FT   CDS_pept        381674..382105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolR"
FT                   /locus_tag="RT0300"
FT                   /product="TolR protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03780"
FT                   /db_xref="GOA:Q68X62"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014168"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X62"
FT                   /protein_id="AAU03780.1"
FT                   /translation="MAIKCAGSSRKSKKTVVSEINVTPLVDVMLVLLIIFMVTSPMLVS
FT                   GVNVDLPETNPSTILGQDEPLVVTINNEGKIYLLETPIERTHLTDKIINITTGNKDARI
FT                   FVRGDKNVSYGKVVEVIAEIHSAGFSRVALISNIKNNEK"
FT   gene            382095..383057
FT                   /locus_tag="RT0301"
FT   CDS_pept        382095..383057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0301"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03781"
FT                   /db_xref="GOA:Q68X61"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X61"
FT                   /protein_id="AAU03781.1"
FT                   /translation="MKNNQIKDHFTFFLSCSIILHLMLFYCVLFCMPSLLNKKFPEEQI
FT                   ISFEIFPLSDRSNIITQTKQKEDPIEHEDAKKSEQSKLTTEAPQVISQEKNAKERETET
FT                   IEEKSPIKESNTKEVKGTLLEQKGEVTQAKLNKEEGKTQGQKVRRPEVNKDNKKLLEIR
FT                   KEVKQKKHKTDELDSLLKNLEQSSEGDNVKSNKYQRLKKVDNPKEAKGVYTDMLPLSNS
FT                   ETSLIKRQIERHWINVPAGVRGNNKVKIIISITLDKAGNVEQVRVIAKICPNIQSSICE
FT                   ALVDNAIRAVWQASPIENLDPARFNHWKEMNFIFDPSKL"
FT   gene            complement(383166..383538)
FT                   /pseudo
FT                   /locus_tag="RTPG16"
FT                   /note="pseudogene of rickettsial conserved hypothetical
FT                   protein"
FT   gene            383652..384359
FT                   /gene="spoTa"
FT                   /locus_tag="RT0302"
FT   CDS_pept        383652..384359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoTa"
FT                   /locus_tag="RT0302"
FT                   /product="guanosine-3,5-bis(diphosphate)
FT                   3-pyrophosphohydrolase SpoTa"
FT                   /db_xref="EnsemblGenomes-Gn:RT0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03782"
FT                   /db_xref="GOA:Q68X60"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X60"
FT                   /protein_id="AAU03782.1"
FT                   /translation="MKDIEYWDKNFESCKYSDKLIERLLFLNNKVKQPIDIREVKKGIY
FT                   YARKYHGKQMRQSGDPYYSHPIAVTIMVAEFVAKEVPKLFTSRILQAALLHDTIEDTEL
FT                   TKDMISSIFDEEVARHVEGLTRIKPCGKISSAKSLILLIKQKRYDTALIKLFDRIHNLQ
FT                   TLEAKSPEKAHKIIKETLKSFLVLSEILEIPSVSELIYAECYKNNLKFNINATFNKIIN
FT                   FDSSPFAQNKLLP"
FT   gene            complement(384310..385626)
FT                   /gene="proP2"
FT                   /locus_tag="RT0303"
FT   CDS_pept        complement(384310..385626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proP2"
FT                   /locus_tag="RT0303"
FT                   /product="proline/betaine transporter ProP2"
FT                   /db_xref="EnsemblGenomes-Gn:RT0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03783"
FT                   /db_xref="GOA:Q68X59"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X59"
FT                   /protein_id="AAU03783.1"
FT                   /translation="MLGYEKEQKSLNKEQKQAVGLLSIGTFLEYFDLMLYVHMAVLLNN
FT                   LFFPEYDPFTFSLLTAFSFCSTYLLRPIGALIFGYIGDQFGRKIVVVLTTLLMAITCVI
FT                   IGSMPTYAQIGITASWILTICRIIQGMSATAEARGAELYLTENSSPPIQYPLVTIITVF
FT                   SAVGTTVALGIASIFTNQNIYQHESSWRIAFFVGATIAFVGTIARTSLKEADAFSNKRN
FT                   KLKLRLQENNIMIEEIDKDILDQKVPNATSIWYFFIQCARPPCFYFVYIYCGDILKREC
FT                   GFTPNQIINHNFWVSIIDLLGIIGLAFISYKIHPLKILKVKLYLFFTSLMFFPIMLNYS
FT                   PNPLYIFIFQCLAALFVFDHVPAAPIFYKYFPVFKRFTYTSMLSAIAKLFTYIITSFGL
FT                   VYITNYLGYWGLFLIFIPVGITFFMGVTYFERMEKNRNL"
FT   gene            complement(385761..387296)
FT                   /gene="aprE"
FT                   /locus_tag="RT0304"
FT   CDS_pept        complement(385761..387296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aprE"
FT                   /locus_tag="RT0304"
FT                   /product="alkaline proteinase secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03784"
FT                   /db_xref="GOA:Q68X58"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X58"
FT                   /protein_id="AAU03784.1"
FT                   /translation="MQDLKHNKPQITPEQLKQLLSLREKGLILKCNNSKRNALINTTLK
FT                   KTSDAIEFLLLKLDRFINFITKKTDENRNNVAQAARSPILFGIYVIIFLVLIGGLWSAL
FT                   APLDSGAVAIGIVIPSTNKKTIQHNEGGIINAIYVKQGDKVSEGDKLIELEETRIKSEH
FT                   ENILSQYRNFLATENRLIAERDNLEQIAFSDLLIQNMNLPEVAKIIHTQENLFKSRKEI
FT                   YLSEKDALNQNIAQLEKKIEGLEAKKISASKTAAVYQDRLKALRTLKEKGFIQKAALLE
FT                   QEAKVAAAKSDVATTEAEIAGIRHAITETQIKIINHQNKYTERTLTELREAQIQTASLK
FT                   EKYNSLTDLLNRVIIRSPVDGIVNNLKYHTIGGVISHGQPIMEISPINDPLIIEARISQ
FT                   KNIDSVHEGLIAKIRFSAFKSRTTPTFTGRVVSISPDIVHDERQHPGYQQDNYYVARVE
FT                   INMEEFNKVAKVKNLALHPGMQAEVQIVTGTRTLLRYLLDPVTDTAFKAFREK"
FT   gene            complement(387489..389240)
FT                   /gene="aprD"
FT                   /locus_tag="RT0305"
FT   CDS_pept        complement(387489..389240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aprD"
FT                   /locus_tag="RT0305"
FT                   /product="alkaline proteinase secretion ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03785"
FT                   /db_xref="GOA:Q68X57"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X57"
FT                   /protein_id="AAU03785.1"
FT                   /translation="MDNKKNLNKKNPLVIALSECKTAFWIVFWFAFVINLLMLITPLYS
FT                   LQVLDRVLGSGNLQTLLFLSIIIAYIYFVYGLLQIARSFTLIKVGEWLDRTVAPVIFAS
FT                   SISATATRVNIGSSQLLRDFQAVKTFLTSTGINTLFDAPWSIIYIAVIFSIHPYIGFIT
FT                   IFGAIIIVSTAFFNAAATNKTLGEATEFSIKGMTQADIANRNAESIEAMGMMKNVTKNW
FT                   HKFNILALDKQSVASYRNGVISNFSRFVRNIMQMAVTGVGAYIVVKSHSADMTPGNMIM
FT                   SSIIVGRALAPFDNAIELWKSMSGAIKSYKNINNLFNTYSSRDEAMPIPNVNGHLTVEN
FT                   VYYAHPIPKHLSQPIVPKYILKGISFVVQPGEILAIIGPSATGKSTLAKIIVGVWKESS
FT                   GSVRLDSAEIYRWNREDFGKHVGYLPQGIELFSGSIKQNIARMEENADPQKVIEAAKIA
FT                   GAHEMILRFQDGYDTDIGPAGSNLSGGQRQRIGLARAFYGNPKLIILDEPNANLDEAGE
FT                   IALAMALKQAKLKGISVLVISHRPSVLSVVDKILILQDGSIAVYGTAEEIQKHLNTFKS
FT                   DTIHIKN"
FT   gene            complement(389248..390264)
FT                   /gene="asd"
FT                   /locus_tag="RT0306"
FT   CDS_pept        complement(389248..390264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="RT0306"
FT                   /product="ASA dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:RT0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03786"
FT                   /db_xref="GOA:Q68X56"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X56"
FT                   /protein_id="AAU03786.1"
FT                   /translation="MTKKYNIAVIGATGNVGRETLNILAERHFPINKIYAIASNNSLGR
FT                   EVRFGAKILHINSLTIFNFYDIDIAFFCAGSNVSKEFIPKATADNCIVIDKTSLFRTDN
FT                   QVPLIVPEANLSTLKEFNTKNIIANPNCIVIPLVVALKPLDNEIKIKRVVISTYQSVSG
FT                   AGKAGMDELYDQTKSKYVFRENNPQKFPKQIAFNLFPHIGDFNKDGYTTEETKIAFELS
FT                   KIMGTHFKTSVTSVRVPVFIGHAISVNIEFSNKIYAKDVEEILQDADGIVTISNNNDLA
FT                   YISPIEVVGKDAVYVSRIRNDLSKENTINLWITCDNLRKGAALNSVQIAEELINNYL"
FT   gene            complement(390257..390619)
FT                   /gene="pkcI"
FT                   /locus_tag="RT0307"
FT   CDS_pept        complement(390257..390619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pkcI"
FT                   /locus_tag="RT0307"
FT                   /product="protein kinase C inhibitor 1"
FT                   /db_xref="EnsemblGenomes-Gn:RT0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03787"
FT                   /db_xref="GOA:Q68X55"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X55"
FT                   /protein_id="AAU03787.1"
FT                   /translation="MYNKENVFAKIITKNLPAEIIYEDKQILAFKDIEPIAPVHIIVIP
FT                   KNEYIDYTDFISKASIDEIKHFFAKISDIANEAGLAKAGYRLITNKGEKSGQTIFHFHF
FT                   HIIGGKKLIGLINNND"
FT   gene            complement(390727..391110)
FT                   /locus_tag="RT0308"
FT   CDS_pept        complement(390727..391110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0308"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03788"
FT                   /db_xref="GOA:Q68X54"
FT                   /db_xref="InterPro:IPR024399"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X54"
FT                   /protein_id="AAU03788.1"
FT                   /translation="MNIYVIYINSTQKNNNFIILEEGFSWIAALFSIFWALYHKMWVVV
FT                   TITVIANIIITTINIVDLKFIFQIFLILSFGFFASDIRENYLNRNNYQLEDIIIANSRI
FT                   EAELKFLERSILNLTKNGYANIK"
FT   gene            391377..391925
FT                   /gene="hslV"
FT                   /locus_tag="RT0309"
FT   CDS_pept        391377..391925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /locus_tag="RT0309"
FT                   /product="heat shock protein ATP dependent protease HslV"
FT                   /db_xref="EnsemblGenomes-Gn:RT0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03789"
FT                   /db_xref="GOA:Q68X53"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X53"
FT                   /protein_id="AAU03789.1"
FT                   /translation="MSDNLALHGTTILCLKKNEEIIIAADGQVSHGNTVLKSTARKLRT
FT                   IANNKIIVGFAGSTADGLALFEKLEIKIEQYNSNLLRSAVELAKDWRNDKYLRRLEAMM
FT                   IVADRSHILILTGNGDVIEPENNIAAIGSGGLFALSAARALMSYENNLTAEEIALKSMN
FT                   IAADLCVFSNHNIIMEKVV"
FT   gene            391922..393274
FT                   /gene="hslU"
FT                   /locus_tag="RT0310"
FT   CDS_pept        391922..393274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="RT0310"
FT                   /product="ATP-dependent protease ATP-binding subunit HslU"
FT                   /db_xref="EnsemblGenomes-Gn:RT0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03790"
FT                   /db_xref="GOA:Q68X52"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X52"
FT                   /protein_id="AAU03790.1"
FT                   /translation="MKSTETTCKKDNMGLTPSQIVNELNRFIVGQDKAKKAVAIALRNR
FT                   YRRKRVEGNLRNEIVPKNILMIGSTGVGKTEIARRLAKLTNSPFYKIEATKFTEVGYVG
FT                   RDVESIIRDLVEIAVNTEKALAKIAVDINAREKAIERILDSLVGKTSSSETREKFKEKV
FT                   LNGELDDTEIEISVADTTPVGGGSFEIPCIPGASMGVLNLGDMIGRALGSSKTKTKKML
FT                   IKDAMTVIIPEESEKLIDQEKIIQKAINLAENDGIVFIDEIDKIASTSNSGAKNAEVSR
FT                   EGVQRDLLPLIEGTTVNTKYGPVKTDHILFIASGAFHIAKPSDLLPELQGRLPIRVELN
FT                   LLTKDDMIKILLEPETSLIKQYSALIGTEEVHLEFTDSAIEKIADYAITVNLEVEDIGA
FT                   RRLHTILENLLEDISFEASEMKVKKIIIDDKFVENQLSKIITNLDLAKFVL"
FT   gene            393926..395068
FT                   /gene="lpxB"
FT                   /locus_tag="RT0311"
FT   CDS_pept        393926..395068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxB"
FT                   /locus_tag="RT0311"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /EC_number="2.4.1.182"
FT                   /db_xref="EnsemblGenomes-Gn:RT0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03791"
FT                   /db_xref="GOA:Q68X51"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X51"
FT                   /protein_id="AAU03791.1"
FT                   /translation="MKKIYFIAGEMSGDFIGGHIIQNLKSNEGLEFTGIGGQYMEEAGN
FT                   FKSLFTITAINFIGFIEIIPHLLKIKKLIDKTVENIINSKVDLLITIDSPGFTYRVAKR
FT                   VRKFLPNLKIIHIVAPSVWAYKAGRAVDYAKIYDCLFALLPFEPPYFTKVGLDCRYIGH
FT                   PILEQEFYRDKIALRKEFKIDDNESILCVTFGTRKGEILRHLPIFITAIQKISKDYKNL
FT                   RIIFPLVHPDHEAIIKPFLENVQFNYLFLSSERLKAYAVSDLALAKSGTNTLEISASGT
FT                   PMVVAYKVNIISFFIIMFLIKIKYVSLINIMAGSAIIPEFIQFNCRANLISNKLKELLS
FT                   NSQKRDNQVVESQKILQKLRFASDRSPSYIAAKIIKQEFL"
FT   gene            395599..396630
FT                   /locus_tag="RT0312"
FT   CDS_pept        395599..396630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0312"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03792"
FT                   /db_xref="GOA:Q68X50"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X50"
FT                   /protein_id="AAU03792.1"
FT                   /translation="MLKNLLKTKLSLVIISLTITILMTLINFSIFYVLMPGNLAQNKTI
FT                   IIEPKLSVNQIVTKLYFNKVIKYPIIFKVIAKIYSITRPIKSGEYVFTRNISPIQTLRI
FT                   LASGKSIIHKIVVPEGTVVSDVIKKINEESRLFGAIKGIIPEGFLMPSTYFFSYGDQKD
FT                   QIIDQMRNLMSINLDKVMKHLAPDSPLKTRIEVLTLASIIEKEAGSNAEKPIIAAVFIN
FT                   RLKKNMKLQADPTTIYALTEGKFKLARALTKKDLLRKLPYNTYYIKGLPPGPIACPSLK
FT                   SLEAVVKPAKTDALFFVVDGKGGHHFSNNLNDHNRFVEIYRKSLIKVPETPIDLKNTKK
FT                   KYE"
FT   gene            396596..396937
FT                   /gene="cyaY"
FT                   /locus_tag="RT0313"
FT   CDS_pept        396596..396937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyaY"
FT                   /locus_tag="RT0313"
FT                   /product="CyaY protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03793"
FT                   /db_xref="GOA:Q68X49"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X49"
FT                   /protein_id="AAU03793.1"
FT                   /translation="MILKTQKKNMNNTAFSKLAETTIVYIVDKIEEQDIEGIIDVDLHG
FT                   DILNLDTENGIYVINTQSASKEIWLSSPVSGPHHFFYEQGKWKSRIGFELMILLTEELG
FT                   IRFDKCEIF"
FT   gene            397194..397355
FT                   /locus_tag="RT0314"
FT   CDS_pept        397194..397355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0314"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03794"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X48"
FT                   /protein_id="AAU03794.1"
FT                   /translation="MYKEFKAFCIAFLDNEELEIYNSVNTYKGIFIIHNHSQSDTLSKF
FT                   SQELKVVL"
FT   gene            397709..398281
FT                   /locus_tag="RT0315"
FT   CDS_pept        397709..398281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0315"
FT                   /product="BioY family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03795"
FT                   /db_xref="GOA:Q68X47"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X47"
FT                   /protein_id="AAU03795.1"
FT                   /translation="MNSLFKILYLNRFVAHLNTNTYILDIVKIVIGVVAIFASAQITIP
FT                   IKPVAITMHSVILCIIAFTYSPRLSFLTILTFIFIGIMGLPVFCQFSSGINYFLGAAGG
FT                   YYLGFLIGIPVMSVLKGKLAENWVNVTIICIIGHIIFYLCGVIWLASIIGLKQAIYSGF
FT                   VIFIPSGLAKLLIFSCLFSYIKNIKSK"
FT   gene            complement(399542..400888)
FT                   /gene="gltX1"
FT                   /locus_tag="RT0316"
FT   CDS_pept        complement(399542..400888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX1"
FT                   /locus_tag="RT0316"
FT                   /product="Glutamic acid translase"
FT                   /EC_number="6.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:RT0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03796"
FT                   /db_xref="GOA:Q68X46"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X46"
FT                   /protein_id="AAU03796.1"
FT                   /translation="MTKVITRFAPSPTGMLHVGNIRVALLNWLYAKKHNGKFILRFDDT
FT                   DLERSKQKYKNDIERDLKFLNINCDQIFNQLSRVSRYNEIKNLLINKKRLYACYETTEE
FT                   LELKRKFRLSKGLPPIYDRASLNLTEKQIQKYIEQGRKPHYRFFLNDEPISWYDMIKGD
FT                   IKYNGKALSDPIVIRADGSMTYMLCSVIDDIDYDITHIIRGEDHVSNTAIQIQMFEALN
FT                   KIPPVFAHLSLIINKEEKISKRVGGFEIAYLKNEVGLEAMTITSFFSLLGSSLHIFPYK
FT                   SIEKLVAQFEISSFSKSPTIYQQYDLERLNHKLLISLDYHEVKERLKEINADYIDENFW
FT                   LSVRANLQKLSDIKDWWDICYQTPKIGNLNLDKEYLKQASELLPLGKITKDSWSIWTKE
FT                   ITNATGRKGKELFLPIRLALTGRKSGPEIAGILPLLKREEIIKRLVAIT"
FT   gene            complement(400985..403324)
FT                   /gene="topA"
FT                   /locus_tag="RT0317"
FT   CDS_pept        complement(400985..403324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topA"
FT                   /locus_tag="RT0317"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:RT0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03797"
FT                   /db_xref="GOA:Q68X45"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X45"
FT                   /protein_id="AAU03797.1"
FT                   /translation="MKLVIVESPAKAKTINKYLGDEFKVIASFGHIRDLPSKKGSVLPD
FT                   KNFAMEYDISDKASKYVDAIVKYARKAEAVYLATDPDREGESISWHVAEVIKEKNKVES
FT                   DDFFKRVAFNEITKKAIIHAVENPRKLDTNLVNAQQARRALDYLVGFTLSPLLWRKLPG
FT                   CKSAGRVQSVALRLICDREDEIERFKAEEYWDISLKMQNSNNELFTAKLTHVNDQKLKK
FT                   FSIINEKEAKDLTRKLKLQKFYVEKIEKKQQKRQPQPPFITSSLQQEAARKLGFSAKKT
FT                   MQIAQKLYEGVDIGKETIGLITYMRTDGVTLSNDAIADIRKLIDKNYGNKYLPINPRIY
FT                   QSKVKNAQEAHEAIRPTNITYTPDNLKQKLEKDYYKLYELIWQRTIACQMENVIMDLVI
FT                   ANLASENKEYLAKANGSIIAFDGFYKVYRESLDDEDEEDNKMLPPLKAQEHIKTKEVIP
FT                   NKHFTEPPPRYSEASLVKKLEELGIGRPSTYASILSVLQDRKYVTLEKKRFIPEELGRL
FT                   VTVFLVGFFKKYVEYDFTAGLENELDEIAAGKLEWKTSLNNFWSGFNNNIESVNEQKIT
FT                   EIINYLQKALDYHLFGENKESKVCPSCKTGQLSLKLGKFGAFLACSNYPECTFKKSIVS
FT                   GNDNNEDEGNLSTILNDNKILGTDKDGVEIYLKTGPYGPYIQLGEQCGKVKPKRTPVPT
FT                   NLKQSEITLEVALKLLSLPLKIGIHKDSGEEIIIGYSKFGPYIKYMCKFISVPKKYDFL
FT                   NLNLDDAIKLIENNKAKLEKKHRSMV"
FT   gene            complement(404448..405050)
FT                   /gene="tdpX1"
FT                   /locus_tag="RT0318"
FT   CDS_pept        complement(404448..405050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdpX1"
FT                   /locus_tag="RT0318"
FT                   /product="thioredoxin peroxidase I"
FT                   /db_xref="EnsemblGenomes-Gn:RT0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03798"
FT                   /db_xref="GOA:Q68X44"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X44"
FT                   /protein_id="AAU03798.1"
FT                   /translation="MSVFVGKTAPDFTAKAIMPNNNIDDKFKLSDYAAGDNVVLFFYPL
FT                   DFTFVCPSEIIAFHNKLGEFTERRTKVIAVSVDSHFSHLAWKNTPHNKGGLGQIQFPMI
FT                   SDITKDISSKYNVLNEDGIALRGTFLIDKDFIVRHMLVNDLPIGRDINYTLKVIDALTH
FT                   HQKHGEVCPAGWHKGEEAITPSHEGIAHYLSSHAEKL"
FT   gene            complement(405132..406067)
FT                   /locus_tag="RT0319"
FT   CDS_pept        complement(405132..406067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0319"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03799"
FT                   /db_xref="GOA:Q68X43"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR032435"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X43"
FT                   /protein_id="AAU03799.1"
FT                   /translation="MEYALLIFSIITILVIIQMVKVVPQQQAWVVEKLGKFDKVLQPGL
FT                   NFLIPIIQRVAYKHTLKEEAIDVTAQTAISNDNVTLSIDGVLYVKIIDPMAASYGVNNP
FT                   YYAITQLAQTTMRSEIGKLPLDRTFEERDALNVAIVSAINQASINWGIQCMRYEIKDIQ
FT                   PPQTILKAMELQVAAERQKRAQILESEGNRQAKINHAEGEKAQIVLNSEASYTDQVNRA
FT                   KGEAEAIGLVATATANSIEIVATAIQKTGGSDAVALKIAEQYINAFGNLAKDTNTVILP
FT                   TNLSEPSSFVTGALSIFNQLKASSDQKRDK"
FT   gene            complement(406502..408064)
FT                   /locus_tag="RT0320"
FT   CDS_pept        complement(406502..408064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0320"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03800"
FT                   /db_xref="GOA:Q68X42"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012549"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR040423"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X42"
FT                   /protein_id="AAU03800.1"
FT                   /translation="MLKNILKHFDTKLIKLSSILAFLYCLLFNTAILIYKFDYYKATIF
FT                   KGILELSKDFCYIYIFAFIAFFGLNVHRFVLKFGAGFLFITSAIASYYIYFFKINPTKQ
FT                   VIGSFFSTDLNEVYELISIKLIIWIIFCLFTCFYTLRSFIAKNSKSFFTTLLSAACLLI
FT                   FIYNIITPSFKILKNYFPIQYLHNSYLNFATIFGDINYADISKQYHFIDNSDPDIIGVL
FT                   VIGESARFDHFGINGYKRDTTPYLNTTKNIISFKAESSYNLTYLSVPSLLSRYPANQIE
FT                   NSRLENTFLSILTRLGFNTTWIGTQTLMRNFANFDLSNIYNDVNFTIVPGGSALFSLND
FT                   HDEKILPFTKEIITKSGKQFLVLHTSGSHWNYNARYPKKFEHFTPICHIKVKGDASDCD
FT                   QLALMNSYDNSILYTDFLLSNIIGLLKDKNAFLLYVSDHGESLGENGYYGHGGPLLSEQ
FT                   ITVPFIVWVSDTFKTKYPESVDAIKSYSSTEISHDYVFHSILDCLNINSDIINKSLSLC
FT                   KSS"
FT   gene            408107..408577
FT                   /locus_tag="RT0321"
FT   CDS_pept        408107..408577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0321"
FT                   /product="possible Holliday junction resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:RT0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03801"
FT                   /db_xref="GOA:Q68X41"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X41"
FT                   /protein_id="AAU03801.1"
FT                   /translation="MIIKNLQEFYRLLIPNEPLIAIDYGSKKIGVALSDQALAIAMPLN
FT                   TITELNQRVIITSLLNIIEKYQVCGIVIGLPIDMSGGVTKQTNIVMKFADKLKQSVSLP
FT                   IYLQDERLTTKSANNFLKSFGIKRKDRNNNDDAVAASMILEIVLNAIKRFNL"
FT   gene            408613..408790
FT                   /pseudo
FT                   /locus_tag="RTPG17"
FT                   /note="pseudogene of rickettsial conserved hypothetical
FT                   protein"
FT   gene            409600..410454
FT                   /gene="rmlD"
FT                   /locus_tag="RT0322"
FT   CDS_pept        409600..410454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rmlD"
FT                   /locus_tag="RT0322"
FT                   /product="dTDP-4-keto-L-rhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /db_xref="EnsemblGenomes-Gn:RT0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03802"
FT                   /db_xref="GOA:Q68X40"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X40"
FT                   /protein_id="AAU03802.1"
FT                   /translation="MKILILGVTGMLGNSMFRFLTQDSKFDVCATARNNAATLYFSKDL
FT                   TNKLITNVDVANHDSLVEVLNKINPDVVINCIGLVKQLADVNDPLKVLPINSLLPHRLA
FT                   NLCGLIGSRLIHISTDCVFSGKRGNYNESDFPDCDDLYGRSKFLGEVDYPHAITLRTSI
FT                   IGHELSSNRSLINWFLSTEGCVKGFAKAIYSGFPTVEFARIIRDFVLPNTELHGLYHVA
FT                   SNPINKLDLLKLVAEIYNKEIEIIPSDELIVERSLDSTRFNSITGYKPPEWRELVKRMY
FT                   EFG"
FT   gene            410487..411512
FT                   /locus_tag="RT0323"
FT   CDS_pept        410487..411512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0323"
FT                   /product="sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:RT0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03803"
FT                   /db_xref="GOA:Q8L2J6"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR013692"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8L2J6"
FT                   /protein_id="AAU03803.1"
FT                   /translation="MFVDKTLMITGGTGSFGNAVLSRFLKSNIINDIKEIRIFSRDEKK
FT                   QEDMRIALNHSKLKFYIGDVRNYQSIDDAMHGVDYVFHAAALKQVPTCEFYPMEAINTN
FT                   VLGAENVLSAAINNKVTKVIVLSTDKAVYPINAMGLSKALMEKLAIAKARMRSPGETIL
FT                   CVTRYGNVMASRGSVIPLFIHQIKQGKELTITEPSMTRFLMSLVDSVDLVLYAFEHGRQ
FT                   GDIFVQKSPASTIEVLAKALQEIFGSKNAIRFIGTRHGEKHYESLVSSEDMAKADDLGG
FT                   YYRIPMDGRDLNYAKYFVEGEKKVALLKDYTSHNTKRLNLKEVKELLLTLDYVQEELKN
FT                   A"
FT   gene            411505..412635
FT                   /gene="rffE"
FT                   /locus_tag="RT0324"
FT   CDS_pept        411505..412635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rffE"
FT                   /locus_tag="RT0324"
FT                   /product="UDP-GlcNAc-2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:RT0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03804"
FT                   /db_xref="GOA:Q68X38"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X38"
FT                   /protein_id="AAU03804.1"
FT                   /translation="MLKVMTILGTRPELIKMCLVISEFDKYTNHILVHTGQNYAYELNQ
FT                   VFFDDMGIRKPDYFLEIASDNTAKSIGIVIEKVDEVLEKEKPEAVLFYGDTNSCLSAIA
FT                   AKRRKIPIFHMEAGNRCFDQRVPEEINRKIIDHISDVNITLTEHARRYLISEGLPPERI
FT                   FKSGSHMPEVLNHFMHKILKSDILEKLLLKANQYFLVSSHREENVDIKDNLQELLSSLQ
FT                   ILIQEYNFPIIFSTHPRTKKRLKDLECFQSLEDKIRFLPPFSFTDYVKLQINAFCILSD
FT                   SGTLTEEASILNLPALNIRAAHERPEGMDAGALIMSGFKAERILQSVKVITAQHKNNKC
FT                   FRDIVSDYAEASVVSKKILRIVLSYVDYINRTVWFK"
FT   gene            412632..413753
FT                   /locus_tag="RT0325"
FT   CDS_pept        412632..413753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0325"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03805"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X37"
FT                   /protein_id="AAU03805.1"
FT                   /translation="MIVADKIVEEWYSKDILHIKIKEFISPVYSVIDIGCGIRPQQYII
FT                   PDLLICVEPYKEYTEILKKNLSGTNSIIIPLDAKSALSTLPDKSIDSIFLIDVIEHIPK
FT                   EIGKEILIKCTRIARRQIIIFTPLGFMPQEVHEIDGWNLHGGVWQEHKSGWYPEDFPGW
FT                   NIIGCKELHTHNSNGELLTTPYGGFYAIKNIVYTENYFNDLYGEKVLFNSTNHLENLKA
FT                   TFPDFKEKVINSEIVRSSLKCGLWMCQRTTELLIEKGTTTSLKEILEIVDSEKINFAIN
FT                   AAQEYVLKINNFASQFKDINKLYEQINNLQELFKSTIDQLTDQLIVNTEELERLKEYIK
FT                   VKEQELKISNENCSIFIKIYAKIRRMLNKFRAI"
FT   gene            413782..415005
FT                   /locus_tag="RT0326"
FT   CDS_pept        413782..415005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0326"
FT                   /product="probable glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RT0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03806"
FT                   /db_xref="GOA:Q68X36"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X36"
FT                   /protein_id="AAU03806.1"
FT                   /translation="MKILQINGYESPGRRFHGLSITQILKKYGIESKHLVWAKDTQDPE
FT                   VLTFEGIIPRKINQILQLIENQASLQSILYRNVPKIITMPAFQEADLIHLHIIHSGYFS
FT                   ISDLSMITDLKPTIWTLHDPWAMTGRCIYPMGCLGWRKDCGICPDLNTPFAMKKDNSRF
FT                   LFNYKRMAYEKANFDIIIASKWMKDMVYSSPMFNDKEIKIYHLPFGVDLEFFSSNFTVS
FT                   ARKRFNISEDKIVISFRSEDTHFKGYQYIMEALEKLETTKSICLLTVGRHNTLERFRGK
FT                   FDIIELGWTNDDILLRDVLSACDIFLMPSVAEAFGVMAIEAMACSKPVIVFDGDNSLPD
FT                   VTFAPDVGIAVPMRDSHALSNAIKHLIDNPKERLDRGNKGREIAELHYSQDLHIKNLVS
FT                   IYKETLNK"
FT   gene            415002..416213
FT                   /locus_tag="RT0327"
FT   CDS_pept        415002..416213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0327"
FT                   /product="possible glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RT0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03807"
FT                   /db_xref="GOA:Q68X35"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X35"
FT                   /protein_id="AAU03807.1"
FT                   /translation="MKILLLTDIPPCENYTAGLVLNPLVEFLPLDEIVICSVANPALEF
FT                   KIPKTLNNIPHLKLFKPIEAAMRYKEGKIGGLIAYGFELFNAATVKYFLLPKIIKFAKE
FT                   HKVDAIWSVLQGQTIIRLTRPLAKKLSVSLFTQIWDPFEWWLRANKIDRLTQKRLLKEF
FT                   DAVIKHSTCCATASWAMSESYKTQYDTPTIPLIAGLSKELARMPATSPHNRYEYIISIA
FT                   GQFYAQSEWLSLINALNQVNWIIAGRKIKVRVMGQGFQVFTQLHANFEYLGWRSQEETI
FT                   RLLAESDLLYMPYWFSEEFYKESSTSFPSKLVTYFASGRPVFCHAPEYSSPSKYIAENN
FT                   AGYLCNSLSTDKIIYDLERAIIDAVSYKTFAKNASQCFLRDFILERMQETFFKFLNRNA
FT                   NDNK"
FT   gene            416200..417237
FT                   /locus_tag="RT0328"
FT   CDS_pept        416200..417237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0328"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03808"
FT                   /db_xref="GOA:Q68X34"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X34"
FT                   /protein_id="AAU03808.1"
FT                   /translation="MTINNNRIVWVDFTKSLAIFMVVIIHSIALSFYKYSSVPFSNNFI
FT                   ISNFINSFCRVAVPLFILLSGSLALHNTMPIEKLWYKVQRLLIPSIFWSILYKYWVSYN
FT                   IGEQFNIFAVLNSMIHKPAMYHLEFVYYMLGIYLLFPILALIVNEMLKDTKFAYYFLIL
FT                   WLSFNTVNTYYYLSIVDCMEIGSFFRYSGYAILGSYLIRKNIGSQFPTYCWLSLYLIGS
FT                   IFTFIVTWKLNINSFIPDETAYVYLTPNVIIASVGIFLVLQTINVPVYYQKLLKCISDN
FT                   CFCIYFIHVLLLDRLQYIAIELSKFNHVNYPVIGSLALAFITFIVSLLVSILIRLIPNS
FT                   SKLVG"
FT   gene            417234..418190
FT                   /locus_tag="RT0329"
FT   CDS_pept        417234..418190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0329"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RT0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03809"
FT                   /db_xref="GOA:Q68X33"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X33"
FT                   /protein_id="AAU03809.1"
FT                   /translation="MKQNTYSPLVSIIIPVYNGANYMREAIDSALAQTYKNIEIIVVND
FT                   GSKDKTETIALSYGDKICYFYKENGGCGSALNYGIKNMKGEYFSWLSHDDLYYPNKIEH
FT                   QINILNKLDNKDVIVYCGYELIDQKSHSLYFVKPDQRYSKEKLDISLFPLLHSLIHGCT
FT                   LLIPSILFKKIGLFDESLKYTHDYDLWFKFLRVSSVYFDHEVLIKSRVHDAQTTNTALN
FT                   QLEEYEALWSGFLKKLTKQEMIMIKGSTHQFLSDIAVFFKKNGYIKSYQLALAMTDKKI
FT                   IGGFCTFIIKEIIYSLRKYGINTTITKIYTWIRKNRK"
FT   gene            418166..419182
FT                   /locus_tag="RT0330"
FT   CDS_pept        418166..419182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0330"
FT                   /product="WaaG-like sugar transferase"
FT                   /db_xref="EnsemblGenomes-Gn:RT0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03810"
FT                   /db_xref="GOA:Q68X32"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X32"
FT                   /protein_id="AAU03810.1"
FT                   /translation="MDQEKSKIVQSFIFYSPSINSGGGLVLLKEILNVQDFVNNCKYIY
FT                   LDEKVRNKLNFSNFFKNIIFIKSRLLGEWQLRKNCEISDTVLCFHGLPPLFPIKSKVIV
FT                   FLQNRLLLEPLKNNRYSILILIKKIWLRLGLKFNNIRYIVQTDSMLRIAKEFLDKDIDI
FT                   TVLPFAPKTIRKNLNHTKKYDFFYPASGEAHKNHFNLLKAWKILAGIGIKPSLALTINT
FT                   ELYPELLEQIQTYQLDIVNLGEISSNEVLDLYTQVSVVIYPSKSESLGLPLIEATVYKI
FT                   PIIASELDYVRDVANPIETFDPNSPISIVRAVRRFLNNNESLIVINSASEFLEAICK"
FT   gene            complement(419194..420192)
FT                   /locus_tag="RT0331"
FT   CDS_pept        complement(419194..420192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0331"
FT                   /product="probable efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RT0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03811"
FT                   /db_xref="GOA:Q68X31"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X31"
FT                   /protein_id="AAU03811.1"
FT                   /translation="MHVKLIIPIILFMSLSTIANKKEEEKIIEVKVTKIQTTKLYDIFN
FT                   VVGQCKNDNSRDYYANTAGVVEKVSAQQGKIVKKGDILLVIDQNIAETTKSRAAALLNT
FT                   KQEDYNRKEALFAKKFISNEAYKMSKSALEDAKFNYAKSLKIYNDMIITAPYSGKIGII
FT                   KYMVGDEVKIGDYLFSITGTENTQSIFIELPESLSEKVHCNTEVLIAGKIKSTIDTVSH
FT                   YLSEYGTFTAKIILPIGTKILHNSFVDVQLIINPHQNLTIPESCIQRNNQGHFIYKIVD
FT                   GNTVKQVYVQIGTRTEGRIEITANDIKEGDLVVIEGMTKINDGSKVKIFDE"
FT   gene            complement(420293..421069)
FT                   /locus_tag="RT0332"
FT   CDS_pept        complement(420293..421069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0332"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03812"
FT                   /db_xref="InterPro:IPR022565"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X30"
FT                   /protein_id="AAU03812.1"
FT                   /translation="MYCKINKVYDFKEVIKAIEQADNTSLVLFDIDEVIVMDSHESRLT
FT                   HDYRKELMENIETRLTRKECELLLSIILKAKKARLVNSDITKIFALLKAENIPAMGLTK
FT                   LPTGKFGIIEDMIEWRIRELTKLKINFQEFSPLADEIIIEDYNAGYGKPTLKDGIIYTA
FT                   ECDKGIVLEYILNKTNYYPQSIIFIDDIEENLLSLQEICNKLKIHYQGFEFTGSAIIPE
FT                   PKLDSQLEKIRFEILEKEYKWLTDEELKKHTLSSSI"
FT   gene            complement(421079..421837)
FT                   /locus_tag="RT0333"
FT   CDS_pept        complement(421079..421837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0333"
FT                   /product="possible hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RT0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03813"
FT                   /db_xref="GOA:Q68X29"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X29"
FT                   /protein_id="AAU03813.1"
FT                   /translation="MHKLYNKTQDKFIVYDNYRIINTNIPSVIFLHGLMSSMQSTKAIY
FT                   LIDYCKKNNYNFIVFDNFGHGNAYGQFEDQTISDWLEGVALILDKLIETEAILIGSSMG
FT                   GWLALLAALRFPDKIKCLICVAPALDFTENIWQNISLNDQNKMKKEGIIEVSSENCQHK
FT                   YPISYKLIEDAKKHLLLRKQQIEINIPVHIIHGMLDKNVPYNVSVKLLEKITSKQIVMK
FT                   LIKDGNHNLSRKEDLKVIANSLEEMISNIK"
FT   gene            421870..423039
FT                   /locus_tag="RT0334"
FT   CDS_pept        421870..423039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0334"
FT                   /product="WaaG-like sugar transferase"
FT                   /db_xref="EnsemblGenomes-Gn:RT0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03814"
FT                   /db_xref="GOA:Q68X28"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X28"
FT                   /protein_id="AAU03814.1"
FT                   /translation="MPALKSHKRYNKYTILQVVPALVSGGVERGTIEVAKYLKILGHTP
FT                   IIISSGGTLVKELDKEDILHIEMNSSSKNPCIIVNNAKLIAEIIKKYNIDIVHTRSRAP
FT                   AWSSYLATKWTNAKFLTTFHGVYNIPNSFKKYYNSVMLKGEKVIAVSNFVKRYLLQNYK
FT                   IDEDKIVVIERGVNCDYFDPANLTPEKLKKCSDKYDAPSNVPIILMPSRMTSWKGHLVL
FT                   VEALSKLKHREFYCLMVGDISRHPNFTNRVKELIATLKLQNKIQIFGNDSDIISLYGIS
FT                   DIIVSASIEPEAFGRTIIEGQAMKKLVIATNLGGAVETINNNITGFHVEPNNAEALAQK
FT                   IDYCFSILGTDSAKKIQEAARHTVIDNFSLDLMLRKNLEVYKAILKNSY"
FT   gene            complement(424413..425030)
FT                   /gene="rpsD"
FT                   /locus_tag="RT0335"
FT   CDS_pept        complement(424413..425030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="RT0335"
FT                   /product="30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:RT0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03815"
FT                   /db_xref="GOA:Q68X27"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X27"
FT                   /protein_id="AAU03815.1"
FT                   /translation="MTKIVRSKYKASRRLGVSLWGDSKDAFNTRNYRPGQHGQNTMIKT
FT                   SDYGLHLKAKQRLKCYYGRVTEKQFRNTFALAQRMQGNTGENFIGLLESRLDTVVYRMN
FT                   IAPTIFAARQLVSHGHIKLNGKKADIASIRLKEGDIIEIKESIQQIPLIQESIAKQGQT
FT                   TPKYLSFDVSSLTGKYLRVPALSDVPYPFEAEVHLVIELYSR"
FT   gene            425149..425995
FT                   /pseudo
FT                   /locus_tag="RTPG18"
FT                   /note="pseudogene of protoheme IX farnesyltransferase
FT                   (cytochrome c oxidase assembly protein CtaB)"
FT   gene            complement(426547..429042)
FT                   /gene="asmA"
FT                   /locus_tag="RT0336"
FT   CDS_pept        complement(426547..429042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asmA"
FT                   /locus_tag="RT0336"
FT                   /product="outer membrane assembly protein AsmA"
FT                   /db_xref="EnsemblGenomes-Gn:RT0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03816"
FT                   /db_xref="GOA:Q68X26"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X26"
FT                   /protein_id="AAU03816.1"
FT                   /translation="MPKALKYSLIIFITIMLLLIIIPFFIPLNNYKGVIIDKVKEATNR
FT                   NLTINGDIKLSLLPTPAISLSDIKLSSINGTKVPHLVSVEAVKASLRIFPLFRGAIEVA
FT                   LIELQKPIIHLEVLDNGQKNWQLYTSNNNNTINNNETVQSNDTQTELELPILINHFKMI
FT                   DGKVIYIEKNNEQIFNKINLETNIKSIKGPIDFNIALNALQQQIHIDGHVQEIGQIIPL
FT                   STNINLVGAKIKIDGKFDSKNNSFIGNVNVKGNTKTLGMPSDLNNDYTLTMSISAYNKN
FT                   INIKDARLNYPNIELLANANYGIENNNLESNIIVNPGNIITKIQSNLDKTNILLHADSL
FT                   KPIFDALKLKTDKLSPIISKKLIFTANVIRKPQAIKLQNINLSATNSHITGEIELKNLI
FT                   GNIIILHNLKINNFESLMSLIGINNLNKIGILELNGRVQKIKDTFNINNKISAFNTNIS
FT                   IKGDINLATQKPNFNLKLYSPLVNFDKILASNSTINTLNKTNNHSHHNIDTDQNNFPWS
FT                   NNRINLGFLNEIEGQLSANFDKVTNNSLIINNLKAKLSIIGGKLNINSVNGNIYGGELN
FT                   STGYVNSGKEQDVAIKINLKNAYLKRLTAQSGKIKIIDGLLSFKTDLTSHGNSVYTYVN
FT                   NLNGQFNVNSDNGEISGFDLNQIADAIDNAKNIEGVLRLINSSLSGGSTSFKNLIVNGD
FT                   IKQGNLNLNKCTLDAAPITASAHGQINLPQYTMNINTNINITELPPITVKLYGSINNMH
FT                   YKLDTHAIQNYLVKNVFNSVMKDLKNSQQKPENIIKDALGLSKTKDTDVKNESSNIQKS
FT                   KQVDPVNKLLHKGLKNYLK"
FT   gene            complement(429605..430102)
FT                   /gene="rimM"
FT                   /locus_tag="RT0337"
FT   CDS_pept        complement(429605..430102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="RT0337"
FT                   /product="16S rRNA processing protein RimM"
FT                   /db_xref="EnsemblGenomes-Gn:RT0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03817"
FT                   /db_xref="GOA:Q68X25"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X25"
FT                   /protein_id="AAU03817.1"
FT                   /translation="MNSLENLILIGIIKSCHGIQGHVILRSFTEPATKILERNLVNESG
FT                   ADIRIKLISQNAKGELICTFNDITTRNEAENLKGYKIFCLRTSLPELEEDEFYIADLNH
FT                   LRILDQYNKEIGKIKNILNFGAGDIIEIEFLDKTTKLLPFNKEFFPTITKDYVILNYQT
FT                   KV"
FT   gene            430167..432794
FT                   /locus_tag="RT0338"
FT   CDS_pept        430167..432794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0338"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03818"
FT                   /db_xref="GOA:Q68X24"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X24"
FT                   /protein_id="AAU03818.1"
FT                   /translation="MIKKIVVGIIICFALLFIIFSVLSFMNYNLVTNNFINHFGIARED
FT                   IRKIKIHKFPLPYLCIDTIKEDGKLDLEQIKIHFSLWSLIKFNPKINKIDILDAKFYAN
FT                   ANVFNIYNHEELIKNFFKYKLQNINLHITNLSIFNKQDYSILNFNNCVLKKANALSSHY
FT                   IFNTTSNNIGRISGSINKRDDIVDFRLNVDNNDYGSKLSQLYKDFKFTRGTGEYQIKNL
FT                   ASVMYNILPDLKHLLNKFNQTEPVNIKFNIANNEDEIELKDIVIESSLIIGNGFVNIAK
FT                   NTNITTNVQLNFPKIDLRSLILPNAVVKFNTFGSNIRFIFADKLLKANVAINEIILSNN
FT                   EALEKIVFAANLSNGTLNINELSGNIKSGGEFRLTGNVTQNAVRSMFDGKLYLKHNDMN
FT                   SLLNILGFNNLTIQESVPFILSSDLKLTLIDLFFKNLLLKTDNLNLSGNFSSKFIAQTP
FT                   RVDATLNISSLDLSGKSYPIISPIIRFTQNLTKDMQSLDYPSKFIPIRTIGYLANLDIL
FT                   IDSVKYNDHVFDKMNLLAKILPATIKISNLDFKTANSCLSTRWHLDTSSVLPSLTVEIK
FT                   DGYLTTDSFSLSSMLNLRNKLVNEYSLNNAILQFYGTLSTLSQNNFIFRNVKFYLANHN
FT                   NLLQFNNIEAELLGGKFQGSGNILLEPYSINFVYALNTVDLNKISALMYNIFTWSGGKG
FT                   SISGSLWTNGNSLKSQLYNLTTKSQFVINNIDVNNFGIDSFIEKINTSDYNVRNLDNDI
FT                   NSSITTGRTNIKDISGDIELQKGIILLKNIKFATQYSSGAASFAVNIYNFDIDSSSVLS
FT                   FYIPEKLVKLNNLHTNSDKASLAQLNIRMNGSIFEPKKTFDSSELKKILIPQTHYNKLT
FT                   IDNH"
FT   gene            432809..433051
FT                   /gene="xseB"
FT                   /locus_tag="RT0339"
FT   CDS_pept        432809..433051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="RT0339"
FT                   /product="E.coli exonuclease VII"
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:RT0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03819"
FT                   /db_xref="GOA:Q68X23"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X23"
FT                   /protein_id="AAU03819.1"
FT                   /translation="MSNTKTLEDNISFEEALRELEEIVKKIDNGQESLETAVNSFERGI
FT                   LLKNYCEKKLKEARLKIEKITKLADSTVILEETEV"
FT   gene            complement(434028..434699)
FT                   /gene="mpg"
FT                   /locus_tag="RT0340"
FT   CDS_pept        complement(434028..434699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpg"
FT                   /locus_tag="RT0340"
FT                   /product="DNA glycosidase I"
FT                   /EC_number="3.2.2.20"
FT                   /db_xref="EnsemblGenomes-Gn:RT0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03820"
FT                   /db_xref="GOA:Q68X22"
FT                   /db_xref="InterPro:IPR003180"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036995"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X22"
FT                   /protein_id="AAU03820.1"
FT                   /translation="MNKLIPLPREFFARDTNLVSTELIGKVLYFQGTTAIITETESYIG
FT                   NDDPACHAARGRTKRTDVMFGPAGFSYVYLIYGMYHCLNFVTEDEGFPAATLIRGVYVI
FT                   SHNDLYTIYTAKVKSQITDEKTQSIIISEDRRSTKFDIPNLEESNLYLNGPGKLCKYLG
FT                   INTTHNKCDLINNKDFFVSDIGLNLPYSTTKRIGITKGTDKLWRYIVTDNKNALLNINI
FT                   L"
FT   gene            complement(434960..435208)
FT                   /locus_tag="RT0341"
FT   CDS_pept        complement(434960..435208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0341"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03821"
FT                   /db_xref="GOA:Q68X21"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X21"
FT                   /protein_id="AAU03821.1"
FT                   /translation="MTKILLLTITFYKYFISPLLGNNCIFSPTCSEYAQEAIITHGIIK
FT                   GLWLTFRRIIKCQPFCIGGYDNVPTSIKNSKQPTKKI"
FT   gene            complement(435223..435735)
FT                   /gene="nuoE"
FT                   /locus_tag="RT0342"
FT   CDS_pept        complement(435223..435735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoE"
FT                   /locus_tag="RT0342"
FT                   /product="NADH dehydrogenase (ubiquinone) subunit E"
FT                   /EC_number="1.6.5.3"
FT                   /note="Coenzyme Q reductase; Complex 1 dehydrogenase;
FT                   Complex I (NADH:Q1 oxidoreductase); Complex I (electron
FT                   transport chain); Complex I (mitochondrial electron
FT                   transport); DPNH-coenzyme Q reductase; DPNH-ubiquinone
FT                   reductase; Dihydronicotinamide adenine
FT                   dinucleotide-coenzyme Q reductase; Electron transfer
FT                   complex I; Mitochondrial electron transport complex 1;
FT                   Mitochondrial electron transport complex I; NADH coenzyme
FT                   Q1 reductase; NADH-CoQ oxidoreductase; NADH-CoQ reductase;
FT                   NADH-Q6 oxidoreductase; NADH-coenzyme Q oxidoreductase;
FT                   NADH-coenzyme Q reductase; NADH-ubiquinone oxidoreductase;
FT                   NADH-ubiquinone reductase; NADH-ubiquinone-1 reductase;
FT                   NADH:ubiquinone oxidoreductase complex; Reduced
FT                   nicotinamide adenine dinucleotide-coenzyme Q reductase;
FT                   Type 1 dehydrogenase; Ubiquinone reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RT0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03822"
FT                   /db_xref="GOA:Q68X20"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X20"
FT                   /protein_id="AAU03822.1"
FT                   /translation="MNTKTTNFTFAFDKKNLNLAETIIKKYPPNGKRSAILPLLDLAQR
FT                   QNGGWLHISAIEYVANMLEMPYMRAYEVATFYSMFNLSPVGKYHIQVCTTTPCWLRGSD
FT                   DIMKICEKKLAIKHKETTKDQKFTLSEIECLGACVNAPVVQINDDYYEDLNEAKMEKLI
FT                   EQYLNDL"
FT   gene            complement(435831..437045)
FT                   /gene="nuoD"
FT                   /locus_tag="RT0343"
FT   CDS_pept        complement(435831..437045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoD"
FT                   /locus_tag="RT0343"
FT                   /product="NADH dehydrogenase (ubiquinone) subunit D"
FT                   /EC_number="1.6.5.3"
FT                   /note="Coenzyme Q reductase; Complex 1 dehydrogenase;
FT                   Complex I (NADH:Q1 oxidoreductase); Complex I (electron
FT                   transport chain); Complex I (mitochondrial electron
FT                   transport); DPNH-coenzyme Q reductase; DPNH-ubiquinone
FT                   reductase; Dihydronicotinamide adenine
FT                   dinucleotide-coenzyme Q reductase; Electron transfer
FT                   complex I; Mitochondrial electron transport complex 1;
FT                   Mitochondrial electron transport complex I; NADH coenzyme
FT                   Q1 reductase; NADH-CoQ oxidoreductase; NADH-CoQ reductase;
FT                   NADH-Q6 oxidoreductase; NADH-coenzyme Q oxidoreductase;
FT                   NADH-coenzyme Q reductase; NADH-ubiquinone oxidoreductase;
FT                   NADH-ubiquinone reductase; NADH-ubiquinone-1 reductase;
FT                   NADH:ubiquinone oxidoreductase complex; Reduced
FT                   nicotinamide adenine dinucleotide-coenzyme Q reductase;
FT                   Type 1 dehydrogenase; Ubiquinone reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RT0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03823"
FT                   /db_xref="GOA:Q68X19"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X19"
FT                   /protein_id="AAU03823.1"
FT                   /translation="MKYKYRNREINNKNTMTNKTITLNLGPQHPATHGVLRLILEMDGE
FT                   VVNNADPHIGLLHRGTEKLIEHKTYLQAIPYFDRLDYVSPMCQEHAFALAVESLLECSV
FT                   PRRAQFIRVLFSELTRILNHTLNIGSQALDIGATTPLLWLFEEREKIMEFYERVSGSRM
FT                   HANYFRPGGVAEDLPEKLLEDINKFIEQFPSKLNDIENLLNENRLWKQRLVDIGVVSQK
FT                   DAMDWGFSGPMLRGSGIAWDLRKSNPYDVYDEMDFEVPVGKNGDCYDRYLVRILEMYES
FT                   IKIIKQCIAKMPKGQVKTDNPKLTPPTREKMKESMEAMIHHFKLYTEGYDVPIGETYKA
FT                   VEAPKGEFGVYLYSQGGNKPYRCRIKAPGFAHLQGLNFMSKGHLISDVITIIATLDIVF
FT                   GEIDR"
FT   gene            complement(437219..437812)
FT                   /gene="nuoC"
FT                   /locus_tag="RT0344"
FT   CDS_pept        complement(437219..437812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoC"
FT                   /locus_tag="RT0344"
FT                   /product="NADH dehydrogenase (ubiquinone) subunit C"
FT                   /EC_number="1.6.5.3"
FT                   /note="Coenzyme Q reductase; Complex 1 dehydrogenase;
FT                   Complex I (NADH:Q1 oxidoreductase); Complex I (electron
FT                   transport chain); Complex I (mitochondrial electron
FT                   transport); DPNH-coenzyme Q reductase; DPNH-ubiquinone
FT                   reductase; Dihydronicotinamide adenine
FT                   dinucleotide-coenzyme Q reductase; Electron transfer
FT                   complex I; Mitochondrial electron transport complex 1;
FT                   Mitochondrial electron transport complex I; NADH coenzyme
FT                   Q1 reductase; NADH-CoQ oxidoreductase; NADH-CoQ reductase;
FT                   NADH-Q6 oxidoreductase; NADH-coenzyme Q oxidoreductase;
FT                   NADH-coenzyme Q reductase; NADH-ubiquinone oxidoreductase;
FT                   NADH-ubiquinone reductase; NADH-ubiquinone-1 reductase;
FT                   NADH:ubiquinone oxidoreductase complex; Reduced
FT                   nicotinamide adenine dinucleotide-coenzyme Q reductase;
FT                   Type 1 dehydrogenase; Ubiquinone reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RT0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03824"
FT                   /db_xref="GOA:Q68X18"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X18"
FT                   /protein_id="AAU03824.1"
FT                   /translation="MTLDELIDKLAAKSRILITKVTVKDHLAYKIEPHFLLPFLKALKE
FT                   SEELRFTVLTDLFGVDFPKREKRFEIVYNLLSLKLNKNLIIKTNISEKESIPSAMKILS
FT                   AACWYELEVYDMYGVNFNGNNDKRRILTDYDFEGHPLRKDFPLTGYTQVKYDKKLKKIA
FT                   YEPVNLDIEYREFDFSSHWHSPSYILPGDEKAEK"
FT   gene            complement(437799..438314)
FT                   /gene="nuoB"
FT                   /locus_tag="RT0345"
FT   CDS_pept        complement(437799..438314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoB"
FT                   /locus_tag="RT0345"
FT                   /product="NADH dehydrogenase (ubiquinone) subunit B"
FT                   /EC_number="1.6.5.3"
FT                   /note="Coenzyme Q reductase; Complex 1 dehydrogenase;
FT                   Complex I (NADH:Q1 oxidoreductase); Complex I (electron
FT                   transport chain); Complex I (mitochondrial electron
FT                   transport); DPNH-coenzyme Q reductase; DPNH-ubiquinone
FT                   reductase; Dihydronicotinamide adenine
FT                   dinucleotide-coenzyme Q reductase; Electron transfer
FT                   complex I; Mitochondrial electron transport complex 1;
FT                   Mitochondrial electron transport complex I; NADH coenzyme
FT                   Q1 reductase; NADH-CoQ oxidoreductase; NADH-CoQ reductase;
FT                   NADH-Q6 oxidoreductase; NADH-coenzyme Q oxidoreductase;
FT                   NADH-coenzyme Q reductase; NADH-ubiquinone oxidoreductase;
FT                   NADH-ubiquinone reductase; NADH-ubiquinone-1 reductase;
FT                   NADH:ubiquinone oxidoreductase complex; Reduced
FT                   nicotinamide adenine dinucleotide-coenzyme Q reductase;
FT                   Type 1 dehydrogenase; Ubiquinone reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RT0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03825"
FT                   /db_xref="GOA:Q68X17"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X17"
FT                   /protein_id="AAU03825.1"
FT                   /translation="MKNDFYQEDELLNSCLTNRGFLLSKIDEVISWARANSLWPMTFGL
FT                   ACCAVEMMQAAASRYDMDRFGMLFRPSPRQSDLMIVAGTLTNKMAPALRKVYDQMTEPK
FT                   WVLSMGSCANGGGYYHFSYSVVRGCDRIVPVDVYVPGCPPTAEALIYGLMQLQKKIKRT
FT                   TGFKYDSR"
FT   gene            complement(438319..438690)
FT                   /gene="nuoA"
FT                   /locus_tag="RT0346"
FT   CDS_pept        complement(438319..438690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoA"
FT                   /locus_tag="RT0346"
FT                   /product="NADH dehydrogenase (ubiquinone) subunit A"
FT                   /EC_number="1.6.5.3"
FT                   /note="Coenzyme Q reductase; Complex 1 dehydrogenase;
FT                   Complex I (NADH:Q1 oxidoreductase); Complex I (electron
FT                   transport chain); Complex I (mitochondrial electron
FT                   transport); DPNH-coenzyme Q reductase; DPNH-ubiquinone
FT                   reductase; Dihydronicotinamide adenine
FT                   dinucleotide-coenzyme Q reductase; Electron transfer
FT                   complex I; Mitochondrial electron transport complex 1;
FT                   Mitochondrial electron transport complex I; NADH coenzyme
FT                   Q1 reductase; NADH-CoQ oxidoreductase; NADH-CoQ reductase;
FT                   NADH-Q6 oxidoreductase; NADH-coenzyme Q oxidoreductase;
FT                   NADH-coenzyme Q reductase; NADH-ubiquinone oxidoreductase;
FT                   NADH-ubiquinone reductase; NADH-ubiquinone-1 reductase;
FT                   NADH:ubiquinone oxidoreductase complex; Reduced
FT                   nicotinamide adenine dinucleotide-coenzyme Q reductase;
FT                   Type 1 dehydrogenase; Ubiquinone reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RT0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03826"
FT                   /db_xref="GOA:Q68X16"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X16"
FT                   /protein_id="AAU03826.1"
FT                   /translation="MLQNSELLHEYLPIAIFFGIAVLVSGLIMMLPNLLSTKKYNKDKL
FT                   EPYECGFAPFSDARSKFDIRFYLVAILFIIFDLEITFLVPWAISLNTIGKIGFFSMMFF
FT                   LFVLIIGFIYEWTKGALDW"
FT   gene            complement(438817..440034)
FT                   /locus_tag="RT0347"
FT   CDS_pept        complement(438817..440034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0347"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03827"
FT                   /db_xref="GOA:Q68X15"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X15"
FT                   /protein_id="AAU03827.1"
FT                   /translation="MQYLILSLIFLIPSLGMLTGLSIAATVLFFLLIIVITELISFIRK
FT                   QEFSKKFLIKLYPRFGFDDIFCVKNRIKTELLFIAWCFISCLFTIHPINSLVTFTKVFA
FT                   LLFLRFVNNVVTFQNILYLKNSLILGIITAILLFFIEYSSHGFLTRMFKTHFGLYMLDR
FT                   GCALLSITTWVVIIILFSNGKNINAFILYIVVLYLLSISDSLASFVGFSIGGIIFILAR
FT                   LIKKIFFKLITISLITGSLLFPIIAKQIDPHNLSEKYLATKPSAAHRLFIWHFVANKII
FT                   IKPILGYGFASSKYIKTSDNEMIDYRGEKLHPLPLHPHNNILQITLELGILGLALFLCL
FT                   VYKYLKEIDNIKISNFRAASYSCFINYYIIGMISYNIWQTWWILSGIWILVLMKLLVKP
FT                   DIIIDN"
FT   gene            complement(440035..440502)
FT                   /locus_tag="RT0348"
FT   CDS_pept        complement(440035..440502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0348"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03828"
FT                   /db_xref="InterPro:IPR019225"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X14"
FT                   /protein_id="AAU03828.1"
FT                   /translation="MKLLQIIFIITIYINLNIFVLAENLESVEDIENDVFIPLDKNHPI
FT                   LNQKDNIYNAEFKNYTNGKIIALNKITATSEEIDLKTGEEKYFGNIKIKLHKCIKNLDP
FT                   YNQDNYLLMTITEYKIDEDPSLLFQGWMVSSSISLSTFEHSIYEIFAKDCF"
FT   gene            440999..441073
FT                   /gene="tRNA-Cys"
FT                   /locus_tag="RT0349"
FT   tRNA            440999..441073
FT                   /gene="tRNA-Cys"
FT                   /locus_tag="RT0349"
FT                   /product="tRNA-Cys"
FT                   /note="codon recognized: UGC"
FT   gene            441132..442025
FT                   /gene="xerD"
FT                   /locus_tag="RT0350"
FT   CDS_pept        441132..442025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerD"
FT                   /locus_tag="RT0350"
FT                   /product="integrase/recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:RT0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03829"
FT                   /db_xref="GOA:Q68X13"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X13"
FT                   /protein_id="AAU03829.1"
FT                   /translation="MLLAERALSKNSILSYKRDLLDFHNYLTKQKISELNITTRNIRKW
FT                   IEYLASNNLHARSINRKISTIKSYYTFLISENHTAFNPVLNVDLPKYQNKLPVILSIDQ
FT                   IKLILEYCSKDHTPEGIRLNAMIHLLYASGLRVSELVSLKLADILTNNTSKGIVRKIFS
FT                   VLGKGNKERVIVINDQAVLSITKYLKIRDIFVNKAKSKNLIYLFPSSAVAGYMTRQNFA
FT                   ILLKSVALDIGLNPKNVSPHILRHSFASHLLEGGADLRVIQELLGHADISTTQIYTHLH
FT                   TNHLKQALLHHPLNKN"
FT   gene            442106..443101
FT                   /locus_tag="RT0351"
FT   CDS_pept        442106..443101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0351"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03830"
FT                   /db_xref="InterPro:IPR020168"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X12"
FT                   /protein_id="AAU03830.1"
FT                   /translation="MKLKEMIFSCIGQPSTTKKYLRSEQELAGYFNIYTKLSHKNLERD
FT                   VNLTVMQNVEHEDKIFITRIINNILQKKITLDDLNHLKELKKGNKEIFLEYLQLLVCND
FT                   SLHELNQKIMQHAADLVNSQDLIFFLRVDNEDILRKLFYSEAKRNSFSVEINEEWTLKI
FT                   NFPSKILELYKLLINNFYLQNFAKEELQKKLYTELFPDFKIPFEQLIEEVSFFENFIEC
FT                   LKEFYIKNSLAQSIMFLLVSKYIEEHDVAKALFKSESFKKVSELEKFKPYYDINKCDEV
FT                   DNYVFNCILNDVKGAYISNLASSILELVNHSQPDCEIVSIEILGNSGVLV"
FT   gene            443221..444384
FT                   /locus_tag="RT0352"
FT   CDS_pept        443221..444384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0352"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03831"
FT                   /db_xref="InterPro:IPR020168"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X11"
FT                   /protein_id="AAU03831.1"
FT                   /translation="MATKNKKEIVNNETKNLANLIIKEIGKENFDFGILKKMQQAFSTA
FT                   SKQKQREAFINILDTKLNKEQLHQLNQTIMQNADELMPDNDPNFVCRTTNNKVFQEILL
FT                   LEAKRSGMQARFSDTGSLQSLDIKDITPEILDHYRVLQEKFYSKRNSKDSIDSRIAQSI
FT                   NFLLYAPLFRESDIYKKLGLKSAEIEREIQDPNGKYVKQLLDAKIGSYTHLYMEVKENN
FT                   VHAGKEIEIASIIEKVMLKFEQDKKISLEGKRRDEITKYLSKSLEGASDYVLTFKKNDL
FT                   VDVIYQGLDKGQTLWSKLVNHIGIKSYSISKENIKVVAQIINNKIKSYHTPLKIEVHDK
FT                   LKQISKELNRLNNPVLPSEAQKVQVKSKKPPIAPKPGHLKKRDHRLC"
FT   gene            complement(444573..445358)
FT                   /gene="fabI"
FT                   /locus_tag="RT0353"
FT   CDS_pept        complement(444573..445358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI"
FT                   /locus_tag="RT0353"
FT                   /product="Enoyl-ACP reductase"
FT                   /EC_number="1.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:RT0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03832"
FT                   /db_xref="GOA:Q68X10"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X10"
FT                   /protein_id="AAU03832.1"
FT                   /translation="MTTRLLQGKKGLITGIANNMSISWAIAQLAKKHGAELWFTYQSEA
FT                   LEKRVKPLAEEIGCNFISELDVTDQKSISNLFNDIKEKWNSFDFLLHGMAFANKNELKG
FT                   RYVDTSLENFYNSLHISCYSLLELSRSAETLMHDGGSILTLTYYGAEKVIPNYNIMGVA
FT                   KAALEASVKYLANDMGENNIRVNAISAGPIKTLASSAISDFSTMLKFHASTAPLKRNIT
FT                   QEDVGGAAVYLFSELSKGVTGEIHYVDCGYNIIGSSKLL"
FT   gene            445435..446925
FT                   /gene="lnt"
FT                   /locus_tag="RT0354"
FT   CDS_pept        445435..446925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lnt"
FT                   /locus_tag="RT0354"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03833"
FT                   /db_xref="GOA:Q68X09"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X09"
FT                   /protein_id="AAU03833.1"
FT                   /translation="MYKTKIICFLLGILSGLVFAPTFFIPALFTFSYLCYIVQKSQNWQ
FT                   AAAKFGYLFGFGHFLSGMYWISIGVSVYIADFWWAIPFALFGLPIILAFFISTNCTLSF
FT                   FAKNNKYYQLIFCLLWVLFEWIRSWICTGLPWNLIGYAFSFSEILIQPLSITGIYGLSF
FT                   IVIYIATSAYPVFSKNFTKLKILLASSMLILTVMVIYGAMRVSTNPTHFTDIKVRLVQP
FT                   SIPQTAKWDEEEFWHNLMLHINLSEKLEPTDLIIWSEAALVVPDDIPQVKLELLNMLNS
FT                   TNAILITGGISDNKKHGDKFELYSAMYALDKNNHKLFEYHKSHLVPFGEYMPLKKILPF
FT                   KKLTHGLIDYKEGNGGLVYIKKYHLKIKPLICYESIFPNFVQTNNEIADVIINITNDSW
FT                   YGKSSGPYQHFHISRSRAVENGLPMIRVANNGISAIVDPVGRIVKKLNLNEINYIQGLI
FT                   PQKLTTPTIFSQFGNFAMLLPIVFILLIHYLLSLIFDD"
FT   gene            448819..449742
FT                   /locus_tag="RT0355"
FT   CDS_pept        448819..449742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0355"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03834"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X08"
FT                   /protein_id="AAU03834.1"
FT                   /translation="MFISNVLQIQKFFSFLFVLLITTLVYANQKKVAVIVPLEHDSMHK
FT                   IVSGIKESLKDIDVEILVKNAHADSNILLAIIKQIKDQDIDLIIPIGTTVSQTAISHII
FT                   NKPIVCAAAIINGKNLPLVTGVNDEIKITDTISKLAFLENITLIYSSSEKVIPEVEMLK
FT                   LYAKNNNISLYTAMIQNLNDMPIAVKNAPKNTQSFIILKDHLIVSGINILKQEAFVRRI
FT                   PIIASDEGSVINGATIAVGVQEKQIGIEAGLMAKKILQGIAPQDIPFSDMKDFTLFINI
FT                   KSFVKQDILTKENLSVLPFTHKEFTE"
FT   gene            449747..450589
FT                   /locus_tag="RT0356"
FT   CDS_pept        449747..450589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0356"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03835"
FT                   /db_xref="GOA:Q68X07"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X07"
FT                   /protein_id="AAU03835.1"
FT                   /translation="MNILVTALEQSLIMLPLILGMYISYRILKITDLTVDGTYVLGAAV
FT                   FARTIHFGLFYALIFAVIAGGINGSIVSFMQKNKRINGLIAGILANFMLYSVNLQIMQR
FT                   PNISILGMPTLLSILHLENWLVPLIIINCFIIFIVLILLKGNLGLFLRAFGFNKDLLID
FT                   LGKPAELYRMLGLSISNGLAALTGTLSAQVNGFADINMGYGVALVGIGAIIIGRQIFLS
FT                   NINNFNAFKEMFSCFIGILFYFISLSILLRIGVDPINLKLILGIVLFISLSSVKREDL"
FT   gene            450586..451326
FT                   /locus_tag="RT0357"
FT   CDS_pept        450586..451326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0357"
FT                   /product="ABC transporter ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03836"
FT                   /db_xref="GOA:Q68X06"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X06"
FT                   /protein_id="AAU03836.1"
FT                   /translation="MKPYLYAEKIQFKVSERSDPIIFETTLNIAQEEFVVILGHNGSGK
FT                   STLAKILAGYLTPTSGQVFLDQVKVDKISQKHKALMLVTITQKLEDRLFTELTLEENIM
FT                   LWESRYHSNERLTSSDVLELTGSPKRFLPLLSQQLGKFSGGEKQVILLALSIAHPPKIL
FT                   FLDEHTANLDPKASLEVIKKTAEIIEHHKITAVMITHNLEAAAHYGKRLIVLDSGKVVL
FT                   DYLKPQNFSLRELRAILSSKIAGW"
FT   gene            complement(452476..452991)
FT                   /locus_tag="RT0358"
FT   CDS_pept        complement(452476..452991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0358"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03837"
FT                   /db_xref="GOA:Q68X05"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="InterPro:IPR024199"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X05"
FT                   /protein_id="AAU03837.1"
FT                   /translation="MILNIINYIKKDRYKVLNLVLIIMSIIALSTAYIAEYIFYYTPCP
FT                   LCVYERFPYLMLIKISLTALIIRQLNKYTLICILITILSSCILSTYHSFVERGIVQPSA
FT                   LCSSMIRIPQGLSIQHIKQMFYSQPITSCTKPAIKILGISMTEYNLLLNIALLIFLGLI
FT                   LFYPRSNK"
FT   gene            453256..454836
FT                   /gene="lysS"
FT                   /locus_tag="RT0359"
FT   CDS_pept        453256..454836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="RT0359"
FT                   /product="Lysine translase"
FT                   /EC_number="6.1.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:RT0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03838"
FT                   /db_xref="GOA:Q68X04"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002904"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR023386"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X04"
FT                   /protein_id="AAU03838.1"
FT                   /translation="MSVIWKDAIRSNAWPFIEAKKILDSLNGKVPEKGYVLFETGYGPS
FT                   GLPHIGTFAENARVVMVQKAFEQLSDIPTKLICFSDDMDGLRKVPSNIPNPEMVAQYMD
FT                   MPLTSIPDPFGECKSYGHYMNAKLCTFLDKFGFQYEFYSSTNCYKAGLFDDMLIRVLEK
FT                   YDEIMALMLPTFREERKTTYAPFMPICPKTGKVLQVPIEKWDARAGTVSYKDEDGNDVE
FT                   VPVTGGHCKLQWKPDFGMRWAALNVDYEMYGKDHLANSRLYSKICQILGGKPPVQFCYE
FT                   LFLDENGEKISKSRGNSISVDDWLKYASVESIALFMYKNPARAKRLFFDVIPKNVDEYI
FT                   TLNQKYHLEEDMVTRFANPVYHIHHGNVPKIETFGLTYSLLLNLTAVCNPSDKSVLWGF
FT                   ITKYEPKATPNTSTYLDHLAEFAIRYYHDFVQIHKSYLVVSEKHKIILYDILDMLSNIT
FT                   DQTEEENIQKAMYDIGMKAGYKNLRYYFKDLYQILLGQNEGPRFGTFIKLYGVEATKKL
FT                   VEEKLYPVA"
FT   gene            454866..455837
FT                   /locus_tag="RT0360"
FT   CDS_pept        454866..455837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0360"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03839"
FT                   /db_xref="GOA:Q68X03"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X03"
FT                   /protein_id="AAU03839.1"
FT                   /translation="MNYGFTVKAINKHMNEIFCSTLPIFLITLLGSIIKNKWLTSEEVW
FT                   RGIEKLSYFILFPAMLFNYVSTADLSVTSIIKLVVALIISTILVSLGLIIYQKKCNIDK
FT                   VQFTSIFQGSIRYNSYIFFGVSSPLLGPSGLSIVAVISSYMIIFTNILSAMIFAYYIPN
FT                   KSVTNTIRTSFILMMKLIVRNPLIIASLVGFIFNYSNLELYLGLKKTLDSLSNAALAIG
FT                   MLNVGAGLNFTIRQELLHNVVLTSFIKLVAFPLVSVIVLWLMSIEGINRSVGILYSCLP
FT                   CASTAYVLSRQLDGDPDSMASIITFTTFFSVITISIIMYLMG"
FT   gene            455946..458249
FT                   /gene="tme"
FT                   /locus_tag="RT0361"
FT   CDS_pept        455946..458249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tme"
FT                   /locus_tag="RT0361"
FT                   /product="Malic enzyme"
FT                   /EC_number="1.1.1.38"
FT                   /EC_number="2.3.1.8"
FT                   /note="bifunctional"
FT                   /db_xref="EnsemblGenomes-Gn:RT0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03840"
FT                   /db_xref="GOA:Q68X02"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X02"
FT                   /protein_id="AAU03840.1"
FT                   /translation="MNEMNKINYAEALEYHEKDKPGKIAITATKSLVTQQDLSLAYSPG
FT                   VAAPCLEISKNLDAVYKYTSRSNLVAVISNGTAVLGLGNLGAAASKPVMEGKAVLFKKF
FT                   ADIDAIDLEINTEDPIEFINAVKYLSYSFGGINLEDIKAPECFLIEEKLKSLMDIPVFH
FT                   DDQHGTAIITAAGLINAAYLTNRTLEDLKIVINGAGAAAIACIDLLIALGVDKSKIILC
FT                   DTKGVIYKGRTSGMNKWKERYASDTKIRTLTESLNNADVFIGLSVKGAVTKDMISQMAH
FT                   KPIIFAMANPDPEITPEDIKFVRDDAIIATGRSDYNNQINNVMGFPYIFRGALDVRAST
FT                   INTEMKIAAARAIADLARRPVPEEVYKAYSGRKLVFGNEYIIPVPFDPRLITVVAAAVA
FT                   VAAIETGVARVKDFSIGKYKQQLGSRLNPTANYMNFLAEKIHNVPLKRIVFAEGEEEEV
FT                   ISAALMMRDEKYGNPIIIGRVERIEVILKKIGKDISLDGIQIMNAALSDRLEQYTDYLY
FT                   KRLQRKGYLYRDCAKLVKTDKNIFAACMVACGDGDALLTGVTKSYIDSLEDIMKVISPK
FT                   QNRRILGYSIMIAKDHNIIIADNCITEYPNSLELAQIATQTAEIAKNMGITPRVALISF
FT                   ATFGNSSQEKTTRIREAVNILDNFSKDKKQLNDMKVDFEYDGEMSIKVALDHDLRKLYN
FT                   FCRLSGSANVLIMPGLNSAAIATELLQKFSSNSFIGPITNGFEKPVQILQTTATANEIL
FT                   KIATFACVEAIKEV"
FT   gene            458514..459878
FT                   /locus_tag="RT0362"
FT   CDS_pept        458514..459878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0362"
FT                   /product="Sec7-domain containing protein transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03841"
FT                   /db_xref="GOA:Q68X01"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="InterPro:IPR023394"
FT                   /db_xref="InterPro:IPR035999"
FT                   /db_xref="InterPro:IPR038075"
FT                   /db_xref="InterPro:IPR040917"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X01"
FT                   /protein_id="AAU03841.1"
FT                   /translation="MDSLLKNEVIKLFNDKQKSGITRIKKWCADNNKDFIEETAKFFYE
FT                   EKSNLNLEFVGDYLGTDGVDNQKVLESFTKKFDFKDKDYLESLRRFLQSFKLPGEAQKI
FT                   DRLVESFGTHYYEQNLNIDINSKDAAYILAYQAIMLNTDLHNPSIAKSKKMTFEQLKNN
FT                   LKGTNENKNFNDNFLKKIYDEIEAKPFKLNFVDSSPGYQINNISSQNDKVFKQLNQFLE
FT                   EKRNIQNIFPKLQNNNLTIEFKNAKTFLNKFTGYKGNVIIQDEQCGKAEIQVYKPSIFS
FT                   RWFLGEKSKIIIQPLREDGKQPSEQSLELAAQITASFETEVTSIKATYDYLKEDLKSKY
FT                   DNIRNAKQELERISTIAEGHKNIKTEVVYQINQPVKNSVAVSTISVVSPMSKDDIHINP
FT                   PPLPLPKSIPNVVKKAAKDISKQIPQERDNHKEELSKVLEVQRKKIDKQNSGRVV"
FT   gene            460352..461572
FT                   /gene="proP3"
FT                   /locus_tag="RT0363"
FT   CDS_pept        460352..461572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proP3"
FT                   /locus_tag="RT0363"
FT                   /product="proline/betaine transporter ProP3"
FT                   /db_xref="EnsemblGenomes-Gn:RT0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03842"
FT                   /db_xref="GOA:Q68X00"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X00"
FT                   /protein_id="AAU03842.1"
FT                   /translation="MPNSAFLVAFFTTIIRYYDYALFGLSANILAQNFLPSIDQDKQLL
FT                   VFFAIFSAAVIVRPLGSLIFGFIGDKYGRIKSIKISMFISSISTGLIAITPSFEIIGIF
FT                   ATVILTLCRMFFLASLAGEVDGIKVYVAEKTGDHRKNLNLGIVSCCSQIGALLASIAYY
FT                   YATHSNIWYLWRLNFFIGTIFGLCAIFMRNFFKESSEFLYYKNKPASKSTIQQIIKDNK
FT                   LFFIIALLINGAIGGVYHFLIIFLGVFLTKIACINHTEIRFMNIALTTTYGISAVFSGL
FT                   LADKINPLRQIIFALFASIIVALGMQIILYQKIFNMFYPIILIGFAAFYSVPLQIIVQS
FT                   LFKTNVKMRLYSLSHSCGGIILSSTTPFFSMLLWQNFKSLSLTLSFFIFLLILLISTVL
FT                   VLHKILS"
FT   gene            complement(461966..462193)
FT                   /locus_tag="RT0364"
FT   CDS_pept        complement(461966..462193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03843"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WZ9"
FT                   /protein_id="AAU03843.1"
FT                   /translation="MNITFKKIIFKCQYKKIQNNLSNLESFIYEVSVNKSTQHTKSLIQ
FT                   DKPEIYRSMISIKARIAKFEINSSLEANLI"
FT   gene            complement(462673..463315)
FT                   /pseudo
FT                   /locus_tag="RTPG19"
FT                   /note="pseudogene of rickettsial conserved hypothetical
FT                   protein"
FT   gene            complement(463313..464257)
FT                   /gene="mdh"
FT                   /locus_tag="RT0365"
FT   CDS_pept        complement(463313..464257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdh"
FT                   /locus_tag="RT0365"
FT                   /product="Malic dehydrogenase"
FT                   /EC_number="1.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:RT0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03844"
FT                   /db_xref="GOA:Q68WZ8"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011275"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WZ8"
FT                   /protein_id="AAU03844.1"
FT                   /translation="MTKNPKISLIGSGNIGGTLAHLISLKKLGDIVLFDVAEGVPQGKA
FT                   LDIMQAATIAGADIKIKGTNNYKDIEGSDAVIITAGLPRKPGMSRDDLISVNTKIMQDV
FT                   AQNIKKYARNAFVIVITNPLDIMVYVMLKESGLPHNKVIGMAGVLDSSRFNLFLAEEFK
FT                   VSVRNVNSIVLGGHGDAMVPLVRYSTISGVPIPDLIKMGLSSNKNIEKIIDRTRNGGGE
FT                   IVALLKTGSAYYAPAASAIAMLESYLKDKRQILTCAAYLQGEYDVHDLYIGVPIIIGKE
FT                   GVIKVIELQLTEEEKILFDKSVVGVKKLIDAIQ"
FT   gene            complement(464933..466456)
FT                   /gene="tlcB"
FT                   /locus_tag="RT0366"
FT   CDS_pept        complement(464933..466456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlcB"
FT                   /locus_tag="RT0366"
FT                   /product="ADP/ATP carrier protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:RT0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03845"
FT                   /db_xref="GOA:Q68WZ7"
FT                   /db_xref="InterPro:IPR004667"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WZ7"
FT                   /protein_id="AAU03845.1"
FT                   /translation="MNIVDSNCTIWHKARNSKFRHIVWPIRSYELTKFIPMALLMFFIL
FT                   LNQNLVRSLKDSFVVTLISSEVLSFIKLWGEMPMGVLFVILYSKLCNIMTTEQVFRIIT
FT                   GTFLFFFTIFGFILFPYKEFFHPDPELINQYITVLPHLKWFLIIWGQWSLVLFYIMGEL
FT                   WPVIVFTLLYWQLANKITKVEEAPRFYSFFTLFGQTNLLFSGTVIIYFAKSEHFLLPLF
FT                   AHLNDTNEILLKSFITVILLSGLICLALHKLIDKSVVEADKNIKFKNQRTDILKLSLIE
FT                   SAKIILTSRYLGFICLLVMSYSMSINLIEGLWMSKVKQLYPATKDFISYHGEVLFWTGV
FT                   LTLVSAFLGSSLIRIYGWFWGAIITPIMMFVAGVIFFSFTIFENHLGNIVNTLGYSSPL
FT                   VIIVFIGGLWHVFSKSVKYSLFDATKEMVYIPLDNEIKTKGKAAVDVIGAKIGKSIGAV
FT                   IQFISFSIFPNAVHNDIAGLLMFTFIIVCILWIYGVKVLSQYNNKMIQN"
FT   gene            complement(466701..468452)
FT                   /gene="pyrG"
FT                   /locus_tag="RT0367"
FT   CDS_pept        complement(466701..468452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="RT0367"
FT                   /product="CTP synthetase"
FT                   /EC_number="6.3.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:RT0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03846"
FT                   /db_xref="GOA:Q68WZ6"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WZ6"
FT                   /protein_id="AAU03846.1"
FT                   /translation="MARFIFVTGGVVSSLGKGITAASLAMLLQAKGFRVSVRKLDPYLN
FT                   VDPGTMNPHEHGEVYVTDDGAETDLDLGHYERFTGVTACKFDNITTGAIYSKLLKDERL
FT                   GNYTGITVQVIPHVTNIIKDFIMSNTNGFDFIICEIGGTVGDIEGLPFFEAIRQIGNKL
FT                   KSANCLFIHLTLLPYVKTVRELKTKPTQHSVKELRAIGISPNILVCRAERNISKSAIDK
FT                   IALFCNIKPEYVIPAIDQKNIYLVPIAYHNSGLENKVLNFFNINLVPSKLDKWYDIIGK
FT                   IKDSNSKVKIAIIIKYHKSHDAYKSVIEALNHAGIYYKYKIDLLWINAENLTEENINKK
FT                   LLNINGILVPGGFGVRATKGKMIAIKYARTNNIPFFGICFGMQLATIEIAQNLIGIKDA
FT                   VTEEFKIKGTKIIEKINKNSEDVTITIKNTHISKCTYSEEFECDTSTVYSNIHEDSNKE
FT                   STHRLPIETNFGNISDIKKTMRLGAYPCNLVANTIAATAYQSLEINERHRHRYKFNNEF
FT                   QNIFEQHGVVFSGFSKNKQIVEIIELPELRWFIGVQFHPEFKSKPFEAHPLFIQFIKAA
FT                   IEYNKCN"
FT   gene            complement(468475..469200)
FT                   /gene="kdsB"
FT                   /locus_tag="RT0368"
FT   CDS_pept        complement(468475..469200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdsB"
FT                   /locus_tag="RT0368"
FT                   /product="CMP-2-keto-3-deoxyoctulosonic acid synthetase"
FT                   /EC_number="2.7.7.38"
FT                   /db_xref="EnsemblGenomes-Gn:RT0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03847"
FT                   /db_xref="GOA:Q68WZ5"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WZ5"
FT                   /protein_id="AAU03847.1"
FT                   /translation="MKNQNVAIIIPSRLNSTRLIQKPLQLIGSITLIERVFKQVNKANI
FT                   QHTYVATDSEEIANIIKKIGGKVILTDSDIPTGTDRTYEAFKLIPNNNNIHYIINVQGD
FT                   IPFIEHRSILKIIEYLKNSEYDIVTPVVRVDRESIEASSNVTVAVDYMGKALYFSRSLI
FT                   PHGAEELLYHLGIYGFRKNALEKFVSLKQTFLEKTERLEQLRILENGMTIGTCLVEDVP
FT                   ISVDTEEDLKKAIKFCREN"
FT   gene            469419..469494
FT                   /gene="tRNA-Lys"
FT                   /locus_tag="RT0369"
FT   tRNA            469419..469494
FT                   /gene="tRNA-Lys"
FT                   /locus_tag="RT0369"
FT                   /product="tRNA-Lys"
FT                   /note="codon recognized: AAA"
FT   gene            469510..469586
FT                   /gene="tRNA-Ile"
FT                   /locus_tag="RT0370"
FT   tRNA            469510..469586
FT                   /gene="tRNA-Ile"
FT                   /locus_tag="RT0370"
FT                   /product="tRNA-Ile"
FT                   /note="codon recognized: AUC"
FT   gene            470138..471491
FT                   /pseudo
FT                   /locus_tag="RTPG20"
FT                   /note="pseudogene of rickettsial conserved hypothetical
FT                   protein"
FT   gene            471509..472081
FT                   /gene="folE"
FT                   /locus_tag="RT0371"
FT   CDS_pept        471509..472081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="RT0371"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:RT0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03848"
FT                   /db_xref="GOA:Q68WZ4"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WZ4"
FT                   /protein_id="AAU03848.1"
FT                   /translation="MNKPTREEAKEAVRTLLRFIGEDPTREGLLKTPDRVINSYMEIFS
FT                   GYGKDVQEILNTKFYDTYNFQDLISLEGIKFTSFCEHHILPFNGTVHIAYIPDNCIIGV
FT                   SKLARIVNIFSRRLQIQEKMTVQIAESIQESLKPLGVAIKISAFHSCMSMRGVMHDNSV
FT                   MNTMYYTGIFAEQQKYRHEFLNFIAKR"
FT   gene            472226..473512
FT                   /gene="proS"
FT                   /locus_tag="RT0372"
FT   CDS_pept        472226..473512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="RT0372"
FT                   /product="Proline translase"
FT                   /EC_number="6.1.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:RT0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03849"
FT                   /db_xref="GOA:Q68WZ3"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR023716"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WZ3"
FT                   /protein_id="AAU03849.1"
FT                   /translation="MLLSKYFLPILKEEPSEAQVISHKLMLRSGMIMKQASGLYTWLPL
FT                   GLKVLKNIENIVRSNMNKVGALEVLMPCIQPAHLWIESGRFEYYGKEMLKFQDRHDNTL
FT                   LFGPTNEDMITDIFRRNIKSYKDLPKNLYHIQWKFRDEIRPRFGVMRGREFLMKDAYSF
FT                   DINQENAVNTYNKMYKAYINTFRDLGVFAIPVIADNGPIGGNLSHEFHIIAETGESTIY
FT                   YDKRFKILKDNPDIDVEEIKSWYAAAEEKHDVNKLSSFPEGITSSKGIEVGHIFYIGSK
FT                   YSVNMNALINDEYGKLIPVEMSSYGIGISRLAAAIIEANCDKKGIIWPFSVAPFKVSLI
FT                   NLNIHDNKCVELAAKTDKELSNKNIEVLYDDTEARPGSKFATHDLIGSPYQVIIGPKKA
FT                   ANNIVELKDRKTGVLEDIEIENLINYIRI"
FT   gene            473514..474113
FT                   /pseudo
FT                   /locus_tag="RTPG21"
FT                   /note="pseudogene of cell filamentation protein"
FT   gene            474114..474401
FT                   /locus_tag="RT0373"
FT   CDS_pept        474114..474401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0373"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03850"
FT                   /db_xref="GOA:Q68WZ2"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WZ2"
FT                   /protein_id="AAU03850.1"
FT                   /translation="MIIKLTIIFVTMWINLFGNNIGFDMKNFIKYLFFSVLYIVVTIII
FT                   AYMVLAQTIPNDGQCHMMDRPLIIHYILASIITALPTLILICSSSKNKKK"
FT   gene            474407..475009
FT                   /gene="ruvA"
FT                   /locus_tag="RT0374"
FT   CDS_pept        474407..475009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="RT0374"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /db_xref="EnsemblGenomes-Gn:RT0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03851"
FT                   /db_xref="GOA:Q68WZ1"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WZ1"
FT                   /protein_id="AAU03851.1"
FT                   /translation="MIGKLSGKIDSQCDDYVIIDVNGVGYLVYASGTTLAKLVEGRFYK
FT                   LFIETHVREEHIHLYGFLTLEEKNFFNLLQSVNGIGTKMALSILSNLTPTDIKIAINND
FT                   DKNIFKAISGVGDKLTERIMLELKGKIAKIFSSSAIIKDSSNISSVEINEVIKALVNLG
FT                   FTRFEAQNTVQGIITQNTKISIDELIKTALKNRNSSF"
FT   gene            475073..476101
FT                   /gene="ruvB"
FT                   /locus_tag="RT0375"
FT   CDS_pept        475073..476101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="RT0375"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /db_xref="EnsemblGenomes-Gn:RT0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03852"
FT                   /db_xref="GOA:Q68WZ0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WZ0"
FT                   /protein_id="AAU03852.1"
FT                   /translation="MTNILSPEKSENDQELPIRPSYLQEFVGQQQIKENLLVFIKAAKS
FT                   RNEHLDHTLFYGPPGLGKTTLAKIISNEIGGNFKSTAGPAIIKAADLAAILTNLEKNDV
FT                   LFIDEIHRLNTLVEEILYSAMEDFELDIIIGEGSAARSVKITLPKFTLIGATTRFGMLS
FT                   NSLRDRFGIPMRLNFYNTEELKQVLNRASKLLDIDLTDSGSEEIAKRSRGTPRIALRLL
FT                   RRIRDFAVVDGKLRIDKEICDFGLKRLTVDSIGLDSNDYRYLKFIADNYHGGPVGIETI
FT                   AAALSEQRDELEETIEPYLIKIGLVKRTPRGRVITIAAFEHLKMPIPNKSQHQFNILNE
FT                   NE"
FT   gene            476094..477857
FT                   /gene="msbA1"
FT                   /locus_tag="RT0376"
FT   CDS_pept        476094..477857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msbA1"
FT                   /locus_tag="RT0376"
FT                   /product="lipid A export ATP-binding/permease protein MsbA"
FT                   /db_xref="EnsemblGenomes-Gn:RT0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03853"
FT                   /db_xref="GOA:Q68WY9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WY9"
FT                   /protein_id="AAU03853.1"
FT                   /translation="MNDNNLNNHYTVVYIIKRLIKDHVKPYANKIYFSMFCMVITALCT
FT                   AVIVHAVRPIIDKIFLTHDNTMLVIMPIILTLTFFIKGISEYYQNYLIKFVGQRVLNDL
FT                   KIKMYEHLLSADIAFIHQQSSGRLISRFTNDISLMRGAVSNLLVGCAKHFLTVVCLIIT
FT                   MFHLEPILSCVVFLVFPLAVYPVQRMGKKIRKIFSQSQEELGHYTSRLDETFQSIKIIK
FT                   SFVGEKIESNRASLIMNNILEFYKKTSKLDAMVSPIMEGLSGIAVGGMVWYGGNLVLDG
FT                   KTTPGALFAFLAAFAAAYRPFKSLVSLNINLQEGIAAAKRVFSILDTEPIIKDHENAKQ
FT                   IDLYNPQITFEKLSLNFASKIALKYIDLKLDSHKIIAFVGRSGSGKTSLSNLLVRFYDP
FT                   SHGRILINNHDIKDIKLTALRRQIALVTQDTHLFDASVADNIAYGHANATREEIIRAAQ
FT                   YADAHEFIMHLPNGYDTQIGVYGKTLSGGQRQRLSIARALLKDAPILIWDEATSNLDQA
FT                   SEQKILKFLKKLRQGKTTLIITHRLSSILDLDNIIVMKNGEICEQGTHTQLIQNKHEYY
FT                   MLYNNELKENV"
FT   gene            479212..480132
FT                   /gene="dacF"
FT                   /locus_tag="RT0377"
FT   CDS_pept        479212..480132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacF"
FT                   /locus_tag="RT0377"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:RT0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03854"
FT                   /db_xref="GOA:Q68WY8"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WY8"
FT                   /protein_id="AAU03854.1"
FT                   /translation="MFRRFLLPYIFIVIFCFAPISEAKKIVKKTNKYPVQTSLVIDAKN
FT                   GKVLQAHNAQVRIYPASLTKLMTLYLMFEAIESGKLSLDKKLLVSAKASKMPHCKLGLR
FT                   AGDNITVRDAINGLIIKSANDVAVTVAEGMKGSEKSFAHLMNVKAKTLGMKHTFFKNAS
FT                   GLHDPLQQTTARDIAKLAIALKRDYPKYYPFFSKTSFVFRGNVINGHNSVTKHYQGAEG
FT                   MKTGFHTPAGYNLVTTASRKNKSLIAVITGAKSAASRDQKMIRLLDHHFGVKTINYKPS
FT                   IKLASNNKANTKAKSKIIKRKNIRS"
FT   gene            complement(480248..481210)
FT                   /gene="rlpA"
FT                   /locus_tag="RT0378"
FT   CDS_pept        complement(480248..481210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlpA"
FT                   /locus_tag="RT0378"
FT                   /product="rare lipoprotein A precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RT0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03855"
FT                   /db_xref="GOA:Q68WY7"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR022438"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WY7"
FT                   /protein_id="AAU03855.1"
FT                   /translation="MIIMRNYKFKLESLHQNQKVFRRCTVHSTVLHIISLHEDWSTRLT
FT                   YKLSLYYCKIKNCYTTFKFEKSNRSIITRAERIINVQHLRRCKDIVDNFSGLISILLVL
FT                   IFCINLSGCNTSKRLAYDNKYSYKELSKDDPHNLTYIGHYKVGKNYKIKGKIYKPYTPK
FT                   YFTETGYASWYGGRKDGFHGKKTANGDRFNRNLLTAAHKTLPLPCLVKVTNKANNKSVI
FT                   LMVNDRGPFKKNRIIDVSQKAAEILAFKNQGITKVRIEYLPNETEKFLKKINLKKTENK
FT                   IFANNYKESLFTKVTKNNQCSINCHIKLVNLKYKLAVNP"
FT   gene            complement(481188..481805)
FT                   /locus_tag="RT0379"
FT   CDS_pept        complement(481188..481805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0379"
FT                   /product="possible periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03856"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WY6"
FT                   /protein_id="AAU03856.1"
FT                   /translation="MILRVLIFISLLLSISACLPAIFTAVTATGIVASKDQPMSKTLND
FT                   VKIATGIKADLVKNNFKDLGAKINVEVSQGRVLLTGNIQKETDALKAVKIAWDQTGVQE
FT                   VINELKVNKNNNHFDLVQYTKDTMITTQIKAKNLVRKDIKFANYTILTIDNIVYLFGVA
FT                   RSEEELEKLASIASKIKGVEKVVCYANIMNNFKTNNDNNEEL"
FT   gene            complement(481999..482541)
FT                   /gene="ispA"
FT                   /locus_tag="RT0380"
FT   CDS_pept        complement(481999..482541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispA"
FT                   /locus_tag="RT0380"
FT                   /product="intracellular septation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:RT0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03857"
FT                   /db_xref="GOA:Q68WY5"
FT                   /db_xref="InterPro:IPR006008"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WY5"
FT                   /protein_id="AAU03857.1"
FT                   /translation="MLKLLSEIGPVIAFFAGFFYGGGIQSATLYMLITSIICITLCYII
FT                   DKKVSKLSIISSTVLFVSGIITLISGDSMYIKIKPTILYVIFGIIFLMSGIRKNPFIKY
FT                   ALESIVRLKEESWIILSYRTAAFFFFMAVVNEVVWRNFSDETWVKFKVFGVIPITFIFI
FT                   LLQLPLLLKNKLPDSKI"
FT   gene            complement(482570..483418)
FT                   /locus_tag="RT0381"
FT   CDS_pept        complement(482570..483418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0381"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03858"
FT                   /db_xref="GOA:Q68WY4"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WY4"
FT                   /protein_id="AAU03858.1"
FT                   /translation="MFKIALVVFRECLEISLLLSVILAVTKQIEKSRLYIIAGIMLGVV
FT                   FASIFAFFTRKLSLSFGGIGDELFDSGIMILITILISWTIIWMQGYGIKVKRHINDLSL
FT                   KIHEGNRSYFMLVFLVATTILREGAEIIILVYSISSVETIPSSIYLQGVIIGATSGFLL
FT                   GLVIYCGLIKIANQKYIFKISTILLMLIAGGFAASAAGILTSSGLVMFLSDQLWDSSWL
FT                   VADRSMIGKILHIVTGYIARPNGLQVLSYFTTILLINIFIQIKLRYYKNNLISVQTNES
FT                   N"
FT   gene            complement(483428..483808)
FT                   /locus_tag="RT0382"
FT   CDS_pept        complement(483428..483808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0382"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03859"
FT                   /db_xref="GOA:Q68WY3"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WY3"
FT                   /protein_id="AAU03859.1"
FT                   /translation="MDIIKKNKNIIILICLIFLAIMVYIYKSNGSNNKTNDNILEVKIT
FT                   IKDHKFVPDIVEVPKSTKIRLIVHNADDTVEEFESHDLHREKIVMPHESINIILAPLKP
FT                   GKYEIFGDFHQDTAQGFIIVND"
FT   gene            complement(484129..485130)
FT                   /locus_tag="RT0383"
FT   CDS_pept        complement(484129..485130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0383"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03860"
FT                   /db_xref="GOA:Q68WY2"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WY2"
FT                   /protein_id="AAU03860.1"
FT                   /translation="MQKFLSLIIVILILYNIVKLKIYPEDNNNSTTIEQITSNNSSTNA
FT                   HQASINNEPTISLNGNLFERTVSKIVINALKTEEGKVFFENILQPLNGPINPNDYTIEV
FT                   HKDLVKTLFKINTFGSGNIGPASCGHVVTVFYQISDMNNNLISEDTKTFTLGSAPVMLG
FT                   LDNVIIGMMVGESREAIIPAKYTVNNSNNTIFDDAYNYKVTVILKSILPQNFVKSNKVK
FT                   IYDDEIAYRVPLLCGEKVSFNAKITRLSNGKILFDSKSTGQPIDMKIGDITYPLIFSYA
FT                   LQGKVQVGTRSVIAESKTFKALGSNLNKVIPHESLPIHEYLLLELNDFKQIK"
FT   gene            485271..485897
FT                   /gene="pcaH"
FT                   /locus_tag="RT0384"
FT   CDS_pept        485271..485897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaH"
FT                   /locus_tag="RT0384"
FT                   /product="Protocatechuate oxygenase"
FT                   /EC_number="1.13.11.3"
FT                   /db_xref="EnsemblGenomes-Gn:RT0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03861"
FT                   /db_xref="GOA:Q68WY1"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WY1"
FT                   /protein_id="AAU03861.1"
FT                   /translation="MKKFIFCFLYLYTLNIFAVSKIAHNKLNSCSITRNIFNNYEPKVF
FT                   ETTNNLLRKTGRLSKFYGEMILIRGKILDQNCVPVTDAKVYLWQAGSGGKYPYEPLKTR
FT                   VDKRRFTNKSDSSFTGSGIVTTNNKGEYYFISMLPYKSSHYLRTANIRIEHPNLTTLET
FT                   RLELSDQNMCDNDCGEISPILTETKKNIQSYCFDLVLQGTTLKRY"
FT   gene            486082..486744
FT                   /gene="tlpA"
FT                   /locus_tag="RT0385"
FT   CDS_pept        486082..486744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlpA"
FT                   /locus_tag="RT0385"
FT                   /product="thiol-disulfide interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03862"
FT                   /db_xref="GOA:Q68WY0"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WY0"
FT                   /protein_id="AAU03862.1"
FT                   /translation="MTLRNYNKYLIYIIVFLLSIIIFPKIQAKLYEKPKNKLEFLKGSS
FT                   VPDNIFFFDEEKNQYSLDQFEGKTILLVFWATWSATCVKEMPDFDILQKDFRKLPFSVI
FT                   PISEDYQDIKIVKEYFKSYHIRYLPIYYDYRNALFKALGIISLPTSILIDSNGKIVTIF
FT                   VGTTNWYDEKVRDTILSAIPGNYPEPKNSYNEQSLNKPAKHLPQIKNYIIKNEQNNE"
FT   gene            486737..487651
FT                   /locus_tag="RT0386"
FT   CDS_pept        486737..487651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0386"
FT                   /product="probable protease"
FT                   /db_xref="EnsemblGenomes-Gn:RT0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03863"
FT                   /db_xref="GOA:Q68WX9"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WX9"
FT                   /protein_id="AAU03863.1"
FT                   /translation="MNEVNKSTIANAEFDQIITKRQISKLDQLFASVFGDSKEVVAVLR
FT                   LSGVIGKVSTVQSGLTLESLNELIEKAFKIKKLKALCLIINSPGGSPVQSELIAKRIRD
FT                   LAKKNKIKVYSFIEDMAASGGYWLACSGDKIYALPSSVIGSIGVISSGFGFHEAINKLG
FT                   IERRVYTEGKNKAVLDPFKPINKDDLKIIKDLQKQVYEHFIEYVKERRAGKLTQQDEIL
FT                   FNGEFWAGQTALDYGLIDGIGDMYSVMKEKFGDNIKFQYLCAKQPWLKKKLGMGSKVLI
FT                   EDLVNTVIDTIENKSITDKFNMK"
FT   gene            487653..488099
FT                   /gene="dut"
FT                   /locus_tag="RT0387"
FT   CDS_pept        487653..488099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="RT0387"
FT                   /product="Deoxyuridine-triphosphatase"
FT                   /EC_number="3.6.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:RT0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03864"
FT                   /db_xref="GOA:Q68WX8"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WX8"
FT                   /protein_id="AAU03864.1"
FT                   /translation="MTIIEVKIKKLENFSGNLPAYATEHSAGVDLIAANEQTILIKVGS
FT                   IQLIPTGIAIALPDSFEAQIRPRSGLAIKHGITVANSPGTIDADYRGEIKVLLINLGKK
FT                   DFLIERGMRIAQMIIAKYERVLWAETSILTETMRGRGGFGSTGL"
FT   gene            488245..490200
FT                   /locus_tag="RT0388"
FT   CDS_pept        488245..490200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0388"
FT                   /product="soluble lytic transglycosylase domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03865"
FT                   /db_xref="GOA:Q68WX7"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WX7"
FT                   /protein_id="AAU03865.1"
FT                   /translation="MKIKLLTSIFLLLALKVNANSDSIDNIQQIFTYIDQKKWSQAKDL
FT                   ALAINSTVLTKIVLSQAFLDNKCSDNSFQKIIKFLRENPDWPQNKLLAKRAEEYLNNNT
FT                   NKKVIFDWFSMHPPLTGKGYKFYAVAAISLVKDHKILSPIIKKAWVYGDFTPEEEKIYY
FT                   NECSKYLTVNDHLERIEEHLWKSDIRTAQRSLKYVDQGYRNSFKAQIAIISTTSNAEKL
FT                   FKNVPEKYYTSGLLYRYLDLKKMQKPTKEMIALFKKAKNNRKHFAKWCRIQSYYARAFI
FT                   DYKDYANSYRMATMRFPVCNKTIREQEWLAGWLSLSFLNKPDQALMHFNKFIKVVKTPI
FT                   SLARGFYWLGRTYEAKGDKQMAKKFYQQASRYSFTFYGQVANIELNRTKLVLPSIPVIT
FT                   SEARKIIENKEIIKAIRLFVKYNQNHLAMIYSKEAIKNTKNQAEIQIIANIIKGCNNTH
FT                   YMVDVAKIAAQNHAFILDCAFPTPYNLTGLPIASSLTYGIIRQESVFDHKAISCSNAMG
FT                   LMQLIKGTACDIAKSINMKCDVEQLIKNPAYNIKLGSHYFKKLLDDHKGSYVLSIASYN
FT                   AGSNNVMKWIEKFGDPRDIKDTRKIIDWIELIPYKETRNYVQRVLENVQIYRVILNNNS
FT                   NLYFKRDLHACAIVKS"
FT   gene            490264..491013
FT                   /locus_tag="RT0389"
FT   CDS_pept        490264..491013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0389"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03866"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WX6"
FT                   /protein_id="AAU03866.1"
FT                   /translation="MQQIEKYIKKKRNAIDAQVKKYKQALTEIGIKYDCEFAHVAVPNH
FT                   ATGRFEYFKWDWMTSTTSSHSEIVQIFQEIVMTLQAAKNNPIQYENLASRLDSNTQDIL
FT                   AFNIQQHNIIVPTIHISQSELVQKALEEAAHCTKVSNVTAEFKNYFSKLDPDGVVEFMN
FT                   CTKGTTINVDGCVGTSLLDNAVNIKYPATWNGILTQKFFIENGITNPYASFEEKIDKTV
FT                   QEGSVDESSIEEVQIKQVELIGGTSDF"
FT   gene            491122..492075
FT                   /gene="ldcA"
FT                   /locus_tag="RT0390"
FT   CDS_pept        491122..492075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ldcA"
FT                   /locus_tag="RT0390"
FT                   /product="Carboxypeptidase IIW"
FT                   /EC_number="3.4.17.13"
FT                   /db_xref="EnsemblGenomes-Gn:RT0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03867"
FT                   /db_xref="GOA:Q68WX5"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WX5"
FT                   /protein_id="AAU03867.1"
FT                   /translation="MVLKNLSLLIILFFSISVFSVSNSLTNIPITVVATATGADNKTLS
FT                   DLKNINGLNLQIPTKCFMKDKLPFLASSDEVRFNCLMDALFDKSDNVVWSLRGGYGSAR
FT                   IIPDLLKISKPNKEKFFIGYSDITALHLFLSQEWGWRTIHGSNIADLLKIEKDQGNFTK
FT                   LGEILKGKVKQVTIDNLIPLNDIAKSSGLVQGKLTGGNLTIVQTSIGTRWQIKAKGKIL
FT                   FLEDTNVAPFRLDRALLHLKQSMLLESVKAIIFGSFGKDIDATMLVLRNFAYSLNIPVF
FT                   KTNRFGHEQINDPIIYNTNSKIIMSKHKGFKLIMEL"
FT   gene            complement(492156..494750)
FT                   /locus_tag="RT0391"
FT   CDS_pept        complement(492156..494750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0391"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03868"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WX4"
FT                   /protein_id="AAU03868.1"
FT                   /translation="MIARYSFLQNFAEYIIDKLKKGIEVQIILPNNLLCLKLKQILIDK
FT                   YKIKLPIIIPFNAIFFKKNESDYISKIEELFILSSIITEYKELPFNLEESLKSAEILRK
FT                   LFNDLIINNIDIKLIEVYNNSNYWQKIYKFLEICFLKWKKAISLTQKYTKTIHEFNILQ
FT                   EEIIKIKKRDKRIILAGIFKPNVFFKKFEEELKDYIIHYNPSYNYISNNISYSEPNNIY
FT                   EEAKQIAYICELNKDKHIAIVTNDNKLKKVYCNFLDQKYSDLLGNDLRRTNIGELLTAI
FT                   IKIICNNFDLKLLFLLLKNPLINCHSVQKLELMLSNQNRFISSPKYLLQLQFENEELKE
FT                   YCANLIDILFTNNPHNITGILTLTQEIAEKLLPTIWEKEEGEVLIEFLTNLISYSKHIN
FT                   LMNKKDFPKIFSFLLSNIKHYKNTDSSSIIIGQPEDLVLCRFDLIILPHFNNEHWSPNA
FT                   KPHPLLSKKALQILNIDYNDAITTMLYTDYFNLLLQNKQIVILNAKKYNGKLSTSCNLF
FT                   LRLQLKHVIPWFDPKLLTPATNSLDIKSQDDHKLTTISHSFPSVLSVTDIESLIRNPYG
FT                   FYAKKILGLYKKDNIWEEPKISDFGNFIHKVLEKYSKNYDKQYVCLNLLDKQAALINIG
FT                   NHILYSTILPAYTKKIWQIKLTAFSKTFILFDIERRKNCKEIYFEIKGELRLNIAGQNI
FT                   KIIGIADRIEVSKSNDITILDYKTGTIPTKKEIEFGLSPQLIIECLMLLENGFNIKSFS
FT                   NLETSQLSNIHIGRDTVICSRAQVVNPSYLKNYKSSCINKKLTIAYVRITSTEPYIQTT
FT                   EIDLNIETLHKHKAGLIRLLEYYVTNKSFSYDFNLSNYNDYRHLTRCYYINS"
FT   gene            complement(495171..496010)
FT                   /locus_tag="RT0392"
FT   CDS_pept        complement(495171..496010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0392"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03869"
FT                   /db_xref="GOA:Q68WX3"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WX3"
FT                   /protein_id="AAU03869.1"
FT                   /translation="MQEKPIIGITPDLAKNCQKYTYADFPWYALRRNYADAIIAAGGIP
FT                   VLLPYQSDTINELMELINGIVIPGGDEDIHPKFYEQKYAEDLVISNEERDHFEILVLKK
FT                   ALEKDMPVLGICRGMQLLNVMFKGTLIKHIPDYIKHFSKLTYRKKFESKTEAFATKVYT
FT                   LPIKLEFDHEPIETIINHIQPAPKNIVSHAINIEVNTKLSKIANNCLQTMVNSTHHQAI
FT                   KKLGNDLIISAKAEDGIVEAIEATKHKFVIGVQWHPEYMNDNGVDLQLFKALVKASK"
FT   gene            complement(496379..497698)
FT                   /pseudo
FT                   /locus_tag="RTPG22"
FT                   /note="pseudogene of cytochrome c oxidase subunit I"
FT   gene            complement(497853..498935)
FT                   /pseudo
FT                   /locus_tag="RTPG23"
FT                   /note="pseudogene of cytochrome c oxidase subunit II"
FT   gene            499359..500723
FT                   /locus_tag="RT0393"
FT   CDS_pept        499359..500723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0393"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03870"
FT                   /db_xref="GOA:Q68WX2"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WX2"
FT                   /protein_id="AAU03870.1"
FT                   /translation="MNDTILYGFNVQSSFISARLKKIFTPAFFLSLLLFIGLVFFVSFA
FT                   INNYVNDTLSITLVQPDSSEEETISFKEVVVKKGDTIKSILVEQKIPKNDIEKIINLVK
FT                   AGQLSSTLKIGQQITFEYETKITENDDEDLTSEITFLNKIIIIIDKLKTVEVIREGDNF
FT                   KVEEIVVPLSKKVSKSSVNIESNFMSALKKLGLSNNSIIELINAYAYQIDFQRQIKNGD
FT                   TATVITEKYITEDGKFSHHGKILYVSLNLSGKEYNIYRYSHDNNANNYAFFSEDGKSVK
FT                   RSLLKTPLKVIKVSSHYGNRKHPILGYTKMHRGVDFAAPTGTPIYSAGNGVITEIGWKS
FT                   GYGKFIQVKHSGTLSTAYAHASSFAKNLKVGSIVKQGQVIAYVGSTGRASGPHLHYEVK
FT                   IDGKHVNPMSVKTTPGIELNGKNLEKFKQFKQEIKTLNVKLDKESYTDEINTVSL"
FT   gene            500855..501445
FT                   /gene="lspA"
FT                   /locus_tag="RT0394"
FT   CDS_pept        500855..501445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="RT0394"
FT                   /product="Bacterial leader peptidase I"
FT                   /EC_number="3.4.23.36"
FT                   /db_xref="EnsemblGenomes-Gn:RT0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03871"
FT                   /db_xref="GOA:Q68WX1"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WX1"
FT                   /protein_id="AAU03871.1"
FT                   /translation="MISLFKKLYFTFSRSSRIIITLVIIDQLTKWWFINNLRWKPGLML
FT                   KVTSILNMVYTWNYGISFGLMREYYQYSNAIFLITNMIIVCYLYHLMICSKTIGSFVGY
FT                   NFVIGGAIGNLIDRFCRGAVFDFIHFHYRNYSFPVFNLADCFITLGVIILIEDYFSTKK
FT                   VIEETSKENFDNLQIEAMAAKIRNTDHVSNDKI"
FT   gene            501466..501714
FT                   /locus_tag="RT0395"
FT   CDS_pept        501466..501714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0395"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03872"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WX0"
FT                   /protein_id="AAU03872.1"
FT                   /translation="MKQIFLLFTLLFITSACNKKLKETLGLSTAGPNEYQVQRVKTLET
FT                   PPHYYLIDPRNNKTTYNNIKVKCELNEGEQALMHDMN"
FT   gene            501879..503252
FT                   /gene="murD"
FT                   /locus_tag="RT0396"
FT   CDS_pept        501879..503252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="RT0396"
FT                   /product="D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:RT0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03873"
FT                   /db_xref="GOA:Q68WW9"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WW9"
FT                   /protein_id="AAU03873.1"
FT                   /translation="MNAYTKQKIGIFGLGKTGISVYEELKNKYDLIVYDDLKAKRDIFE
FT                   KLFGNKLITILSDSRWQDLDKIVLSPGVPLTHEVVRIAHHFNIPIISDIDLLFEKSKNL
FT                   KFIAITGTNGKSTTAALISHILNSNGLDYTVAGNIGVPALQAKASKDGYVLELSSFQLD
FT                   LVKIFTVKVAVLLNITPDHLDRYQDMNGYIAAKAKIFDRMDKDSYAVINIDNDYCRKIF
FT                   LLLQREQLIKLIPFSVTKILNNGISIVDDKIHDNNLTYKLPLNKNLQGLHNCENIAASY
FT                   AVSKIIGVESKKILESISSFQSLHHRMQYIGSINNISFYNDSKATNAISALQSIKALDN
FT                   IYWLAGGIPKEGGIEGIKPYFNKIKKAYFYGQAKTMFANTAKNIIDCVICDNLEYAFNI
FT                   AYKDAVSDNTEIKNILLAPSCSSYDQFKNFEERGELFIKLSKNVIGSNYLLSNLRIFD"
FT   gene            503293..504426
FT                   /gene="ftsW"
FT                   /locus_tag="RT0397"
FT   CDS_pept        503293..504426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="RT0397"
FT                   /product="cell division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:RT0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03874"
FT                   /db_xref="GOA:Q68WW8"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WW8"
FT                   /protein_id="AAU03874.1"
FT                   /translation="MNNEISNNFIKLWWRSTDRQIIISLIILFAFSLMLVTTSGSIVAS
FT                   RIGLEESYFASRQIFYLAVASGLILLLSCLNKKWLRRFAILGFIMSVVLLIAVKFFGYE
FT                   VKGAVRWINILGLSIQPSEFIKPFFEVVTGWILALKFNDDFPSFTICVIFYFIVAILLI
FT                   IQPDFGMLVMITAVFGIQLFIAGMPIFWIMLAVFLGMLGVTIAYFWLPHVTQRINSFLD
FT                   PESSENYQVSKSLKAFEHGGLYGCGPGEGVVKQVLPDSHTDFIFAVAGEEFGAIICLIV
FT                   IAIFAFIVLSSFIKLLNETDKFVQFAASGIIAQLGLQAIINIGVTLHLLPTKGMTLPFI
FT                   SYGGSSTIAIAIATGMLLGFTRHRTPLNSYKICNIEI"
FT   gene            504423..505580
FT                   /gene="murG"
FT                   /locus_tag="RT0398"
FT   CDS_pept        504423..505580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="RT0398"
FT                   /product="MurG transferase"
FT                   /EC_number="2.4.1.227"
FT                   /db_xref="EnsemblGenomes-Gn:RT0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03875"
FT                   /db_xref="GOA:Q68WW7"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WW7"
FT                   /protein_id="AAU03875.1"
FT                   /translation="MKKIILVAGGTGGHFFPAVALGEELIKRGYIVHFITDLRCKKYIN
FT                   KDMKIIFYLLDLKRFSNILLFLPTLLIAFLKSIKLIYHIKSCVIIGFGGYPVIAPMFAA
FT                   IFLRIPIIIHEQNSYLGKVNKFFARFAKKIAISYEDIKNVPEFAKSKIVLTGGIVRKNI
FT                   RELDSFIYLASQHCPTKLTKTVLTNTLNHFVKARNNKFSNCNIFTLFIFGGSQGAKLFS
FT                   ELIPASIEILMKKQPNLELKIIQQASLAHQVKIKDIYSKLNITYEFAEFFDNIALQYKV
FT                   ANLVISRAGASTIEELTYIGLPTIFIPLPSAADNHQYYNAKLLADNKAGWCLEQNNISA
FT                   EKLADQILDLISNRQLLEDAAQNLLNRKQEGHLLLSNLIEDTVFL"
FT   gene            505835..506491
FT                   /locus_tag="RT0399"
FT   CDS_pept        505835..506491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0399"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03876"
FT                   /db_xref="GOA:Q68WW6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WW6"
FT                   /protein_id="AAU03876.1"
FT                   /translation="MLKKIIILFLGIFLLSSCTDNFRNYFQRSANNKLFDVKGAKGGKR
FT                   KPVYNNKYIALAKKNIVEDNIDYDNDVDDNYDNDGPLISEKIDNVKRNREMYLNMIKSD
FT                   IARQKAEFSATQSNNVMTLSKANKKVRKDDSYKEKKIEEELNQIKAMLKETKRDITKYT
FT                   CPNATVNQNYVPPVTNYEHVNYPPIKNSNPYNNTSKVKQKFIREDDDDTNNACSI"
FT   gene            complement(509116..510132)
FT                   /locus_tag="RT0400"
FT   CDS_pept        complement(509116..510132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0400"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RT0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03877"
FT                   /db_xref="GOA:Q68WW5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WW5"
FT                   /protein_id="AAU03877.1"
FT                   /translation="MKILNIMLSRDLGGIQQAFLDYNAALEIQKIEVINVTSYKAKINS
FT                   FLNRRSFKLINLIPIDPLSVLILKYIIYKTQPDIIIAHGNRSINFSKLAKPHNTKLVGI
FT                   AHNYSLKGLRKCDFVIALTYHMKEFLLKNHFDKSRIFVLPNMINITKNFVPNKIYKKVI
FT                   VIGVLARFVAKKGIDVLIKATKLLKDKKYDIQVVIGGNGNEKDNLIALVHKLNLQDQIS
FT                   FKGWVNDRDTFFKQIDIFCLPSLHEPFGIIILEAMEASVPIVSTDTEGPKEILKHLKDG
FT                   LICKAGSIEDLAEKIIYLIDNPLQAAEFSKNAYLKLKQNYDIKVVSKKLEYILESFR"
FT   gene            510908..511720
FT                   /gene="dapF"
FT                   /locus_tag="RT0401"
FT   CDS_pept        510908..511720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="RT0401"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:RT0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03878"
FT                   /db_xref="GOA:Q68WW4"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WW4"
FT                   /protein_id="AAU03878.1"
FT                   /translation="MINKINFVKMHGLGNDFVIVHKRDLATVCNLSQLAKNMADRHTGI
FT                   GCDQCIIYEEYNNVYTMIIYNIDGSNAKLCGNATRCLAKLIYLDTGKKDITIMVGKKKL
FT                   LCNVEAANKISVNVGNVSFNETWMPSRDRIWAFAERYMLDLKETMCVDIGNPHLIIFSK
FT                   LEPQDQKIIGQKLQAKELFVDGVNVNFAEVKDNKIYLSVWERGAGLTLACGSGACGSFA
FT                   AGLKLGFVHSPSTVVFKYGNLIMQEEDGNIIMQGEATFVMRGEYYCEK"
FT   gene            511695..512960
FT                   /gene="miaB1"
FT                   /locus_tag="RT0402"
FT   CDS_pept        511695..512960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaB1"
FT                   /locus_tag="RT0402"
FT                   /product="tRNA-methylthiotransferase (MiaB protein)"
FT                   /db_xref="EnsemblGenomes-Gn:RT0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03879"
FT                   /db_xref="GOA:Q68WW3"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WW3"
FT                   /protein_id="AAU03879.1"
FT                   /translation="MENIIVRNNLRQEIVTFGCRLNIYESEIIRKNLELSGLDNVAIFN
FT                   TCAVTKSAEKQARQAIRKAKKNNPDLKIIVTGCSAQANPKMYGNMSEVDKVIGNEEKLL
FT                   SHYYQITDQKISVNDIMSVKETACHLVSSFDGKSRAFIQVQNGCDHNCTFCIIPYGRGR
FT                   SRSTPIGTIVAQVKHLVLKGFKEVVITGVDVTAYGSDLPGSPTFAQMIKRVLNLVPELK
FT                   RIRLSSIDIAEVDDEFFELIAYSKRIMPHFHISLQSGDDMILKRMKRRHNRASVIEFCQ
FT                   KLRAIRPEVSFGADIIAGFPTETNEMFENTRKLILEAELQYLHVFPYSEREGTPAIRMP
FT                   QVPKNIRKERAKILRQDGYNQLTEFFKKHIGQKVELLIENNNVAHTENFIPVKLDKYLA
FT                   IGQIFKAELVGIENGYMKCVLI"
FT   gene            513084..514136
FT                   /gene="pheS"
FT                   /locus_tag="RT0403"
FT   CDS_pept        513084..514136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="RT0403"
FT                   /product="Phenylalanine translase"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:RT0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03880"
FT                   /db_xref="GOA:Q68WW2"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WW2"
FT                   /protein_id="AAU03880.1"
FT                   /translation="MANIETILKLAEEKILLVHNLKDLQEYKVEFLGKNGIVTSELKKL
FT                   SSLVNGQERKEFGLKINTLKDKIHNIIKAKVQILEEEELNLKLAADKIDLTIPARRYKQ
FT                   GSIHPITQCMDELIQVFAQFGFTIENGPNIENDFHNFTALNFEYDHPARQMHDTFYLKG
FT                   RENDKPLLLRTHTSTVQIRAMKNGKPPFRFIAPGRTYRSDSDMTHTPMFHQIEGLVIDK
FT                   NINMGHLKYVIIKFIRSFFENPNIELRFRPSFFPFTEPSAEVDIRMNKNDKWLEVLGCG
FT                   MVHPNVLKNVGIDRSEYQGFAFGLGVERFAMLKYNIKDLRRFFEGDIRWLKHYNFESFD
FT                   IPNLAGGLTK"
FT   gene            514133..516580
FT                   /gene="pheT"
FT                   /locus_tag="RT0404"
FT   CDS_pept        514133..516580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="RT0404"
FT                   /product="Phenylalanine translase"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:RT0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03881"
FT                   /db_xref="GOA:Q68WW1"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WW1"
FT                   /protein_id="AAU03881.1"
FT                   /translation="MKFTLSWLKQFLEISASVTEIAEALTDIGLEVEEVIDKATELQKF
FT                   EVAYIRNIKPHPSADKLKLCDVETKNGILQIVCGASNVRADIKVVLANIGIEIPKGNFK
FT                   IKESIIRGEKSYGMLCSEEELLLSSDSNGIIELPEYAVVGDNFTRYYGLDDPIFVINVT
FT                   PNRGDVLGVYGIARDLSAKGLGTLKKLELPEIKSTFFSKIKLNVHDKAACPLFTFREIR
FT                   NLKNKPSPSWLQQLLKNVGIKTISSLVDITNYIAYSFGQPIHVYDADRIYGALSVGRDC
FT                   NCKVISYKNHEIATAVLKSSNDTANFYAINGKEYLLTENDLTIKDESGIQGLAGIICGA
FT                   KSSCNDSTINVILEAACFNARLVAASGRRLKIDTESRYRNERNIDRNFTEKALDIATNL
FT                   ILSICGNCEVSEVVKVGEQELQKIPLDFSVYFLEKITGIKLSIKEIEVILNKLGFITDV
FT                   KGDIIKVIAPSWRHDINILEDIAEEIVRIYGYDKIESIKLPELHQDNNNLREYKRISSF
FT                   KRILASQGYDEVVTNSFMSSEDAKLFAELKEELFLLNPMSIDENYMRPTVLPNLISIVS
FT                   KNLARAIKDMAFFEVGPSFINLNTELTYLTAIISGSFNNKNPHSLGRSYDIFDIKGALE
FT                   QVIEYAGLSLDKCIVANETVLPQYYHPTRAINIRLGKNLLGHFGQIHPKILKYYDINQE
FT                   IFAFELNITNLPLIKAKFGKRNELKVSDFQANFRDYSFIVNQDHRVGEIISYINNFNKN
FT                   LVKSVMLFDIYSGDKLPEGKKSISIKIELQADDRTLSETDLNAFSQDLVESISQKFQGT
FT                   LRE"
FT   gene            516585..517730
FT                   /gene="dnaN"
FT                   /locus_tag="RT0405"
FT   CDS_pept        516585..517730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="RT0405"
FT                   /product="DNA nucleotidyltransferase (DNA-directed)"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:RT0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03882"
FT                   /db_xref="GOA:Q68WW0"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="PDB:6D46"
FT                   /db_xref="PDB:6DJK"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WW0"
FT                   /protein_id="AAU03882.1"
FT                   /translation="MLKLIVETKTLVQSLGFARSVVEKRNVIPEYANIKLSAKDGNLEL
FT                   SSTNMDLYLSQKIAVQVLSEGEITVSTQTLSDIVRKLPDSELTLTELDIMKLEIKGQNC
FT                   QFNLFTLPVSSFPAMDSIKPEVSFKISCADFAKIIESTKFSISLDETRYNLNGIYLHIK
FT                   DKEFFAASTDGHRLSISWITLEEKIKNFGVILPQKSAEEILKIVKDLKNIHEDIEILLS
FT                   SNKIKFICNENTILLSKLIDGTFPDYSAFIPKSSISKLVINRKIFADSIERIAIITVEK
FT                   FRAIKLSLSRKTLEISAVGEARGNAKEIITASQDKESFYEYNCDESLVIGFNPQYLEDV
FT                   LKAVKSNLVELYFSDISASAPVLIKFPQNPKDIFVIMPVKV"
FT   gene            518076..518576
FT                   /locus_tag="RT0406"
FT   CDS_pept        518076..518576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0406"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03883"
FT                   /db_xref="InterPro:IPR021959"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WV9"
FT                   /protein_id="AAU03883.1"
FT                   /translation="MKKIIGLFVIILLVINISILAYDYPKAEQEQKWDEVGSIAGESGL
FT                   VFRPGRVKNESTKAVGGTVNKYLWQAALEIISFIPLASVDSNGGVIITEWYSPRSNTNF
FT                   RFKINIFIKDDVISPDAIEVKIFEEMLKNKQWILNENTSNFAIMLEDKILRKARGIYIN
FT                   SVR"
FT   gene            518641..521127
FT                   /gene="leuS"
FT                   /locus_tag="RT0407"
FT   CDS_pept        518641..521127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="RT0407"
FT                   /product="Leucine translase"
FT                   /EC_number="6.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:RT0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03884"
FT                   /db_xref="GOA:Q68WV8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WV8"
FT                   /protein_id="AAU03884.1"
FT                   /translation="MHKIEQKWQKIWKEEKAFQVSNDSSKPKYYVLEMLPYPSGKIHIG
FT                   HIRNYSIGDVIARFMTMQGFNVLHPMGWDAFGLPAENAAIQNNSRPQDWTYSNIEYMKK
FT                   QLQSMGFSYDWTREINSCDPQYYKHEQKFFLELYDRDLVYQKESLVNWDPVDNTVLANE
FT                   QVVNGRGWRSGAIIEKRYLNQWFLKITNYAEELLNEIQNLKDWPEAVRVMQEEWIGKST
FT                   GVNFHFKIKYHENSTIEVFSTKPETIFGASFIGIAFNHPIIEQLIFKTDEIANFITKCS
FT                   YITKSSELEKSEKEGVFTGLYVIHPFDANIILPVIITNFVLMDYGTGAIFGCPAHDKRD
FT                   HELAMKMNLPIKKVIGTDNTQEEVLINSDWLNGLTSSEAKQKVISKFETLGIGKRSVNY
FT                   RLKDWGISRQRFWGCPIPIIYCETCGIVPVPYKDLPVTLPDDVSFDNNYNPLEHHPSWK
FT                   HVNCPKCDNHAIRETDTFDTFFESSWYFTRYCNNNAVEMTDSKACNYWLPVDKYIGGIE
FT                   HAVMHLLYARFFTKLMNEHHYVSIREPFKGLFTQGMVLHATYKDENNNWLYPAEVVKNG
FT                   NEFFHKETNTRVVQGRIEKMSKSKKNIIDLETIQEQYSADAIRLFVLSDSPPEKDLQWS
FT                   ASGIEGCSRFIHKLDNMFEVISSLKDDMNNEINTELNRLIHFTIKHVADDIKTFSLNRA
FT                   IARMRTLTNAIYCEISKDKIDVRTIKYGFNVLIQLLNPFIPHITEEIWQKLGNKERLYK
FT                   SVFAEFDDSMLEFSTYIMAVQVNGKLRDTYEFNTDISEDEVKQITVNLPKIQKFLAGKE
FT                   PNKIILVPRKIVNIII"
FT   gene            complement(521384..521995)
FT                   /gene="rnd1"
FT                   /locus_tag="RT0408"
FT   CDS_pept        complement(521384..521995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnd1"
FT                   /locus_tag="RT0408"
FT                   /product="ribonuclease D"
FT                   /db_xref="EnsemblGenomes-Gn:RT0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03885"
FT                   /db_xref="GOA:Q68WV7"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WV7"
FT                   /protein_id="AAU03885.1"
FT                   /translation="MNIKIYQNDLPNNFKLEGDIAVDTETMGLNIHRDKLCLLQFSNGN
FT                   GAAHLVHFINQDYTAPNLKALLLDKTRCKIFHFARFDLASIKKYLSIDLENIFCTKISS
FT                   KLVRTYTDSHGLKDLCRELLNINISKQQQSSYWGTDNLSLEQKEYAAKDVLYLHQLKDI
FT                   LQKMLFRENRLELAHEIFRFLPTRVNLDLIGWDQIDIFTH"
FT   gene            complement(522133..522456)
FT                   /locus_tag="RT0409"
FT   CDS_pept        complement(522133..522456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0409"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03886"
FT                   /db_xref="GOA:Q68WV6"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WV6"
FT                   /protein_id="AAU03886.1"
FT                   /translation="MIIHFNKHSKKIILNIFLALLLVYFIFHCIYGNKGIIAYLKVNRQ
FT                   LEKAYDELKILRAKRVELEHNVKLLRTESLNKDMLEEQVKKILGIAAPNEQVFTIKDIA
FT                   NQR"
FT   gene            complement(522453..523139)
FT                   /gene="cdsA"
FT                   /locus_tag="RT0410"
FT   CDS_pept        complement(522453..523139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="RT0410"
FT                   /product="CDP-diacylglycerol synthase"
FT                   /EC_number="2.7.7.41"
FT                   /db_xref="EnsemblGenomes-Gn:RT0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03887"
FT                   /db_xref="GOA:Q68WV5"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WV5"
FT                   /protein_id="AAU03887.1"
FT                   /translation="MITQKEKEHLAKDKQNIYLRIISGIVLVSLFVVAILWFKTLFYIL
FT                   MILVGLGMLSEWCNMTSSSIHYLLIGFIIIPIPISLLIFLSTQESNRLVIMLYFCIIWS
FT                   VDTFAMIGGKTFKGTKLAPKISPKKTWTGLIIGTISAGLIAVLVSLIPYYHIENYYFSN
FT                   KIYLFIISCILALIAQSSDLFISYFKRKFNIKDSGHIIPGHGGVLDRFDSIILTAPVFF
FT                   GINIYL"
FT   gene            complement(523099..523779)
FT                   /gene="uppS"
FT                   /locus_tag="RT0411"
FT   CDS_pept        complement(523099..523779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppS"
FT                   /locus_tag="RT0411"
FT                   /product="Bactoprenyl-diphosphate synthase"
FT                   /EC_number="2.5.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:RT0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03888"
FT                   /db_xref="GOA:Q68WV4"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WV4"
FT                   /protein_id="AAU03888.1"
FT                   /translation="MTTIKHLAIIMDGNARWADQHNLTKSEGHKAGADKIRELLPEFIN
FT                   LNIPYITLYTFSSENWQRSSSEVNFLIKLLSLYLKNELDSLHENGVKIKVIGRLNLLRS
FT                   SLQKQINNAIELTQNNNKIKLCIAFSYGSRQEIVDACTKIIANGKKQVSENDIQHALYD
FT                   PEMPDVDLLIRSGGVYRISNFLLWQAAYAELYFSQKYWPDFNKDDIHEAINDYSKRKRT
FT                   FGKR"
FT   gene            complement(523930..525240)
FT                   /gene="envZ"
FT                   /locus_tag="RT0412"
FT   CDS_pept        complement(523930..525240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="envZ"
FT                   /locus_tag="RT0412"
FT                   /product="osmolarity sensor protein EnvZ"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03889"
FT                   /db_xref="GOA:Q68WV3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WV3"
FT                   /protein_id="AAU03889.1"
FT                   /translation="MAMHFISKLLPKTLFIRFMFIIIIPILIGQIVAIFLFYDRHWYNV
FT                   SYYTSTIIINEIESLIKEHKNNSRESTHLLENYLNLSYQFQFNKKLSIKQSKLSEPLTI
FT                   FKNILATKIYEKNIVKLNKENKIEVFLELKDGILYITFPAKLLLNPTVYIFVLWIISLT
FT                   IILLSVSIIFSKNQIKSILTLADSMDKFGRGILKSNNFKPSGALEIRNAGLAFLKMKAR
FT                   IEKQINKRTNMLAMISHDLRTPLTRMKLQLELMEENEAIKGFKQDILTMQQMINSYLDF
FT                   AKGESTEEFEEILLLPWIEHLLNKWPHINIEFIKSTNLNKLAVLMKPNSFERALSNLIG
FT                   NAIKYGTKIEISVKNNQSTVTIIIEDNGIGIDDMEKHLVFKPFYRSDKARQLDNSSNVG
FT                   LGLAITKEIINNHKGCIYLEDSKNLGGLLVRIEIPKI"
FT   gene            complement(525218..525886)
FT                   /gene="ompR"
FT                   /locus_tag="RT0413"
FT   CDS_pept        complement(525218..525886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompR"
FT                   /locus_tag="RT0413"
FT                   /product="response regulator protein OmpR"
FT                   /db_xref="EnsemblGenomes-Gn:RT0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03890"
FT                   /db_xref="GOA:Q68WV2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WV2"
FT                   /protein_id="AAU03890.1"
FT                   /translation="MQPHILIVDDDSRILALLKQFLNKNNFLVSTANSVIEAKNLLKTS
FT                   NYDLIILDVMLPEITGLDFATTIRDAGNTIPIVMLTALSEANERVKGLEAGASDYITKP
FT                   FEPRELLLRINNLINNYNFKKATNIIKFGNNLYNCTTKEFTKNNQIVSLSSTEQKLLEI
FT                   LIKNSGKSTSRFELSKIMGGLSMRSIDVQITRIRSKIEDNPKEPKYLKTVRNDGYALYI
FT                   "
FT   gene            526015..526881
FT                   /gene="ilvE"
FT                   /locus_tag="RT0414"
FT   CDS_pept        526015..526881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="RT0414"
FT                   /product="Branched-chain amino acid aminotransferase"
FT                   /EC_number="2.6.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:RT0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03891"
FT                   /db_xref="GOA:Q9AKE5"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9AKE5"
FT                   /protein_id="AAU03891.1"
FT                   /translation="MIKLEQICRYVWINGDLIPYQFARIHVLTHSLHYSGSVFEGERAY
FT                   NGKVFKLKEHTERLIQSAEALGLKVPYSVDEIIKAHEFLITHNNIKDAYIRPLIWCGDE
FT                   SLNITNPALSTNFLIASIPSMPMSCEQGVNLHVSRWRKAMPDSTPVQSKSAAQYNMAIT
FT                   SKKEAKALGYDDALLLDYEGFIAECTTTNIFFVKDTTLYTPIADRFLNGITRKTIIEIA
FT                   KNLCLEVKEERLKLAQIEYFTGCFVTGTAIEVQNISSIDLGDKKILFEDCKIADLLKKE
FT                   YLRIVRG"
FT   gene            527113..527997
FT                   /gene="dapA"
FT                   /locus_tag="RT0415"
FT   CDS_pept        527113..527997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="RT0415"
FT                   /product="DHDPS"
FT                   /EC_number="4.3.3.7"
FT                   /db_xref="EnsemblGenomes-Gn:RT0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03892"
FT                   /db_xref="GOA:Q9AKE4"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9AKE4"
FT                   /protein_id="AAU03892.1"
FT                   /translation="MYNIFKGLITALITPFKNNKLDLYAFESILNQQIKHEVDAVLIAG
FT                   STGEANSLSFEEYKLLLKTSVEIVNNRMPIISGCSSNNTAYAIELAIASKKIGVDGFMA
FT                   SPPSYVKPTQHGIYKHFEALHEACNLPIMLYSAPTRSGVDFSDETILRLSKLPRILALK
FT                   DCGVDLERPMRIRAIVKEDFNILTGNDEVVLAFHAQGVIGWISVTSNIAPKICKELLDK
FT                   WYNNDIQGALEMHQKLLPLYKALFLESNPIPVKYAAHYLGLCENEIRLPLTEASDSAKK
FT                   QIKKIITSLSIKI"
FT   gene            527994..528452
FT                   /gene="smpB"
FT                   /locus_tag="RT0416"
FT   CDS_pept        527994..528452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="RT0416"
FT                   /product="tmRNA-binding protein SmpB"
FT                   /db_xref="EnsemblGenomes-Gn:RT0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03893"
FT                   /db_xref="GOA:Q9AKE3"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9AKE3"
FT                   /protein_id="AAU03893.1"
FT                   /translation="MTEYKKVIAQNKKAIFNYFIEEILEAGIVLKGSEVQSLRQGKASI
FT                   DESYASDNGHEVFLYNCHITEYEKANRFNHSTRRPRKLLLHTKEIKKIIGKIRIKGYTL
FT                   VALSMYFNKNNKVKVELGIAKGKKLYDKRATIKEKDWKKDQSRLIRQK"
FT   gene            528597..529397
FT                   /locus_tag="RT0417"
FT   CDS_pept        528597..529397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0417"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03894"
FT                   /db_xref="GOA:Q68WU8"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041205"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WU8"
FT                   /protein_id="AAU03894.1"
FT                   /translation="MKHIIGKILVIFVVIIGVLFVVKTIKTYSTNSIFVEVKQSEDAKK
FT                   CEEARIQEIIKDYLLKTPEIIIESIEGLQKRKIHENETKINNYLKANKSTIENSANFPV
FT                   IGNQNGDITIIAFYDYNCSFCKKGDISINELLQNDQKVKVVLRPLPILGDASEYLARIV
FT                   LAVYKVNPNKFKVIHDALIKIRTASQESIKELLIEHGLNSTEIEKIADSNEIKDLITQN
FT                   IKIARSLRMQGVPTYIIDSKLIHGLIDLPQLLNLVKEIMDNKFS"
FT   gene            complement(529419..529619)
FT                   /locus_tag="RT0418"
FT   CDS_pept        complement(529419..529619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0418"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03895"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WU7"
FT                   /protein_id="AAU03895.1"
FT                   /translation="MLGQARGNFYKRFIMHNPRITKFKFSNNFIYLLNINIICLDGDPY
FT                   WITGLHRLSFTSLSGKKTQYF"
FT   gene            complement(529897..530775)
FT                   /gene="sucD"
FT                   /locus_tag="RT0419"
FT   CDS_pept        complement(529897..530775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucD"
FT                   /locus_tag="RT0419"
FT                   /product="Succinate thiokinase"
FT                   /EC_number="6.2.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:RT0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03896"
FT                   /db_xref="GOA:Q9AKE1"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9AKE1"
FT                   /protein_id="AAU03896.1"
FT                   /translation="MAILINKKTKVICQGFTGSQGTFHSEQAIAYGTNMVGGVTPGKGG
FT                   HTHLNLPVYNTVHEAKAKTDANASVIYVPPGFAADSILEAIDAKIEVVVCITEGIPVLD
FT                   MVKVKRALIGSKTRLIGPNCPGVITPGECKIGIMPGHIHKTGIIGIVSRSGTLTYEAVA
FT                   QTTAVGLGQSTCIGIGGDPVNGTSFVECIEMFLQDDETKAIIMIGEIGGNAEEDAADFI
FT                   KQSKIKKPIVSFIAGITAPSDKRMGHAGAIISGGKGSAKDKLEALQSAGVTITKSPADI
FT                   GKTMLDLLNKI"
FT   gene            complement(530913..532073)
FT                   /gene="sucC"
FT                   /locus_tag="RT0420"
FT   CDS_pept        complement(530913..532073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucC"
FT                   /locus_tag="RT0420"
FT                   /product="Succinate thiokinase"
FT                   /EC_number="6.2.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:RT0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03897"
FT                   /db_xref="GOA:Q68WU5"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WU5"
FT                   /protein_id="AAU03897.1"
FT                   /translation="MNIHEYQAKEILRKYGVPTSTGLVVTKTEKINEAIDKLNTKVYVV
FT                   KAQIHAGGRGKAGGVKVVKSKEEAKKVAHDMFGINLVTHQTGPQGQKVNHLYIESGCDI
FT                   LKEYYFSIVFDRSASCITFIASTEGGVDIEAVAEKMPEKIIKFAVDPATGLQDFHMRGI
FT                   AYGLGFKDSQAKQMKEIVKSVYNAFIETDATQIEINPLIINSYKNLLALDAKITFDDNG
FT                   LFKHPNITAMRDHDEEDPLETRAANAGLSYVKMDGNIGCMVNGAGLAMATMDIIKLYGA
FT                   SPANFLDVGGGADRERVKEALKIILSDKEVKGILVNIFGGIMRCDIIAEGIIAAARDIG
FT                   ITVPLVVRLAGTNVEKGKEILSNSNLKIIPAHDLADAANKIVEAIR"
FT   gene            complement(532224..532862)
FT                   /locus_tag="RT0421"
FT   CDS_pept        complement(532224..532862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0421"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03898"
FT                   /db_xref="GOA:Q68WU4"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WU4"
FT                   /protein_id="AAU03898.1"
FT                   /translation="MSPQIIELLIFAIIAFYIINKLITTLGSTSEEEQIKNKSYFGEPM
FT                   IKDVTYSTVKANKIAEKNISRVQDIKVFKDIIVEHNINAVVDGMEQIHKRLYSFDPVKF
FT                   INNAKTAFQMIIEAAYKKDIKELTELIDKRYLEEFEKITPSYGDFFDSSALSAKYSEIY
FT                   MFGNNIFIKLLFQGKNVVDKIENLQEEWTFTRNANTKEVDWFLSNIERV"
FT   gene            complement(533157..533540)
FT                   /gene="rbfA"
FT                   /locus_tag="RT0422"
FT   CDS_pept        complement(533157..533540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="RT0422"
FT                   /product="ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:RT0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03899"
FT                   /db_xref="GOA:Q68WU3"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WU3"
FT                   /protein_id="AAU03899.1"
FT                   /translation="MKKLTKTNSHRQQKLASIINEVLIEILKRGKMLDRRLFDCPLTIT
FT                   KIVVTADLKIANCYFFPFNTKLTFNDIMDALNNSKHAIRNFITNKINMKFSPEIRFHYD
FT                   YGFDNAIKIEKLLKSSSLKDKTN"
FT   gene            complement(533544..533969)
FT                   /locus_tag="RT0423"
FT   CDS_pept        complement(533544..533969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0423"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03900"
FT                   /db_xref="GOA:Q68WU2"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WU2"
FT                   /protein_id="AAU03900.1"
FT                   /translation="MNQFEAYSLLFVDSFVSNLIIGFQNELIFHSMKMFVGYNRLIMLL
FT                   VAICSSLSGNTVNYIFGRIVLNIFYASKNEQNILRHKNLTKLYYKYEIFIIFLIYFPFW
FT                   GCFVALFSGFFKTKFLKFLSIGCFAKACYYALKIYIS"
FT   gene            534138..534659
FT                   /locus_tag="RT0424"
FT   CDS_pept        534138..534659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0424"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03901"
FT                   /db_xref="GOA:Q68WU1"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WU1"
FT                   /protein_id="AAU03901.1"
FT                   /translation="MKKQIIYPDFIARIFSTALDLSLIAFIAIPISQFCFFNLLWLFFN
FT                   DYFLSIKINIHNPNEMLNSVMSQEFYEYLKVGNFNKYIMFNISIFTTNILVICSYFITF
FT                   WYYKGTTLSKMFLRMKIVDAITLNRPTLKQLIKRFLAYMTFPIGIFFILFSSKKQALHD
FT                   RIAGTVVIKS"
FT   gene            534807..535406
FT                   /gene="recR"
FT                   /locus_tag="RT0425"
FT   CDS_pept        534807..535406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="RT0425"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:RT0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03902"
FT                   /db_xref="GOA:Q68WU0"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WU0"
FT                   /protein_id="AAU03902.1"
FT                   /translation="MNKTNDIDQLIYLFSKLPGLGIRSARRIVLYLLQDKDVRLKSLIN
FT                   HLIELDKKIVKCEICGNMDTKNICHICSSEHRDKSTIAIVETVAELCAMERSGNFKGLY
FT                   HVLGHNLSAASRQNPRILRLPELLKRCFVENIKEVIIATNSTLEGQTTAYFIIEYLKEH
FT                   PAKISRLASGIPIGGELDYLDEGTLSAAINLRQPCE"
FT   gene            535490..536665
FT                   /locus_tag="RT0426"
FT   CDS_pept        535490..536665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0426"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03903"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WT9"
FT                   /protein_id="AAU03903.1"
FT                   /translation="MQDFNVESRSVLHMTAQIRAKQLAIRDAQNREQNAIVKTWEENGV
FT                   DTSDEAVSNRIINSLEFFYNTSKALSDYLKTQDINNVGYPITFNKTALQLKMALNYAKQ
FT                   QEDNLIDQIIKGKFYNGLSNDINSQELPVLQSNNMLSFWGNENSSVSSVLLASIARILD
FT                   IEFVPLVGAATNYKFYNPEYTLPQELIPEDYYFASKEGMLLFGDYQYGGHRAFEEQLVF
FT                   GPEDCSSSVGKATYLSNQQTRSITTTQMKENYSKYNYKLITLLKDIVEQKQLELIEPGD
FT                   LYVYKNHCAIIATKPDNKAEVTTLQFSRNIDRVENKVSGGGICNYNLIDKAQEEPVNPI
FT                   YILRKNLEPLPSQSSLKYFLSTIDEGYLNLYPDGPSENVVGDCRMFFETQE"
FT   gene            complement(538134..538901)
FT                   /gene="ppnK"
FT                   /locus_tag="RT0427"
FT   CDS_pept        complement(538134..538901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppnK"
FT                   /locus_tag="RT0427"
FT                   /product="DPN kinase"
FT                   /EC_number="2.7.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:RT0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03904"
FT                   /db_xref="GOA:Q68WT8"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WT8"
FT                   /protein_id="AAU03904.1"
FT                   /translation="MNTNKIALIYNKNSKHLAIIEEIKKLFNYCKIEDAEVIIIIGGDG
FT                   ELLHNIHRYMHLNIPFYGLNLGSLGFLMNPLDTKKLLQNIYESTVSVLNPLLMQAEDTN
FT                   GQIYKALAINEVSIFRKTNQAAKFRIDINGVERMSELVADGALVATPAGSSAYNLSAGG
FT                   PILPLASNMLCLTPICSFRPRRWHGALLLSSATIKFEILNITKRPVNATADFQEFNNIT
FT                   RVTVKSTKDQHIKLLFNKNHTLEDRIIKEQFGE"
FT   gene            538987..540669
FT                   /locus_tag="RT0428"
FT   CDS_pept        538987..540669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0428"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03905"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WT7"
FT                   /protein_id="AAU03905.1"
FT                   /translation="MLSFNIKNHKNDLLFVPLGGSNEIGMNLNLYHYKGKWLMIDCGSG
FT                   FADDYLPGVDMIIADSSFIEKYKKDLVGLILTHAHEDHLGGVQYLWNSLKCPIYTTTFT
FT                   ANFLKIRLNEYDFAKNIKIHEVKPGSKINLEPFLLEMVPLTHSAPEMQAIMIRTDAGNI
FT                   LHTGDWKFDNDPILGEKVDEELLKSYGDEGVLALVCDSTNVFNKGSSGSEGDVRKSLID
FT                   IIAGCPQMVVVSTFASNLARLDTIMHAARLAGRKVVLTGRSLYRMIFAAQESGYFKDLA
FT                   PLISERDVSRFRRKELLVIATGCQGESMAATAKLASNSHPSIKLAPKDTMIFSAKIIPG
FT                   NEKKIFRLFNIFVKAGVEVMTERDHFVHVSGHPSIDELQKMYSLIRPNICIPVHGEPVH
FT                   IHEHVKLARKNGIEHAIEVENGSVVLLELNNAKVISKVENGYLAVDGNYLLPVESPIFK
FT                   IRRRMRDSGIVVASVVINKKGLLSANPILSMPGLLDPKEDIALVNLIKNDIKELIAIQN
FT                   QRVKKVLSDEQIIESIKSTIRKTLKQEINKSPVIIVNLEKTLE"
FT   gene            540772..541734
FT                   /gene="gpsA"
FT                   /locus_tag="RT0429"
FT   CDS_pept        540772..541734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="RT0429"
FT                   /product="NAD(P)H-dependent dihydroxyacetone-phosphate
FT                   reductase"
FT                   /EC_number="1.1.1.94"
FT                   /db_xref="EnsemblGenomes-Gn:RT0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03906"
FT                   /db_xref="GOA:Q68WT6"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WT6"
FT                   /protein_id="AAU03906.1"
FT                   /translation="MNKFKNIAVYGGGSFGTSLASVVARNCNNVTLFLRNETILKEILY
FT                   KKTNVQYLGDIKLPTNLQATTNLSVIKDFDLIIIAVPSYAFVDAIKLLKTYGISKDNTL
FT                   LVATKGFAHNPTELLSDRLNTLLPDNPIGFLSGPNLAKELAKNLHTSASIASLDIDIAN
FT                   KIAHNLSSKTFTTNTTIDIVTLQVAGALKNIFAIKSGIDLAREQGANSRAMLIVAALKE
FT                   ITTLSKVLGGMQKNSDILLEAGVVGDLVLTCYSLGSRNTKFGYEFEISMDKKKFLREYK
FT                   ELVEGREALKLVLDLIKKYNLHMPIVSEVASLIHCGIYI"
FT   gene            542365..543294
FT                   /locus_tag="RT0430"
FT   CDS_pept        542365..543294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03907"
FT                   /db_xref="GOA:Q68WT5"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WT5"
FT                   /protein_id="AAU03907.1"
FT                   /translation="MIIFSIVFFKTVSVLLSVVIGFLAGRYSNVEKDSISSLLFYFISP
FT                   IVFFTIPASTTLTLSALSVTVVTFVIATLLSLFSYYFFGKFWQDHTRNIIALSAGTANG
FT                   GYFMLPIAAALFDDYTLSIYMMAVIGINIYECSVGFYICMRSFTNTTDSILKVVKLPIL
FT                   NAFFLGCLFSFCGFTLPDFLDDFIYNMKGSFSILGMVMVGLALSSLQKFEVDIKFTLAT
FT                   FAAKFLFYPLGVGLFIMFDHFVTKWYNNDYYNALKLLSTAPLAANTIVIANLQKFYPEK
FT                   VAATVFLSLLFVVIYMPTMVSIFLSDLN"
FT   gene            543352..544224
FT                   /locus_tag="RT0431"
FT   CDS_pept        543352..544224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0431"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03908"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="PDB:4OSE"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WT4"
FT                   /protein_id="AAU03908.1"
FT                   /translation="MQINSIKIGPYINLLPLQYIPQHKISYVEFGDPKNKNIILCAHGL
FT                   TRNAHDFDKIAKELCKNYRIISINYPGRSDSENLKKPYHYNYTTYIKDTLLFFKRLNIK
FT                   NPIWLGTSMGGIIGMVLASKYKNIFKALILNDIGAFIDAAPLIKIGDYAKKTVLLDDLA
FT                   SAKEHLKLIYAQIGIKNEEDWDYLTKYSVISTFGGKYKMNYDPAITKGMQSDNNQEDVK
FT                   LWSVWNKIKCRILVIHGMKSQILTKSTIQKMKKTNTFDLYEIKYAGHAPSLMNDEEIYY
FT                   IESWLKQKS"
FT   gene            544357..545289
FT                   /gene="trxB1"
FT                   /locus_tag="RT0432"
FT   CDS_pept        544357..545289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB1"
FT                   /locus_tag="RT0432"
FT                   /product="NADP-thioredoxin reductase"
FT                   /EC_number="1.8.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:RT0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03909"
FT                   /db_xref="GOA:Q68WT3"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WT3"
FT                   /protein_id="AAU03909.1"
FT                   /translation="MKITTKVLIIGSGPAGLSAAIYTARSSLKPILINGMQPGGQLTMT
FT                   TDVENYPGFAKTIQGPWLMEQMSIQAKNVGTEIINDYVERVDLSKRPFKIFTGTGNKYE
FT                   ADSIIICTGAESKWLGITSEQEFRGFGVSSCAICDGFFFKNQDIVVVGGGNSALEEALY
FT                   LTNHANKVTVVHRRNSFRAEKILQDRLFKNPKISVIWDHVIDEIVGSNQPKTVTGVKIK
FT                   NVYTNEINLVNCSGVFIAIGHTPNTTLFNGQIAIDDDNYIITQTGSTRTSVEGVFAAGD
FT                   VQDKIYRQAITAAASGCMAALEVAKFLNK"
FT   gene            546736..547578
FT                   /locus_tag="RT0433"
FT   CDS_pept        546736..547578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0433"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RT0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03910"
FT                   /db_xref="GOA:Q68WT2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WT2"
FT                   /protein_id="AAU03910.1"
FT                   /translation="MHTNYSISIVLTVYNREKLLPFAIESCLNQSFKDFELIIIDDCSK
FT                   DNSAMIAKKYAEQDSRIKIIINEHNKRLSASLNIAFKKANGKYFTWTSDDNLFHEDALA
FT                   KMVKILDNSPEIGLVYTDYTLIDEQGNIGARLYQESPKFLPIRDCVGACFLYRADLAKQ
FT                   VGGYNENMALVDDYEYWLRLGLITKFAHIPESLYFYRAHDQSLTIQRKVEAKIAKRTLK
FT                   KLFQDKYIIPDEIKPINDLYNWFIEDRNLISCFRLLKIIIYNPIITISYIIKNLRRIR"
FT   gene            547599..549575
FT                   /gene="uvrD"
FT                   /locus_tag="RT0434"
FT   CDS_pept        547599..549575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /locus_tag="RT0434"
FT                   /product="DNA helicase II"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03911"
FT                   /db_xref="GOA:Q68WT1"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005751"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WT1"
FT                   /protein_id="AAU03911.1"
FT                   /translation="MKDKMQNQNFMHTLNSEQKKAALHTEGPLLLLAGAGTGKTKVLTS
FT                   RIANIIQQNLALPHNILAVTFTNKAAKEMSERVHNLINCYGVNIGTFHSMAAKILRDQI
FT                   ENLNLGLNNKFTIISHDDQLTLVKDIVKLKKDIDTKKYTPKLIHIIISRWKDQGLLPSK
FT                   LSASDTNLPLQRVAKLIYEEYQKNLLISNVLDFGDLLLYNNELFIKNPEILKYYQEKYR
FT                   YILIDEYQDTNIAQYLWARMLASLYRNICCVGDDDQSIYGWRGAEVGNILRFEKDFAGA
FT                   TIIKLEQNYRSTLPILAAASNVINNNKNRHSKTLWTDSASGEKIKIISCLSDKEEARYI
FT                   ACEIDKLVREERYHAGNIAILVRAGFQTRSFEEAFINSAMPYKIIGGLRFYERMEIRDV
FT                   LAYIRISLNQNDNLALERIINVPKRAIGAASLNKIRSYALERNISNFVAIKEILETGIF
FT                   KAKSYESLKDLLTKIDNWYEKFITDTPINVVKTILDDSGYLSMLQEEKTEEAFGRIENI
FT                   NEMLRAIAEFNDIHDFIEHSSLVMENEVLETNYGGSVTIMTLHAAKGLEFDVVFLPGWE
FT                   EGVFPSQRSLDEDGEKGLEEERRIAYVGITRAKKDLYITHAESRKIFYEIVHSCPSRFI
FT                   NEIPDEITIRTSSMKKYNSFYKF"
FT   gene            550679..552044
FT                   /locus_tag="RT0435"
FT   CDS_pept        join(550679..551433,551435..552044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="RT0435"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03912"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WT0"
FT                   /protein_id="AAU03912.1"
FT                   /translation="MSAIITNINDSIQKMKKNDEMTELSAAVQGKIIDIKNVDSRLDTL
FT                   NKNIVILDPIQQYLQSEEYITSTLEVLASNIISEVVENKDVQKLVDNLHINLGQVTKLM
FT                   PSAADKFKFDIARAEAALKGFVLPLNDGGNFDELSLMGIEDKEEIFAGPISATKKALIA
FT                   ISGNAIPKEQYANAVKDKAIEILQQDPKNTPEKLEKYEKFIIQGDKNQKFNKDSNQFIP
FT                   RVNKLSQVEFKALQNAATDTVHKISARLEKNNEISKQLEQIVLITNSSGIKKSEVIINK
FT                   LNKLDSTYLKENSTKIATALKDINNKGSSLWEKFKQIFTGKNYLEERLSKFVDKHITLS
FT                   DGYVVKTINDKIFSNALTNPEIAVGLTQFLNQNKDKVTTNPEFKNLIPVTGEHIIIQPQ
FT                   QVQNLNLAQLRKINPITFDRTIFEDSIKLRNSNIKYPQTTPHTATKNQEAVRSKG"
FT   gene            complement(552180..553181)
FT                   /gene="tdcB"
FT                   /locus_tag="RT0436"
FT   CDS_pept        complement(552180..553181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdcB"
FT                   /locus_tag="RT0436"
FT                   /product="L-serine dehydratase"
FT                   /EC_number="4.3.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:RT0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03913"
FT                   /db_xref="GOA:Q68WS9"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WS9"
FT                   /protein_id="AAU03913.1"
FT                   /translation="MNLLLQSPQNVAIAHNRIKQYINLTPIIHSESLNEMLGHEIFFKV
FT                   ESLQKTGAFKVRGVLNNLLELKEQEKLPNKIVCYSSGNHGIGLAYSSKLFGIKTRIYLP
FT                   LNTSKVKLQAALYYGCEVIYTNTRQEAESRAKEDEEQGFYYMHPSDSDSIIAGAGTLCY
FT                   EALQQLDFIPDAIFASCGGGGLISGSYLAKELISPTSLLIGSEPAAANDAYLSIKNNNI
FT                   YRFNDTPITIADGLKTLSVSARTFEYLKKLDHFYLAEEYEIYYWTAWLIHLLKVICEPS
FT                   SSINMVSVISWLKTQTRTQKLLVLISGGNIDPTLYNELWQDDYLTVPPSISN"
FT   gene            553281..555635
FT                   /gene="lon"
FT                   /locus_tag="RT0437"
FT   CDS_pept        553281..555635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon"
FT                   /locus_tag="RT0437"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /db_xref="EnsemblGenomes-Gn:RT0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03914"
FT                   /db_xref="GOA:Q68WS8"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WS8"
FT                   /protein_id="AAU03914.1"
FT                   /translation="MNKKSLPLMALRDMVLFPGVIAPIFVGRKKSLQALSRTTISEENN
FT                   TKYILVTLQKKFDQENPSKHELYNTAILAKIIQIVKLPNNTAKILIEAVARVKLSDIKD
FT                   EESFEANYEIIPDEEILDMHNMRSLVDNAVQLFNKYAMNDKKVNTEIIETINKEISNKT
FT                   NFINIINILASHLITSLETKQQLLEETSPVKRITTVITTLTSNIVNSETEHALQQRVRK
FT                   QIEKTQRDYYLHEQMKAIQKELDEDKSELADIEKKIKSLKLSKEAKEKAESEFKKLRAM
FT                   NQMSAESGVTRNYLETLLSLPWGKYDNSKIDINQAEKILNRDHFGLEKVKERIIEYLAV
FT                   LQRSNKIRGPILCLIGPPGVGKTSLVKSIAEGMGRKYAKFSLGGVRDEAEIRGHRKTYL
FT                   GSMPGKILGQLKKVKTSNPVMLLDEIDKMSSDFRGDPASALLEVLDPEQNSHFVDHYLE
FT                   VEYDLSNVVFIATANSHDLPRALSDRMEKIYISGYVEEEKLQIAKNYLVPKQFKVHKIK
FT                   KDEITISEDAILDLIRYYTKESGVRALEREICALTRKALKQILADNTVKNISIDSNNLE
FT                   EFLGAKKYNFGLVEKEDQIGSTTGLAYTEVGGELLTIEALAFSGKGEIKTTGKLGDVMK
FT                   ESAMAAYSCFRSRAPNFGLKYDNYKDFDIHIHVPAGAIPKDGPSAGCALFTTIVSLMTK
FT                   IPVHRTVAMTGEITLRGNVLPIGGLKEKLLAASRGGIKTVLIPEENVKDLKDIPPNIKE
FT                   NLEIISVSNIDQVLKHALVEMPINKGLSYDL"
FT   gene            556234..563229
FT                   /gene="sca3"
FT                   /locus_tag="RT0438"
FT   CDS_pept        556234..563229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sca3"
FT                   /locus_tag="RT0438"
FT                   /product="cell surface antigen Sca3"
FT                   /db_xref="EnsemblGenomes-Gn:RT0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03915"
FT                   /db_xref="GOA:Q68WS7"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WS7"
FT                   /protein_id="AAU03915.1"
FT                   /translation="MKKSKILRKFLATASLCGTLFTNSNATGAIIPNSGSVSLNTGAGL
FT                   VGGVFQNGDIIQIVNGGREIKISADKANAVIGGISALRELPDFGGVEVSQNVSIGPLSA
FT                   GENLNTNFGPLKFISNNVTSIITGVDTQTFSNIDFAGKNATLQINKDLNITTKIDNTVA
FT                   GNNGTITFEGSGVISNHIGFTNSLLGINVGNGEAKIDASRANNITINAKNINLTHNNSI
FT                   FTLCDCNITTLKGNINNTTGIDGQGILNLAYDPDSSNIITGDICNIGSLDTINVLRGSA
FT                   TLNSTIVKATNINLQHDTATLNLGDNIIVIGNIKGINNEEERLNLKVNDQIDNEMIIPI
FT                   NKGMSGKLNLQGNATLNGNIDNLRILKFSGGHDKILNLQGNTEVEHIIFEDSILNSGTI
FT                   TVNGLLNTHVVTFNKSNANGGTLIINAKNTISASLLNAIKAKIQINANLTINHPSAGHI
FT                   GDIRIADNTTYTINADIGHVNLLQNGAKIMFEGADAMLALINTSFTDRTFTIYNNLNQS
FT                   GNDEYGIVKIEAITKGITISNHSEPYTIGQDNTHRLKELIVEGGGNIIVDNTVFTKLLS
FT                   INSTGQITFNRTLDLGAGGNIAFGKNGTLVVHGVAGSITTSENNQGILTINSGNVTGTI
FT                   GANGLGLKLVNIGAGSVTCSANVFAPVALTNPSSILILADGVTLTGTVTTHNNTKGILS
FT                   LGIGSNVTGLIGENNATLEKINIGAGASNIDNNIYAGSMVLTDKTSELILNTNVVVNGN
FT                   ITTIAGNNSGKLVFTGNGDITGNIGANGAALQEVVFNGTTNIGGTANSQNFTVAHSEAN
FT                   VVITGLTTGSLKYKDTGTIIANGGLVGDIDFNNKAGKFILGDGTTIDGSVLCTGGIAGT
FT                   LHFIGDGNVTQNIGSDTENSISTINIQGDNTKNVTITNDIFVNNIYFTNGGVLQLGGNL
FT                   TTHNIDFGANGGTLEFNGNNTYNLNAIIVNGQNGILNAFTNLKATDDTIGTVKIINIGQ
FT                   IGTPQNFTIQVNNKNLTLVSNINSSINFCDSNSQLILSAPVDQTIKFINNLNGTGGGII
FT                   TLDGNGNNLTISGNNGIKLGSRDNELSSLNIKGKVTVTHNLDVQNIHQLNINNGAFFND
FT                   HSLTSAKIKNINIGEETGEATYTLDAINCDFDLNTSGMVFKHQDSVLELKNSSNTNDRI
FT                   ITLTSVLDPGNGQSGIIKLITDTNKLTIDNNGNVAYTLGTANHMLKQLTFTSINNGAIA
FT                   LKVGINVENITLNIKDIELNEVNANVLFNKNVTYTATGNINGHVDFQGNAGVINLDDGI
FT                   KIDGSVTSTNDVNGTLNLNGSGEVTGLITNIAMLQAGAGDVSLSASGNYSITEIQGNGN
FT                   NNLTFAANSHLTTDINKTDGQAVNLVFINGGSVSGSVGLSKAVGDIIIHAGNVTFNNTV
FT                   KSSNVVISDGSTMQVNNNITANDISGKNINNGTLKLNNHTPIIITSTLGHNNSIGTIEV
FT                   ANNDVTITGALKAQNIHFSNAAQETTLTLGAASQVTNITTAGNNIHTLEITDLDTGNDG
FT                   TIGTENNRLKSIELTGNGTITINSKHVYSSITTANNEQGNVKLNIEGGIAYDLGSEIRS
FT                   LANVQISEDSTVKGDVYSKYLNIDAGKTINFDRGDNNMNPKNLDIPDAIIDLDVLPRSL
FT                   SLFNYFTDIKADNLNFVDGTATANFKDAVVIDARIDNGGTLKFNNNVWLTQEIKNANSI
FT                   EIASNKFMLLQKNIKAATLIADKANLVLLDNVEINTNLNVRDIVLDLANYELKYTGNVT
FT                   HNGLLTIITYFDTALQKGGHILVGQGSNVDMSDLDNLIIKIKSRSDITNITSDTKHQVV
FT                   KLEAGAIYNPVPQTKVIIDASGEQNKFVKWVTDANGFVLLTNTDTIGQNNTDNGSLDNG
FT                   YVGNSSNNNSSNGVVGPSKDKDHGITDIAPIFDPSPILDYTKNNYVASSIANQLINHVK
FT                   GFGNTTDAGKLLNDLGFMLPNRVTETLDRLSHRTNINGLNEGVAGLNGIEIENFLTDIA
FT                   INMDNFTAEGIGNRLEELIDAGTVNGLNRTNASLNNNNLNLRRLAANNQTVIAAGDEDN
FT                   TVTGIWGMSFYSKIKQNSKNSASGYQSNTGGGIIGFDYNIDNSIVIGAAYTMADSKVKH
FT                   KNDKSGDKTKAKSNIYSIYGLYHWLNNNFFVEAIGVYGRNKIKNYEKRITAITDQTAIG
FT                   KFINTFYSYELLGGYNYLVSNRTTITPMFGIRYTTLKNNSYKENNTTFQNLSIKKNYHD
FT                   KFETILGLNGATHYLAQDIIIKPELHWFINYQYKNKLPNIDARLDGIDEPLTTIRFKSA
FT                   KITYNLGGGISTKNNMIEFGIRYNLSLAKKYTAHQGSLKIKVKL"
FT   gene            complement(563954..564982)
FT                   /gene="idi"
FT                   /locus_tag="RT0439"
FT   CDS_pept        complement(563954..564982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="idi"
FT                   /locus_tag="RT0439"
FT                   /product="IPP isomerase"
FT                   /EC_number="5.3.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:RT0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03916"
FT                   /db_xref="GOA:Q68WS6"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR011179"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WS6"
FT                   /protein_id="AAU03916.1"
FT                   /translation="MLEEQNSDIERKQDHIEINLKQNVNSTLKSGLASIKFIHNALPEI
FT                   NYDNIDTTTTFLGKYMKAPILISSMTGGTTRAKDINYRLAQAAQKSGIAMGLGSMRILL
FT                   TKPDTIKTFTVRHVAPDIPLLANIGAVQLNYGVTPKECQYLIDTIKADALILHLNVLHE
FT                   LTQPEGNRNWENLLPKIKEVINYLSVPVIIKEVGYGLSKQVAKKLIKVGVKVLDIAGSG
FT                   GTSWSQVEAYRAKNSMQNRIASSFINWGITTLDSLKMLREVSKDITLIASGGLQSGIDG
FT                   AKAIRMGANIFGLAGQLLKAADIAESLVSEEIQLIIEQLKITMLCTGSCTLKDLAKAEI
FT                   ML"
FT   gene            complement(566513..566600)
FT                   /gene="tRNA-Ser"
FT                   /locus_tag="RT0440"
FT   tRNA            complement(566513..566600)
FT                   /gene="tRNA-Ser"
FT                   /locus_tag="RT0440"
FT                   /product="tRNA-Ser"
FT                   /note="codon recognized: UCC"
FT   gene            complement(566819..567565)
FT                   /gene="glmU"
FT                   /locus_tag="RT0441"
FT   CDS_pept        complement(566819..567565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="RT0441"
FT                   /product="N-acetylglucosamine-1-phosphate
FT                   uridyltransferase"
FT                   /EC_number="2.7.7.23"
FT                   /db_xref="EnsemblGenomes-Gn:RT0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03917"
FT                   /db_xref="GOA:Q68WS5"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WS5"
FT                   /protein_id="AAU03917.1"
FT                   /translation="MLHNENYQIIILAAGKGTRMESDLPKVMHEVGGVPMLETVLKNAL
FT                   KITHDVIIVYSEALKKYLTPYENMCRFVLQEEPKGTAHATHAAIDLIDQNKIILVLYGD
FT                   HPLITPTLMYELIDYLSIINAALVTLSFERANPAQYGRIAIDKHGNFLEIIEYKNASEE
FT                   EKKIKLCNSGIMAFSSGILNKYLPLFANNNTNCNQEIYLTEIVKICKNHGEKVSYLLST
FT                   DHDLIVGINTQSELKEANNIFFQNKS"
FT   gene            complement(567565..568323)
FT                   /locus_tag="RT0442"
FT   CDS_pept        complement(567565..568323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0442"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03918"
FT                   /db_xref="GOA:Q68WS4"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WS4"
FT                   /protein_id="AAU03918.1"
FT                   /translation="MSGHSKFKNIQHRKGAQDKKKSKVFTKLIREIVTAVKTGASNVPE
FT                   NNPRLRKALNAARSQNLPKERIDKAINSANDASNTESYTEIRYEGYAPNGIAIIIEALT
FT                   DNKNRTASEVRSSFTKYGGILGETGSVNYLFNHCGVIQYPINIASNEDIFEAAIEAGGN
FT                   DIISNDFAHTIYTDIENFYKALGFLTDKYGIPEDSYIGWIPVNTIIIDDKEKAKKLLKL
FT                   IEVLEENDDVQRVFGNYMLSEDVYEIIQEE"
FT   gene            complement(568342..568467)
FT                   /gene="rpmJ"
FT                   /locus_tag="RT0443"
FT   CDS_pept        complement(568342..568467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="RT0443"
FT                   /product="50S ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:RT0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03919"
FT                   /db_xref="GOA:Q68WS3"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WS3"
FT                   /protein_id="AAU03919.1"
FT                   /translation="MKVVSSLKSLKKRDKDCQIVKRRGKIFVINKKNKRFRAKQG"
FT   gene            568744..569532
FT                   /locus_tag="RT0444"
FT   CDS_pept        568744..569532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0444"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03920"
FT                   /db_xref="GOA:Q68WS2"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WS2"
FT                   /protein_id="AAU03920.1"
FT                   /translation="MVRQYIISRKYTTIGYFLKHVVKLWDNIRRILLYFILLLLSFFLF
FT                   SNQIIADPEIAESFKCSKLFPYFEKKFNIPSNTLYSIALKESGKKHSTRKIKLVWPWTV
FT                   NVEGKGYYFNSKREAINFVRIALIKGQASIDVGCMQINLKHHLEAFNSLDQAFDPHNNI
FT                   RYGAAFLRSKYDQLGNWYKAIAHYHSANHSLGGKYKQDVIKIASNMELYKALLFSYRNN
FT                   NEGALADIMHVNNKVLKKTLFSSNKRYRSSIMIPIPAKMN"
FT   gene            569537..570028
FT                   /locus_tag="RT0445"
FT   CDS_pept        569537..570028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0445"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03921"
FT                   /db_xref="InterPro:IPR024386"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WS1"
FT                   /protein_id="AAU03921.1"
FT                   /translation="MNIKLVIYFLILVNSLKVNADLNHIQDSFEYQKEQLAIELPWSDC
FT                   TAIHKFLEEKLFFSEQQIKKENKIHEKYKQFYLQYNNKLSDFSMHFLDKNTEINGVETL
FT                   ISGFLKFCEDNFQTNKSKTNFLNFFQKQQDQWLHNIRNENYKTHYRKNMKIIPLEKLTN
FT                   "
FT   gene            571983..572663
FT                   /locus_tag="RT0446"
FT   CDS_pept        571983..572663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0446"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03922"
FT                   /db_xref="GOA:Q68WS0"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WS0"
FT                   /protein_id="AAU03922.1"
FT                   /translation="MIDKNFADILEISAKCGYLTNLLKNVYRSADIIVTDMSPLLLDSF
FT                   DHNNKLLIDDENLEFQKDSFDLIIYSLGLHWINDVQRFLYNIRTFLKSDGIFIGNFVGG
FT                   DSLKNLRKSLIDDEIASGFKHSPHISPFIRFDHVPMLLLHAGFSEVIVDYENIALKFEN
FT                   PLVLMREIKNIGESNALNSQHSYAISKKMFSLLKNYINVFEDNITLISFIAAPNKNSIR
FT                   LKLL"
FT   gene            572799..574178
FT                   /gene="pdhD1"
FT                   /locus_tag="RT0447"
FT   CDS_pept        572799..574178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhD1"
FT                   /locus_tag="RT0447"
FT                   /product="Diaphorase"
FT                   /EC_number="1.8.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:RT0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03923"
FT                   /db_xref="GOA:Q68WR9"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WR9"
FT                   /protein_id="AAU03923.1"
FT                   /translation="MQEFDLVVIGSGPAGYTGSIRAAQLGLKVACIEKNDTLGGTCLNI
FT                   GCIPSKALLNTSKKYEETLRYFENIGIIADTKLDLQKMLSNKDKIVLDLTKGIESLFVK
FT                   NKVTKIKGEAKIISNNIVEVNKEHIKASNILIATGSSVIGIPTVIIDEEFIVSSTGALK
FT                   LSKVPEHLIVVGGGYIGLELGSVWRRLGSKVTVIEYASSIVPMLDKEIAKQFMTIQQKQ
FT                   GIKFKLNTKVVASEVRSGKVNLTIEEADKRSIITSDVVLIAVGRKAYTKNLGFESIGIT
FT                   TDNQGRIEINEYFQTAVSNIYAVGDVVKGAMLAHKAEEEAIAAVEIIAGQAGHVNYNLI
FT                   PSVIYTYPEVASVGATEQQLQEQGIHYKVGKFPFLANSRARAIGSTEGMVKILADSKTD
FT                   RVLGAHIIGSDAGTLIAELIAYMEFGASTEDIARTCHAHPTLSEAIKEAALSVDKRTIN
FT                   I"
FT   gene            574305..574826
FT                   /locus_tag="RT0448"
FT   CDS_pept        574305..574826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0448"
FT                   /product="5,10-methenyltetrahydrofolate synthetase"
FT                   /EC_number="6.3.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:RT0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03924"
FT                   /db_xref="GOA:Q68WR8"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WR8"
FT                   /protein_id="AAU03924.1"
FT                   /translation="MTKQELRLYFKDLLIKKQDKINSDLVKDALITKISWLLKKLRVNT
FT                   VGIYYPLKYEINLLSMINLLPEINFYLPKIKNEIKYCAYNFNDALVLGKFKTYEPINNN
FT                   FIIPELIILPGLAFSKDGYRLGYGKGYFDQYLNNNHKNIFTVGVCLKEQLLDNFPIESH
FT                   DYKLDLLISV"
FT   gene            complement(574970..575815)
FT                   /gene="rnd2"
FT                   /locus_tag="RT0449"
FT   CDS_pept        complement(574970..575815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnd2"
FT                   /locus_tag="RT0449"
FT                   /product="ribonuclease D"
FT                   /db_xref="EnsemblGenomes-Gn:RT0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03925"
FT                   /db_xref="GOA:Q68WR7"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WR7"
FT                   /protein_id="AAU03925.1"
FT                   /translation="MQIIDKQKTLEEFCDRLAHHKSLSIDTEFERRYTYYAQLSIIQVK
FT                   AEGYCGIIDTLSNLDLNIFNKLLIDNNITKIFHAPREDLEIFYNLFKTLPSNIFDIQIA
FT                   ASICGFGQQLSYDNLCYKLIGITIDKTHQKSNWLKRPITSDMLNYAILDVEYLYKIYKE
FT                   LNNIIISNNLTNKYQHTLGTLLNVRNYKVELKDAWKKIRYKSDDKNFNRIIQILAAYRE
FT                   ENAQTINIPRQHFILDEDLIKLCKNNPLNYKDFKNLKLKSKYLHKQKYKDEIISLFNNL
FT                   "
FT   gene            complement(575827..576618)
FT                   /locus_tag="RT0450"
FT   CDS_pept        complement(575827..576618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03926"
FT                   /db_xref="InterPro:IPR003734"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WR6"
FT                   /protein_id="AAU03926.1"
FT                   /translation="MSDLVANLKKNGLEPQHFDDVLYIQKEINKDSDFIEVFFFPFGCV
FT                   TIWGGDEIQEKIILSNTDLVAVNKLKEHLSDYIYFEYNTDVEKTFIDEEKNKIILADKS
FT                   IFVKLSISHALAQSVKLSVLEQSVSNLIVQTTPIQQELARTGSVSLSKKEILQQIGILF
FT                   NERYSISLHSDIFDTPEFFWRRPNYEPLYLMTAEFQDIEIRQNIMNHRLNMIQELLDIL
FT                   SNDLNYKHSTKLEWIIIILIGLEVILSLSHTNLFLKIIGAL"
FT   gene            576730..577590
FT                   /locus_tag="RT0451"
FT   CDS_pept        576730..577590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0451"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03927"
FT                   /db_xref="GOA:Q68WR5"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WR5"
FT                   /protein_id="AAU03927.1"
FT                   /translation="MYEILSNRKIIKIIGLDSLMFLQKLITNDICNKRYCYTYLLNNQG
FT                   RYLFDFFVYVHHKEEIYIDIDKSNKTALIAHLNFYKLRSKIQIIDCSEEYKVIYSHQKL
FT                   DIDMLITVRDPRYAKLGFRSINKLDIITCTSNNVKDMESISSITSYRQSMNPIYLEDKY
FT                   NFAIIDGIEDLITNKSIPNMYGAEELNAISFEKGCYVGQEIISRTKYQGVIRRKIYRIT
FT                   AYEDLLSLVQDDVILANNEKIGVICSSYQNKGIALIMEKKYHDYKTYNITVKGIKINLS
FT                   LAPWY"
FT   gene            578846..581596
FT                   /locus_tag="RT0452"
FT   CDS_pept        578846..581596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0452"
FT                   /product="two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RT0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03928"
FT                   /db_xref="GOA:Q68WR4"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WR4"
FT                   /protein_id="AAU03928.1"
FT                   /translation="MPNIDLFILTSFLGINLLIGLLNIKNIKNNREYAVGERNFSTSAI
FT                   VATLIATWISTSIFLIDNSIIYQNGLFYLLPSIFGSIVSWLLMSYFIAPRCENILGSLS
FT                   VAEIIGAAYGNKVRILTAIVSILMSIGRIAMQFHVAGLILQLFFNISNFYINLCIATII
FT                   ISYSAFGGVKSVTFTKAVQFFTYSLIIPIIGIVIWNVLSDPYIVINSNVQNSLIDLQEL
FT                   FHCTSPKFWIALNIFIYFAIPSFSPSIFQSILIAKDTKQISRTFFISAVICLCWSIIFI
FT                   WITILLSQNSVIETNELFLRIIKSYIGFKGLIVGVVMAMIIASTNSYINVAAVTFTNDI
FT                   IKKTSLNYNYITAITIGLIGFIISLYTQDLINLFLLLTSIYFPLITLPLILLIYGFKST
FT                   TKSFFIGTIAAIFTIISWQIFSLRAVLGIYPMLPTTIVTLIFFLGRHYILKQPGGFSTL
FT                   KEPLSVKIIRQDRKRKFLTLFRAVKNFNIFKYWKSTLPNQEITYSYVGIFILISMFSSL
FT                   YTTSGSRIMNHLVIYNIIYHTTFIAAAILITYPLWSLKFKKKYIISFSWFIATFVILIF
FT                   FGSLLVILNDFDQLQLMYSVINSLIIATIFRWQATLLMTVTGVFASIEFYKYFIDEKLL
FT                   ISIDSFQFKVVYFLTLFSSLLIVFLKPRQDQEMLINLKNTHLGNRVNYREQELEKLLDL
FT                   KHEFLRNINHEINTPLTGIISLGETLWANYDKFNEDQRRNAVEIIAKSSIRLNSLINNI
FT                   LDFSKLSSLNYELNKNYINLSELLHERIKICKKLYLNGKILNFVSDIEENIIFNCDPHY
FT                   IQHTFDNLIINAISYSSEGTIKIDLQKQTDSILFMIKDDGIGVPKEELPNIFGVFVVSS
FT                   KTRTQAGGRGVGLALCKKVIELHSGKIWAENDKQGKTHFIVTMPL"
FT   gene            582670..583569
FT                   /gene="hemC"
FT                   /locus_tag="RT0453"
FT   CDS_pept        582670..583569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="RT0453"
FT                   /product="Porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:RT0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03929"
FT                   /db_xref="GOA:Q68WR3"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WR3"
FT                   /protein_id="AAU03929.1"
FT                   /translation="MINSIRIGTRNSTLALIQTNLVIAQIKQFFPDINCEIVPIITSGD
FT                   LIQNKPLYDIGGKALFLKEIEQALLDKKIDLAVHSLKDIPGRIPVDLVIAAVLEREDPR
FT                   DVLVCLNYKSIETLPQNAVIGSSAVRRKAFIKKIRPDLNIKVFRGNVDSRIKKLMTGEV
FT                   DATILSYAGLKRLNAFNKKYCHLIEYSQILPCVGQGVIAVEIRKDDNAMFNICNQINHI
FT                   PTFELIKPERAFLEHLDANCSTPIGAYSQYLDAYNIQTDFMLGKLDCNKIIFQTEITNI
FT                   NTSRECGIKAAKMMLAQQ"
FT   gene            complement(584848..584938)
FT                   /gene="tRNA-Ser"
FT                   /locus_tag="RT0454"
FT   tRNA            complement(584848..584938)
FT                   /gene="tRNA-Ser"
FT                   /locus_tag="RT0454"
FT                   /product="tRNA-Ser"
FT                   /note="codon recognized: UCA"
FT   gene            complement(584997..585989)
FT                   /gene="trpS"
FT                   /locus_tag="RT0455"
FT   CDS_pept        complement(584997..585989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="RT0455"
FT                   /product="L-tryptophan-tRNATrp ligase (AMP-forming)"
FT                   /EC_number="6.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:RT0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03930"
FT                   /db_xref="GOA:Q68WR2"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WR2"
FT                   /protein_id="AAU03930.1"
FT                   /translation="MKKTVLSGVQTTGALHLGNYLGSIKNWVKMQEEYNCFFFLADLHA
FT                   ITIDIKTSELNNSIMEVLAIYLAAGLNPDKVTIFAQSMVKEHAELSWLLNCVTPLGWLK
FT                   RMTQFKDKAGSDQCKACLGLFAYPILMAADILIYKADIVPVGEDQKQHLELTRDIAEVI
FT                   NRRFDKEILKVPDILISETGTRIMSLRNGLKKMSKSDIADFSRINLKDSNDLIYQKIKK
FT                   AKTDHLSFISYDKKTRPEISNLLDIYKSLSKESMEKIINNYQNQGFAKFKEDLAEIIIT
FT                   NLQPIRDKCLELMNDKEYLLKILHKGAEKAKIRASETVNEVKKQFGFII"
FT   gene            586060..586788
FT                   /gene="plsC"
FT                   /locus_tag="RT0456"
FT   CDS_pept        586060..586788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsC"
FT                   /locus_tag="RT0456"
FT                   /product="probable 1-acyl-sn-glycerol-3-phosphate
FT                   O-acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:RT0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03931"
FT                   /db_xref="GOA:Q68WR1"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WR1"
FT                   /protein_id="AAU03931.1"
FT                   /translation="MMLWRLRILSFYGLLSLFTFIFFLICYIPITFFNVNYQIKYRIAI
FT                   IFSYTFVWLAKICCGLKYEVEGLEKLPNTTSIVVSNHQSFWDQMFMQLIIPKHSWVLKR
FT                   ELFNIPLLGWGLRMVKPIAVDRGTNSSVAQILREGQEKIKEGLWLIIFPESTKVPPDKT
FT                   VKFKPSAVKLASITRVPIVMIAHNAGLFWPRGFWFQRPGTIRVKIIGVIDKSEVEQTDV
FT                   RILNEKVEQIINSEKQKLLN"
FT   gene            586848..587288
FT                   /locus_tag="RT0457"
FT   CDS_pept        586848..587288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0457"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03932"
FT                   /db_xref="InterPro:IPR019291"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WR0"
FT                   /protein_id="AAU03932.1"
FT                   /translation="MVGTALLKLIAVIDSKHMMLYDALGIKITTNKPLKLTLDLEEHHH
FT                   HREKRQSFYQNKSTPGALFEPHTSLKDIEHKEAARSVIKHLEKITTANQTKYKELIIIA
FT                   EPQMLGYIRQKLTSGLKKIVTKEIAKDLVQHNVGAVERAVFA"
FT   gene            587681..588397
FT                   /locus_tag="RT0458"
FT   CDS_pept        587681..588397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0458"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03933"
FT                   /db_xref="GOA:Q68WQ9"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WQ9"
FT                   /protein_id="AAU03933.1"
FT                   /translation="MPQIYFNGPEGRIEGRYAKATSPNAPIALVLHPHPLYEGNMNNKV
FT                   VYNAYKILVDNGYTVLRINFRGVGGSQGKFDNGVGEVVDAGAALDWLQQNNPNAQSNLI
FT                   LGFSFGAWIAMQLVMRRPEINHFLAISPPVNTIHKYDFSFLAPCPIPGFILQGDNDSIV
FT                   SADDVKDLVNRLSNQQSHIKIDYKIINGADHFFRYKTEEFSKAINDYLITIQSNYHQHN
FT                   NVNEDKNKNQKKLFLY"
FT   gene            complement(588509..589513)
FT                   /locus_tag="RT0459"
FT   CDS_pept        complement(588509..589513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0459"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03934"
FT                   /db_xref="GOA:Q68WQ8"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WQ8"
FT                   /protein_id="AAU03934.1"
FT                   /translation="MFRLLLISITFLVLYSGFTFIEHFNSKVVISLYNYNIETTLFLSV
FT                   ILELLLLVFCFIIIRFLIIIIDLPATIHNIFSKRKINHDRHALILAFAEYIIGNKMKAA
FT                   SIARKNLSSDDLKDFQKFYNFILAITADDIDSKIFYFQKLITSKEFIFYASKNLAKLYY
FT                   DKSLYDKAENYAIKAYNLNKLDSDNLIILMHCYAKLSLWTKFIFITNKLAKFHKHEFIP
FT                   KITQYYLLIAKQEVNSNNTANAIDYLEKAIDLNFYNDELLEFYFNLNDKLSVDQKTKIL
FT                   KKAFRITPSLRLVQLFKKITSLSDKQIYEELIQVLDTKKDKIFILAIESYLEL"
FT   gene            complement(589506..590186)
FT                   /locus_tag="RT0460"
FT   CDS_pept        complement(589506..590186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0460"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03935"
FT                   /db_xref="GOA:Q68WQ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WQ7"
FT                   /protein_id="AAU03935.1"
FT                   /translation="MQKFDSLFKSRNIFFIAIVIFILSSVILYHNRSDILKLFKIENKD
FT                   LNQITAQEIENKENAILEKKEYETILSTKSFLNYVNFLKSSKTSILNSEGDSVEAPIKL
FT                   NSVNYTDYLLNVNLLVYNFTQDKDYSKELRILKSYPLPQNIRNILNNLEKYNNNYLVSK
FT                   LSSTVVIFPTQHKWLEQLIKIEKKSSAIIAKEQDKTLILEKLNYLIYFLYSEKFMQEFV
FT                   NKDV"
FT   gene            complement(590170..590985)
FT                   /locus_tag="RT0461"
FT   CDS_pept        complement(590170..590985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0461"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03936"
FT                   /db_xref="GOA:Q68WQ6"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WQ6"
FT                   /protein_id="AAU03936.1"
FT                   /translation="MKSVLLTRNIQENKETIQEISKYNLDLRYIHCALIKYQTLDFNIN
FT                   ILNNYSNIIITSKYAASILADYNLQQDIWVVGSKTKQLLGKKVMYTAKNIADLIQHFPT
FT                   DLYKHTIYLSSNEITKDLPHKIARHIIYNVEYLNELPISIIQEFEKNIRFFSKVAYRNE
FT                   FKENITRDTTSYKKVDDDHSLGPTYPLEEQLGKMSIDFILLYSQNSAKTLVRLLLQNNL
FT                   LQYLQDSLVIAISLKVANIVRPFIKNVVYCDNQNSNDIIKLLYENAKIR"
FT   gene            complement(591272..592603)
FT                   /gene="ampG1"
FT                   /locus_tag="RT0462"
FT   CDS_pept        complement(591272..592603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampG1"
FT                   /locus_tag="RT0462"
FT                   /product="murein peptide permease protein AmpG"
FT                   /db_xref="EnsemblGenomes-Gn:RT0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03937"
FT                   /db_xref="GOA:Q68WQ5"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WQ5"
FT                   /protein_id="AAU03937.1"
FT                   /translation="MLKNSHVCIIIWLFGFISGFNIMITGNTLNYWFAKKDIALQTIGI
FT                   LSFITLPYSINFLLAPVFDTVQIKCLNKILGHRLSWICLTSTTLISLTSILSFLDPGTD
FT                   LVLLSFIAFIISFFSATQDTILSALRTEIVPKELLGFTSGIYIFGYRVGMLLASSGAIY
FT                   LSIYLTFNKIYQIFACVIFVYLILLILVSRYTNSVDVIEENTSYFYVARCYTMEEMHLK
FT                   NEFFIKHYFNFFKNCISAYLLKIFSGSHVYRNDISLAYFIVLILIFLVLYRLPDNLINV
FT                   MINPFLLHLGYNAFEIASVCKFCGVIGAIIGGLIGGIIMKYKNMLYSILLFGIIHALSH
FT                   ILFILLEVNGKNSLILFITIGIESITGGMTMTAYIAFISSLCQGKFRATQYSLLSSMMG
FT                   ISRSIFPIISGYMVVNFGWQNFFLFTTIITIPSLLILLKIQTKL"
FT   gene            593138..594691
FT                   /locus_tag="RT0463"
FT   CDS_pept        593138..594691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0463"
FT                   /product="possible lipopolysaccharide
FT                   1,2-glucosyltransferase WaaJ"
FT                   /db_xref="EnsemblGenomes-Gn:RT0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03938"
FT                   /db_xref="GOA:Q68WQ4"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WQ4"
FT                   /protein_id="AAU03938.1"
FT                   /translation="MPSTNLILFFFIFLMVIVISTFFISNYRMHKNTNCIMDIGTYSYK
FT                   KFYSTIREDQLNLDLVLERLEDIESLNAKDKARLEKICSFQVEDGMVRLDVAKGYDCLL
FT                   RFALDKNANLVQQYKAIKNGSYSLDTLYTKKAAFNLAKLIILGYKEKVKEIFALKNDDD
FT                   LLKYYSGYTEDEVPFLNSLISLNIPELTARCLYRLSLIHVLGRSSFNEKTIRTDYKRAI
FT                   KEIQNVIKLTGIRQNNILDIALTINDRYAIHAGAVIASSLLNSDLDSFYRFHIVMDSND
FT                   PISQESINKLSSMKYIRDYSIDFTTFPDNILNKILTYKKIKFADNWPSLVMYRLYFDKV
FT                   FPNLDSILYLDADIVVLRDLNSLKKIDMNDYVAACSLDTAITYCIHKVQEDCKRNVAHS
FT                   YKNSGIVFLNLKNMREKQYNNMLLETLKNSKCDFSLPDQDLLNVAFQNYLYPLSMRWNF
FT                   CTYFEHQSPYFSYFILHYAGPKPWTIEKEELWKTNHDKLDKITQYYWQYREITPWSSIN
FT                   "
FT   gene            594760..596265
FT                   /gene="tlcC"
FT                   /locus_tag="RT0464"
FT   CDS_pept        594760..596265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlcC"
FT                   /locus_tag="RT0464"
FT                   /product="ADP/ATP carrier protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:RT0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03939"
FT                   /db_xref="GOA:Q68WQ3"
FT                   /db_xref="InterPro:IPR004667"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WQ3"
FT                   /protein_id="AAU03939.1"
FT                   /translation="MLPPKIFFEKFKEIIWPIERKELKLFIPMALMMLCILFNFGALRS
FT                   IKDSLVVPSMGAEIISFLKLWLVLPSCVIFTVLYVKLSNKLNFEYIFYSIVGTFLLFFL
FT                   LFAYIIYPNQDIYHPNDAMINNLIASYPNLKWFIKIGSKWSYALMYIFSELWSAVVINL
FT                   MFWQFANHIFDTAKAKRFYPVLGMIGNIGLIIAGSVLVFFSSGQYIIDSELLTDSFNSS
FT                   SCNSIILQPIISIIVTAGIIAMFLFRIINRFILTNAINVLDVKKAAARTKTKLALIESI
FT                   KLIIHSKYIGRIALLIICYGLLINIVEGPWKAKIKELHPNTIDYVNFMGMFNIWMGISC
FT                   VTFMIIGSNILRRLGWLISALLTPIMLSITGFIFFIFIIFIEEIGTCFGDFNLLYVAII
FT                   VGAIQNILSKSSKYSLFDSTKEMAYIPLSLELRTKGKAAVEVIGTKFGKSLGAFIQSLI
FT                   FIIIPTATFDSIIIYLLVIFIVMMNLWIWNIIKLNKEYIKLCK"
FT   gene            596393..598063
FT                   /locus_tag="RT0465"
FT   CDS_pept        596393..598063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0465"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03940"
FT                   /db_xref="GOA:Q68WQ2"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WQ2"
FT                   /protein_id="AAU03940.1"
FT                   /translation="MKKILIIILFIIIFIVLVYSGLWFVIMFSLSRSINQKYSGVNLNI
FT                   EKDNNNLHQQYLVKFSKVRPYGFPFKLGIMVINWQEESINRAIEFTTPINIGYDLFEQK
FT                   LFINFSGEALGKFKPVQRGFGVRFHNENCILSAKIPLNLKLFKMVWLKKDLFEFLNLIK
FT                   NIKFISDKTQIFDLVDNQKLYEEDNTILTMLFDKSQYYTSKQDFLDKIPQKLEFYYETE
FT                   IIQSNLEDRIIPAGLLLYRPAWHHNFKFSGNFVISTSSLHFKDVGKDLTIKVNNAKINS
FT                   NNFENNMNLLYKGQLNDFGNSNIHLSIESQFKLKSGFIIGFLEFIKKYYDKQKQTDLFK
FT                   FSDNKIYKDFNNELVYILNNNQQYNFSILEERQYHFNLNINLVTELKKLTRAQINALSL
FT                   YSNRSGFNITNETIVNDLKDSYSKGIIVINNYSKIIEILSPYIYGVVGFKNLSKENKVV
FT                   YVEALQSFLKTISDHPNSSNLIDASIEYEFDLSDLKQAKIGTIDDINKLIPLYYLSLYQ
FT                   AAVKKMEPGANIKEKILELIPSINQKILEECVLSDIVTQ"
FT   gene            598143..599126
FT                   /gene="ispB"
FT                   /locus_tag="RT0466"
FT   CDS_pept        598143..599126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispB"
FT                   /locus_tag="RT0466"
FT                   /product="octaprenyl-diphosphate synthase"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03941"
FT                   /db_xref="GOA:Q68WQ1"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WQ1"
FT                   /protein_id="AAU03941.1"
FT                   /translation="MNIIVKIQQDLKEEVTQLNDLIISCLKSDTELIEKVGKYLLEAGG
FT                   KRIRPLLTIITAKMFDYKGDNHIKLASAVEFIHAATLLHDDVVDDSTLRRFKPTVNVIW
FT                   GSKTSILVGDFLFSQSFKLMIASGCIKAMNVLARASVIISEGEVVQLVKLNERRIITID
FT                   EYQQIVKSKTAELFGAACEVGAIIAEQVDRVSEDVQDFGMLLGTIFQVIDDLLDYLGSD
FT                   KQVGKNIGDDFLEGKVTLPLIFLYHKLEQDKKLWLENMIKSDKRTKDDFIKIRDLMLKH
FT                   AIYNETVNYLSSLENEANNLLNKIPVQNIYKYYLFSIIRFILYRSY"
FT   gene            599153..599229
FT                   /gene="tRNA-Arg"
FT                   /locus_tag="RT0467"
FT   tRNA            599153..599229
FT                   /gene="tRNA-Arg"
FT                   /locus_tag="RT0467"
FT                   /product="tRNA-Arg"
FT                   /note="codon recognized: CGG"
FT   gene            complement(599290..599364)
FT                   /gene="tRNA-Gln"
FT                   /locus_tag="RT0468"
FT   tRNA            complement(599290..599364)
FT                   /gene="tRNA-Gln"
FT                   /locus_tag="RT0468"
FT                   /product="tRNA-Gln"
FT                   /note="codon recognized: CAA"
FT   gene            complement(599427..601199)
FT                   /locus_tag="RT0469"
FT   CDS_pept        complement(599427..601199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0469"
FT                   /product="probable aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:RT0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03942"
FT                   /db_xref="GOA:Q68WQ0"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR032416"
FT                   /db_xref="InterPro:IPR033740"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WQ0"
FT                   /protein_id="AAU03942.1"
FT                   /translation="MRHDRINLLRNLFIEYNVEGYIIPSNDKYMNEYVPEYAKRLEYIT
FT                   GFTGSNGIAIICKDTAFFFTDGRYLEQANKELDLEFYKIFDLKDISKTLDKNIKIGYDP
FT                   QLFTYQVLSNLNINFHKINENLVDKIWYNQPLEPNSKIYLHDIKFAGVSHNDKINKCRE
FT                   TILSSSSVTVDANKNNNDMLVILDIASICWLLNLRASDVNYAPLMFAKVILTPTKLYLF
FT                   INPIRIDTEIINARPEITVLPEKEFENILRDSKNRYLIDDSITSVHIMDLIANKKVKKI
FT                   LEPCLLPKACKNDIEIKNAIDFHIKDAVALCEFFAEFFLYNSSENMDSYFYSHERITEY
FT                   SLCLKLTAQRAKQDGYVSDSFHAICGFQENSAIIHYRANPKTAKKIEGHGILLIDSGGQ
FT                   YKGATTDITRTIIIGTPTCEQKKRYTQVLKGHIALAKAKFPKNIVTGANLDILARQYLW
FT                   QDMIDYPHGTGHGVGSFLSVHEGPHSINLSNKIILKAGMILSNEPGFYIPGKYGIRIEN
FT                   LIYIKENKENNGWLEFETLSLVPYASKLIDMELLNIDEINYIKEYYNKIRAQIYDLLST
FT                   QAKYWLNNEINLFL"
FT   gene            complement(601272..602561)
FT                   /gene="potE"
FT                   /locus_tag="RT0470"
FT   CDS_pept        complement(601272..602561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potE"
FT                   /locus_tag="RT0470"
FT                   /product="putrescine-ornithine antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:RT0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03943"
FT                   /db_xref="GOA:Q68WP9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WP9"
FT                   /protein_id="AAU03943.1"
FT                   /translation="MSQKLSFWSVFALVTGSQIGTSVFILPLSLAPFGVYSIWGWVLSL
FT                   FGAMSIALVFSCLCTKFPKTGGPHVYVRASFGETIAFFTGWTYWIISFVSTSIVVISAI
FT                   GYLTPFFKSQKILDLILQLILLAAIAILNLKGPKIAGKIEFYLTLLKFVPLLVVGLAAL
FT                   SHFNIDNIVIAQEIENLTIPTIMGRVALLTFWGFIGIECATTTAGTVKDPAKTIPRAII
FT                   IGTCCVAFLYIINSIGIIGLIPASELINSKAPYADAATLLFGGTWSKVITVIASVICIG
FT                   TLNAWVLTSGQIALGLAEDGLLPQFFAKKNSNNAPTYGIIVSCLGITPLLFFTSNNNFA
FT                   QQITQIIDFSVIAFLFVYLICSLAFLKLIFSSKENFSYYYLFVDIISIIFCIWVIYKTP
FT                   FETLIIACSFTILGIPVYYGWYRLMNRIKL"
FT   gene            complement(602764..603096)
FT                   /gene="iscA2"
FT                   /locus_tag="RT0471"
FT   CDS_pept        complement(602764..603096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iscA2"
FT                   /locus_tag="RT0471"
FT                   /product="iron-binding protein IscA/HesB"
FT                   /db_xref="EnsemblGenomes-Gn:RT0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03944"
FT                   /db_xref="GOA:Q68WP8"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WP8"
FT                   /protein_id="AAU03944.1"
FT                   /translation="MKNVISLTDSAAKQVKLLIEKRAKPTFGIRVGIKSGGCAGQTYYV
FT                   EYADNKNQFDEVVEEKGVRILIDPKALMYILGSEMDYVETNFKSQFTFTNPNEKANCGC
FT                   GKSFSV"
FT   gene            complement(603100..603495)
FT                   /gene="iscU"
FT                   /locus_tag="RT0472"
FT   CDS_pept        complement(603100..603495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iscU"
FT                   /locus_tag="RT0472"
FT                   /product="iron-sulfur cofactor synthesis protein IscU/NifU"
FT                   /db_xref="EnsemblGenomes-Gn:RT0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03945"
FT                   /db_xref="GOA:Q68WP7"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR011339"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WP7"
FT                   /protein_id="AAU03945.1"
FT                   /translation="MAYNKKVIDHYENPRNVGSLDKNKKNVGTGLVGAPACGDVMKLQI
FT                   EVDDDEIITDAKFKTFGCGSAIASSSLVTELVKGRSVEDAQEIKNTEIAKELSLPPVKL
FT                   HCSLLAEDAIKAAIADYKQKKGNKKDS"
FT   gene            complement(603542..604774)
FT                   /gene="iscS1"
FT                   /locus_tag="RT0473"
FT   CDS_pept        complement(603542..604774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iscS1"
FT                   /locus_tag="RT0473"
FT                   /product="cysteine desulfurase protein IscS/NifS"
FT                   /EC_number="4.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03946"
FT                   /db_xref="GOA:Q68WP6"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WP6"
FT                   /protein_id="AAU03946.1"
FT                   /translation="MNQQLKNLTLPIYMDYQSTTPIDPRVMEAMLPYFTTKFGNPHSRS
FT                   HSFGWEAENAVENARSMIAKLIGADSKEIIFTSGATESNNLVIKGIAKFYGNKKNHIIT
FT                   LVSEHKCVLNACRYLEQEGIKITYLPIKPNGIIDLEILKNAITDQTLLVSVMAVNNEIG
FT                   VIQPLREIGKICRERSVFFHSDIAQGFGKIPINVNEYNIDLASISGHKIYGPKGIGALY
FT                   IRKKPRVRVTPLINGGGQERGMRSGTLPTPLIVGFGIAAEISYNEMEKDAQHVNYLFDR
FT                   FLNNIYSRIPEVYLNGDKDQRYKGNLNLSFAGVEGESIILAIKDLAVSSGSACTSASLE
FT                   PSYVLRSIGISEELAHTSIRFGIGRFTTEQEIDYAVNLICSKIDKLRKLSPLWEMMQEG
FT                   IDLKKIKWTAH"
FT   gene            complement(604841..605977)
FT                   /gene="iscS2"
FT                   /locus_tag="RT0474"
FT   CDS_pept        complement(604841..605977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iscS2"
FT                   /locus_tag="RT0474"
FT                   /product="cysteine desulfurase protein IscS/NifS"
FT                   /EC_number="4.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03947"
FT                   /db_xref="GOA:Q68WP5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WP5"
FT                   /protein_id="AAU03947.1"
FT                   /translation="MIYLDHNATTFIDPRVKEYIISLMDKELNPSSTHMAGRFAQNIIE
FT                   TARSQIATSLGITMLSGEYNITFTSSGTESNNLIMKNFYDGDIFISAIEHLSIYNHINY
FT                   APNIKVIRVNKQGLVDLEHLEDLLFQSNARKKLVSVMIANNENGVLQDIAAISKITKKY
FT                   DAKFHSDLVQSFGKISLNIKELGLDFATISGHKIGGGHGCGALISNSNFQLIPIIIGGG
FT                   QEKSVRSGTENVLAIAGFGLAAEFRRKNVSENYIKIRDLQERLEQKLKKYSNVNIISNN
FT                   VARLANTTLITVDNTDAQVKLIEFDLRNICVSSGSACSSGKISKSHVLTNMGIREEEAK
FT                   SSIRISLSHTNTVSDIKAFIKAFEEIYEYKPSSNHGIK"
FT   gene            complement(605974..606376)
FT                   /pseudo
FT                   /locus_tag="RTPG24"
FT                   /note="pseudogene of rickettsial conserved hypothetical
FT                   protein"
FT   gene            complement(606540..607406)
FT                   /locus_tag="RT0475"
FT   CDS_pept        complement(606540..607406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0475"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03948"
FT                   /db_xref="GOA:Q68WP4"
FT                   /db_xref="InterPro:IPR009574"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WP4"
FT                   /protein_id="AAU03948.1"
FT                   /translation="MYLLSFILGGLNTLVRQLLLSISSIEFYKDVYKNYQGYGIRYFFT
FT                   LSFIPSIIYCILILNYIVALKDYFNGTKSSKVTDNIEYVINQLPKIKYNNSKISVEEVE
FT                   PIYLYSKNNNKIFVIDTKNQVSNKEKSKVPFVLEENKLKINLVSNTKKHFPSIINYSEI
FT                   FKQNEVILTPEIIKKYFADNLLYAPNLFIFFGTPVIILFWFVTFLLERSIIVLLVYSLA
FT                   NLLITKTSIQTAIRLVMFSSGIPIILQPVIIILIPKLSILIQLLQMFTTFLVFIAILQI
FT                   NKSLSHI"
FT   gene            complement(607961..608629)
FT                   /locus_tag="RT0476"
FT   CDS_pept        complement(607961..608629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0476"
FT                   /product="Glutathione S-alkyltransferase"
FT                   /EC_number="2.5.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:RT0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03949"
FT                   /db_xref="GOA:Q68WP3"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WP3"
FT                   /protein_id="AAU03949.1"
FT                   /translation="MKKLYHNPICPLSRQARFFLKELEIEFTTIKEDYWQFNKNFLKIN
FT                   PAGTLPILEESYGLLVVGIYPFVEYLNNKYPNFNFLDTDIDICCEIRRLFFWFNNKFYF
FT                   EVTKIIIDEKVIRSISKMSSPRTEFLRAAKNNLNYHLEYMTSLLEKRSYLVSECLTIAD
FT                   IAASCHLSVLDYFGEIYWDKWALIKHWYSLIKSRPAFRLLLQDRIPGFTPPTYYTDLDF
FT                   "
FT   gene            complement(608807..609191)
FT                   /gene="ssrA"
FT                   /locus_tag="RT0477"
FT   misc_RNA        complement(608807..609191)
FT                   /gene="ssrA"
FT                   /locus_tag="RT0477"
FT                   /product="tmRNA involved in trans translation (10SaRNA)"
FT   gene            609438..612080
FT                   /gene="ppdK"
FT                   /locus_tag="RT0478"
FT   CDS_pept        609438..612080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppdK"
FT                   /locus_tag="RT0478"
FT                   /product="Pyruvate,orthophosphate dikinase"
FT                   /EC_number="2.7.9.1"
FT                   /db_xref="EnsemblGenomes-Gn:RT0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03950"
FT                   /db_xref="GOA:Q68WP2"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WP2"
FT                   /protein_id="AAU03950.1"
FT                   /translation="MNKLIYYFGNNGSDGNASMKNILGNKGAGLAEMSNLKLPIPNGFT
FT                   ITTELCNYFYKHNNNLPKNFQNELQQAITKLEITTGKIFGSTTSNPLLLSVRSGSTVSM
FT                   PGMMDTILNLGMNNEVCNALADSCGNKLFALDSYRRFLEMYGSTVLSIPSDLFEQIYEK
FT                   HKVQADIYKDSDITVELLEKIIDDFKRLHIKYTKQLIKDPYEQLESAIKAVLYSWKNNR
FT                   AIVYRKLNNISEDFGTAINIQEMVFGNLGKTSATGVVFTRSPSTGEKKLFGEFLINAQG
FT                   EDIVSGTRTPMPIIANDSNSMQAMMPEVFTKLSQIAKKLEEHYLDMQDIEFTIENNKLY
FT                   ILQTRTAKRTAIAAINIAVQMVEEKLISKEQALMRIDPESLNQLLHTRIDYSKKLTAIA
FT                   EGLPASPGAATGIVVFSPYDAEKLSHHHKVILVRHDTSPEDINGMHVASGILTIRGGMT
FT                   SHAAVVARGMGKPCVCGTNNLSIDEQKQILIAGDIVIKQGDIITIDGGSGKIFLGEMPL
FT                   IQPTFSEESTLILDWADEISSLKVRANAETVNDALVSIKFGAQGIGLCRSEHMFFDKNK
FT                   IPLVREMIIAPDIERRQCALQKLLPLQTEDFKALFRVMKNKPVNIRLLDPPLHEFLPTT
FT                   DEDKKNLAHSLNLPLSMIHQRLHAMHEVNPMLGHRGCRLGICLPEIYQMQIEAILTAIF
FT                   ELHKKEHIESNLELMIPLISNVAEIKKLKMDIYAVVKKLEQRYSYKFSFTLGTMIELPR
FT                   AALGSKKIAKEVDYFSFGTNDLTQTTYGISRDDIASFLPYYLEEKIFESDPFTTLDEEG
FT                   VGELIKIAIKRGKSSNANLKLGACGEHAGNPTSIAFFHKMNLNYVSCSPYRIPIARIAA
FT                   AQAKIKQGS"
FT   gene            613098..613790
FT                   /gene="addA"
FT                   /locus_tag="RT0479"
FT   CDS_pept        613098..613790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="addA"
FT                   /locus_tag="RT0479"
FT                   /product="class II aldolase/adducin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03951"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WP1"
FT                   /protein_id="AAU03951.1"
FT                   /translation="MDIKYNLAAAYRIMAYLSLDDHTYTHLSARSKNADFYYIYPFGLR
FT                   FEEVTTENLLKVSLDGKILEGEEYQYNKTGYFIHGSIYKARPDVFAIFHYHTPASIAVS
FT                   SLKCGLLPISQWALHFYDRISYHDYNSLVLDAGQSAKFVNDLKQNYVMLLRNHGAIICG
FT                   KTIHEAMFYTYHLEQACKTQCLLNSTIQQELIIPSVEICKKTVKDLLSFEEDLGKRDWE
FT                   AWLRLINM"
FT   gene            614027..614167
FT                   /locus_tag="RT0480"
FT   CDS_pept        614027..614167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03952"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WP0"
FT                   /protein_id="AAU03952.1"
FT                   /translation="MYHILSLEVFVALDLHKLANCTASLQDVKNIKDQFKYAIRPKFKL
FT                   F"
FT   gene            complement(614683..615405)
FT                   /locus_tag="RT0481"
FT   CDS_pept        complement(614683..615405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0481"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03953"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WN9"
FT                   /protein_id="AAU03953.1"
FT                   /translation="MERLIHKSVYYKIFDKTFNNSSHRYIQKNYSIYDAEIVANIESIT
FT                   NYFKAQDILILNQVHSNQIVNADEHIMTIPEADGSITTKKNLVLTVQSADCVPVLLASD
FT                   DGKIIGAAHAGWQGSINNIISNIVTKMVETGAKNLIAVIGPAIAQSSYEVDDKYYKTFL
FT                   SKDINNKQFFINSIKENHYMFDLPAFVEFKLNESGVKDIKNLTEDTYTNPFKYPSKRRS
FT                   YHMQVPYNEKILSAIVIK"
FT   gene            615404..616234
FT                   /locus_tag="RT0482"
FT   CDS_pept        615404..616234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0482"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03954"
FT                   /db_xref="GOA:Q68WN8"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WN8"
FT                   /protein_id="AAU03954.1"
FT                   /translation="MKIPYINYNNFINTLSNNLQKNKQLEKIIEQFYQDYQLIPIIGVE
FT                   IEFYLSNNIDIANFEILSREYLSKFKISKIKKEKGNNQFEIALPPSINLIQYIKNILEV
FT                   KKILKKSAKQLNGYIDFSPKPFLDDYGNSMHFHINFNSELHDYYILAAQGICHYMLDTL
FT                   LVFMPTTLDYLRINKKFMSPTHVSYGGNNRSVAVRTPNSLPKRLEHRLSSPETDPYIAM
FT                   FTILKSILLALTFPNSIKKIEKIYGNAFDPQYNLTPLPTSFQESSMLFKPEFFT"
FT   gene            complement(616338..617183)
FT                   /locus_tag="RT0483"
FT   CDS_pept        complement(616338..617183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0483"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03955"
FT                   /db_xref="GOA:Q68WN7"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WN7"
FT                   /protein_id="AAU03955.1"
FT                   /translation="MIMRKILNCLYVALFRTIKDDGVEHSGYMSFMILLSIFPFLVFLL
FT                   ALTSFLGASELGQNFIQIFLESLPEQATESIEKRIRELLSAPPQSLMNLAIIGSIWTAS
FT                   SFVECLRTILNRVYQIKSPPPYIRRRLLSIIQFLIISALITFTMFLLVVIPIIFTKIPI
FT                   ILETIEQYKIILNFIRYSLILILLFLGASSLYYILPNVKLNFVDVFPGAVLTVVLWIIS
FT                   GYLLSTYIVYYNQLNLMYGSLGSIIVTLIFFYIINMIFIYGAEFNYLMQNYANVEQSAA
FT                   "
FT   gene            617447..617602
FT                   /pseudo
FT                   /locus_tag="RTPG25"
FT                   /note="pseudogene of hypothetical protein RC0669"
FT   gene            617672..618064
FT                   /locus_tag="RT0484"
FT   CDS_pept        617672..618064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0484"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03956"
FT                   /db_xref="GOA:Q68WN6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WN6"
FT                   /protein_id="AAU03956.1"
FT                   /translation="MGRKNDIIQKIDSFIGQKIYSLRLAKGLSRQQLAEVIDVTHQQLQ
FT                   KYEKAINRISVGRLVLIAEALDRNIDYFFEGLEEANKPQPVHTQHQRMCIEVSRNFMKI
FT                   NSTEEQQAINNLVKCLAGKEKLKTNV"
FT   gene            complement(618161..621220)
FT                   /gene="sca4"
FT                   /locus_tag="RT0485"
FT   CDS_pept        complement(618161..621220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sca4"
FT                   /locus_tag="RT0485"
FT                   /product="cell surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:RT0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03957"
FT                   /db_xref="GOA:Q9AJ63"
FT                   /db_xref="InterPro:IPR020954"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9AJ63"
FT                   /protein_id="AAU03957.1"
FT                   /translation="MSKNDNQDISEFDPLNREFTEAEKQQQMQQEQEFFSQSILDIVDD
FT                   GFIVASSSQSTPSISVLSNSLPHGDQKSDPITEAIRKEILEKQRDILREYLANTNPELA
FT                   AQIAKEEDDKKFRAFLSNQDNYALINKAFEDPETKKNLEEVEIVGYRNILSTYSAASGY
FT                   PGGFQPVQWENQVSASDLRSTVVKNDAGEELCTLNETTIKTNSLIVAKQDGTQVQINSY
FT                   REIDFPIKLDKADGSMHLSMVALKADGTKPAKDKAVYFTAHYEEGPNGKPQLKEISSPQ
FT                   PLKFVGTGDDAVAYIEHGGEIYTLAVTRGKYKAMMKEVALNNGQSVDLSQTIAEDLTKV
FT                   QGPSHVRHTPIITPNQELELSIETHSNQQVPPITTFNKPLQPEISQTHQLQPQQAQSSG
FT                   IPNLVLNAAHALSISMQDLLHNINASLTQKQDINKQSDLIKEAANTILNNKKSDFAEKQ
FT                   YNIIALTENTLSNKDIIADAKVNVVSALLETIQNDQNTLDIQKSKILEATVAITLNSEN
FT                   IELKQKQQILEKVVDVSLSIKDDISRAVAIDSITDAVIKSNIANKDKEQIFMTIFDQVN
FT                   SYEFSNITKQKLLGSMLKKAVETKVISPEQQQLIHQNLDKITTEHTKRDTIEKVNNILL
FT                   DPFSNTVLKTTNIQVITANVLDSPVPVEIKSELIQVVTQKVAESALEPKDKTEIVKGIG
FT                   KIIATHSDTSLPLYDKGVIMESVAKGIVESKTDLRERELITEGLVNGIYEVKGDKAVVH
FT                   AISSVIANSNINQSEKEVLKKSQDIVSERVLDKEIQNLDGELKEKNIEESKLRDDIYNK
FT                   TQDVANELNIKTFLDDNHGKREVSEEVPKNTSSLLNDISQRTIEKVNNLRAMLSQDANL
FT                   KTFEEKKDESTKKVDELVKAFDNKSSTEEQQNFIKSHLIDNKTLSREVRLQIIDNLLKA
FT                   QAQKRAETIENLSAKTEDVRVVSGKSELEPISKDEPYIQKAKMVVERDRVGIKDNIKIM
FT                   GALINARDSIQSENLNKSTHIKKESSVPQR"
FT   gene            complement(621462..623000)
FT                   /gene="tlcD"
FT                   /locus_tag="RT0486"
FT   CDS_pept        complement(621462..623000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlcD"
FT                   /locus_tag="RT0486"
FT                   /product="ADP/ATP carrier protein 4"
FT                   /db_xref="EnsemblGenomes-Gn:RT0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03958"
FT                   /db_xref="GOA:Q83W27"
FT                   /db_xref="InterPro:IPR004667"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83W27"
FT                   /protein_id="AAU03958.1"
FT                   /translation="MTINASNIENSFSKINSHFSKLTDYIWPIKRNEISKFLFITLLMF
FT                   CILFIQNLIRALKDSIVTTMIGAETISFLKFWGVMPSAFLITVMYVKLVNRMKAENIFY
FT                   LIISIFLIFFALFAYVIFPNHEILHLRPVTVHNLTTSLPNLKWFILLLSKWSFSLFYII
FT                   AELWPNVVFALLFWQFVNNITTVEESKRFYPLFGLLSQTGIYLAGHFLENLSKINYYIT
FT                   DKFALQSSFHTLSIQIILTIVLILGIVSIKTFWLLNHKVLDKKHMSLLRFKTKNKSITI
FT                   AKSFQMILSSRHIRLIATLLICYGIAINLVEGPWKAAATKIYKTPTEYAAFIGSYLSYT
FT                   GVFTIFFVLLGSNIVRRIGWFTSAVITPSIVFITGILFFAFNNFEGFAGLIIANFILTD
FT                   PALVAITIGAIQNVLSKSSKYTLFDSTKEMAYVPLEPEIKISGKAAADVIGTKLGKSGS
FT                   AFLQSLIFIILPSSSYQSISICLMIIFILTCLTWIWATKELNKEYKNSIKFSQK"
FT   gene            623210..624088
FT                   /gene="truB"
FT                   /locus_tag="RT0487"
FT   CDS_pept        623210..624088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="RT0487"
FT                   /product="Pseudouridine synthase"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:RT0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03959"
FT                   /db_xref="GOA:Q68WN3"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WN3"
FT                   /protein_id="AAU03959.1"
FT                   /translation="MSNYWLNFYKPKGISSAKLVNIVKKIIGKTKIGHAGTLDVEAEGI
FT                   LPLAVGEATKLIQLLIDAKKTYIFSVKFGAQTDNGDYTGKVIASKNYIPSQEEAYAVCS
FT                   KFIGNIKQIPPMFSAIKVNGIRAYKLAREGKVVELKPRNVTIYDLKCLNFDKEKAIATY
FT                   YTECSKGTYIRTLTEDLALSLQSLGFVIELRRTQVGIFKEENAIHIKASDAITKNFIDK
FT                   KSIKIEAILDDILVLDATDDQAQKIKYGQKCVFDYEEDVNFLWVRYNGTLLAIGSLNKS
FT                   CFNSLRVFNLL"
FT   gene            624114..624389
FT                   /gene="rpsO"
FT                   /locus_tag="RT0488"
FT   CDS_pept        624114..624389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="RT0488"
FT                   /product="30S ribosomal protein S15"
FT                   /db_xref="EnsemblGenomes-Gn:RT0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03960"
FT                   /db_xref="GOA:Q68WN2"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WN2"
FT                   /protein_id="AAU03960.1"
FT                   /translation="MSITTERKQQLIKEYAITENDTGSSAVQCAILTERINNLTEHFKS
FT                   NHKDHTSRRGLLILVGRRRRLLNYIKKNNVSEYLDLITKLGIRKIK"
FT   gene            624535..626772
FT                   /gene="pnp"
FT                   /locus_tag="RT0489"
FT   CDS_pept        624535..626772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnp"
FT                   /locus_tag="RT0489"
FT                   /product="Polynucleotide phosphorylase"
FT                   /EC_number="2.7.7.8"
FT                   /db_xref="EnsemblGenomes-Gn:RT0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03961"
FT                   /db_xref="GOA:Q68WN1"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WN1"
FT                   /protein_id="AAU03961.1"
FT                   /translation="MFNEITKSVIWNRQVLEISTGKIARQADAAVTVKMGNSILLCTCV
FT                   VANKVKDGIGFFPLTINYREMAYSAGKIPGGFLKREGKASDKEILVSRLIDRPIRPLFH
FT                   QAFIHETHITCSVLSYDPETPVDILAIIGASAALSISPAPYLEIVAASKVGLINGEFVL
FT                   NPTLELLKTSQLDLVVAGTKDSVMMVESEAHLLSEEKMLEAIKFGFENFQTVIKLIKEF
FT                   AKEAKKPKFEMQDLYPSSLKKEIGKLFAKEIEQAFAIKSKQERNANLALIHEKVLTHFV
FT                   CDIENKKYNNYQIESTLKAISADILRNKILEQNIRIDGRSTTDIRQIACEVGLLPSAHG
FT                   SALFTRGETQSLVSTTFGTSLDEQIVDSLEGEYKERFMLNYIFPPYSVNEAMPMKAPSR
FT                   REVGHGKLAWRAINPILPNKVQFPYSIRVVAETTESNGSSSMATVCGSSLALMYAGVPI
FT                   KAPVAGIAMGLIKEGDKFAILSDIIGDEDYFGDMDFKVAGTSKGITALQMDIKISGIDF
FT                   KIIQVALEQARHGRLHILEQMNKIISKPNSELSKNAPSSTTIKIDKDKIKDIIGPGGKI
FT                   IKEICETSNAKIDISDDGTVSVYAADRDKIKVALDKIKAIAVEPEIGEIFNGTVMKVLD
FT                   SGAFINYLGNKDGFVHISEISETRIDKVSSVLKQGDIVKVKLIGFDNKGKAKLTIKNAC
FT                   KDHSLNNPKQKNNVKEDSEPEQRRDASKKRTWNEDNNTEMSEVITERKYFT"
FT   gene            626956..627915
FT                   /locus_tag="RT0490"
FT   CDS_pept        626956..627915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0490"
FT                   /product="sugar isomerase protein KpsF/GutQ family"
FT                   /db_xref="EnsemblGenomes-Gn:RT0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03962"
FT                   /db_xref="GOA:Q68WN0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WN0"
FT                   /protein_id="AAU03962.1"
FT                   /translation="MINTNNYHIIAKRIISNAANALDKLSNNIPADFNRIIEFLLSFKG
FT                   RIILTGIGKSGYIARKIAASFSSTGMPSFYLHPSEASHGDLGTITRNDLVMMLSNSGET
FT                   KELFNIIEYCNNSSIKIAAMTMNKNSTLAKRSDFLLIIPECQEASLIGAPTISSLIMLS
FT                   LGDAVMTVIHEERGFTRDDFKIYHPGGTIGANLTKIKNIMRSGDEIPLVYEDTSFTETI
FT                   IIMNKKRLGCTLVTDKEQNLIGIITDGDLRRNINDQIHLKTASSIMTKNPHHISSGIFA
FT                   QEALNLMKAKNITNIPIVDNNMIIGIIHIHDLLRMGVS"
FT   gene            627922..628527
FT                   /locus_tag="RT0491"
FT   CDS_pept        627922..628527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0491"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03963"
FT                   /db_xref="GOA:Q68WM9"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WM9"
FT                   /protein_id="AAU03963.1"
FT                   /translation="MPYFYKLRKKIWKSVYLLIILGMLYIGYILIQNGYMNEKNDINVT
FT                   KKNLNLRNNKNYDLKYNVILQDSIFEGVNKNLNAYKIKTERAIKESGNKYKLDIINAIY
FT                   SIKQDQTLIITAKEGFLDQESNTLDLKNDIKLFVDEIIFNTNNARINLVNQNINGNSSA
FT                   KLIYKNSSITSDSFNTMNENNIIIFKGNVSTIIDLSDY"
FT   gene            628493..628924
FT                   /locus_tag="RT0492"
FT   CDS_pept        628493..628924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0492"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03964"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WM8"
FT                   /protein_id="AAU03964.1"
FT                   /translation="MSLQSSIYRIIKLIIFLTVNISIASAKDTNLQITANTLIIDRIKQ
FT                   KAEYSGNVIIYFDNAILKTQKLYIFYKTIAEKKIIEHIVVPTKLTVERKINNELLLADS
FT                   AKYFFVDKQLILLGNVILQRNDHVLKTNKLIYYVEIVRK"
FT   gene            629037..629759
FT                   /locus_tag="RT0493"
FT   CDS_pept        629037..629759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0493"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03965"
FT                   /db_xref="GOA:Q68WM7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WM7"
FT                   /protein_id="AAU03965.1"
FT                   /translation="MDNLQIKNISKSYKKRNILTDISLHIKQGEIVGLFGPNGAGKTTC
FT                   FNIIIGLMSPDSGQLLLNDINITNLPIYLRARLGIGYLLQEPSIFRGLSVADNIKAVVE
FT                   ISENDKEVIEQKTHDLLEKFSIIHLKDFSSASLSGGERRRLEIARSFVIEPKFIMLDEP
FT                   LAGIDPLAISDIKNLITYLREFNIGILITDHNVRDTLDIVDRAYVIFEGKVLLEGSAQE
FT                   IANSKKVKEVYLGESFNF"
FT   gene            629876..631369
FT                   /gene="exoC"
FT                   /locus_tag="RT0494"
FT   CDS_pept        629876..631369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exoC"
FT                   /locus_tag="RT0494"
FT                   /product="Phosphomannose mutase"
FT                   /EC_number="5.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:RT0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03966"
FT                   /db_xref="GOA:Q68WM6"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WM6"
FT                   /protein_id="AAU03966.1"
FT                   /translation="MNINKEIFRAYDIRGNSIKHLTEEVAYKIGFCFANMSITKDNNKI
FT                   CVGLDGRISSPTLCKALELGLTDSGAKIINIGVVPTPVLYFADKHFIPAGSIMVTGSHN
FT                   PRDDNGFKMLQNGKSFFGTQIQSLLTKINGVQWPDHNLKSRWKIIPSWNEIKDKYTVDT
FT                   LKAKGQLNSDSTQCIKKGCYMSSIEFDVLKVYIKRILEGININPKLKVAWDPGNGATCN
FT                   VITELTKHLINKNIIINSKIDGNFPNHHPDPTNPANLQELIKLVKEQNCDIGIAFDGDG
FT                   DRIGIISGVGKILFGDQIVCIFAEDILKAHPNANIIVDVKTSQFIVDKIKSFSGNTIIC
FT                   RTGHPFIKSKMLETNALLAGEMSGHIFFADKYFGFDDAIYAALRFLDLLSKSSKTLDKI
FT                   IDELPKIYSTPEIKIFVTSRLKLQIIKEIKEKLLEDKIEFNDIDGVRVNTKNGWWLLRS
FT                   SNTESIIVARAESVSQHGLKHIIAMMNKYLVKYDLLINY"
FT   gene            631818..632753
FT                   /gene="miaA"
FT                   /locus_tag="RT0495"
FT   CDS_pept        631818..632753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="RT0495"
FT                   /product="IPP transferase"
FT                   /EC_number="2.5.1.75"
FT                   /db_xref="EnsemblGenomes-Gn:RT0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03967"
FT                   /db_xref="GOA:Q68WM5"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WM5"
FT                   /protein_id="AAU03967.1"
FT                   /translation="MIKKEIIILCGPTASGKSYLGHELAKAYGCEIINIDSMQVYREIP
FT                   IITASPIQIYNTGIHYHLYNFLSITEDFSVIKYLKLASEKIREITARGKIPILIGGTGL
FT                   YINLLVFGYNNIPDISQDVRVQVRNLHNEIGNIELWNKLEKLDPIAATKINHCDTQRLI
FT                   RAYEVLMHTGKSIFSFHTAQKERILSDFNFKIIFLNPERKFLYKTCDERLDKIFKDKAI
FT                   DEIALIKKQFTPKEYANLKAVGIKEIIAYLDGNLTLNDALNVAQMRTRQYAKRQVTWFT
FT                   HQIQDKTILEYSTQEEFEQILRNLLFTLKS"
FT   gene            complement(632751..633562)
FT                   /pseudo
FT                   /locus_tag="RTPG26"
FT                   /note="pseudogene of rickettsial conserved hypothetical
FT                   protein RP511"
FT   gene            complement(633560..636421)
FT                   /locus_tag="RT0496"
FT   CDS_pept        complement(633560..636421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0496"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03968"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WM4"
FT                   /protein_id="AAU03968.1"
FT                   /translation="MAATNNKNYQKVVEKVLSSSKANKALKSAIKDLSSSNSISLRTIL
FT                   LGAKFILTHPVNTYNLVKLAKSSNIYLGSEFQKSLLENSPIWEFLKKHSDDLPKIGRIL
FT                   AKAGFREFQDKSALDEEGLKILKECFKNEKVLNKLQDIAVELKQELTDWNKVTSNILDM
FT                   LVTDKNFQKFFNAKSKDITHYIRTGVTEILPSDYIKSFDDILQKPEKKKLLKIFNTHPD
FT                   VKQELVNNINNPNILKKFNKLFYEQEIILSSFLKEVKAQSKPFLQEYFESYKIDLKILD
FT                   IIPTLLNKIPEIKEIFDTLNDPNQGVMISLEKALAMVAGDDQLKNFFANNKTILPNIAL
FT                   GIIENTPSVQNITKEYNFDKQMLIIVGEVMSKPEIAYEIITDLNKGDYMSLTGNIISII
FT                   NDPSFKLKDILVEQSKKGLFDNLINGVLAQDEKNSQIIKQQLINYGMEASDVTKLTRIM
FT                   PILLDKPESLKNVFRDFIKGNYTQMTKELIVLTKDNPEIKEYLNNNRTIFANILDKTLS
FT                   DIPGINNLDKQELYNVLPSMLNYPGELVKIIEEVEKSNYHGAISAIYDLAQKTNYFEGQ
FT                   LPNIIKAGFNSGFNYATEKVKDIFSSSQDFKDKAIDEITIRTNLDKIRNRKFNLEGAIL
FT                   SGNLSNIDFSGVSLKNADLTQVTSLRDCNFKNTNLVDAKLPDNLIIFTDTYNLDKTIPT
FT                   LAPKLIKAQQAKLVDKAIDKVFVQIKAEDKRNLVSKKEFVQQVKILLEENQIVKDYIID
FT                   KLNSLPMNMVTNLETPKINQYKHITNHVNSPFQILNPLYENIANQQDIKSNLFANILSE
FT                   KISKKLFDKGDNRGEDFYLINQMLKSIVAEYSKPNQNNIDNFLEHQNLEKLASNIASTF
FT                   YSKSKYTLLGTITSGIYLPKEIFNEQLKDNLKNEFKKINTSDVLKEAKSIVSNLDSKVH
FT                   IVDNKNKSHTYKSVLTKNQKIHR"
FT   gene            complement(636488..637462)
FT                   /gene="nrdB"
FT                   /locus_tag="RT0497"
FT   CDS_pept        complement(636488..637462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdB"
FT                   /locus_tag="RT0497"
FT                   /product="Ribonucleotide reductase"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:RT0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03969"
FT                   /db_xref="GOA:Q68WM3"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WM3"
FT                   /protein_id="AAU03969.1"
FT                   /translation="MSLLDASPIYKPFSYPWAYEAWHTQQKIHWLPEEVPLAYDVKDWK
FT                   YNLTPGEKHLLTQIFRFFTQADIEVNNCYMKHYSRVFKPTEVLMMLSAFSNMETVHIAA
FT                   YSHLLDTVGMPEVEYSAFLKYKEMKDKYDYMQQFGVDNKEDIATTLAVFGAFTEGLQLF
FT                   ASFAIMLNFPRFNKMKGMGQIIAWSVRDETLHTNSIITLFKTFVRENPEVWTETLRKRI
FT                   YEACTTIVHFEDAFIELAFEVGGIEGLTAYEVRQYIRYIADRRLMQLGLKDVYLVNHNP
FT                   LPWLDEMLNGVEHTNFFENRATEYSKAATTGSWEEVFAEMDNK"
FT   gene            complement(637628..639451)
FT                   /gene="nrdA"
FT                   /locus_tag="RT0498"
FT   CDS_pept        complement(637628..639451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdA"
FT                   /locus_tag="RT0498"
FT                   /product="Ribonucleotide reductase"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:RT0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03970"
FT                   /db_xref="GOA:Q68WM2"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WM2"
FT                   /protein_id="AAU03970.1"
FT                   /translation="MNMLKKNKFQITINNKYNNLLTPFGKAILRDRYLMKGEDFQDLFA
FT                   RVSSYYAENKQHAQKLYEYMSQMWFMPATPILSNGGTERGLPISCFLNETDDSLDDIVN
FT                   LWMENVWLAARGGGIGSYWGNVRSINEAIRDKGHSSGIIPFIKVMDSMTLAISQGSIRR
FT                   GSSAVYLPINHPEIEEFIDIRRPTGGDVNRKSLNIHHGITITDEFMQAVENNMDFDLVS
FT                   PATKKVANKVRARDLWIKLLTTRIETGEPYLLFIDSVNKTIPAHHKKLGLQVKMSNLCS
FT                   EITLPTGIDHLGKSRTAVCCLSSLNLEYYEVWKDDKEFIHSIMLFLDNVLEDFINKAPN
FT                   TMARAKYAAFRERSVGLGVIGFHSFLQMKKVPIESVMAKVWNKKIFEYISSEVDKASIE
FT                   IAKDKGACPDALDSGSNERFSNKTAIAPTASISVIAGNASPGIEPFAANSFVQKTLTGS
FT                   FNVRNKHLEQLLEEKGFNNDQVWSSIATHEGSVQHLTFLSEEEKQIFKTAYEIDQNWLI
FT                   ELAADRTPYITQSQALNIFLHGNVSKKYLNNIHFKAWKKGIKSLYYCRSTSIQRADKVS
FT                   HDVLKADFKDLEKQNAKLAQTRNYEECLACQ"
FT   gene            640260..640412
FT                   /locus_tag="RT0499"
FT   CDS_pept        640260..640412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03971"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WM1"
FT                   /protein_id="AAU03971.1"
FT                   /translation="MQKSVIANVHILISLLFTDQLYRYHQYLNLLHTIMHTKLFASYTS
FT                   LYKNT"
FT   gene            640916..641920
FT                   /gene="trxB2"
FT                   /locus_tag="RT0500"
FT   CDS_pept        640916..641920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB2"
FT                   /locus_tag="RT0500"
FT                   /product="NADP-thioredoxin reductase"
FT                   /EC_number="1.8.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:RT0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03972"
FT                   /db_xref="GOA:Q68WM0"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WM0"
FT                   /protein_id="AAU03972.1"
FT                   /translation="MYNTDIVIIGSGPVGLFAVFQAGMLGMKCHVIDAQEVIGGQCITL
FT                   YPEKHIYDIPAYPKITAKELIEQLKSQAAPFNPVYHLNQQAIELNKHNDFFEIKTSKNT
FT                   IIKSKVIIIAAGAGAFGPNKPPLANIEDFEGKSIFYFINDKSKFLGKNIVVAGGGDSAV
FT                   DWTIALSEIANKIYLVHRRDKFTAATESIRQLRHIAETGKIELVTGYQLNNLDGHNNEL
FT                   QAVIVKDLQNNIRKLDANILLPFFGLKQDLGPLANWGLNVKLQHIEVDNYYYQTNIKGI
FT                   YAIGDVAHYVGKLKLIITGFAEAAHSINHAYSRVFDGKALHFEYSTNKYEQKQ"
FT   gene            642111..642968
FT                   /gene="folD"
FT                   /locus_tag="RT0501"
FT   CDS_pept        642111..642968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="RT0501"
FT                   /product="methylenetetrahydrofolate dehydrogenase (NADP+)"
FT                   /EC_number="1.5.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:RT0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03973"
FT                   /db_xref="GOA:Q68WL9"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WL9"
FT                   /protein_id="AAU03973.1"
FT                   /translation="MNNIIDGKALANEILADLKLEIQGFKEKTQTSPKLAIVLVGDNPA
FT                   SMIYIKNKIKNAQQVGIDTLLVNLSTNIYTDDLISKINELNLDKEISGIIVQLPLPSSI
FT                   DENKILSAVLPSKDSDGFHPLNVGYLHSGINQGFIPCTALGCLAVIKKYAPNLNGKDAV
FT                   IVGRSNIVGKPLSALLLKENCSVTICHSKTCNLSSITSKADIVVVAIGSPLKLTAEYFN
FT                   PESIVIDVGINRISNNKIIGDVDFENVKSKVKYITPVPGGIGPMTIAFLLKNTVKAFKN
FT                   AIAL"
FT   gene            complement(643047..643604)
FT                   /locus_tag="RT0502"
FT   CDS_pept        complement(643047..643604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0502"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03974"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WL8"
FT                   /protein_id="AAU03974.1"
FT                   /translation="MLIIPYKGIIPKIAKSAYIAKNSSLIGDVVIGNNSSIWFNTVLRG
FT                   DVESIKIGNNTNVQDGSVIHTSRFNGPVEIGNNITIGHLSLIHACTIHNNAFIGMSTTI
FT                   MDNAVIEEYAFIAAGSLVPSKKIIKSNELWMGSPAKFIRYLTDQDLQYMEDNIRNYVEL
FT                   ANLYKTQSQCTLHSINNCKKLS"
FT   gene            complement(643815..644165)
FT                   /locus_tag="RT0503"
FT   CDS_pept        complement(643815..644165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0503"
FT                   /product="probable sigma(54) modulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03975"
FT                   /db_xref="GOA:Q68WL7"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WL7"
FT                   /protein_id="AAU03975.1"
FT                   /translation="MIISVSGQHISIGSNLQEYAKVRATQGIKKYLTDLINIDIHFSKE
FT                   GINFKCDIIVKYGSGKYNIVKSNDMCNDIYLAFDKAMSKLEKQLRKYKSKFKNHHAGKV
FT                   KISEISYEGTNI"
FT   gene            644665..644741
FT                   /gene="tRNA-Asp"
FT                   /locus_tag="RT0504"
FT   tRNA            644665..644741
FT                   /gene="tRNA-Asp"
FT                   /locus_tag="RT0504"
FT                   /product="tRNA-Asp"
FT                   /note="codon recognized: GAC"
FT   gene            complement(645384..645518)
FT                   /locus_tag="RT0505"
FT   CDS_pept        complement(645384..645518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03976"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WL6"
FT                   /protein_id="AAU03976.1"
FT                   /translation="MENTFAVYINYKCDNTSSNVLYFDQMHQVLIDMWYKILKMDAAC"
FT   gene            complement(645793..645868)
FT                   /gene="tRNA-Ala"
FT                   /locus_tag="RT0506"
FT   tRNA            complement(645793..645868)
FT                   /gene="tRNA-Ala"
FT                   /locus_tag="RT0506"
FT                   /product="tRNA-Ala"
FT                   /note="codon recognized: GCC"
FT   gene            complement(646091..646696)
FT                   /gene="clpP"
FT                   /locus_tag="RT0507"
FT   CDS_pept        complement(646091..646696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="RT0507"
FT                   /product="Caseinolytic protease"
FT                   /EC_number="3.4.21.92"
FT                   /db_xref="EnsemblGenomes-Gn:RT0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03977"
FT                   /db_xref="GOA:Q68WL5"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WL5"
FT                   /protein_id="AAU03977.1"
FT                   /translation="MSYIPVVIEQTSRGERAYDIYSRLLKERIIFVCSTVEDHMANLIV
FT                   AQLLFLEAENPKKDIYMYINSPGGVVTAGLAIYDTMQFIKPKVATLCIGQACSMGSLLL
FT                   CGGEHGMRYSLPHSRIMIHQPSGGYKGQATDIEIHARETLKIKKLLNELYSKHTEQALK
FT                   HIEKSMERDNFMSPGEAKKFGLVDNIISSRDAMALLHK"
FT   gene            complement(646852..648558)
FT                   /gene="rpsA"
FT                   /locus_tag="RT0508"
FT   CDS_pept        complement(646852..648558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsA"
FT                   /locus_tag="RT0508"
FT                   /product="30S ribosomal protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:RT0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03978"
FT                   /db_xref="GOA:Q68WL4"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WL4"
FT                   /protein_id="AAU03978.1"
FT                   /translation="MSIKLKQRFVPQLAAINYQFEEDFSKMLKTVDTSHIKEKTVVKGQ
FT                   VIEIKNDMIIVDVGLKNEGRIPKSEFLSLPEVGDVVEVFIEKIEGRNGRTILSREKAVK
FT                   EELWGQLEIMCSKGEFVDGTIFGRVKGGFTVDLSGVVAFLPGSQVDVRPIKDPTSIMNI
FT                   KQPFKILSMDKKLGNIVVSRRVILEESRSEARDEMLSKIKEGMILEGVVKNITDYGAFI
FT                   DLGSVDGLLHLTDISWGRVNHPSEVLEFNQKVKVMVIKFDEKTKRISLGIKQLDSNPWD
FT                   AIKEEFPVGKKMTGKVTNFADYGVFLELKDGLEGLVHSSEISWLKSNQNPRKMLTIGQE
FT                   VEFIVLEVDTEKHRVSLSIKQCQENPLIKFAENNPIGTIIKAPIRNITDFGIFVVLGNN
FT                   MDGMIHEGDISWEDNGTDLLKSYKKGDEIECKVLAINFEKEQVSLGIKQLSPNPYQKIS
FT                   DEYKKGTIVKAVVTEIKDDGLVVLLNNKVTGFIKRVELSDEKDEQKPEMFQVDEEIDAK
FT                   VVSIEKSTGRVLLSVKAHKIAERQKTLKEYGSSDNTTNMGDILANVLEEKK"
FT   gene            complement(648809..649468)
FT                   /gene="cmk"
FT                   /locus_tag="RT0509"
FT   CDS_pept        complement(648809..649468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmk"
FT                   /locus_tag="RT0509"
FT                   /product="CMP kinase"
FT                   /EC_number="2.7.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:RT0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03979"
FT                   /db_xref="GOA:Q68WL3"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WL3"
FT                   /protein_id="AAU03979.1"
FT                   /translation="MVDLKTKAFDIAQNFTISLDGPAASGKGTIGLILAKKFALKYFQS
FT                   SIVYRQLAFNCIHQQIDITDIDAVIALSQELKLDNNIDLENEDIGDIASKIAVISEVRN
FT                   NLNHNLINLVKTTPRIIMEGRDIGTVVAPDADLKIFITASPYVRAVRRYNQLQAKGKTC
FT                   ILDEIIQQIILRDKRDKERKVGPLLPALGAFIIDTSKLSAIEVVEEVTNYIKNKIT"
FT   gene            649921..649997
FT                   /gene="tRNA-Val"
FT                   /locus_tag="RT0510"
FT   tRNA            649921..649997
FT                   /gene="tRNA-Val"
FT                   /locus_tag="RT0510"
FT                   /product="tRNA-Val"
FT                   /note="codon recognized: GUC"
FT   gene            complement(650083..650663)
FT                   /pseudo
FT                   /locus_tag="RTPG27"
FT                   /note="pseudogene of hypothetical protein RC0754"
FT   gene            complement(651272..651514)
FT                   /gene="ihfB"
FT                   /locus_tag="RT0511"
FT   CDS_pept        complement(651272..651514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ihfB"
FT                   /locus_tag="RT0511"
FT                   /product="integration host factor beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RT0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03980"
FT                   /db_xref="GOA:Q68WL2"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WL2"
FT                   /protein_id="AAU03980.1"
FT                   /translation="MATKNYLIDKVHDKLNYLSKQDVKESVDLILDYLNESLKEQKRIE
FT                   IRNFGNFSIRKRKFPESNKFYNTVYYRMPKNLFKD"
FT   gene            complement(651514..652428)
FT                   /locus_tag="RT0512"
FT   CDS_pept        complement(651514..652428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0512"
FT                   /product="probable protease IV"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03981"
FT                   /db_xref="GOA:Q68WL1"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WL1"
FT                   /protein_id="AAU03981.1"
FT                   /translation="MSITPDYLIERRQLKSRLLIWKLADIILIAIICLLISKDFVQKQI
FT                   LSINSNEDYIASVLIDGIILEDEKRDKKLKKIIDNSHIKALIVNVNSPGGTVVGSEKIY
FT                   NILRKISAKKPVVVVMGTMATSGGYLISLGGDYIISHNGTITGSIGVILQTAEVTELAQ
FT                   KLGIKFNNFKSGAFKAVPNPTEKLTEEVRVAVMENIEDTYKFFIELVSERRSLPIEEVH
FT                   KLADGRVYSGRQAFKLRLVDTIGSEDTALKWLQEIKKIDINLTVKDYQLKPKSTLIEIM
FT                   FEDFTSLVLSFFKNSFNGIKSIS"
FT   gene            complement(652567..653919)
FT                   /gene="rho"
FT                   /locus_tag="RT0513"
FT   CDS_pept        complement(652567..653919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="RT0513"
FT                   /product="transcription termination factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:RT0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03982"
FT                   /db_xref="GOA:Q68WL0"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WL0"
FT                   /protein_id="AAU03982.1"
FT                   /translation="MTEELNNTESNNDHNDFAENNIINLKQLKRKLPEELQVQAEELKI
FT                   ENISSLLKQELVFAILKKSVEQGGLIVGDGVLEVLPDGFGFLRSPEVNYLAGPDDIYIS
FT                   PSQIRRFGLRTGDTVEGQIRAPKAGERYFALLKVNRVNFDDPVNAYHRVHFDNLTPLYP
FT                   DEKLGLELENNSKDSKDFSTRVIELVAPMGKGQRALIVAPPRTGKTVLLQNIAHAITTN
FT                   NPEVFLIVLLIDERPEEVTDMQRSVRGEVVSSTFDEPASRHVQLAEMVIEKAKRLVEHK
FT                   KDVVILVDAITRLARAYNTVVPSSGKVLTGGVDANALQRPKRFFGAARNIENGGSLTII
FT                   GTALIETGSRMDEVIFEEFKGTGNSEIVLDRKIADKRIYPAIDITRSGTRKEDLLVDKI
FT                   ILNKMWVLRRIIDPMGSSEAIEFLLKKLENTKTNYEFFEMMKSPERSRNGL"
FT   gene            complement(654254..655576)
FT                   /locus_tag="RT0514"
FT   CDS_pept        complement(654254..655576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0514"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03983"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WK9"
FT                   /protein_id="AAU03983.1"
FT                   /translation="MNNLKKIKNITISKDLAEVQEHYQDYPYPFRDPNHEKERLLAICG
FT                   EFLGELNHFLYKGKENFNNNFRCLIAGGGTGDSTIYLAEQLKDKNAEIIYLDFSKPSME
FT                   IAQKRAEVRGLKNIKWINNSILNIPNLKLGKFDYINCTGVLHHLANPDEGLKNLKASLK
FT                   PTGGMGLMVYAKYGRTGVYQIQDLMKMINKDTKNRIEEIMNGKLILDNLPATNWYKRGC
FT                   DLFSDYQNFGDIGVYDMFLHKQDRAYSIPELYEFIAKADLNFVDYLDPLEKILLRTENY
FT                   IKDFTLLQKVKKMDKVTQEAISEILTGNIIKHSFYVSNQKDSVASLDNLDNIPYFHNIF
FT                   NFAKQIYEYLESNSSSINNVINFTINNGILNNVNISMSIFRSTKYIFKYMIEEKSLREI
FT                   FDAVRSELNQEISDEALLNEVKNVFMPLLNTNVLLLKSKDL"
FT   gene            complement(655603..657363)
FT                   /gene="recJ"
FT                   /locus_tag="RT0515"
FT   CDS_pept        complement(655603..657363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recJ"
FT                   /locus_tag="RT0515"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03984"
FT                   /db_xref="GOA:Q68WK8"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WK8"
FT                   /protein_id="AAU03984.1"
FT                   /translation="MKPQISINGKIWKQKQIKEDIVTELCRSFKISDLLARIVSLRVNN
FT                   LAEVENFLIPKIKNLLPDPFHLLDMDKAVDRIVQAIVHNQQICIFADYDVDGATSAALL
FT                   KHLLRDLNIICDIYVPDRIYEGYGPTPLAIQKIKDNGTELLITVDCGAMAHDALKYAKD
FT                   VKLDVIVIDHHISTAILPDAVAIVNPNRIDETSEYKYLAAVGVTFLFATAILSNLKKRN
FT                   YFSQSIPTPNLMQYLDLVALGTVCDMMKLTGLNRAFVATGLKVMQQRQNIGIKTLYDIA
FT                   GINEIPQCYHLGFILGPRINAGGRVGKSNLGANLLATSCHNEASKLANELEKYNNERKV
FT                   IELLMIDEAIDIALTQKDSSLLFVVKEGWHPGVIGIVAGRLKEKFDKPVAVVALNNGIG
FT                   KASCRSILGIDFSAEIINAKSKDLIIAGGGHAMAAGFTVTAGKLEELQDFLNNAFSISI
FT                   NKLANYKHAEYDIDLTVNSVNFYLMEELKILEPFGSGNHEPIFKFDDLFILKADIVGSK
FT                   HIKCMLAPDKRGFGNKVLSAIAFDAVGTPFEDILLSSRAKHISAIGTLKTNNWKDNYTI
FT                   QLIIKDLLLK"
FT   gene            complement(657468..658535)
FT                   /gene="prfA"
FT                   /locus_tag="RT0516"
FT   CDS_pept        complement(657468..658535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="RT0516"
FT                   /product="peptide chain release factor 1 (RF-1)"
FT                   /db_xref="EnsemblGenomes-Gn:RT0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03985"
FT                   /db_xref="GOA:Q68WK7"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WK7"
FT                   /protein_id="AAU03985.1"
FT                   /translation="MSFSDNLVKILDKYENLGRKLSSGIIGDEFVKASKEYAELEDIVV
FT                   KIKEYNKVKSELEEANNLRLEVALDNATLEMINNEIYILENLLPKLERAVRISLLPKDE
FT                   ADSKSAIIEVRAGSGGEEAALFAAVLFNMYQRYAEFKGWRFEILAISNTGIGGYKEASA
FT                   SIKGKDVFSKLKFESGVHRVQRVPETESQGRIHTSAATVAVLPEAEGVDIKIEDKDLRI
FT                   DTYRSSGAGGQHVNTTDSAVRITHIPTGITVALQDEKSQHKNKAKALKILRARLYEEKR
FT                   RQKEQERSDSRRWQVGSGDRSERIRTYNFLHGRVSDHRINLTLYKIDEVVKHGQLDEFI
FT                   EALIANDEAKKLSEL"
FT   gene            complement(658717..659931)
FT                   /gene="pdhC"
FT                   /locus_tag="RT0517"
FT   CDS_pept        complement(658717..659931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhC"
FT                   /locus_tag="RT0517"
FT                   /product="Lipoate acetyltransferase"
FT                   /EC_number="2.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:RT0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03986"
FT                   /db_xref="GOA:Q68WK6"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006257"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WK6"
FT                   /protein_id="AAU03986.1"
FT                   /translation="MPIKILMPALSPTMKDGNLARWLKKEGDKVNPGEVIAEIETDKAT
FT                   MEVESVDEGILAKIIIPQNSQNVPVNSLIAVLSEEGESTADIDAFIAKNNSVSLSLKTD
FT                   TTLKKANESITNVEVVKHDLSKIFASPLAKRLAKIRNIRLESVQGSGPHGRIVKQDILS
FT                   YSPSTAYNRDTEEYRSVPNNNIRQIIAKRLLESKQTVPHFYLSIECNVDKLLDIREDIN
FT                   KSFSEDKLTKISVNDFIILAVAKALQEVPNANASWAEDAIRYYNNVDISVAVAIENGIV
FT                   TPIIKDANKKNIIELSHEMKILIKKAKDNKLTPVEFQGGGFTISNLGMYGIKNFNAIIN
FT                   TPQSCIMGVGASTKRAIVKNDQIIIATIMDVTLSADHRVIDGAVSAEFLASFKRFIEHP
FT                   VLMLI"
FT   gene            complement(660053..660610)
FT                   /gene="infC"
FT                   /locus_tag="RT0518"
FT   CDS_pept        complement(660053..660610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="RT0518"
FT                   /product="translation initiation factor IF-3"
FT                   /db_xref="EnsemblGenomes-Gn:RT0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03987"
FT                   /db_xref="GOA:Q68WK5"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WK5"
FT                   /protein_id="AAU03987.1"
FT                   /translation="MYLFVNIIWRNFISKNNLPKANREIRAREVRLVDENSEMHGVVNI
FT                   REALDMAERAGLDLVEISPNAVPPVCKILDFGKFKYENKKRLHEARKKQKIVVLKEMKF
FT                   KPNISIGDFETKLRKIKEFLKDGDKVKISLWFKGREILHKEVGHELFKRIELALEGLIK
FT                   IDQHAKMEGKQMIMIISPDIKV"
FT   gene            complement(660661..660993)
FT                   /locus_tag="RT0519"
FT   CDS_pept        complement(660661..660993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0519"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03988"
FT                   /db_xref="GOA:Q68WK4"
FT                   /db_xref="InterPro:IPR019284"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WK4"
FT                   /protein_id="AAU03988.1"
FT                   /translation="MKETKRFFNKNNRLNKGYAKTFSINEPDNNFYRKKFEHILPPIDL
FT                   ISEYENIYPGTLQELMHMAQKEQAHKHAIDLKHLKIQERIAKLTRICLLIFGIGLVVLI
FT                   YLKLFK"
FT   gene            complement(660968..661153)
FT                   /locus_tag="RT0520"
FT   CDS_pept        complement(660968..661153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0520"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03989"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WK3"
FT                   /protein_id="AAU03989.1"
FT                   /translation="MKRSFIKLVYIELKNIINMQSFKQQKKRERQLIDYFKIVESNILY
FT                   TFRKIKKEYERDKTFF"
FT   gene            complement(661620..662408)
FT                   /gene="birA"
FT                   /locus_tag="RT0521"
FT   CDS_pept        complement(661620..662408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="birA"
FT                   /locus_tag="RT0521"
FT                   /product="Acetyl-CoA carboxylase biotin holoenzyme
FT                   synthetase"
FT                   /EC_number="6.3.4.15"
FT                   /db_xref="EnsemblGenomes-Gn:RT0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03990"
FT                   /db_xref="GOA:Q68WK2"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WK2"
FT                   /protein_id="AAU03990.1"
FT                   /translation="MNIGKFKLIVFDEIDSTSSEAMRIAKHNKVYADYAIFAKSQTSGR
FT                   GRSGKNWQSRSGNLHVSLLIRPEKELELLPQLSFVTALAVYNTILSCVLCVGSNQLINN
FT                   FNAMSVCAQNYSIQLKWPNDVLMNGRKIAGILLESVKVDNNYYLIIGIGINITYHPENI
FT                   DQPTTSLITENIIHVVPQALLKILIQNFEKYYQIWQNNGFSFIRKKWIEHAYKLYENIN
FT                   IKYQNGIVTGLFKDIDNTGRIILQLNSQKIISFSTVEFYF"
FT   gene            complement(662594..664348)
FT                   /locus_tag="RT0522"
FT   CDS_pept        complement(662594..664348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0522"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03991"
FT                   /db_xref="GOA:Q68WK1"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WK1"
FT                   /protein_id="AAU03991.1"
FT                   /translation="MKQEFKTSVFNEQSEILEQLEYITKDQNSSINQIKTLYELEKAQK
FT                   APIEYIAFSGGGAKGAIYSGVYEAAKKAGILDNVKAVAGSSVGAITAAVVALGTPPKRF
FT                   EEISKNTNLQTLFGKQGFSAGMIQLNKDGTPLYDLMELIIKENIGNFLHRSDIVNVKND
FT                   KALNELRARYNQKDGKIYFKDIALLRKYDPVQYKDLVITATQRETSALTIFNSFDTPNV
FT                   EIALACRASASIPIVFKPVEIDGKKYVDGGYRDNIPTKYFKDNEPEFCIQEVTDNLEEI
FT                   TLAKKQGRTLAMAFGTGMGADANIAIYSAKNFDSPSDIIKFLVDVLFKIIAQVGGKFKY
FT                   TETLRATNEQLRENSLNTVVLDTAGIDTLDFKDAQKYSDYLHIKGYCQTLEHLNNHDLT
FT                   TKIDKTFDHQKFLLNVYEVYNNKNLHKTFGTKLFGMFIPSKDNNTSKWQDGIIETHNDK
FT                   AKMLLSFCKIGLLTEEKLNEKLREYVIIAATSRNNTIKTDTNSLNALLYTLNTSVASSK
FT                   IKDSFIEVLEIDKNKDTRFDKTKTFDYNIANFQFTKKDLESFLAKKKSAALKIQHKYDL
FT                   VRNHRNRW"
FT   gene            complement(664397..665026)
FT                   /gene="sodB"
FT                   /locus_tag="RT0523"
FT   CDS_pept        complement(664397..665026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sodB"
FT                   /locus_tag="RT0523"
FT                   /product="superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RT0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03992"
FT                   /db_xref="GOA:Q68WK0"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WK0"
FT                   /protein_id="AAU03992.1"
FT                   /translation="MTYCRKANQTSYPFILPDLPYAKESFKPHFTCETFDYHHGKHHNS
FT                   YVQNLNNLLKDREELQKKDLEGIIKWSSKNSEVTVFNNASQIWNHTFFWYSIKPHGGGK
FT                   PSGKVFEQISQDFGSFEQFCEQFKQEALGQFGSGWVWVVYNNNKLQIIKTSNADTPIVN
FT                   LMKPILVCDVWEHAYYIDYRNKRSDYIDIFISHMINWKFVEDNLIQ"
FT   gene            complement(665120..666421)
FT                   /gene="folC"
FT                   /locus_tag="RT0524"
FT   CDS_pept        complement(665120..666421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /locus_tag="RT0524"
FT                   /product="Folate polyglutamate synthetase"
FT                   /EC_number="6.3.2.17"
FT                   /db_xref="EnsemblGenomes-Gn:RT0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03993"
FT                   /db_xref="GOA:Q68WJ9"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WJ9"
FT                   /protein_id="AAU03993.1"
FT                   /translation="MLMPHFPLPTWQNQVKYDLDNIKRLLKVLGNPHLSLPPVIHIAGT
FT                   NGKGSSSAMLKSIFTVAGYKVHCYTSPHLLEFNERIIVAGEKISDNALWQVCEHVRIVS
FT                   EKFNIEASFFEGTTAAAFLAFAQTKADILILETGLGGRLDATNIFEHPLITLITPISYD
FT                   HMNVLGNTLQMIAVEKAGIMKACVPCVISMQTLGVYATLFARAQELDVPTFCYEYDFGI
FT                   QKTDNGFIYASRNFTYEFPSPSLLGDHQLINAASVIALISLINQQFYISNAIISKGLQN
FT                   TVWQARIEKIEPQKYSKLIGENVQIWVDAAHNNSGAQVLANWVRVNLKSPIYLILGMTK
FT                   NRDIKAFCSYFNDLTIKGYGVKVLSEPLSHSAAIINLEGRKSGIDFSESDSLEAAISDI
FT                   NKRNGDNKTNIIITGSLYLASDFYKLLSNCYQIA"
FT   gene            complement(668721..668858)
FT                   /locus_tag="RT0525"
FT   CDS_pept        complement(668721..668858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03994"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WJ8"
FT                   /protein_id="AAU03994.1"
FT                   /translation="MSDMFGLRVDNKGFDSESIKIFIMLKELGVLSLFGFSYPNKRNVS
FT                   "
FT   gene            669638..671014
FT                   /gene="nuoN"
FT                   /locus_tag="RT0526"
FT   CDS_pept        669638..671014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoN"
FT                   /locus_tag="RT0526"
FT                   /product="NADH dehydrogenase (ubiquinone) subunit N"
FT                   /EC_number="1.6.5.3"
FT                   /note="Coenzyme Q reductase; Complex 1 dehydrogenase;
FT                   Complex I (NADH:Q1 oxidoreductase); Complex I (electron
FT                   transport chain); Complex I (mitochondrial electron
FT                   transport); DPNH-coenzyme Q reductase; DPNH-ubiquinone
FT                   reductase; Dihydronicotinamide adenine
FT                   dinucleotide-coenzyme Q reductase; Electron transfer
FT                   complex I; Mitochondrial electron transport complex 1;
FT                   Mitochondrial electron transport complex I; NADH coenzyme
FT                   Q1 reductase; NADH-CoQ oxidoreductase; NADH-CoQ reductase;
FT                   NADH-Q6 oxidoreductase; NADH-coenzyme Q oxidoreductase;
FT                   NADH-coenzyme Q reductase; NADH-ubiquinone oxidoreductase;
FT                   NADH-ubiquinone reductase; NADH-ubiquinone-1 reductase;
FT                   NADH:ubiquinone oxidoreductase complex; Reduced
FT                   nicotinamide adenine dinucleotide-coenzyme Q reductase;
FT                   Type 1 dehydrogenase; Ubiquinone reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RT0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03995"
FT                   /db_xref="GOA:Q68WJ7"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WJ7"
FT                   /protein_id="AAU03995.1"
FT                   /translation="MLLILPEITLTLIALLGQCFALMIPNKNKIIYNIVILLCIISIFL
FT                   TFKYSSYEGIWHSFATGINIGISKSIVLLFTIVSLIIYRDYSNLIGEAIKFEFITLILL
FT                   SIVGIFVAISSRNFLLLFCGMELTALTSYALAGFKLDDIQSSEGALKYFILGSLVTCLS
FT                   LFGISFIYGFGGSIQFEDILHQLNNNSEIKPGLIIGIVLFLSSIFFKLASSPLHFWIPD
FT                   VYEGSPISSITYFTSAAKIGMVIVLFNISKLIIGNYYPINYNLIKIIAILSMLFGAFGA
FT                   IQQTSLKRLMAYSTILNIGYVLIGVILPNQEGYKAALLYILIYAVVSIGFFTCLIMLFG
FT                   KDVDKASFKTIQGIAETHKTIAALISIVMFSMIGIPPLTGFFGKYYLFYQAINKQEFTL
FT                   AYCGIFTSVVAAFYYLKVVKAMYFSKKNSIIKLPIQYGLLLINYLVLVFLLFGSFIILF
FT                   "
FT   gene            complement(671001..672536)
FT                   /locus_tag="RT0527"
FT   CDS_pept        complement(671001..672536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0527"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03996"
FT                   /db_xref="InterPro:IPR040519"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WJ6"
FT                   /protein_id="AAU03996.1"
FT                   /translation="MIQNKKSVFKGWNFLKPKLGGMNEAGEYGGVYQSSDGKITALIKK
FT                   ERSSSKNIAEFLGSQIFEAISPGNGAKVNLIAPDDFNKSKSVDSQIYVKSEFFENYSSD
FT                   MYIDMDKYMSAKTKPSSWFRKDGGRPLFMGSRNKLFRTLENAFKEIKYQNFEKIMPASL
FT                   LIGDFDVHLGNIGVIRNKKKPKTLPHLVRIDFGGSFDNLTDNIYPHSRIRHLPGFGPTN
FT                   HFREFPSSLRTKNPHFADSLLAASKIDLSKIIDQSFDKLTKYYSNEAITKFAQRAMPKK
FT                   FNNKSHEITIEEIKASLIDIMKKRQVSLKEYGLEIKINTLISKKYRFPYYEVKKQELKT
FT                   LIKEYPDYFAKILNYTKSKNGSLKLKFRDKLTTNFVRILKKFCIRNSVKKHLIKTIESL
FT                   NEDIKYESNLANSSDKRKNASKTVKTDRYGKSEYVDSLAKFYQAGGMDDIVCVTPSKLG
FT                   LISKAKQQDQDLLKLDVEDLKQIKNLKEKLMTPIKITESSVILNKKPTLTKIR"
FT   gene            complement(672613..673605)
FT                   /gene="hemB"
FT                   /locus_tag="RT0528"
FT   CDS_pept        complement(672613..673605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="RT0528"
FT                   /product="Aminolevulinate dehydratase"
FT                   /EC_number="4.2.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:RT0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03997"
FT                   /db_xref="GOA:Q68WJ5"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WJ5"
FT                   /protein_id="AAU03997.1"
FT                   /translation="MYPIIRFRRNRKALWLRELIAESNLSISDLVLPLFVVEGHNVKQE
FT                   IKTMPGIYRLSIDQIVETAKKAADFGINAIALFPSIDHSLKSDNADEAYNLDNLICRTI
FT                   IEIKNANIDIGIICDVALDPYTTSGHDGIVYHGEVDNDISVKALCNQALVLAKAGVDIV
FT                   APSDMMDGRIAAIREYLDKAGFINVGILAYAAKYASSFYGPFRDAVQSNKKNYLDKSSY
FT                   QIDVRNIKEAMLEIEHDIAEGADIVMVKPGMPFLDVIREAANNFNAKIFAYQVSGEYAM
FT                   LKFAAEAGAINWERALIESLISFKRAGATGIFTYAAFEVAEVLKNNNIK"
FT   gene            complement(674309..676255)
FT                   /gene="priA"
FT                   /locus_tag="RT0529"
FT   CDS_pept        complement(674309..676255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="RT0529"
FT                   /product="primosomal protein N prime"
FT                   /db_xref="EnsemblGenomes-Gn:RT0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03998"
FT                   /db_xref="GOA:Q68WJ4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WJ4"
FT                   /protein_id="AAU03998.1"
FT                   /translation="MRIAKILLPVSKLFPLDYLITEDLELNIGDLVVVHFRNQELTGIV
FT                   WELATNSEAKKIKTIKAKVPLNLNISLEVLALIKWMSSYYMSELGSIAKLVLPINIAEK
FT                   PIKIKEQQVKNYFVLPQLSEEQKQAVTIFNESNKPTLIKGVTGSGKTEIYFHIIADHLM
FT                   KGQQVLIMLPEIALSRQIINRFIDRFGFEPIIWNSSVTKAQKKMILRGILSDKVKVVIG
FT                   ARSSLFLPFHNLGLIVIDEEHDDSYKQDDNILYNARDTAIVRGVFDKAKIVLCSATPSL
FT                   ETIYNIKTHKYQLVTLVNRYKNIDLPNIEIIDMTKEKLPKNSYLSKILIDAIKGNLENK
FT                   KQVLLFLNRRGYAPLMLCKACGHRFTCRFCSAWMVLHKATKTLECHHCGYQSKIFSSCP
FT                   ECLEDETLTICGPGIERIEEEAMLLFPKSKIAVISKDHAKTPAKIAQLLHQMENLEIDI
FT                   LIGTQIITKGYHFPNLTLVGVIDADLGSNNAELRASERTFQLLHQVGGRAGRGDSKGVV
FT                   YLQSYYPDNIIFSYVKVGDEDSFFTNELEIRKAANMPPFSKTASLILSGFSESKILDIA
FT                   KNIVQIAPKANVKILGPARALMSKLAGKYRYRILIIADKKFNLQQYLKFWLSLIKIPSY
FT                   CQIKIDIDPKTFY"
FT   gene            676318..676890
FT                   /gene="ubiX"
FT                   /locus_tag="RT0530"
FT   CDS_pept        676318..676890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiX"
FT                   /locus_tag="RT0530"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /EC_number="4.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03999"
FT                   /db_xref="GOA:Q68WJ3"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WJ3"
FT                   /protein_id="AAU03999.1"
FT                   /translation="MIKNQKIIIAISGASGAIYGIRLLKVLKEQNIETHLVISDGAALT
FT                   IKFETKYSIQEVKLLANYCYDDKNLGAAISSGSFKTSGMIIAPCSMKTLASIAHSMEHS
FT                   LISRAAGVVLKERRKLILMARETPLHIGHLENMLKVASHGGIIAPPIPAFYNNPASIND
FT                   IVDHSITRVLDFFDIETNLIKRWSSDE"
FT   gene            678118..679611
FT                   /gene="dnaB"
FT                   /locus_tag="RT0531"
FT   CDS_pept        678118..679611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="RT0531"
FT                   /product="replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04000"
FT                   /db_xref="GOA:Q68WJ2"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WJ2"
FT                   /protein_id="AAU04000.1"
FT                   /translation="MVRNKINNNINIITNNDDNLSIPRVLPSNIQAEQMLLGAIITNNE
FT                   LLSYVSEFLRNEHFFEPIHQKIYDAIEKIIEKGLIATPITLRSMLTQDALFQEIEGVEY
FT                   LAKLITMSMMVINPIDYGKIIYDLAIKRNLINIGEEVVNNAYNASLAVAAKEQIEHAEA
FT                   KLYDLAREGLNEKSFTQVGISIAESLASINKAMKNNDHVIGISTGLLDLDNKLFGFHNS
FT                   DLIILAGRPSMGKTAFAINLALNTCNNMRLKNIRDNQEIKSVGFFSLEMSSEQLTTRLL
FT                   SLCAEIDSTSLRTGMLSEEKYNRLRKEANTLSELQFFIDDTPALSISAIRTRARRMKRK
FT                   HNLGILFIDYLQLIRGVSKSENRVNEISEITQGLKAIAKELNIPVIALSQLSRAVELRE
FT                   DKKPMLSDLRESGTIEQDADIVMFIYREEYYLTRKEPAAGDAKHAEWLDKLNKVYNIAD
FT                   IIIAKHRNGPVGNISLYYDSQFSKFGNLEKRTFNSILNT"
FT   gene            680777..680989
FT                   /pseudo
FT                   /locus_tag="RTPG28"
FT                   /note="pseudogene of hypothetical protein RP543"
FT   gene            680982..681710
FT                   /gene="rluB"
FT                   /locus_tag="RT0532"
FT   CDS_pept        680982..681710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluB"
FT                   /locus_tag="RT0532"
FT                   /product="Pseudouridine synthase"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:RT0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04001"
FT                   /db_xref="GOA:Q68WJ1"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WJ1"
FT                   /protein_id="AAU04001.1"
FT                   /translation="MYRLAKIISNAGVCSRRNAEKLIVGGKVKIDGITILSPATNVDIS
FT                   NQIEVSGRLINNIQKPRLWIYYKPIGLITTHKDPLSRKTVFEQLIGLPRVISIGRLDLN
FT                   SEGLLLLTNSGDLAHQFEMPSSKLKRVYNVRAYGNANFLLKNNYNNLKIDGIFYNPYSI
FT                   KLLRQNKNNSWFEVVLFEGKNREIRRIFEYFGLKVNKLIRVQYGALKIGNLKPGDYKEI
FT                   SNKILKKIISNKLTNYIDNR"
FT   gene            682218..682928
FT                   /locus_tag="RT0533"
FT   CDS_pept        682218..682928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0533"
FT                   /product="probable methylase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04002"
FT                   /db_xref="GOA:Q68WJ0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WJ0"
FT                   /protein_id="AAU04002.1"
FT                   /translation="MLKIISGKYKNQIIPTAKNIKYRPSTARLKEAIFSILTSGEFIDK
FT                   KLFNENTQILDLFAGSGSLAFESLSRGAGFATLIDIDTSALKIAAGFAKSLNIENNVHF
FT                   ININALNLQKTTRYLTKQTYRNEFINTATSYIGISEHKNTNMAYKLRLKSQFWDMSNKA
FT                   FDLVFIDPPYNKDIVPKVMKLLIKNNWLKNGTIIVIEMSKTDDYALDKNIEIIRTKLYG
FT                   KSKLLVLRYSDHPS"
FT   gene            683023..684360
FT                   /gene="radA"
FT                   /locus_tag="RT0534"
FT   CDS_pept        683023..684360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="RT0534"
FT                   /product="DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:RT0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04003"
FT                   /db_xref="GOA:Q68WI9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WI9"
FT                   /protein_id="AAU04003.1"
FT                   /translation="MTRDKKHYICSNCANISHKWSGQCFDCGVWGSIVEEIISTNKSII
FT                   TGSKQTFDKLSCDVSEPLRISTPISELNRVLGGGLVLGSAILIGGEPGIGKSTLLLQLT
FT                   ASNFESKMRCLYITGEESLDQIKLRAIRLNITNYNTAILAATNLEDIIASIDDNNNNID
FT                   LVVIDSIQTITTKELSSPPGTVSQIRTCANELVNYSKQNNIIILLSCHVTKDGQIAGPK
FT                   ILEHLVDTVLYFEGDHNNHFRILRSYKNRFGSIGEIGVFEMSSSGILEVTNHSELFLMK
FT                   REHNVVGTSIFAGVEGSRPLLMEVQALIVPSNMLTPKRSAVGWDANRLSMILAVLSSRI
FT                   GLNLANYEIYLSIAGGLKITDPASDLAVAASLISAATSIPLPEHSVFFGEISLSGEIRK
FT                   TAKAETRIKEAVKLGFNKVICSKLENLTYDFICSCTHLQDLKEIIK"
FT   gene            684357..684692
FT                   /locus_tag="RT0535"
FT   CDS_pept        684357..684692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0535"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04004"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WI8"
FT                   /protein_id="AAU04004.1"
FT                   /translation="MSIVYKIKNLEEARNFLYSIEEPLILTNYDSSVKYYGMLVIDYMF
FT                   KTLRREFPKKVLSLTVNVGKDHAALFTAIKLGYKNIVYIGASEEAQRLLSSLLNPSLSY
FT                   NLIRYNP"
FT   gene            684741..685451
FT                   /locus_tag="RT0536"
FT   CDS_pept        684741..685451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0536"
FT                   /product="possible RecO-like recombinational DNA repair
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04005"
FT                   /db_xref="GOA:Q68WI7"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WI7"
FT                   /protein_id="AAU04005.1"
FT                   /translation="MNIKDIGVIISKKPLKENTFIIRVFTKNHGLYSGVIKASSKKNKF
FT                   IYQEGNIVDFLWQARLHEHIGIAKCELIKSYTGYFIINKAKLYAFNSVKFLIQELFHER
FT                   EEHSIFFAFLINYLDNLSKNFCFRDYINFELNLLAETGYKIDLTKCCVSHVTTDLTYVS
FT                   PKSARALSYKVGKPYRDKLLILPKFLLSEDSKITLEEKKQALTLTNYFFNRYLFHNNRQ
FT                   VEARKEFIEYITNI"
FT   gene            686003..686680
FT                   /locus_tag="RT0537"
FT   CDS_pept        686003..686680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0537"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04006"
FT                   /db_xref="GOA:Q68WI6"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WI6"
FT                   /protein_id="AAU04006.1"
FT                   /translation="MKILAFDTANNTTSVAISENDNILKYIEALGPAMQAENLMPMIED
FT                   VMQSAQFSYDDLDYLAVTNGPGSFTGIRIGLASAKGILFAKKNIKAVVVSNFEYAYFRA
FT                   ITQVKNYDKIYVFLNAYRLQLYMQVFHKSGKREEPLLINYEYAIKCLTKEQGNIVCCGS
FT                   GLEFIYHKIMYLSHIITLPRFTRVKAWVICKYITTMLPRNIKLNNSIAPLYIRPPDAKR
FT                   TID"
FT   gene            complement(686867..687124)
FT                   /locus_tag="RT0538"
FT   CDS_pept        complement(686867..687124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04007"
FT                   /db_xref="GOA:Q68WI5"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WI5"
FT                   /protein_id="AAU04007.1"
FT                   /translation="MIRGKNHMTYLHVIPVLVLAIVIEISGNKVENFNSALATNILGND
FT                   FRFFDDVMYYCTQKFISTFSNFIVIFLDVIYLYHWRVSQA"
FT   gene            complement(687125..688408)
FT                   /pseudo
FT                   /locus_tag="RTPG29"
FT                   /note="pseudogene of hypothetical protein RC0815"
FT   gene            complement(688406..690901)
FT                   /gene="infB"
FT                   /locus_tag="RT0539"
FT   CDS_pept        complement(688406..690901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="RT0539"
FT                   /product="translation initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:RT0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04008"
FT                   /db_xref="GOA:Q68WI4"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WI4"
FT                   /protein_id="AAU04008.1"
FT                   /translation="MTDNQEIKPKKLTLGNSKLLLNKSFDSLTGVQSFVNAKSKTLVEV
FT                   RKSSIGSTTTISLNKERNSLDQTVIDSNKEEFNRRLSILKKAAEQSKLYDSAQISTLSK
FT                   LASINQSVNSKNEQFTTDKAVEQKQQDIEDTKVEIGTKIVQDDEDIRSQIPNKKKETFA
FT                   KSLLVGMRTRYGIEAESALEKIGDNKVVVPKIKLEEPKKFKKADLFNMLSDDENGSGRT
FT                   RSLASIKRAREKEKRKLVSQIPEKVYREVTIPEVIGVGDLANAMSERVADVIKELMKLG
FT                   ILANASQTIDADTAELVATNLGHTVTRVQESDVENVLINDDKVEDLRTRAPVVTVMGHV
FT                   DHGKTSLLDALKSTDIAAGELGGITQHIGAYRVTLSDCKAITFIDTPGHEAFSEMRSRG
FT                   AKVTDIVIIVVAADDGIKTQTVEAINHAKAAGVPIIVAINKIDKPDIDIERIKNELYVH
FT                   EIIGEEAGGDVIFIPISALKKINLDKLEEAILLISEMQDLKASPFGLAAGVVIESKIEK
FT                   GRGTLTTILVQRGTLRNGDIIIAGTSYGKVKKMINDKGREILEATPSVPVEIQGLNEVP
FT                   FAGDQFNVVQNEKQAKDIAEYRIRLAKEKKISVTSRSSLEELLLKASGNSKIKELPLII
FT                   KCDVQGSIEAIAGSLLKLPSDEIKLRILHSGVGPITESDVSLAHVSSAIVVGFNVRAGT
FT                   NALTAAEKTKVDIRYYSIIYNLIDDVKAIMSGMLDPIVREQYIGSVEIRQVFNITKIGK
FT                   IAGSYVTKGIIKKGAGVRLLRDNVVIHAGKLKTLKRFKDEVKEVREGYECGIAFENYED
FT                   IREGDTVEVFELVQEQRQL"
FT   gene            complement(691129..692640)
FT                   /gene="nusA"
FT                   /locus_tag="RT0540"
FT   CDS_pept        complement(691129..692640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="RT0540"
FT                   /product="transcription elongation protein NusA (N
FT                   utilization substance protein A)"
FT                   /db_xref="EnsemblGenomes-Gn:RT0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04009"
FT                   /db_xref="GOA:Q68WI3"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WI3"
FT                   /protein_id="AAU04009.1"
FT                   /translation="MSNIYNVEILQIIDSVAREKGISKEILIATVEQAIQVAGRKKYGN
FT                   EYNIKAQINRKTGEINLLRILKIVEDVEDYLTQISLEDALVKNPEAKIGDEIYEYLPPI
FT                   DYARVSAQAAKQVITQRVIEAEREKQYNDFKDRKGDIINGIVKRIEYGDIIVDLGRAEA
FT                   IIKKDQLIKGEHFKPNDRIKAYVQDVRQETKGPQIFLSRVDNKMLVKLFKLEVPEILED
FT                   IIQVKSVARDPGSKAKIAVFASDSSIDPVGSCVGIRGNRVKAVTNELNGEKIDIVLWSN
FT                   DLAQFIVNSLVPLAPSEITKILIDEDSHKVEVVVSQENQSIAIGRRGQNVRLASKLTGW
FT                   NIDIMTEEQESKRRNEEFSTSTELFMEALDVEEVIGQLLSVTGFNSVEQIASSEISTLT
FT                   RIEGFEEELAVEIKNRAIRYVDLKNEQIIKKLEELGVEQELIDILELPLELILKFAEYG
FT                   IKTIEDLGEMSVNEFKNLAPNSNITDDNIKLLIKTARHHGELKDS"
FT   gene            complement(692815..693300)
FT                   /locus_tag="RT0541"
FT   CDS_pept        complement(692815..693300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0541"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04010"
FT                   /db_xref="GOA:Q68WI2"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WI2"
FT                   /protein_id="AAU04010.1"
FT                   /translation="MQTIEQQITNIIEESLTDMGFELVLVKFKGVNTKVVEILIDSLNG
FT                   NKISIEDCTNVSRTISAILDVEDLIEDAYSLEVSSSGIERKLVKFENYNRFLGREVKVK
FT                   LKALLNGKTLYQGKIIKAENNKIYLKCAEQEVLIDFNLIKNANLVLTEEVFKKLLGS"
FT   gene            complement(693301..694041)
FT                   /pseudo
FT                   /locus_tag="RTPG30"
FT                   /note="pseudogene of hypothetical protein RC0819"
FT   gene            complement(694039..694113)
FT                   /locus_tag="RT0542"
FT   CDS_pept        complement(694039..694113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04011"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WI1"
FT                   /protein_id="AAU04011.1"
FT                   /translation="MELNNSSMEAHFVSVEKNQDSEKI"
FT   gene            complement(694675..695430)
FT                   /gene="tlyA"
FT                   /locus_tag="RT0543"
FT   CDS_pept        complement(694675..695430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlyA"
FT                   /locus_tag="RT0543"
FT                   /product="hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:RT0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04012"
FT                   /db_xref="GOA:Q68WI0"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WI0"
FT                   /protein_id="AAU04012.1"
FT                   /translation="MTKIRLDEYLLQKGLVTDITIARSLIIQGKVHNKHEQLIKSGMKV
FT                   NIHDQDIKVKLPQHNYVSRGALKLITALDYFKIEPTNLVCIDIGSSTGGFTEVLFERKA
FT                   ALIFAVDVGYGALHSKLRYNPQIKVLEKTNARYLTDKQITTKPDLIVCDASFISLTTIL
FT                   PTPLNLAKEDCMLIALIKPQFEVKKNEVENRGIIKNPLLHQKVCDKIKDWLEQEHHFQI
FT                   FGIIESPILGTKGNKEFLICGKRNMAISL"
FT   gene            complement(695583..696818)
FT                   /gene="tyrS"
FT                   /locus_tag="RT0544"
FT   CDS_pept        complement(695583..696818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="RT0544"
FT                   /product="L-tyrosine-tRNATyr ligase (AMP-forming)"
FT                   /EC_number="6.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RT0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04013"
FT                   /db_xref="GOA:Q68WH9"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WH9"
FT                   /protein_id="AAU04013.1"
FT                   /translation="MTFIEEFIYKGYLHQCTDLDQLTAITQEVKIAAYIGFDCTATSLH
FT                   IGSLMQIMILRLLQKHGHTPIVIIGGGTSKIGDPSGKEVTRKALTQEDIKRNTAGIKKS
FT                   LSKFIKFGKDQGDAIILDNAEWLDSLNYLDFLRDFGRHFSVNRMLTMDSVKLRLERSHH
FT                   LSFLELNYMLLQAYDFYYLSKHYNCILQLGGSDQWGNIVIGADLIRRISGKEVFGMTTP
FT                   LLTTASGAKMGKTAAGAVWLNEDLLSPYDYYQYWRNCEDADVIRFAKLYSELDIIELNK
FT                   FEHLVSEDINAAKKQLAYELTKLCHGERLAKLALETAVRIFEQGDIDENLHTFILAPEI
FT                   LQAGISAYKLFYNVNLARSKSEARKIIRGKGAKINDQLVEDENMTIDTNFLLDKKVIKL
FT                   SVGKKRHILVKV"
FT   gene            698354..698430
FT                   /gene="tRNA-Arg"
FT                   /locus_tag="RT0545"
FT   tRNA            698354..698430
FT                   /gene="tRNA-Arg"
FT                   /locus_tag="RT0545"
FT                   /product="tRNA-Arg"
FT                   /note="codon recognized: CGU"
FT   gene            699459..705140
FT                   /locus_tag="RT0546"
FT   CDS_pept        699459..705140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0546"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04014"
FT                   /db_xref="GOA:Q68WH8"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR001599"
FT                   /db_xref="InterPro:IPR002890"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR011625"
FT                   /db_xref="InterPro:IPR021868"
FT                   /db_xref="InterPro:IPR041203"
FT                   /db_xref="InterPro:IPR041246"
FT                   /db_xref="InterPro:IPR041462"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WH8"
FT                   /protein_id="AAU04014.1"
FT                   /translation="MKNICCKCVLTIFLYLINLQVIATSFNEKIPVYLKLTNEKMLAGK
FT                   NSLNIDLCDSRIKEWCAKPQREMGLNRQKINEYISISPDIKGEWRFGWNYNINFIPEEN
FT                   FLPNQTYKITIKDSIFPNFISLKKNNISFTSLPLLSMIKEMNYLQDNINISQKFVQTKI
FT                   AFNYPIDPKSLEERIEFIKSSTKEKLSFSIKFNTDKTEAISITNIPPLTDKKDIVSIII
FT                   KDGVKILYGDEIFTQKNVDIQNNKMMQNNIRYSYKENVLIPSLSSYLKITNSTATIVKD
FT                   DKLKPEQIIIITTNTPVSGEEVKKHLELFLLPKNKPHFLGVAGKKNYKWQSPREITDDI
FT                   LKLSEKINFELLPAVPKITNVHHFKVDTLASRTVLIKIKKGVRTLDNLTLGSDYTQIIQ
FT                   IPDNPKEVKFMSDGSILSLSGKKKLPVYSLGIDKLYVEIDKIHQQEINHLISQTNRYNI
FT                   FQNPTFINEYSFNEYNISDVFQEEVIVNSQNLNLPHYTDLDFSKYLHLEQAGRYSKGLF
FT                   LAKVYSKDNNNNIISQDKRLILVTDLGFIVKTDKTGTHHIFVSYISNGKPAEGVKADII
FT                   GLNGEILVSSKTDSQGHTVLSNIRDLNKGKIPIAYVLTTKDDFSFMPYNRVDQQVNYSR
FT                   FDISGTVNSEEGLKAYLFSDRGIYRPSEQGHIGIMLKQNDWHGKFDGLPLGIQVTNPYG
FT                   RVIDKNKIVLNSEGLGEYLFTTFDDSLTGLYNISLYLGEPGINNYLNSVSVRVGDFQPD
FT                   RMKININFNNSKDTLWTHPKDLKATVKLINLYGIPAENRKVRGLIDIRPTEFFVANFKE
FT                   YTFYRSKDNKEFFNEHLGDVTTDSTGTANFDLNLDKYYNATFNLTFSAEGFEPDSGRSV
FT                   QGSKSLIVSPLPYIIGFRSNSNLKYIKKQVISTIEFIAISNKAKKVSAHNLTLKLNKIN
FT                   YVNNLVSDSNGNYSYSAVPVETNISSDNVNITENEGYIYNVPTNEEGDYVIYLTDTENR
FT                   IFAQTEFSVIGEGNVTANLINKANLKVKLDKGDYKAGDTILLNINTPYTGYGLITIETD
FT                   KVHNFKWFKADKNNSIQEIKIPDGFEGKGYVNVQFIRDITDTEIFISPFSYAVLPFTAG
FT                   VYKHKENIELTLLPKIKSGEKLSIRYRTTNPCKIIIFAVDEGILSFADYQTPDPINYFM
FT                   NDKALEVRTSQIMDLILPEHHLLMKSYIASPPGDSFINVSRNLNPFKRNSQPPVTFWSG
FT                   ILESDLNEREITFDIPSYFNGTLRVIGIASSLDTIGVSKTDLLVQSDLIINTNLPLFVA
FT                   PNDEFAVPITIFNNLKDSGNAQIFLNIETSEGLEILDYPKAIQIDENNEATINVKLKAT
FT                   DKLGSANLNVVASINNIKTDITSMTLVHSSELTSTTSVRPASPNITTVDTGFIPGNKAN
FT                   LKILRDLYPKFAKLQISASKSPLAIISGFKDFLDNYHYGCTEQLVSQNFANVLLYNEQE
FT                   LVQILKTDRKKMDESLSKIFQTLLERQNDDGGFRYWNNFYDDSDPFISVYTMHFLNEGV
FT                   TRYLAVPSDMFNAGLYYLENIANREINSLDEAREKAYAIYILTRNSIITTNYIANILKY
FT                   LDEYHKNTWHDDLISVYLASSYKMLKMDEDADKLLDRFTLNKPISKTNYQYYNQLIKYS
FT                   QYLYLISLHFPERLKNFDSKIIQDIALFAKDNYNSLSASYAIMASLTYAAKIHNVDEAT
FT                   IKVTDTDKVVTLKGDKVMISELSLESNEIDLTSSSNGFFYQLLTSGYDKQLKGNKEIVQ
FT                   GIEITKKYLDENNKEVSKVKLGDNITVNITINSASNKTLSNIVILDLLPGGFELLQDNN
FT                   NLNILERHQEIMIWKPIYINNRDDRVMIFGTISDQKMTYRYKIKAVNKGIFTTTAVYGQ
FT                   AMYDTQTYYRGSIGCIIVE"
FT   gene            complement(705855..708017)
FT                   /gene="fadB"
FT                   /locus_tag="RT0547"
FT   CDS_pept        complement(705855..708017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadB"
FT                   /locus_tag="RT0547"
FT                   /product="Beta-hydroxyacyl dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:RT0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04015"
FT                   /db_xref="GOA:Q68WH7"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR032259"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WH7"
FT                   /protein_id="AAU04015.1"
FT                   /translation="MQNEIKKVCVIGAGVMGSGIAALIANSSHRVVLLDILDKDSNDPN
FT                   KIVKNAVKNLHRQKLPPLSYPDKVNFITIGNLEHDLDLIKECNLVIEVIVEKLDIKHQL
FT                   YNKIIPYLKEDTIIASNTSTLPLKKLKENLPNNIKSRFIITHFFNPPRYMELVELIIDN
FT                   TIKDEVIEKISVFLTKILGKTIIKCNDTPGFIANRVGCFLLELVAHKAIAQNLDFVTID
FT                   QIFSRCLGLPNTGIFGLYDLIGHDVMKLISSSLLSALPKSDDYHRIYFNTKVFDKMIEH
FT                   NLIGRKGEGGFYRLSVSNGKKIKEVINISDLSYHPVQKVDISFNNLDELLASDSIYSKF
FT                   FSEIITEFYIYLTSLVPSVTNNIYDIDATMKLGYSWHYGPFELLTIAVKNGWNSIIKNA
FT                   DLMNISLPKYLASKEYQKIDKQKFNSKKDFLQESTIVLANDSANLIHYCENLIFVITTK
FT                   MNTLNHNVFYLLQEAVSKAENYGKNLYIFPQGNNFSAGADLKLILSYIQDGNFDNLENL
FT                   LKLGQQTMRYLKYSSVHIISCARGVALGGGCELLLNSSYIVANQELNAGLIEFGVGLIP
FT                   GWSGVTEMFARSNGDKTKLIRNIKNIIEQNKTSSADYFKADYDVSNMQVNMNKHYILDE
FT                   ALKLNVSNKIVSIPHKIALPKINIVSEIDTSKYNDLQNKVLNKFQNIIDKHNEISEAEL
FT                   LTYEREIFLELAKEPQTIEKLHAIVG"
FT   gene            complement(709503..710657)
FT                   /locus_tag="RT0548"
FT   CDS_pept        complement(709503..710657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0548"
FT                   /product="monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:RT0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04016"
FT                   /db_xref="GOA:Q68WH6"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR011295"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WH6"
FT                   /protein_id="AAU04016.1"
FT                   /translation="MSQKIEIDKMLNIVILGCGLSGMLTALSFAQKGIKTTILESKLVK
FT                   SPDFLKDIRTTALTPYSKKFLFSIEIWKELEQFVAEMQDVYVVDNKASEMLDLRNENDA
FT                   VLGYVIKNSDFKKILLSAITNNSFITLIDNNQYQEVISHNNYSIIKFNNDKQIKCDLLI
FT                   ICDGANSKVRSYYFTNEVDKPYQTALTFNVKHEKPHENCAMEHFLPLGPFALLPLKDQY
FT                   SSSVIWSTSSVQADLIINFPIKEVDFLIQRNAGHFLGQITIDSEISSFPLKAFIANRYF
FT                   HNRIVLIADTAHIIHPLAGQGLNQGIKDIEILSMIISNNGTLQEYQKLRQYDNFIMYKL
FT                   TDSLNSIFSSYSINLRCLRQIGFKVINNLKPIKNLITNYAMGQR"
FT   gene            complement(710632..710895)
FT                   /locus_tag="RT0549"
FT   CDS_pept        complement(710632..710895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0549"
FT                   /product="possible Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:RT0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04017"
FT                   /db_xref="GOA:Q68WH5"
FT                   /db_xref="InterPro:IPR007208"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WH5"
FT                   /protein_id="AAU04017.1"
FT                   /translation="MLNIFLIIIALFICLTIYLFIRNNDIFTNLLILNSCTTITCLFIC
FT                   CLGLYSGNSSYFDIAIIYFLLSFIATNGYLRYFIYESKNRNR"
FT   gene            711324..712751
FT                   /gene="ntrX"
FT                   /locus_tag="RT0550"
FT   CDS_pept        711324..712751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrX"
FT                   /locus_tag="RT0550"
FT                   /product="nitrogen assimilation regulatory protein NtrX"
FT                   /db_xref="EnsemblGenomes-Gn:RT0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04018"
FT                   /db_xref="GOA:Q68WH4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WH4"
FT                   /protein_id="AAU04018.1"
FT                   /translation="MSQLDVLILDDEESIRNLIAANLKDEGFNPKVAANSTQALKIISE
FT                   KPVSAVILDIWLQGSEIDGLGVLEIIKKRYPLIPVIIISGHGTIETAVNAIKMGAYDYI
FT                   EKPFNNDKLIILLKRACEVTKLKRENIDLKSKVIDKTELVGGCSVTLKYKMEIEKAASS
FT                   SSRIMIHGKVGSGKELAARLIHKQSKRVNNPFIIFSPTCMTTEKINQELFGESEKQENN
FT                   NKRPTILEFANNGTLYIDEVSNIPIPIQVKLLKFLKDQTITKPCGKKTKVDIKIITSTS
FT                   KNIQDEVNNGKFLEDLYYRLNVFSLKVPSLYERKEDIPLLVKYFVKQLSKFSGLKERHF
FT                   SDEAITALQSYEWPGNIRQLRNVVEWTLIMNPLTTGNNEIIKPYMIPSEILANSANLTK
FT                   LEDSFDMLSMPLREAREVFERQYLSAQMSRFNNNISKTSSFVGMERSALHRKLKLLSLH
FT                   IPPTNKINEEEYEKANA"
FT   gene            712732..714501
FT                   /locus_tag="RT0551"
FT   CDS_pept        712732..714501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0551"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04019"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WH3"
FT                   /protein_id="AAU04019.1"
FT                   /translation="MRKQMLKIISIITIYLLLNSCSESTRDVNGLLTDSQSTIIRDYII
FT                   SQNSKNLKVNLKEKFGSNLKGVKLIGIKLTNEDLSGIDFTSCEILRTDFSGSNLDKAIL
FT                   TNAVIQESNFTDSVIKNISGYNADFQGSIFNNITLQNTNFVQSNFSDTAFNKTTIINVN
FT                   FENSKFSNVLWCNSNIDSSNFQKTNLKNNSFKNTNVINSIFYGTDLGKSVINNTNFTNN
FT                   YFESSDLSNTKFTAVIIKDSNFTQSIFNSVNFNNIQSNNSFFSYASFEDSTLQNINLTK
FT                   CDLQNSTISSAVLNHFKIDNAILNNMSFNDNTFNNLSIKNSNTNFVRINKSKGLNITLI
FT                   NTTCSNNIYSNNDLKEFKVINTDFNNSEIINSNFTNGQFNNVNFSKSLIQNVNFTDIKI
FT                   TLGNLNQVALINANLINTNIINSVLANSQINNINYQAYSSFINTNLSNNIIINDSADKI
FT                   PPNKILHNNIVINSVKDLQKISNLANMNLTNLNLSNLVFNGVDFSNSIFKKANLTNTVI
FT                   KNSILKETNFSAAILTKTDFSKSILTGSIFKCAKIDQTFFSNADLTNTDFTEVTIKNTT
FT                   FDNANTNGIKGLE"
FT   gene            complement(714652..715617)
FT                   /locus_tag="RT0552"
FT   CDS_pept        complement(714652..715617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0552"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04020"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WH2"
FT                   /protein_id="AAU04020.1"
FT                   /translation="MSMNEQDDQIIKELEARLAALKGIPPSIEELEERLAKLQDTSYIY
FT                   KKSGNEVDNLIEQMHSELKLEQKSKNLNDQKDQVIRDRLDKLRENSSVTETLIDFSFND
FT                   TKSIITDTISSQADIVSAYANRSTELDDKKVLLHLANNLTEARDIIMDTPSISKAYDTK
FT                   IFDVIASGLGRIYEGIKTVATPAVNIIKEVGNILINSIRSLSQKSSEKQIEESKKELKK
FT                   LYKSYTDLKGVDEKVKKEFLKKHYQQIDKLQTPKEIFLETAKITKSISIAGKQKINNLK
FT                   PQQVINRMQDKNPSGLLNKSSFTPSNTPTNKVKSSKINQR"
FT   gene            complement(715866..717650)
FT                   /gene="ftsI1"
FT                   /locus_tag="RT0553"
FT   CDS_pept        complement(715866..717650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsI1"
FT                   /locus_tag="RT0553"
FT                   /product="cell division protein FtsI/ penicillin-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04021"
FT                   /db_xref="GOA:Q68WH1"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WH1"
FT                   /protein_id="AAU04021.1"
FT                   /translation="MLNKKILHGELISRRAFIIGLGKLWFLSLLGIRMFYLQLIKSEEY
FT                   RTLSDKNRINFVVLPPIRGKIYDLDGNILATNKPCYQLVIDKSINNNYRDELEIISNIL
FT                   NFSPDKYNYIKQKIKKSSRHTILTILDHLDWEQVSMIEEQKHKLAAIFIDVGYLRFYPF
FT                   SSTTSHLIGYLGQINEQEKQELNIRSLSDFNIGKSGIEKYYDNKLRGEFGYKKVEVNAY
FT                   GKQVRTISETPTQSGADMHLNIDASLQKKIQQYLNPKGSSAIVMDIRTGNVLICVSTPG
FT                   FESNNFSKLSENYWQSLISDPHKPLINKVIQNSYPPGSVFKIITVLAALEVGINPNKTV
FT                   FCDGSSILGTNSFRCWNHRGHGTLDMMSALKYSCNIYMYELARIVGPDKILAVAREFGF
FT                   GSKTGIDISPESSGFVPSKEWKKKKLKLPWSIGDSFNLAIGQGFLGVTPIQLARFITAI
FT                   ASNGKLYTPRILKNASEFYNVNIKTENIKIIQESLYNTVNVAGGTAYYNRIFAENRKLA
FT                   GKTGTAQVQSKLNAKDDLNRDSIAWARRNHALFLGFAPYSDPRYSVTVFVDHGGGGSIA
FT                   AAPVARKIMSDVLDKYMR"
FT   gene            complement(717640..718161)
FT                   /locus_tag="RT0554"
FT   CDS_pept        complement(717640..718161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0554"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04022"
FT                   /db_xref="GOA:Q68WH0"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WH0"
FT                   /protein_id="AAU04022.1"
FT                   /translation="MLKIKQEIYKNSLQVILQFFFALLCFCIILFPLMSYKINIQSRIF
FT                   PAMEIIFIYYFMSLYSLNILSIFFLGLLIDQISGVPIGTDSLVFISANIIYKLSSKYFL
FT                   AKNYLINFVVFCVYCLFILNFKYLLVTIKHLDAEGYLIIFFQFLTTIFSYNIIRLILDS
FT                   PMNYFKKYAK"
FT   gene            complement(718673..720358)
FT                   /gene="ftsI2"
FT                   /locus_tag="RT0555"
FT   CDS_pept        complement(718673..720358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsI2"
FT                   /locus_tag="RT0555"
FT                   /product="cell division protein FtsI/ penicillin-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04023"
FT                   /db_xref="GOA:Q68WG9"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WG9"
FT                   /protein_id="AAU04023.1"
FT                   /translation="MKQILEKWKPAIKSLIIWNICSKNTKIRLLMVICGFSFLFSTVSY
FT                   RLIIVATNVYDKNINSFKKKHQFRKEIVDRNGNLLAMNLPSASLFANPQIVLDPETSVK
FT                   KLAEILPDINKAKLIKELKSNKSFIWVKRDLLPSQQEKIISLGLLGFEFEEEQKRIYIF
FT                   SNLLSHVIGYVGRDAVGLSGLELAYDKYLTNTDYELNDLKDQKAPLQLSIDIRLQSILS
FT                   EEIDKTLKKFNAIGAVGIIADPNNGEILALVNKPDFDPHYPSLAKPEELFNTASLGIYE
FT                   MGSVFKSLTMAVGFDTGVINMNDAYDISYMKVGGFQLKDYTPRQGWHSVPEIFLYSSNI
FT                   GTSQIMLEIGKNDFKKYLKKLGLLDQLQIELPERGTPLFPSEKRWNELTSVTMSYGYGI
FT                   SISPLHFVRAILPVVNGGTLYDLTLLKRKTQKVIGTKVFSENTSTQMKKLFRSVVKEGN
FT                   GKRAEIKGYLIGGKTGTAEKLSQGVGGKKKYLKNSRASSFLGILPASNPQYVIFIRFDE
FT                   PKPTKESFGFATASWTAVPTAGRVFERMISLYGLEPIEQNEEES"
FT   gene            complement(720483..720869)
FT                   /locus_tag="RT0556"
FT   CDS_pept        complement(720483..720869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0556"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04024"
FT                   /db_xref="GOA:Q68WG8"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WG8"
FT                   /protein_id="AAU04024.1"
FT                   /translation="MTRKFHYSILFITIIAICSLFRIKDRVSTLNYQLRSVIKQINSEN
FT                   NNINILKAEQAYLLLPTRLEKLAAAYLKLEIVKSYQMINDPLAPNIEQNIKFNHNISIS
FT                   KSNKWRYKRIMNNKYIQTVSSRVK"
FT   gene            complement(721061..721981)
FT                   /gene="mraW"
FT                   /locus_tag="RT0557"
FT   CDS_pept        complement(721061..721981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="RT0557"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04025"
FT                   /db_xref="GOA:Q68WG7"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WG7"
FT                   /protein_id="AAU04025.1"
FT                   /translation="MSQYHIPVMLSEVLEVLAPKGYESYLDCTFGAGGYSNAILKSCYC
FT                   SVTSLDCDPHVIERVEQIKQDYGERFSFIKTNFADSFGKLKQQKFDGIVMDLGVSSMQL
FT                   DIAGRGFSFLYDGPLDMRMSAQGFSAEEFVNTADEEEISDVIYKYGNESLSRRIAKNII
FT                   KYRKIARIDSTRKLAEIVRYSIGFRKGKIDSATKTFQAIRIYINNELGELERFLANVKN
FT                   ILKKNGRLVVVSFHSLEDRIVKNFFKENSAKPVARSKYAKDEIKIDQNKWLEIITHKVL
FT                   TPSSQEIRLNVRARSAKLRAAKKIL"
FT   gene            complement(721981..722430)
FT                   /gene="mraZ"
FT                   /locus_tag="RT0558"
FT   CDS_pept        complement(721981..722430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraZ"
FT                   /locus_tag="RT0558"
FT                   /product="protein MraZ"
FT                   /db_xref="EnsemblGenomes-Gn:RT0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04026"
FT                   /db_xref="GOA:Q68WG6"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WG6"
FT                   /protein_id="AAU04026.1"
FT                   /translation="MNVFLSKYINGVDKKSRVTVPANYRAVLGKELFNGVIAYPSIRNN
FT                   CIEVCGIAHIEKLRKMIETLDPYSEERDAFETMIFGEAVQLAFDGEGRIILPQSLMKHA
FT                   DIEEQACFVGKGIIFEIWQPQNFEKYLSYAQNIAHEKRLTLRNVH"
FT   gene            723366..724751
FT                   /locus_tag="RT0559"
FT   CDS_pept        723366..724751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0559"
FT                   /product="sodium coupled symporter"
FT                   /db_xref="EnsemblGenomes-Gn:RT0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04027"
FT                   /db_xref="GOA:Q68WG5"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WG5"
FT                   /protein_id="AAU04027.1"
FT                   /translation="MFNLPIDNIIVFIYLISILVIGIYYRAKHSSFKNYANVERKSQHN
FT                   KLLLIATIFTSSVGGATTFGIMEKVFLGHGYYAYALIVTIPIDILIAFYIVPLIVKHYG
FT                   AESIGDIMSRYYGNTGRFIGGVSTVIVSVGFLAAQISVSGYIFKYILGIHYVHGVILSY
FT                   SIVLIYTTIGGLQSIVFTNLLQFFAMIIAIPAITFISLNKIGFVYFIDNFTNTNFDQTN
FT                   LLYYAITAALNFSVMNLYPTFIQRALINKNPTHTIKAIYIKSAIYFFFLICITLNGLIA
FT                   FNLYPNQPSNLVLPYLINQIIPPLIQGFVISGLLAAVMSTADSDLNVTSISIVKDIINP
FT                   IVKVKNQKKLLLITRIINVIIGSLAIIVALKFSNVIDLVMFFTGFWGPVILVPLITTLF
FT                   DIKTSKIIIVLSSFSGAATFLTWEYYACSLQYFNLRGVFVGTIVSLVIFILGQIIIARK
FT                   LCK"
FT   gene            complement(724994..726874)
FT                   /gene="uvrC"
FT                   /locus_tag="RT0560"
FT   CDS_pept        complement(724994..726874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /locus_tag="RT0560"
FT                   /product="excinuclease ABC subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:RT0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04028"
FT                   /db_xref="GOA:Q68WG4"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WG4"
FT                   /protein_id="AAU04028.1"
FT                   /translation="MSLEISGRELIKSKIIDAPECSGVYKMLDVSKQVIYVGKAKILKK
FT                   RLTNYIKSDLDNKTLRMIANTYFLEYIITHSEVEALLLEAQLIKKFQPKFNILLKDDKS
FT                   FPFIKLSLDHDFPQLLKYRGKALSDGKLFGPFASNTQVNTTLTELQKIFKLRSCTDNYF
FT                   NSRTRPCLQYEIKRCYAPCVGKINKENYRVLVIQVKDFLQCRTRELQENLSKKMQELSS
FT                   QMRFEEAAEIRDRIKALSYVQLKSRILDVVKNADIISIVHKDLHYCIEVALYRAGQPYG
FT                   NIPYFFSSTENSTHEEVLEYFLLQFYQKQQVPSEIIMNHEINSKENVIEAIKKINNISD
FT                   LSIIVPHKGDKAKLVHKAEVNALFSLEQYLKKITKNTEIMFEVKKLFDLPEIPERIEIY
FT                   DNSHIQGMFAVGVMVVAGKIGFDKKEYRVFSLSSRNFTIGSEIELRDDIKGDDYGMLRQ
FT                   VLTRRFTRLKNEPNKLPSLMIIDGGKGHLTVVKEVMDKFGMNIPFVCMSKGRDRNAGLE
FT                   QLHMQGKEVFTLDKNLLVMKYLQILRDEAHNFAIKNHRLGRSRAIKISSLDDIDGVGEA
FT                   RKTALLHYFGSYKAVCNATIDELAKVKGISKSLASMIFNVLNRKISLDNS"
FT   gene            complement(726980..727507)
FT                   /locus_tag="RT0561"
FT   CDS_pept        complement(726980..727507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0561"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04029"
FT                   /db_xref="InterPro:IPR007410"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WG3"
FT                   /protein_id="AAU04029.1"
FT                   /translation="MLKIVLVSFINLICALSYADQTTQNPNFTNVASNHSDDLLPAEAA
FT                   VHFVQPWAMPTTNVQAKVSNSAMYFTLINTRSKSYKLVNISSDKIGWIEIYQTINDQGG
FT                   SKMVKVDYPFLISSNVNVDFKPGSMHIMLYDPKVDLNVGDEFKVTFFFDDNTQKIVNVK
FT                   VANDNPYNKIGN"
FT   gene            complement(728672..728746)
FT                   /gene="tRNA-Ala"
FT                   /locus_tag="RT0562"
FT   tRNA            complement(728672..728746)
FT                   /gene="tRNA-Ala"
FT                   /locus_tag="RT0562"
FT                   /product="tRNA-Ala"
FT                   /note="codon recognized: GCA"
FT   gene            complement(728779..728994)
FT                   /locus_tag="RT0563"
FT   CDS_pept        complement(728779..728994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0563"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04030"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WG2"
FT                   /protein_id="AAU04030.1"
FT                   /translation="MSKAKAKTASKNNPTSREQAKEYLHNGQKIKPVKLISAQNSFIAA
FT                   EYESSGDLVVGSNNQPLPWGLVKSLS"
FT   gene            complement(729876..732593)
FT                   /gene="secA"
FT                   /locus_tag="RT0564"
FT   CDS_pept        complement(729876..732593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="RT0564"
FT                   /product="preprotein translocase SecA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RT0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04031"
FT                   /db_xref="GOA:Q6TUJ8"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6TUJ8"
FT                   /protein_id="AAU04031.1"
FT                   /translation="MFSILKKLFGTANDRTVKKLFSEITKINSLEPAIKILSDAALKNK
FT                   TVEFKEKLKNGATLDDILYEAFAVVREAASRVCGMRHFDVQLIGGLILHRGMIAEMRTG
FT                   EGKTLVATLPAYLNALTGKGVHVVTVNDYLAIRDSASMGKIYNFLGLSVGCIVAGMTDE
FT                   AKRIAYNSDITHATNNELGFDYLRDNMKYSMQERVLRPFNFAIIDEVDSILIDEARTPI
FT                   VISGPVNDNSALYGKIDKIIRLLNDSDFEKDEKLKTINLTEVGITNIESLLIKDGIIKP
FT                   DTGLYDFENLNLVHYVNQALRAHHMFTVDVDYLVREGKVMIIDEFTGRVMEGRRYSEGL
FT                   HQALEAKENVKIQNENQTLASITFQNYFRNYHKLSGMTGTSMTEASELKDIYNLDVVAV
FT                   PTHNKVTRIDLDDEIYGSKQEKYDAILKLIRDCYNRGQPILVGTISIEKSEELSSILNK
FT                   EKIPHNVLNAKFHEQEAFIIAQAGRFKAVTIATNMAGRGTDIMLGGNPEMLIEQLNKDR
FT                   NYVAKTAEIKAQIAEEKQKVIETGGLFVIGTERHESRRIDNQLRGRSGRQGDPGKTQFF
FT                   LSLDDDLMRIFASDRISGVLRTLGLKNGEAIHHPMISRSLEKAQQKVEAHNYEMRKNLL
FT                   RFDDVMNDQRKIIYEQRTEIIKSKDSYGFLNSTTEELARKIVLTFMPLGSYREDWDIDN
FT                   LTVELHRIFSIKFDHNLVHKNDVTEEDITKLVIQMAHDIYKSKEEAYSSELMNNAVKYI
FT                   LLTTLDQVWKDHLYSLDHLRQGISLRAYAQKDPLSEYKREAFNLFEQMLNNLKELFIQT
FT                   VYHFHIDLRHLQKEDISLEHKKLQKNMCESREDPAFSKYNAGNSIETYLKPVVLRVDPK
FT                   DRKPDDPMSWGRVSRNELCPCGSGKKYKYCHGAN"
FT   gene            732792..733652
FT                   /gene="prsA"
FT                   /locus_tag="RT0565"
FT   CDS_pept        732792..733652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prsA"
FT                   /locus_tag="RT0565"
FT                   /product="protein export protein PrsA precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RT0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04032"
FT                   /db_xref="GOA:Q68WG0"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WG0"
FT                   /protein_id="AAU04032.1"
FT                   /translation="MMSHMKKLSVIFLSVSMLSSIAFCDQDKVVATYKGGEVKESQIMQ
FT                   EFKPQLNLQSGETIKNFDDFPLQDQEKLIKIYVNNLLLKEEVAKSSITSSKEFQEKLEN
FT                   AKNQLAQQELLANYIKSNITDKMFDDEYNKYVDNLKGKEQIKVAHILVKSQKEANTVKT
FT                   KLSKGGNFNKLAEEFSLDKATASNGGVIGYIILNQSGQLVPEFENKAFALKVNEVSTPV
FT                   KTDFGWHIIKVLEKKPVPIPTKKEAKVTIDNILAAEILKKYISDLEAKADLKIMLPKAN
FT                   SKTGS"
FT   gene            complement(733806..734192)
FT                   /gene="acpS"
FT                   /locus_tag="RT0566"
FT   CDS_pept        complement(733806..734192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="RT0566"
FT                   /product="Holo-ACP synthase"
FT                   /EC_number="2.7.8.7"
FT                   /db_xref="EnsemblGenomes-Gn:RT0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04033"
FT                   /db_xref="GOA:Q68WF9"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WF9"
FT                   /protein_id="AAU04033.1"
FT                   /translation="MLIGVGTDIVQIPRIEKILNLYQELFAKKILTSQELKQFTLLDKP
FT                   NHATFLAKRFAAKEAVSKAFGVGIGQGINFKNITIINDNLGKPVVEVSSHYTNKLIPFH
FT                   IHLSLSDDYPICIAFAIVESNCSV"
FT   gene            complement(734193..734576)
FT                   /gene="rpoZ"
FT                   /locus_tag="RT0567"
FT   CDS_pept        complement(734193..734576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="RT0567"
FT                   /product="RNA nucleotidyltransferase (DNA-directed)"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:RT0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04034"
FT                   /db_xref="GOA:Q68WF8"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WF8"
FT                   /protein_id="AAU04034.1"
FT                   /translation="MARITAEDCNKIIPDRFRLVVLATRYAKLLNYKVETNQIKKEKRD
FT                   KPPVISLRRIAAGKVSVPQLEQDLINSLRTSSMIEPLVNQDESEDVEEKFEYLPEVYIG
FT                   EDYSDLDDQIFINENGEDYETDK"
FT   gene            complement(734733..735992)
FT                   /gene="murA"
FT                   /locus_tag="RT0568"
FT   CDS_pept        complement(734733..735992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="RT0568"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="Enoylpyruvate transferase; MurA transferase;
FT                   Phosphoenolpyruvate-UDP-acetylglucosamine-3-
FT                   enolpyruvyltransferase;
FT                   Phosphoenolpyruvate:UDP-2-acetamido-2-deoxy-D-glucose
FT                   2-enoyl-1-; Phosphoenolpyruvate:uridine diphosphate
FT                   N-acetylglucosamine;
FT                   Phosphoenolpyruvate:uridine-5prime-diphospho-N-acetyl-2-
FT                   amino-2-; Phosphopyruvate-uridine
FT                   diphosphoacetylglucosamine pyruvatetransferase;
FT                   Pyruvate-UDP-acetylglucosamine transferase;
FT                   Pyruvate-uridine diphospho-N-acetyl-glucosamine
FT                   transferase; Pyruvate-uridine diphospho-N-acetylglucosamine
FT                   transferase; Pyruvic-uridine
FT                   diphospho-N-acetylglucosaminyltransferase;
FT                   UDP-N-acetylglucosamine 1-carboxyvinyl-transferase;
FT                   UDP-N-acetylglucosamine enolpyruvyl transferase;
FT                   carboxyethyltransferase; deoxyglucose
FT                   3-enolpyruvyltransferase; enolpyruvyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RT0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04035"
FT                   /db_xref="GOA:Q68WF7"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WF7"
FT                   /protein_id="AAU04035.1"
FT                   /translation="MQKLIIHGGKPLEGSINISGAKNAVLPIMAASILTNKLHITNVPK
FT                   LTDVSTMKDLLQNHGACIRIIEHTDALEIIINTTNINKFTADYEIVRKMRASIWVLGPL
FT                   LTKYGKAKVSLPGGCAIGARQVDLHIAVLKSMGAEIEIEDGYINASSKGRLKGTHFVFD
FT                   KVSVGATINAILAAVLANGETVLFNCGREPEIVDLCYCLIKMGADILGVGSSTITIKGK
FT                   DCLNETSYKVLSDRIEAGTYMFAAAITKGDVKICGIDYNIIENIALKLIETGIKVVQIN
FT                   NGVQVTYAGMLNSVDLETNPYPGFATDLQAQFMSLMSLSRGVSMITENIFENRFMHVPE
FT                   LCRMGADIVVRGNKAVVRGVEMLKGAEVMASDLRASVSLILAGLSTNSKTVLHRIYHLD
FT                   RGFQDLEKKLSNCGADIKRV"
FT   gene            complement(736101..738524)
FT                   /gene="gyrB"
FT                   /locus_tag="RT0569"
FT   CDS_pept        complement(736101..738524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="RT0569"
FT                   /product="DNA gyrase"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:RT0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04036"
FT                   /db_xref="GOA:Q68WF6"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WF6"
FT                   /protein_id="AAU04036.1"
FT                   /translation="MSGIEEKCNESSYSADSIKVLKGLEAVRKRPGMYIGDVGDGSGLH
FT                   HMIYEVVDNSIDEALAGYCDLIRVTLNKNGSVTVSDNGRGIPVEIHEEEGISAAEVIMT
FT                   QLHAGGKFDQHSYKISGGLHGVGVSVVNALSEWLELRIWRNNKEYFIRFNNGITEAPLS
FT                   IVKENIDKKGTEVTFFPSVGIFTNIEFDFVTIEHRLRELAFLNSGVKILLIDNRFEEVK
FT                   KVEFFYTGGIEAYVQYIDRAKHAIHPCIVVNTEHVESGISLELAIHWNDSYHENILCFT
FT                   NNIRQRDGGTHLSAFKSAITRVITSYLDTTGLNKKTKHDFSGEDTREGICCVLSVKVPD
FT                   PKFSSQTKDKLVSSEVRPVVENAVYTKVLEWFEEHPIEAKAIIAKIMEAANAREAARKA
FT                   RELTRRKSALEVSNLPGKLADCHAKDPAISELFIVEGDSAGGTAKQGRDSKIQAILPLR
FT                   GKILNVERARFDKMLSSEQIGTLITALGISVEREFSLEKLRYHKVIIMTDADVDGSHIR
FT                   TLLLTFFYRHMPELINKGYLYIAQPPLYKVKSGASELYLKNEQALQNYLIKSTINDTKL
FT                   ILDGQEQLIGYNLEDLINKVVQFNCLLDRASKKFNRSITEILAINDLFNKKIFEPESGS
FT                   RLQKALDVLNNLEESPDKTNLQVLKHENRIEFFHFSRGLKNTKILLKEQLELFEFVEIS
FT                   QFALSIFDIFSKRLKLIVKGKEFDVVTPSQLLNTIIECGKKGITIQRFKGLGEMNSDQL
FT                   WDTTLDPTKRTLLQVRVSEVDEAEGIFSTLMGDVVEPRRLFIQANALNVMNLDI"
FT   gene            738635..739495
FT                   /locus_tag="RT0570"
FT   CDS_pept        738635..739495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0570"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04037"
FT                   /db_xref="InterPro:IPR006356"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WF5"
FT                   /protein_id="AAU04037.1"
FT                   /translation="MKTLNYKNIFDVINDYDVFLFDLWGVIIEGNHTYPGVVQNINKII
FT                   AQKKVYFVTNAPRNIFSLHKTIKSWGINALPEMIISSGEIAVQMILESKKRFNIKKPII
FT                   YHLGHLENDIINVMQCYTTDDINKANISLITIYRDENEKLDLNEFDELFKIIVQRKIIN
FT                   ICANPDLGINQHGIYRYCSGYYAEKIKQLGGKVIYSGKPYSEIYHKILKECSNIPKNRM
FT                   LMIGDTFYTDILAANRLGFDSALVLTGNSREYHFDFDNINEKLDSLMKAAIKQSIIPNF
FT                   VVDLS"
FT   gene            739677..739763
FT                   /gene="tRNA-Leu"
FT                   /locus_tag="RT0571"
FT   tRNA            739677..739763
FT                   /gene="tRNA-Leu"
FT                   /locus_tag="RT0571"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: CUC"
FT   gene            740010..741380
FT                   /gene="mgtE"
FT                   /locus_tag="RT0572"
FT   CDS_pept        740010..741380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtE"
FT                   /locus_tag="RT0572"
FT                   /product="magnesium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RT0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04038"
FT                   /db_xref="GOA:Q68WF4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WF4"
FT                   /protein_id="AAU04038.1"
FT                   /translation="MPNFNIFKSILPDHHNQFAEIFDQINDLIEDHNYDAAASRLAKLH
FT                   YADLADFLDNLNNKTYKIIIPLLHDKIKPETLVSLNAYSKPLIIETLGIKKSAELINKL
FT                   VIEDAIEVVIDLDDDIKDLILSNLTKEKKHQITVGCTYPENTVGRVIERDFINLQAGWT
FT                   VEESLNFIKNVKNEFYAAIVTDNKLRPIGIISLSTLIKGKKNELIKDLMSKDFKLADTF
FT                   TDLNELSFIFRQYALTIVPVVNKSGKLVGSVSIDNIIYIIEEQAGKDILSLSGVHTQDT
FT                   FFNVFYTVKHRFPWLFVNLITACMTSLIINHFNDTIAKLVTLAATMPIVASMGGNAGTQ
FT                   AMTVTVKALANKDIHYNNVNKVILKEIAVSAFNGFVLAIIGAGLSFVMLFDLNLSVIFA
FT                   IAVILNFLVAGLFGSAIPIILHYFDIDPAAGSGVFLTTITDALGFLTFLSLANIFLV"
FT   gene            742580..742654
FT                   /gene="tRNA-Gly"
FT                   /locus_tag="RT0573"
FT   tRNA            742580..742654
FT                   /gene="tRNA-Gly"
FT                   /locus_tag="RT0573"
FT                   /product="tRNA-Gly"
FT                   /note="codon recognized: GGC"
FT   gene            743745..744173
FT                   /locus_tag="RT0574"
FT   CDS_pept        743745..744173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0574"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04039"
FT                   /db_xref="GOA:Q68WF3"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WF3"
FT                   /protein_id="AAU04039.1"
FT                   /translation="MSQHTQDNQINNNETIEIQETDTVPIETNSLQSGLTSLIPMILIF
FT                   AVFYFLLLRPQEQRRKEREKLVREVKKGEEVLTNSGIYGIVTKVSENDNNIEIEIAKDV
FT                   RIKAIKSSIIDITSRKKEVAATQENNKKNKKVICAKSS"
FT   gene            744157..745713
FT                   /gene="secD"
FT                   /locus_tag="RT0575"
FT   CDS_pept        744157..745713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="RT0575"
FT                   /product="protein-export membrane protein SecD"
FT                   /db_xref="EnsemblGenomes-Gn:RT0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04040"
FT                   /db_xref="GOA:Q68WF2"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WF2"
FT                   /protein_id="AAU04040.1"
FT                   /translation="MQNLPKWKIVLSIICTVFAIICALPNFIQINWKFLPHDSVNLGLD
FT                   LRGGANLLLDVDFDTYLNDSMENIADTLRKNFREHKIGYKNLLVRHNNIQLEVRSTEVL
FT                   KSLKKIIHKIDPEIIIEVNKNKIKLRYSESRLNDLLNKVVEQSIEIVRMRIDSTGTKEP
FT                   ILQRQGNKHILLQVPGVDNPSYLKNILGKTAKLTFHLVDENANIEEAIKGHIPLDSMLI
FT                   KGDSEHHGEYYIVIKKKVLLSGTHLTKASASFDQNSQPMVAFSFNNLGSKIFTEITKNN
FT                   TGKRLAIVLDNKLLSAPMINGAIIGGDGIITGNFTIESANELALLLRVGSLPTPLKIIE
FT                   ERSIGPNLGADSIESGKKAGLIGFTAVCIFMILSYGVIGLFANIALILALLYILALLSL
FT                   FQATLTLPGIAGIILTMGMAVDANVLIYERIKEELHKGVSNLYAIRTGFESAFATIIDS
FT                   NLTTLIVAFALYIFGVGAIKGFAVALTIGIISSMFSAIIITKLLIDIWVKYFKPEKLGL
FT                   L"
FT   gene            745873..746469
FT                   /locus_tag="RT0576"
FT   CDS_pept        745873..746469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0576"
FT                   /product="Sco2-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04041"
FT                   /db_xref="GOA:Q68WF1"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WF1"
FT                   /protein_id="AAU04041.1"
FT                   /translation="MKIIIIVSLLIVVGTLYVLLSLSTPKKPLAGQVNIYKDNIKIGEA
FT                   FELIDQNGEIFNSNKLRGHLSLIYFGFTSCPDICPTFLNKMTNIVEILHQNQIDIIPIF
FT                   ITIDPKRDTPEVLKEYIKNFHPKFICLTGNEHQIKDVTDKFKILYARVNGYDDDQNYMI
FT                   DHSSFTYLIDKNGKYIKHFYLDISAKEIMEFLRNE"
FT   gene            746571..746957
FT                   /gene="ccmE"
FT                   /locus_tag="RT0577"
FT   CDS_pept        746571..746957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmE"
FT                   /locus_tag="RT0577"
FT                   /product="cytochrome c-type biogenesis protein CcmE"
FT                   /db_xref="EnsemblGenomes-Gn:RT0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04042"
FT                   /db_xref="GOA:Q68WF0"
FT                   /db_xref="InterPro:IPR004329"
FT                   /db_xref="InterPro:IPR036127"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WF0"
FT                   /protein_id="AAU04042.1"
FT                   /translation="MQKIVRNRLIKIILCFCSTCLGISIILYNLEKNIIFFFPPSKINE
FT                   AEQGKELRVGGLVKRDSINRISANKISFVITDNIKDLEILYQGVLPALFREGQGIIAIG
FT                   QLSDNKFIARQLLAKHDENYRPPS"
FT   gene            747085..747621
FT                   /gene="ppa"
FT                   /locus_tag="RT0578"
FT   CDS_pept        747085..747621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppa"
FT                   /locus_tag="RT0578"
FT                   /product="Diphosphate phosphohydrolase"
FT                   /EC_number="3.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RT0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04043"
FT                   /db_xref="GOA:Q68WE9"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WE9"
FT                   /protein_id="AAU04043.1"
FT                   /translation="MFIDKIKAKANNNEINVIIEIPMNSGPIKYEFDKESGAIFVDRFM
FT                   QTTMSYPCNYGFIPDTLSNDGDPVDVLVVAHHPVVPGSVIKCRAIGVLMMEDESGLDEK
FT                   IIAVPTSKLDITFDHIQELDDLCKMLKKRIVHFFEHYKDLEKDKWVKVTGWGNKVKAED
FT                   LIKEGIDRNQQKWNN"
FT   gene            747676..749199
FT                   /locus_tag="RT0579"
FT   CDS_pept        747676..749199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0579"
FT                   /product="MviN-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04044"
FT                   /db_xref="GOA:Q68WE8"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WE8"
FT                   /protein_id="AAU04044.1"
FT                   /translation="MTLFRSGIVVAFFTLISRIFGLVREQFIASLFGSTPIGDSINIAF
FT                   KLPNLFRRIFAEGALSSVFIPIYNEKMLISKKAANNFSGKVFTLLFLILIVTIALMQIF
FT                   MPQLILFIAPGFYAKKEKFELTVFLCRITIPYLIFVSLTALLGGILNSVKKFAAFAFSP
FT                   IILSVCVIIFTLIFENYIESTISISVSLIIAGILQVVFMFICVKRADLHFPIIFYTNDP
FT                   DVKKLLINMGPATISSGIQQLNLFISQSIASFIEGAISILAYADRIYQFPLSIIGASFS
FT                   TILLPAMSKVYKSNDIVSAQKIQNNSIRIGLLLSLPATFGIIILSHPITHIIYERGVFT
FT                   HQDTTNTAEAISAFALGLPAFILAKILTPIFYANGDTKTPLKITLFSIIMNTNMNLLLM
FT                   DSLKHIGIAVGTSIAAWYNLGLLYSYSTKQHKLHIDAGIKLFCSKILLCCTLMSIIISL
FT                   IKYYYLEYMYSEYLLIKVAMLGSTITIGVATFFGAAYLLKVVNYDNSTK"
FT   gene            749180..749926
FT                   /locus_tag="RT0580"
FT   CDS_pept        749180..749926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0580"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04045"
FT                   /db_xref="GOA:Q68WE7"
FT                   /db_xref="InterPro:IPR008875"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WE7"
FT                   /protein_id="AAU04045.1"
FT                   /translation="MIIAQNKTNYQDFLKTLAIIAMTIDHIGIYLYHELTIMRIIGRIS
FT                   MPVFCFFAGYNFYDKPKTRIIVYGIILQIYTTILFKQFLTSNILISIYLGQCYIYYFRN
FT                   SVTSFFYSGSCHVVIMIILWYISWALIDYGTLVIATMILGFIAQHEKTNLKLCCCIAIF
FT                   ISIVHSTFFTLLIPLSDFNFSNTNLILNLTFLTIIYILMILSDYSQKILINLKWISRNV
FT                   IYIYCIQIIILQFIFIYKYTYGFKNW"
FT   gene            750001..750615
FT                   /locus_tag="RT0581"
FT   CDS_pept        750001..750615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0581"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04046"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WE6"
FT                   /protein_id="AAU04046.1"
FT                   /translation="MNVIDLLILDNEKYKKHFRKNKLFKVKFDSTLRKNKFLKHFRIWS
FT                   DEFQKMVLARVVFSETKEFKQLAWEHLTDEFGHNIELSQNLENDKETTDSIFEALGSWF
FT                   TLKMMTLGDSERAVLVHLVIESCATIFYEKLGSIFCNHKTSQHFKTHMQLDPEHEQMGI
FT                   DLLKQININDISLLIIQKKGWDMIDALFTRLAEITTVPDNV"
FT   gene            complement(750897..753008)
FT                   /gene="recG"
FT                   /locus_tag="RT0582"
FT   CDS_pept        complement(750897..753008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="RT0582"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04047"
FT                   /db_xref="GOA:Q68WE5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WE5"
FT                   /protein_id="AAU04047.1"
FT                   /translation="MILATLEQFLFAPVKAFINIREDTVSAFKRLGINNIRDLLFYLPV
FT                   SYQNKILSPNLTEVRGGEIIQTEIIVNSINLQKKGNQPLKITASNNTGSILLVFFHKPP
FT                   QFILNKLKVGTKHIISGKVQFFNYQLQILHPEFITNPKLSKAIEPLYSITYSLSNKQLY
FT                   SYIIKAIEIFEEKCKGIEDKEVHEYLDVILQNLKILHVFFSPHNLISWSSTMDIVVNPR
FT                   YATVAAKKQLAIKELIANQISLLNVRMQINRKQGNIYPKATSIQDNILRELGFELTYYQ
FT                   KQVIEEIESEQSDKVEMMRLLQGDVGSGKTLVALLTMVNVVTTGLQATLMAPTDLLANQ
FT                   HYDFFVKALKNTNIKVGLLTGKILGKARKNIIIQLVNGKIDILIGTHALFQEKVSFKKL
FT                   GYIVIDEQHRFGVQQRLNLINKGVNPDVLIMTATPIPRSLALTMFGDMTISKLMGKPKD
FT                   RLSIVTKTMSINKIGYIIEAINKRLIAGERVYWICPLITQREKEALQEDHLLMDVINRF
FT                   NSIENVYQGYTGIIHGKMANDQKERIMKQFKEGKIKILVATNVIEVGIDVSEATLIVIE
FT                   NAEQFGLAQLHQLRGRVGRCSLQSYCILLYNPKRLGKVAQNRFKIMKHTNDGFYIAEQD
FT                   LKLRGSGEILGIKQSGEIDFFFADLKDDYELLIKAHKVAERAICTKDNVNFINFQIKLF
FT                   AKSQVSYLI"
FT   gene            753627..754173
FT                   /pseudo
FT                   /locus_tag="RTPG31"
FT                   /note="pseudogene of 3-oxoacid CoA-transferase subunit B"
FT   gene            complement(754171..755256)
FT                   /gene="mraY"
FT                   /locus_tag="RT0583"
FT   CDS_pept        complement(754171..755256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="RT0583"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="MraY transferase; Phospho-MurNAc-pentapeptide
FT                   transferase; Phospho-N-acetylmuramoyl pentapeptide
FT                   translocase; Phospho-NAc-muramoyl-pentapeptide translocase
FT                   (UMP); Phosphoacetylmuramoylpentapeptide translocase;
FT                   Phosphoacetylmuramoylpentapeptidetransferase;
FT                   UDP-MurNAc-Ala-gDGlu-Lys-DAla-DAla:undecaprenylphosphate
FT                   transferase;
FT                   UDP-MurNAc-L-Ala-D-gamma-Glu-L-Lys-D-Ala-D-Ala:C(55)-
FT                   isoprenoid alcohol; UDP-MurNAc-pentapeptide
FT                   phosphotransferase; transferase"
FT                   /db_xref="EnsemblGenomes-Gn:RT0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04048"
FT                   /db_xref="GOA:Q9AKD8"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9AKD8"
FT                   /protein_id="AAU04048.1"
FT                   /translation="MLYNLLLPHIHNSHIANLFHYITFRSGLAIIITLSLSFVTGPILI
FT                   KFLRSLQKYGQPIRSDGPESHQTKAGTPTMGGIMIILSSCISTLLLADLTNKYIWITLF
FT                   GFISFGIIGFMDDYAKVKRNNHYGVRGKSKFLLQGIISVIIYVLLEYLDKNSSHVLNVP
FT                   FFKNLSLDLSYFYMVFAIFVIVGSSNAVNLTDGLDGLATVPIAFTAGSFALISYLVGNL
FT                   IYANYLQLTYIPNTGELTVLCSGLVGSCIGFLWFNAQPAEVFMGDTGSLSLGGVLGIIS
FT                   VITKHEIVLAIIGGLFVIETTSVILQVYYFKATKGKRIFKMAPLHHHFEKHGWAESKVV
FT                   IRFWIISVIFSLIGLSSLKLR"
FT   gene            complement(755424..756770)
FT                   /gene="murF"
FT                   /locus_tag="RT0584"
FT   CDS_pept        complement(755424..756770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="RT0584"
FT                   /product="synthetase"
FT                   /EC_number="6.3.2.10"
FT                   /note="D-alanine ligase; D-alanyl-D-alanine synthetase;
FT                   MurF synthetase; UDP-MurNAc-L-Ala-D-Glu-L-Lys:D-Ala-D-Ala
FT                   ligase; UDP-MurNAc-pentapeptide synthetase;
FT                   UDP-N-acetylmuramoyl-L-alanyl-D-glutamyl-L-lysyl-D-alanyl-
FT                   D-alanine; UDP-N-acetylmuramoyl-L-alanyl-D-glutamyl-meso-2,
FT                   6-diaminopimeloyl-;
FT                   UDP-N-acetylmuramoylalanine-D-glutamyl-lysine--D-alanyl-D-
FT                   alanine; UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl-;
FT                   UDP-N-acetylmuramoylalanyl-D-glutamyl-lysine-D-alanyl-D-
FT                   alanine ligase; UDPacetylmuramoylpentapeptide synthetase;
FT                   Uridine diphosphoacetylmuramoylpentapeptide synthetase;
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RT0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04049"
FT                   /db_xref="GOA:Q68WE3"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WE3"
FT                   /protein_id="AAU04049.1"
FT                   /translation="MIWNSKTLSIALGIEISHSVNCNAVQFNSKDVKKGDLFIALQGNR
FT                   DGHDYIQDAIDKGATAVIVSKQVEINDKDKIILVNDSFNALQKMALYKRKNSKAKFIAI
FT                   TGSVGKTSTKEALKILLQHDFIVFASRGNFNNYLGLLINLASMADDTEYAIFELGMNHK
FT                   GEISELVQILKPNIAMISNISEAHLEFFNSIEEIAEAKCEIFKNFSKNDIAIINASNNC
FT                   YNKILSILKNLSITNIYSFGRSKASAELIFYKTLGEQVHLKYYINNKFIDITIPFIPKH
FT                   FANNYTGVLLIIDILGKDIEIAANYLADISITKGRGEIINIQNSRVICDYYNASPQSMK
FT                   AALEYLKQVPADNKTSIIGEMLELGWNSQRLHEELVPYILDSGCTKVYLIGAYTKYIYD
FT                   LLPTKISKKFFKNVEEFIMHITDLFEYSELILIKGSRGVKLDKIVDYYQ"
FT   gene            complement(756841..758337)
FT                   /gene="murE"
FT                   /locus_tag="RT0585"
FT   CDS_pept        complement(756841..758337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="RT0585"
FT                   /product="MurE synthetase [ambiguous]"
FT                   /EC_number="6.3.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:RT0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04050"
FT                   /db_xref="GOA:Q68WE2"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WE2"
FT                   /protein_id="AAU04050.1"
FT                   /translation="MDVILFMKYNLNQLFKNYKINGLSTNSQTVKENEVFFALKGQNVD
FT                   GNDFINDALNNGAVLVITENKKNTVIDKVIYVEDVYEALYEAIEIFYPKKPKNLISVTG
FT                   TNGKSSVVSYIAQTYFLLRKKAAFIGTIGLEIFGCNNIINDVPSLTTLDYLNFRKIAHN
FT                   LAEDSIEYLAFEASSHGLEQGRLGKTKVNIVSFTSFSQDHLDYHHTKENYLLAKLKLFT
FT                   DHLLPSGIAILNSDIEEIEFVKDYLRNNNVKFITVGKKGDVQITKITCSLTGQNIDFIF
FT                   NNIIYNLHTLIIGSFQASNLLIAALTLYYTGFKFDEIIEALSKVKPVKGRMERIDGTNI
FT                   FVDYSHTPDALEKALIELQNIKPHGGKLSVIFGCGGDRDKTKRGLMGKIAAKFADNVII
FT                   TDDNPRFEDPKLIRTEIIRGIGTATYTEIESREEAIKYGINNLKQDDILLIAGKGHENY
FT                   QIVGDKKLPFDDSEVVRKYLFSMSCTRNQQKHLVSSRTVV"
FT   gene            complement(758439..761801)
FT                   /gene="mfd"
FT                   /locus_tag="RT0586"
FT   CDS_pept        complement(758439..761801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="RT0586"
FT                   /product="transcription-repair coupling factor (superfamily
FT                   helicase II)"
FT                   /db_xref="EnsemblGenomes-Gn:RT0586"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04051"
FT                   /db_xref="GOA:Q9AKD5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9AKD5"
FT                   /protein_id="AAU04051.1"
FT                   /translation="MLQQKFPATAKCFFAIDNFTKHLNQDFILSVNNEEEALKLYKQAF
FT                   FFSSNENIYYFPSYDTIPYDYTSPNTNIISRRAETLTKLITNNNSKLLITHAANLLNKL
FT                   PPKDFFSKYFLKLYPKIKFTIDELSMLLVENSFTRNISSNDVGEFSVRGEIIDIILPGP
FT                   KAYRINFSWDYIESIKEFDINTQISTKYCTELVISPVSEIVLNSKTIGNFKNNYLRNFG
FT                   VNHTDNPLYEAVISGRKFPGYEQLLPLFYDSCSSLVDYLNDPICIFDNLSKQEILEFEN
FT                   SCNDFYLARSNANKLKVNNFYPALSPASLYFTASAITELLEQKNNILISYENSEQASLI
FT                   GNISSTSFMEKKTIFDKLFELIKANFHKKIIICSSVLSSFERIKSIIQNYKYTFNEINK
FT                   LDDAKASVINIGIIPLNQSFYTKEYLFITSSELLEEKTLYTNTNKKLKNILLELDNLAE
FT                   GEFVVHKDHGIGQFLKLEAFEIQGKLHDFLKILYSGNDKLYVPVENIEVIKKYGSNNVE
FT                   LDKLGSAAWHKSKAKLKDRIKEISLHLIQIAAKRKLNISTPIEFDLEEYDKFCANFPFI
FT                   ETEDQLTAINDIRKDLTNGMLMDRLICGDVGFGKTEVAMRAVFMVAKSLNEYLPQVAVV
FT                   VPTTILCSQHFSRFIERFKGFGLNIKQLSSVVSSQEANIIRLELASGKINIIIGTHTLL
FT                   HKNIKFFNLKLLIIDEEQHFGVSQKEFLKSLKYSSHVLAMSATPIPRTLQMSLTGLKEL
FT                   SIIATPPLNRLEVRTSVMPFDTVIIRDALLREHFRGGRSFYVVPRIKDMEDIEKQLKQI
FT                   VPELSYKIAHGKMTPSKIDEVMSEFYAGKFDILISTTIIESGIDITEANTMIIHNADTL
FT                   GLSQLYQLRGRIGRGKIRGYAYLTVASNKKLMQHSLRRLEIIQNSCALGSGFTIASHDA
FT                   DLRGFGNLIGEEQSGQIREVGAELYQEMLEEQIALLKDESIVSEQSFIPNINLGLSVFI
FT                   PDHYVSDSALKIALYRRIGNLSNEIEVEKFKDEMIDRFGLLPIEFNNLLDIVKIKLLCF
FT                   KLNIENLDSGDDGFVIRFYKNADMSDKILKFVSRYSNQTKIKPNNKLVFIKKLVDKNII
FT                   TEANQLLWTLLEI"
FT   gene            complement(761803..762075)
FT                   /locus_tag="RT0587"
FT   CDS_pept        complement(761803..762075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0587"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04052"
FT                   /db_xref="InterPro:IPR005631"
FT                   /db_xref="InterPro:IPR036714"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WE0"
FT                   /protein_id="AAU04052.1"
FT                   /translation="MNKLNKNALQKKLFYRSKKRGCREMDYILGSFAEKYLSFMDEKTL
FT                   KRYTLILDQNDNDLYNWINNKSSAPSYIDSEIIDKLSKIAQIKLL"
FT   gene            762298..762567
FT                   /locus_tag="RT0588"
FT   CDS_pept        762298..762567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0588"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0588"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04053"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WD9"
FT                   /protein_id="AAU04053.1"
FT                   /translation="MLVRNICSTKVFNMLVLNNNSFLVEVSIQEEWEQVGVPHLDNENK
FT                   VIFLRLQLNKNFADNFLSIINWKIDTAIFFLCRSGSCHSLQQIL"
FT   gene            762664..764055
FT                   /gene="dnaA"
FT                   /locus_tag="RT0589"
FT   CDS_pept        762664..764055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="RT0589"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:RT0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04054"
FT                   /db_xref="GOA:Q68WD8"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WD8"
FT                   /protein_id="AAU04054.1"
FT                   /translation="MSTNQIPLTDQGDNYVNVWSYVAQDLYNHYGETLYNSWFSKVNFI
FT                   ESSLNTVILCAPTNFIRDWIKSKYAMVILQLFQHYNNAIKSIEIITKEVPGTTQTVIEL
FT                   PTKTFSNISNSALNSENTISTLDLRFTFDNFVVGAPNELAYAAARAVAESSGAVFESNP
FT                   LFLYGGVGLGKTHLMHAIGWYIKQNNPSRKVIYMSAEKFMYQFVKALRNKEVILFKEKF
FT                   RSVDVLMIDDIQFICGKDSTQEEFFHTFNTLIDNNRQMVISCDRSPSDLDNIEDRIKSR
FT                   LGWGLVADVHSTTYELRLGILESKIEQMNVKIPKDVINFLASKIVSNVRELEGALNKVI
FT                   AHSNFTLKAITLENTQNILRDLLRSNERIITVEDIQKKVANRYNIKLSDMYSSRRLREV
FT                   ARPRQIAMYLSKILTPKSLADIGKKFGKKDHTTVMHAIKKVEELLENDIELREEINLLM
FT                   KILQN"
FT   gene            766134..767630
FT                   /locus_tag="RT0590"
FT   CDS_pept        766134..767630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0590"
FT                   /product="patatin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0590"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04055"
FT                   /db_xref="GOA:Q68WD7"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WD7"
FT                   /protein_id="AAU04055.1"
FT                   /translation="MVDISNTKKSSLAILEGGGVKGEIHLEKLKVIEQITGKPTCKVFD
FT                   FTGGTSVGGLILILLNLPDPNNPGKPLFSAEQAQKLFEGMVHNIFPEGLTFRKLWSCNG
FT                   LFSYKFSPEPLVKLLKKYCKDYTLKDLIGEVIVTGYDLNNKQNPLITFSTIEARKSQDN
FT                   DYYLSDIIQGITAAPGYFPSHHFSNITNTKLHTIIDGGIYANDPTLQTWQLLKANECKI
FT                   DNALYLSLKEENNADYKTVCCGGGILELLKNNMPHKILAATQQADEITAQRIFGDKLIE
FT                   IPTYIPEKHAEMSDSSIENLQALKEFAKKSIYESSYFREALYNEKFKEVIDTIINNYNA
FT                   NNPQDKIVMNDAYKKLFHINTSNNGFDKSYANVEDITHNEDIVDAPIAQALDAKNTKDI
FT                   AHDKEEVLAGIKKFFDSFVEKNPETKIDIENFLNEIQNYTLEEIKNCIVSFKLASSKWQ
FT                   DTQNNLDVFSSCSMQALKEDISLEGEEHTDDVPGYNEIVA"
FT   gene            complement(767843..769072)
FT                   /gene="bcr1"
FT                   /locus_tag="RT0591"
FT   CDS_pept        complement(767843..769072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcr1"
FT                   /locus_tag="RT0591"
FT                   /product="bicyclomycin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0591"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04056"
FT                   /db_xref="GOA:Q68WD6"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WD6"
FT                   /protein_id="AAU04056.1"
FT                   /translation="MKIIVKIPVWMLLSLFILSPTTETIYTSGLPSLTKYFSIDGCITQ
FT                   ITSTLYFLGFAVGILSLGRLSDIYGRRPIVLLGLFIYIVSSIISIFSVNIEMLMIARFI
FT                   QAFGVSVGSVIGQSMARDSYQGAELSYVYAILSPWLLFIPSLGSYIGGYIIEYSSWHYV
FT                   FVFFSLIGTILLALYYKILPETNYYIDFSQSSKYFEVFNIIIKDKILWLYAFIIGAFNG
FT                   IYYGFFIEAPFILIDKMKVLPSFYGKLAFLLSFSAIFGGFLGGYLIKKRQVHDKKVMSI
FT                   GFIFSLCGCILFVVNAFILEFILVSNGLAISMIFVPMMIHIIGHSLLIPITLRYALEDY
FT                   AKVTGTAGSIFGAIYYIVIAAVTYCVSKIHGETISNFSLLCLVSSISSVISFYYICILY
FT                   KKKSIVANEK"
FT   gene            complement(769896..770993)
FT                   /locus_tag="RT0592"
FT   CDS_pept        complement(769896..770993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0592"
FT                   /product="probable GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04057"
FT                   /db_xref="GOA:Q68WD5"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WD5"
FT                   /protein_id="AAU04057.1"
FT                   /translation="MTLKLGIVGLPNVGKSTLFNALTASQIADAANYPFCTIEPNSSKV
FT                   LVPDERLQRLVSLAGSNKMVPSYIEFVDIAGLVKGASKGDGLGNKFLSHIREVDAILHV
FT                   LRCFEDDDIIHVHNNVDPLYDIDVIETELILADIVSLEKHFNKSEKRLRSGDKTMVEQI
FT                   ALLKEIYKVLAEGKPARILNEVLGADNLKQLQLITSKPVLYVCNVVEQDAAIGNEFTRL
FT                   VSKRAETEKTKSIVISSKIESEIASLESVEEKAELLKCIGLNKTGLSKVIKEGYNLLNL
FT                   KSFFTIGPKEAHSWTFKDGTLAPAAAGIIHTDFEKGFIRAEVIGYEDYINLGSEAKAKE
FT                   VGKMRLEGKEYKMQDGDIVHFRFNI"
FT   gene            complement(771512..772069)
FT                   /gene="pth"
FT                   /locus_tag="RT0593"
FT   CDS_pept        complement(771512..772069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="RT0593"
FT                   /product="Peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:RT0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04058"
FT                   /db_xref="GOA:Q68WD4"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WD4"
FT                   /protein_id="AAU04058.1"
FT                   /translation="MILVIGLGNPGIVYQYTRHNIGFIAIERIANKYHLSFSTKQKFNC
FT                   KIAEAIIDRQKICFIKPTTYMNLSGKSVILVKTYYNINYEKVFVIHDDIDLEIGRIKFK
FT                   TGGSNGGHNGLKSIDSIIGSHYNRIRIGIGRPQNNHDVADYVLSNFSESEYKTVMQSID
FT                   NVANNFGLILEHKLAEFKNKIV"
FT   gene            complement(772293..772904)
FT                   /gene="rplY"
FT                   /locus_tag="RT0594"
FT   CDS_pept        complement(772293..772904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplY"
FT                   /locus_tag="RT0594"
FT                   /product="50S ribosomal protein L25"
FT                   /db_xref="EnsemblGenomes-Gn:RT0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04059"
FT                   /db_xref="GOA:Q68WD3"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020055"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WD3"
FT                   /protein_id="AAU04059.1"
FT                   /translation="MSEILELEAKSRTEFGTGAARALRREGRVPAIIYGAGKIPISISL
FT                   EEKEITKYYRRPAFISQLINLTIDKKQYKVLPKAVELHPVTDIVRHVDFVFLEAKTQKM
FT                   EVPVVYEGKERALGVKRGGYFNIIKRRVILLCDINNIPRNVTIDVTNMPIGTSLKSSEV
FT                   KLPIGCSFVTKKEFVLATIIGRKGVKTEIEGEQQVAGAMQ"
FT   gene            complement(773139..773834)
FT                   /locus_tag="RT0595"
FT   CDS_pept        complement(773139..773834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0595"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0595"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04060"
FT                   /db_xref="GOA:Q68WD2"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WD2"
FT                   /protein_id="AAU04060.1"
FT                   /translation="MNNIVIMFGYNPKRSVLSGDGTKLEVQSIFKTIQGEGIFVGYPSI
FT                   FIRLGGCNLACNFCDTEFEDFELIDIDQIINKVQNLSLNSKNSKTINLVVITGGEPMRQ
FT                   PIGLLCQKLLDQDFKVQIETNGTLYRSLPKGVFIVCSPKVGKTGYNKIREDLLPQVCAV
FT                   KFIISKNIIEYSIIPEVGQSAYNIPVFVQSMDQNDKKLNAENNELAVKLALESGARLSL
FT                   QIHKFLGIE"
FT   gene            773991..774197
FT                   /gene="rpmI"
FT                   /locus_tag="RT0596"
FT   CDS_pept        773991..774197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="RT0596"
FT                   /product="50S ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:RT0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04061"
FT                   /db_xref="GOA:Q68WD1"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WD1"
FT                   /protein_id="AAU04061.1"
FT                   /translation="MPKLKTKSAVKKRFKFTATGKVIASQAGKKHFMRRRTKAQIRNLR
FT                   GTTILCPQDGYNIKKYFLPYGIN"
FT   gene            774213..774566
FT                   /gene="rplT"
FT                   /locus_tag="RT0597"
FT   CDS_pept        774213..774566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="RT0597"
FT                   /product="50S ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:RT0597"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04062"
FT                   /db_xref="GOA:Q68WD0"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WD0"
FT                   /protein_id="AAU04062.1"
FT                   /translation="MTRAKSGKISKKRHKKILKLAKGYRGRANSCFRVAIEKVEKALLY
FT                   AYRDRRNRKRDFRGLWIQRINAAVREHGLIYSQFMGALKKAGINIDRKVLAELAVNNND
FT                   GFTSIVQQSKAYI"
FT   gene            774692..774826
FT                   /gene="rpmH"
FT                   /locus_tag="RT0598"
FT   CDS_pept        774692..774826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="RT0598"
FT                   /product="50S ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:RT0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04063"
FT                   /db_xref="GOA:Q68WC9"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WC9"
FT                   /protein_id="AAU04063.1"
FT                   /translation="MKRTFQPSNLVRKRRHGFRSRMITVTGRAILKKRRAKGRHKLSA"
FT   gene            774846..775202
FT                   /gene="rnpA"
FT                   /locus_tag="RT0599"
FT   CDS_pept        774846..775202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="RT0599"
FT                   /product="ribonuclease P"
FT                   /EC_number="3.1.26.5"
FT                   /db_xref="EnsemblGenomes-Gn:RT0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04064"
FT                   /db_xref="GOA:Q68WC8"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WC8"
FT                   /protein_id="AAU04064.1"
FT                   /translation="MCITSLKNQKEFELINKLGQKFYERYFILVIAKKLPKIFLESKYN
FT                   TFLGIKVSRKLNKKAVVRNKIKRRIRHLMRIIVNDSSVKAIKFAIIIIPRKGFEEINFS
FT                   HLNYELSKIILRNI"
FT   gene            complement(775364..777202)
FT                   /locus_tag="RT0600"
FT   CDS_pept        complement(775364..777202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0600"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04065"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WC7"
FT                   /protein_id="AAU04065.1"
FT                   /translation="MQKILLQGYDINMNNTNPDIKEMRTLNDLPSAKACEYFIYAHGSE
FT                   FFYQNSHLGLLGRIQLYFMPDPSYLSVSILSDEGVTSMLDITLLNKIQRNTPVNQCNIV
FT                   HIFSCHSGAAQHHLNFIEGNIVLCTYNKASDSNVIQLAKSNYETRTKNHSSLIEYIHDN
FT                   FHLLVASDFSISYKLDNKIYNFSFSADKIKNMKSIEELPSFLYKEYGIFVEFYKNIYAQ
FT                   YHKSYPEIFNSSIETKPKGLTYADLIRVFNRALTLEVYNFNKFSLRKIENMLNQKGLNT
FT                   DFSIDQAIEQENFELLISLLNYDNTKIQFYTVNKAIEKGNLDILKAVLEHSTTNIIPYN
FT                   IERVIEKGNLDILKAVLEHSTIKIESNNVDTAIEKGNLDLLKAVLEHNTTKIESYNIDR
FT                   AIVKGNLDIFKAVLEHSTTKIESYNFDKIIEKGNLDIFKAALEHSTIKIESYNFDKIIE
FT                   KGNLDIVKAVLAHSTTKIESYNINKAIEKSNLDILKAVLEHSTAKIESYNIERAIEKGN
FT                   LDILKAVLEHSTAKMYSYNFDTVIKTGNLEMLDMVLQHLDIAVDSYNIYVAQRTNNLEV
FT                   IELIKKYHNHTINNIMPEVYSSIEEDVTILGAEIVQ"
FT   gene            complement(777824..778728)
FT                   /pseudo
FT                   /locus_tag="RTPG32"
FT                   /note="pseudogene of Mg/Co transport protein RC0943"
FT   gene            complement(778825..778974)
FT                   /locus_tag="RT0601"
FT   CDS_pept        complement(778825..778974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0601"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04066"
FT                   /db_xref="GOA:Q68WC6"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WC6"
FT                   /protein_id="AAU04066.1"
FT                   /translation="MHYLGYGGLSLGTILAIVISFNVNKSILWAIIHGFCGWFYVVYYL
FT                   LLKK"
FT   gene            complement(779669..781167)
FT                   /gene="rrs"
FT                   /locus_tag="RT0602"
FT   rRNA            complement(779669..781167)
FT                   /gene="rrs"
FT                   /locus_tag="RT0602"
FT                   /product="16S ribosomal RNA"
FT   gene            complement(783022..784827)
FT                   /gene="ntrY"
FT                   /locus_tag="RT0603"
FT   CDS_pept        complement(783022..784827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrY"
FT                   /locus_tag="RT0603"
FT                   /product="nitrogen regulation protein NtrY"
FT                   /db_xref="EnsemblGenomes-Gn:RT0603"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04067"
FT                   /db_xref="GOA:Q68WC5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WC5"
FT                   /protein_id="AAU04067.1"
FT                   /translation="MSMLSYLKQNLCFYLSSKILILALAISAIVSACTTFYVISLEAKN
FT                   FSTIIGFLLIDLAIFLILGILLTQKFFSKNNDNDSSRLQNRIVIAFSLVAAIPTIIVSV
FT                   FSVYFFNLSVKAWFDKKISTVLDQSVIVAETYIAEHKVQLKETALAVAEDLSDMYYDLI
FT                   HNPALFTKTLNTEADMRSLDEAIVLNKSTNTIVANSYLSFSLSFATIPAHLIKKADLGE
FT                   PVEVKSDPTKIRMLIKLKEYNDVYLLVGRLVDNKIIDHIDATNGAAAEYNSLKNEIDNI
FT                   QIKFSIMFIFIALLLLFVAINFGVLFTAQIVKPIKKLVTATDKVKDGDLTVQVPENEVD
FT                   KDEIGTLYVAFNRMIKQLSRQQRDLVIAQRAMAWSDVAKKVAHEIKNPLTPILLASERL
FT                   LKKFSAEIKDKSEFESYLKMIIRHTNDIKNIVSEFVLFARLPAPKFTKSELVYLVKHII
FT                   EARKLLNDNIVYTCDSNVDQFDFMCDATQINQVMINVLKNAEESIEGQEFGRIDVILDI
FT                   KDDFINVIVMDNGKGFPPELIGKATESYVTTSSKGMGVGLAIVKRIVEEHCGVLDIANR
FT                   EDKGAIIDIKFDLKELHLKVRRSCG"
FT   gene            complement(785049..785249)
FT                   /gene="rpsU"
FT                   /locus_tag="RT0604"
FT   CDS_pept        complement(785049..785249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="RT0604"
FT                   /product="30S ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:RT0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04068"
FT                   /db_xref="GOA:Q68WC4"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WC4"
FT                   /protein_id="AAU04068.1"
FT                   /translation="MILVNVHAGNCDNTLKNFKKKLQRELYFRKMKEQRYYETPSAKRV
FT                   RKAQEAARRIRKFARKKMYEE"
FT   gene            785330..785941
FT                   /locus_tag="RT0605"
FT   CDS_pept        785330..785941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0605"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0605"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04069"
FT                   /db_xref="GOA:Q68WC3"
FT                   /db_xref="InterPro:IPR012762"
FT                   /db_xref="InterPro:IPR013718"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WC3"
FT                   /protein_id="AAU04069.1"
FT                   /translation="MSIKEEYNIKKINFMQSLLELLPFHEWDNNLLEEAEEKCGFAKGY
FT                   ALIIFPDGLSEIIEFFEDYLDKIMLANLTTITEPEKIREKISLALKIRVKIFIPIIHSK
FT                   NAAYFALNPIQGIKVAVRSCDAIWRYAGDKSLDFNYYTKRGLLLSVYISSILFYIQDES
FT                   EHYIETDQFIETSIKNRVKTFTKIQKILNKSNIPIIRMFM"
FT   gene            786574..789834
FT                   /gene="ileS"
FT                   /locus_tag="RT0606"
FT   CDS_pept        786574..789834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="RT0606"
FT                   /product="Isoleucine translase"
FT                   /EC_number="6.1.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:RT0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04070"
FT                   /db_xref="GOA:Q68WC2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WC2"
FT                   /protein_id="AAU04070.1"
FT                   /translation="MTNTKYYPDVSANVDFAAIEREILKFWQNNNIFQKSIDHRDGESE
FT                   FIFYDGPPFANGLPHYGHLLTGFIKDVYARYQTVKGKKVERRFGWDCHGLPAEMQSEKE
FT                   LGISGRLAITNFGIEKFNNHCRASVMQYASEWKQYVTRQARWVAFDNAYKTMDKNFMES
FT                   VLWAFKELYNKGLLYESMRVMPYSWACETPLSNFETRLDNSYRERTDKAITVSFMLNDI
FT                   TLFNSMISQKLGMTGGDNFKEYRILAWTTTPWTLPANLALAVGSDIDYALVNKNDVCYI
FT                   IAASSVAKYAKELGLSGKENFEIIKGLKLQGLSYKPLFNYFENHPNSFKIFASNFVVEG
FT                   EGTGIVHMAPGFGEDDQILCESKGIELVCPVDNSGKFTKEIPDLEGVQVFDANDKIIIK
FT                   LKEQGNWIKTEQYIHNYPHCWRTDTPLIYKAVPSWYVRVTQFKDRMVELNQQINWIPHN
FT                   VKDNLFGKWLENARDWSISRNRFWGTPLPVWKSDDPKYPRIDVYGSIEEIEQDFGVKIN
FT                   DLHRPFIDELTRTNPDDPTGKSIMRRIDDVFDCWFESGSMPYGQAHYPFENKKWFVEHF
FT                   PADFIVEYSSQTRGWFYTLIVLSTALFDRPPFLNCICHGVILDATGQKLSKRLNNYADP
FT                   LELFDRYGSDALRVTMLSSNVVKGQELLIDKDGKMIFDTLRLFIKPIWNAYHFFTIYAN
FT                   ADALKGTLNFTSQNVLDIYILSKLKIAVNKIEESLDNFDTQTAYHAVSEFFEVLNNWYI
FT                   RRSRARFWKKEKDTDKQNAYNTLYSCLETMTIAMSALVPMISEAIYQGLHNTAITQLNC
FT                   LLLEGKHVVQNPMSGTQDYNTSVHLCNYPTLSDFEINHELVSTMDNVLDICSNSLFIRS
FT                   TKNIRVRQPLACITIISKHNNNLKDFEDLIKDEINVKTVIYRDDLENYAHKKLSLNFAI
FT                   LGKRLPHKMKAIIDASKKGEWETSTLGLVICGEILNSNEYKLVLEPHSHIKGTANFENN
FT                   SSLLILDLELTSELIEEGYARDIIRFIQHARKEADFSITDKILIEIISEFDLSKIIENY
FT                   GDFIKEQTLGEFAKNFMPDYVSKVALENNLIQLKVKRL"
FT   gene            790366..790560
FT                   /locus_tag="RT0607"
FT   CDS_pept        790366..790560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0607"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0607"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04071"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WC1"
FT                   /protein_id="AAU04071.1"
FT                   /translation="MKYDSIKVLSLIAVTNLDKYPEVIIYLNIYKLSLLQNIILLMLKL
FT                   SNKTNKSLFDILGIEKNCN"
FT   gene            complement(790779..792776)
FT                   /gene="pccA"
FT                   /locus_tag="RT0608"
FT   CDS_pept        complement(790779..792776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pccA"
FT                   /locus_tag="RT0608"
FT                   /product="PCCase"
FT                   /EC_number="6.4.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:RT0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04072"
FT                   /db_xref="GOA:Q68WC0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR041265"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WC0"
FT                   /protein_id="AAU04072.1"
FT                   /translation="MTKPLFDKILIANRSEIAVRIIRTLKKMGIGSVAVYSEADTNSMY
FT                   VQHADEAYYIGDSPATASYLSVKNLISAIRESGASAVHPGYGFLSENPNFANILKREGV
FT                   VLIGPSAGTIKKMGDKIEAKKIAIEAGVSTVPGYMGTIKDVKQAIDIAKEIGFPVIVKA
FT                   TAGGGGRGMRVVNNPAEMANAFESAKLEAANSFSDDRLFIEKLIQTPRHIEIQLIADQY
FT                   GNSVCLGERECSIQRHHQKVIEEAPSSFITENIRQEMYRQVISLSQKVGYYSAGTVEFI
FT                   VDSNKNFYFLEMNTRLQVEHPVTELITGIDIVEEMIKIAAGEKLSFTQDDIKLKGWAFE
FT                   SRICAENPSRGFLPSSGRIIAYSEPAKSPNIRIDTGIGLGGEVSMFYDSMIAKLCTYGE
FT                   TREQAIEVMRSALSSYIINGIAHNISFLEAVMLHPRFVSGDISTDFIQEEYPDGFSGAS
FT                   LTSEVTTVFLATAIFIYISEQRRASLISGNINNQANKIGTRWVVTIDDKLFPVLITPVE
FT                   NGYNIRHESDRIYIRSNWNLGNELFTAIINGKKTNVKIENIRTGYLLSHAGISVKAFVR
FT                   SPRISELEALMVSKVVLEENSELQVPLSGQIAAIKVKEGQEVTIGQEIMILTAMKMENI
FT                   ILAERDGKIAKIFVNEKDNVVKGKILLEFA"
FT   gene            complement(792874..794418)
FT                   /gene="pccB"
FT                   /locus_tag="RT0609"
FT   CDS_pept        complement(792874..794418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pccB"
FT                   /locus_tag="RT0609"
FT                   /product="PCCase"
FT                   /EC_number="6.4.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:RT0609"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04073"
FT                   /db_xref="GOA:Q68WB9"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WB9"
FT                   /protein_id="AAU04073.1"
FT                   /translation="MNQSNIISPELLDERKNIARQGGGEARINAQHKKGKLTARERIEV
FT                   LLDPNSFTETGMFVSHRCDNFGMQNKKFLGDGVVTGHGTINGRLVFIYSQDFTVLGGSL
FT                   GEYHAKKICDIIDQAIATGAPVIGINDSGGARIQEGVDALAGYGELFQRNVLASGVIPQ
FT                   ITLIMGPCAGGAVYSPALTDFIFMVKNSSYMFVTGPDVVKTVTGEEVTQEKLGGARMHT
FT                   TKSGVADLAFNNDIEALLEIRKFFNFLPSSNRSTLPVRPTVDPADRVDMSLSTLIPNTP
FT                   NKPYDMKELVERIVDEGEFFELQPDFAKNIIIGFGYMEGYPVGFVANQPLHLAGCLDIN
FT                   ASRKAARFIRFCDAFNISIVSLVDVPGFLPGTSQEHEGIIKHGAKLLYAYAEATVPKIT
FT                   VITRKAYGGAYIVMNSKHLRGDINYAWFNSEIAVMGAEGAAEIIFKEECKDNEAKKQKI
FT                   DEYRKIVTSPFVAASRGYLDDIIRPQNTRWRICKALNFLRTKKVSLPWKKHDNLPL"
FT   gene            794494..794634
FT                   /locus_tag="RT0610"
FT   CDS_pept        794494..794634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0610"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0610"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04074"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WB8"
FT                   /protein_id="AAU04074.1"
FT                   /translation="MSSTEDTKEVLQKVKSLAKFANLSTTLKKNLYRRKKVQKEKNNKK
FT                   Y"
FT   gene            795116..798574
FT                   /gene="aas"
FT                   /locus_tag="RT0611"
FT   CDS_pept        795116..798574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aas"
FT                   /locus_tag="RT0611"
FT                   /product="bifunctional protein Aas
FT                   (2-acylglycerophosphoethanolamine acyltransferase and
FT                   Acyl-acyl carrier protein synthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:RT0611"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04075"
FT                   /db_xref="GOA:Q68WB7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WB7"
FT                   /protein_id="AAU04075.1"
FT                   /translation="MNTNKLYLFKDRRFLPNFIIQLFGCLNDNILKNALVILITYGISE
FT                   TISKYNNVLVLIANATFVLPFIIFASIAGQIADKYERASLIKILKIYEIGIIAFAIYGF
FT                   HNNNLLILFCSICLMGIHSTFFGPIKYSVLPDHLNKDELLGANGFVEAATFIGIFIGTI
FT                   IGSYYTISNNFIIYSLMTIAFLGFITSLLSPKSKNANHNIKINFNIIDESINMIKYAKA
FT                   KKQIYLAILGISWFWFIGAAIIAQIPLLAKITFKADENVANLFLAVFSLGVGVGSFLCS
FT                   KIFEDEITVKYLFISALGISIFGIDLFFASRISSVNYEPTQLKSIFVFLSKRHNWRIVI
FT                   DLFFLAIISGLYIVPLFAILQHYANPAHRSRIIAANNLINSIFMVGSTIILSLLFYLNF
FT                   TIPWIILFISLANIVVTIYIYRLIPEVKIIPFKLLRRIFQICFDLMYKVEVKGFENFQK
FT                   AGKKVVVVANHISYLDPPLIATYLREEMIFAISPDIQKIWWIKPFLRMAKTLPVDPSNP
FT                   MAIKTLVKAVQKDQKIAIFPEGRISVTGSLMKIYEGPGMIADKADATLLPVRIDGTQFT
FT                   HLSKLKNILKKKIFPKITITVLPPVKFANIDTANNQARRSYISRTLYDIMADMMFESSD
FT                   YKNTLFSSLIEAAKIHGFKKKIVDDFEKNTVTYRDLIFKSFILGDLIKKNNIFDRHLGL
FT                   MLPNTTNTLITFYAMQSNGYVPAIINWSSAIGTITNCCKLAQIKVVYTSKEFIEKANLH
FT                   ELITHLLDLGIKIIYLEDFKNQISTALKLKAKIGSYFSQTYYNYFCHNRDDEKPAVIIF
FT                   TSGTEGEPKAVLLSHKNLQTNRYQITAKVPFSPEDIVFNSLPLFHSFGLGGAIITTLNG
FT                   IKLFLYPHALNYRSIPEAIYDIGATILISTDTFLKGYANYAHPYDFFSLRYIFAGNEKL
FT                   KETTRQFWLNKYGIRIFEGYGITEAAPIIACNTPMHNKAGTVGRLLPKIDYKLEKVAGI
FT                   NEGGRLFIKGPNIMLGYLDLEGHRSYQEWYDTGDIVKIDSEGYITILGRLKRFAKIAGE
FT                   MISLTKIEELASEIDPESLHAAISVQDKRYGAKIILLTTGSDINKENFTKMVSNAQISL
FT                   LHLPKLIITNSEIPLLASGKIDYLEIMKNRNLIDSRHSEHYSIER"
FT   gene            complement(798925..799686)
FT                   /gene="znuB"
FT                   /locus_tag="RT0612"
FT   CDS_pept        complement(798925..799686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="znuB"
FT                   /locus_tag="RT0612"
FT                   /product="zinc/manganese ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0612"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04076"
FT                   /db_xref="GOA:Q68WB6"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WB6"
FT                   /protein_id="AAU04076.1"
FT                   /translation="MTLIILALILISCIFAPLGCIALWKRYIYFGDGLAHSSFLAASIS
FT                   IIAHFPLIYSGIIVAILFSFFVFFFKNNSEKNAVINLISSFMLAVALIINYFTSLQNNI
FT                   VHLLFGDILSVSFNDLIILVVVFITIISFIVYFYNQILLTIINRDIAVIQGLNVNIIEL
FT                   IFLLLLSLSVFAAIKIVGVLMVTAILLIPAMIARFVAYSPSQMIIISIFISLFINFCAA
FT                   FSSFYFDLPLTPLFIVLGTLIYSLFYLKRFL"
FT   gene            799767..800507
FT                   /gene="ubiG"
FT                   /locus_tag="RT0613"
FT   CDS_pept        799767..800507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiG"
FT                   /locus_tag="RT0613"
FT                   /product="3-demethylubiquinone-9 3-O-methyltransferase"
FT                   /EC_number="2.1.1.64"
FT                   /db_xref="EnsemblGenomes-Gn:RT0613"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04077"
FT                   /db_xref="GOA:Q68WB5"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WB5"
FT                   /protein_id="AAU04077.1"
FT                   /translation="MSSINKKELKKFEKISHNWWNKDGEFGILHRINHIRIEYIIEKIK
FT                   LHYNDISKLQILDVGCGGGLIAAPLASQGFNVTAIDALKSNIETATIYAQKNDLKINYL
FT                   QTTIEELENDKLYDVVICLEVIEHVENVQQFILNLVQHIKPNGIAIISTINRTKKAYLF
FT                   GIIVAEYILGWVPKNTHDYSKFLKPSEIYEILTDTNIEIKELKGLVFNLARNEWKLSND
FT                   IDVNYFMYLGKKINSLSNAINSIP"
FT   gene            800628..802037
FT                   /gene="gltX2"
FT                   /locus_tag="RT0614"
FT   CDS_pept        800628..802037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX2"
FT                   /locus_tag="RT0614"
FT                   /product="Glutamic acid translase"
FT                   /EC_number="6.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:RT0614"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04078"
FT                   /db_xref="GOA:Q68WB4"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WB4"
FT                   /protein_id="AAU04078.1"
FT                   /translation="MTNIITRFAPSPTGFLHIGSARTALFNYLFARHNNGKFFLRIEDT
FT                   DKKRSTKEAIAAIFSGLKWLGINWDGEVIFQSKRNSLYKEAALKLLKEGKAYYCFTKQE
FT                   EIARQRQQALKDKKHFIFNSEWRDKGPSTYPADIKPVIRLKVPREGSITIHDTLQGDIV
FT                   IENSHIDDMILIRADGTATYMLAVIVDDHDMGITHIIRGDDHLTNAARQIAIYHAFGYE
FT                   VPNMTHIPLIHGADGTKLSKRHGALGVEAYKDMGYLPESLCNYLLRLGWSHGDDEIISM
FT                   NQAIEWFNLDSLGKSPSKLDFAKMNSINSHYLRMLDNDSLTSKTVAILKQNYKISEKEV
FT                   SYIKQAMPSLIVRSATLIDLAQLAYIYLVDSPMIYNQDAKEVIKNCDKDLIKQIIANLN
FT                   KLEQFDKECIQNKFKEIAIYNGLKLNDIMRPVRALITGMTASPSIFEIAETLGKENILK
FT                   RLNIIYYNLNF"
FT   gene            804351..805103
FT                   /gene="spoTb"
FT                   /locus_tag="RT0615"
FT   CDS_pept        804351..805103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoTb"
FT                   /locus_tag="RT0615"
FT                   /product="guanosine-3,5-bis(diphosphate)
FT                   3-pyrophosphohydrolase SpoTb"
FT                   /db_xref="EnsemblGenomes-Gn:RT0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04079"
FT                   /db_xref="GOA:Q68WB3"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WB3"
FT                   /protein_id="AAU04079.1"
FT                   /translation="MEDIDIWQEKFEFCNYSKKLIGRIEYLNTIVDSPIDIIEVKKGIY
FT                   YTRKYHATQMRQSGEPYYSHPIEVAIMLADFTALEAPKLYKSYMINVALLHDTIEDTIL
FT                   THADISKIFDKNIADNVERLTRIKPYGKISSGEMLNLLIQEQRYDIALIKVFDRLHNLQ
FT                   TINAKSTEKALETVKETIESFLLIAAYLEIRTVEQQLLNVCNNFIKQHFPSEQKAIFRS
FT                   VYEISFFNFKIIQNKLKRMQYYFRKKKA"
FT   gene            complement(805109..805450)
FT                   /gene="spoTc"
FT                   /locus_tag="RT0616"
FT   CDS_pept        complement(805109..805450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoTc"
FT                   /locus_tag="RT0616"
FT                   /product="guanosine-3,5-bis(diphosphate)
FT                   3-pyrophosphohydrolase SpoTc"
FT                   /db_xref="EnsemblGenomes-Gn:RT0616"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04080"
FT                   /db_xref="GOA:Q68WB2"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WB2"
FT                   /protein_id="AAU04080.1"
FT                   /translation="MTGRIKHPISILYKLYRKGIKLEELTDIFAIRIVVIDEEKCYKAL
FT                   KIVHELYDHEKDKFKNYILNPKPNGYQSLHTIIITEDNYKIEIQIRDYNMHYNAESGDA
FT                   AHWKYKNSF"
FT   gene            complement(806356..808008)
FT                   /gene="groEL"
FT                   /locus_tag="RT0617"
FT   CDS_pept        complement(806356..808008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="RT0617"
FT                   /product="60 kDa chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:RT0617"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04081"
FT                   /db_xref="GOA:O85754"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:O85754"
FT                   /protein_id="AAU04081.1"
FT                   /translation="MTTKLIKHGSKAREQMLEGIDILADAVKVTLGPKGRNVLIEQSFG
FT                   APKITKDGVTVAKSIELKDKIRNAGAQLLKSAATKAAEVAGDGTTTATVLARALAREGN
FT                   KLVAAGYNPMDLKRGMDLAVNAVVEEIKRSSKKINSQEEIAQVGTISSNGDKEIGEKIA
FT                   KAMEEVGKEGVITVEEAKNFSFDVEVVKGMMFDRGYLSPYFVTNSEKMVAELENPFILL
FT                   FEKKLSNLQPMLPILEAVVQSQRPLLIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGF
FT                   GDRRKAMMEDIAILTKGELITEDLGMKLENVNIKNLGTAKRVTISKENTVIVDGNGDKK
FT                   NIEDRVLQIKSQIAETTSDYDKEKLQERLAKLSGGVAVLKVGGATEVEVKERKDRVEDA
FT                   LAATRAAVEEGVVAGGGVTLLHASQTLTKLKVENKDQQAGIEIVIEALKDPLKQIVKNA
FT                   GENGGVVVGKLLEHNDKNYGFNAQDMQYVDMIKAGIIDPAKVVRTALQDAASVASLIIT
FT                   TETLIVDEPSDKEEPMPMRGGMGGMGGMGGMDF"
FT   gene            complement(808029..808316)
FT                   /gene="groES"
FT                   /locus_tag="RT0618"
FT   CDS_pept        complement(808029..808316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="RT0618"
FT                   /product="10 kDa chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:RT0618"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04082"
FT                   /db_xref="GOA:P80469"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:P80469"
FT                   /protein_id="AAU04082.1"
FT                   /translation="MSFKPLHDRIAIKPIENEEKTKGGIIIPDTAKEKPMQGEIVAVGN
FT                   GVLNKNGEIYPLELKVGDKVLYGKWAGTEIEIKGEKLIVMKESDVFGIIN"
FT   gene            complement(810065..810571)
FT                   /gene="rph"
FT                   /locus_tag="RT0619"
FT   CDS_pept        complement(810065..810571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="RT0619"
FT                   /product="Phosphate-dependent exonuclease"
FT                   /EC_number="2.7.7.56"
FT                   /db_xref="EnsemblGenomes-Gn:RT0619"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04083"
FT                   /db_xref="GOA:Q68WA9"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WA9"
FT                   /protein_id="AAU04083.1"
FT                   /translation="MRQSGRKSNQLRPISLELSPLIHAEGSCLIKIGNTHVMCSATCET
FT                   TVPPFLRGQNRGWITAEYGMIPGSTSNRIKREVALGKQGGRTQEIQRLIGRVMRCVINL
FT                   QKLGERQIIIDCDVINADGGTRTSAITGSYIALHLAIRLLMKKRILKVNTLISQIAAIS
FT                   CGIYR"
FT   gene            810786..811322
FT                   /gene="grpE"
FT                   /locus_tag="RT0620"
FT   CDS_pept        810786..811322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="RT0620"
FT                   /product="HSP-70 cofactor"
FT                   /db_xref="EnsemblGenomes-Gn:RT0620"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04084"
FT                   /db_xref="GOA:Q68WA8"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WA8"
FT                   /protein_id="AAU04084.1"
FT                   /translation="MKDDNIENNNIEEENLNIETQVVANEEIALLKAEIKELQDKLIRT
FT                   TAEIDNTRKRLEKARDEAKDYAIATFAKELLNVSDNLSRALAHKPSNADVEVTNIISGV
FT                   QMTKDELDKIFHKHHIEEIKPEIGSMFDYNVHNAISHIEHPDHKPNSIITLMQSGYKIR
FT                   DRLLRPATVQVVKKP"
FT   gene            811469..812524
FT                   /locus_tag="RT0621"
FT   CDS_pept        811469..812524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0621"
FT                   /product="possible permease"
FT                   /db_xref="EnsemblGenomes-Gn:RT0621"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04085"
FT                   /db_xref="GOA:Q68WA7"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WA7"
FT                   /protein_id="AAU04085.1"
FT                   /translation="MNRTAVFLLVFLTLSISSFMLIPDTIKPFFIAFIISYLLQPAIYF
FT                   IESKLEISNKFASSIMYLIFLSIFFLIFTILVPIIYGQIFTLINNIPKYKDYLQSEILP
FT                   PIMEKIYSIEPDIADKIKHSLSNFINSIFTILGSIANNFWRYTIITINIFVLFLLIPII
FT                   LFYFLRDWNKIIANMKSLLPIKTRPKILEILSAINNLLSSYIRGQLNICLLLSTYYSIA
FT                   FTVIGLDLALLLGILTGFLVIIPFLGTFISFLLTLIIGYLTFGITSKLLYIMIIYLIGN
FT                   IGESYILTPKIIGDKIGLHPLWIIFAIFACGSLFGIIGIFFAIPIAGITKILLLNLIKF
FT                   YKSSKFYRTDV"
FT   gene            812539..813204
FT                   /locus_tag="RT0622"
FT   CDS_pept        812539..813204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0622"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0622"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04086"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WA6"
FT                   /protein_id="AAU04086.1"
FT                   /translation="MQQYIFRFTTSNKYHPDEFIVSSSNAQAYNIIKNWQCCFGVNPYK
FT                   FTLLIKGPSSSGKTYLTKIWQNLSNAYIIKDIFLNEEILEKNNTFIIEDIESWQEPALL
FT                   HIFNIINEKQKYLLLTSSDKNDNFTLPDLSSRIKSVLSILLNSPDDELIKILIFKHFSI
FT                   SSVTISRQIIDLLLVNLPREYSKIIEILENINYFALISKRKITISLVKEVLNNYKNKI"
FT   gene            complement(813926..814159)
FT                   /locus_tag="RT0623"
FT   CDS_pept        complement(813926..814159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0623"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0623"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04087"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WA5"
FT                   /protein_id="AAU04087.1"
FT                   /translation="MSNTSKLENHYNKLLKDIMLKTLEQNKTVETYLIQQDFSSALDEL
FT                   QQINEKLAEYCKVFTLLEIIKTELDEEDKVYN"
FT   gene            complement(814509..814584)
FT                   /gene="tRNA-Val"
FT                   /locus_tag="RT0624"
FT   tRNA            complement(814509..814584)
FT                   /gene="tRNA-Val"
FT                   /locus_tag="RT0624"
FT                   /product="tRNA-Val"
FT                   /note="codon recognized: GUA"
FT   gene            complement(814653..814925)
FT                   /gene="rpsT"
FT                   /locus_tag="RT0625"
FT   CDS_pept        complement(814653..814925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="RT0625"
FT                   /product="30S ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:RT0625"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04088"
FT                   /db_xref="GOA:Q68WA4"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WA4"
FT                   /protein_id="AAU04088.1"
FT                   /translation="MANHSSAKKVVRQTIKRTLINKKRSSAIKTFIKKVMYEISRGNKE
FT                   DANLALSVAQSKIMQGVKKNIIKLNTASRKISRLSRQIKNLHKSE"
FT   gene            complement(814945..815358)
FT                   /gene="rplQ"
FT                   /locus_tag="RT0626"
FT   CDS_pept        complement(814945..815358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="RT0626"
FT                   /product="50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:RT0626"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04089"
FT                   /db_xref="GOA:Q68WA3"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WA3"
FT                   /protein_id="AAU04089.1"
FT                   /translation="MRHRIKGRRLNVTSSHRQSMLANMAVALVMHEQIKTTLPKAKELR
FT                   PYIEAIITKAKKADLTVRRSVLSKIKDKKAVEKIINILGVRYKDRPGGYTRIVKSGFRY
FT                   GDLAPIAYIEFVDRDINAKGKKMYQDASEEIKN"
FT   gene            complement(815371..816393)
FT                   /gene="rpoA"
FT                   /locus_tag="RT0627"
FT   CDS_pept        complement(815371..816393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="RT0627"
FT                   /product="RNA nucleotidyltransferase (DNA-directed)"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:RT0627"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04090"
FT                   /db_xref="GOA:Q68WA2"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WA2"
FT                   /protein_id="AAU04090.1"
FT                   /translation="MLSLSKNWNTLIKPNRVTYENFPETNNKAKIIVEPLERGFGLTLG
FT                   NAMRRVLLSSLQGAAITSIKIPAIEHEFSSIPGVQEDVSEVILNIKGIEVKMHVSEKRI
FT                   MKLKATGPCVVTAGMIDTGHDVEILNPNHVICNLAKNKQLEMELTCKVGKGYVLSTNSY
FT                   EDNLPIGEIAIDALFNPVKSVTYKVENTRVGQVTDYDKLIIFVETNGDVLPEMAVGLAA
FT                   RILQEQLQLFIAFEEQEEDKQVKTDSLPFSPYLLKRVDELELSVRSANCLKNDNIIYIG
FT                   DLVKRTESDMLRTPNFGRKSLNEIKEILAKFNLRFGMDVPDWPPENIQELSKRYEDSYN
FT                   "
FT   gene            complement(816412..816795)
FT                   /gene="rpsK"
FT                   /locus_tag="RT0628"
FT   CDS_pept        complement(816412..816795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="RT0628"
FT                   /product="30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:RT0628"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04091"
FT                   /db_xref="GOA:Q68WA1"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WA1"
FT                   /protein_id="AAU04091.1"
FT                   /translation="MNQTIKVKKKKKTITLGVVHIRASFNNTIVTFTDIQGNTISSASA
FT                   GGNGFKGARKATPYAAQVTIDKASEKAKECGLKTISIRIGGPGAQRESAMRALFGQNFV
FT                   VTSILDVSSIAHNGVRPPKRRRV"
FT   gene            complement(816821..817198)
FT                   /gene="rpsM"
FT                   /locus_tag="RT0629"
FT   CDS_pept        complement(816821..817198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="RT0629"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:RT0629"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04092"
FT                   /db_xref="GOA:Q68WA0"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WA0"
FT                   /protein_id="AAU04092.1"
FT                   /translation="MARIASVNIPDNKRLVVSLTYIYGLGSTMAAEICNKAKISRDKKV
FT                   KVLTDQELIRLRNIIENEYKVEGDLRREVTLNIKKKKDIRCYQGLRHIRKLPVRGQNTH
FT                   SNARTRKGKAIAIAGKKKTVK"
FT   gene            complement(817256..817897)
FT                   /gene="adk"
FT                   /locus_tag="RT0630"
FT   CDS_pept        complement(817256..817897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="RT0630"
FT                   /product="Adenylic kinase"
FT                   /EC_number="2.7.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:RT0630"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04093"
FT                   /db_xref="GOA:Q68W99"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W99"
FT                   /protein_id="AAU04093.1"
FT                   /translation="MIVIFLGPPGAGKGTQGKKIAKKIDLPHIAVGDIFRTIIKTSTSE
FT                   AELINNYVKQGALIPNEIVNQVIKIFLLSSQYKNGYILDGYPRNLEQARFFESFIKKAQ
FT                   IKIIYFDVADELLIKRVLGRYSCKNCGKIYNVHFLQPKTDYVCDVCSSNVFDYRRDDNE
FT                   EVIKKRIEVYKTETYPLIDYYKNSGNFYIVNASKDEQEIENDIQKILKIN"
FT   gene            complement(817913..819214)
FT                   /gene="secY"
FT                   /locus_tag="RT0631"
FT   CDS_pept        complement(817913..819214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="RT0631"
FT                   /product="preprotein translocase SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RT0631"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04094"
FT                   /db_xref="GOA:Q68W98"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W98"
FT                   /protein_id="AAU04094.1"
FT                   /translation="MGQNFSKKSSNDLVSRIIFTIFMLIICRIGSFIPIPGIDSIALNS
FT                   VAEKNQFGILGMFNMLSGGSLGRMSIFALAIMPYITASIIIQLMSVAYKPLENLKKEGE
FT                   SGKRKINQLSRYLTVLLASFQAYGVALSLESMVTNTGPVVILAGFFFRVTTVITLVVGT
FT                   MLLMWLGEQITQRGIGNGTSLIIFIGIISGVPSAIISMFELSRKGALSPLIAITVCIGV
FT                   VLLIAIIIFFEKAQRKLLVQYPKRQVGNKIYGGEATHMPLKLNTSGVIPPIFASSILLF
FT                   PTTLANFSNSNSETMSMLSYYLGHGKPVYILLYVVLIMFFSFFYTAIVFNSEETANNLR
FT                   KYGAYIPGKRPGKNTSDYFDYILTRLTVIGGLYLSIICVIPELLMNKYVISLSLGGTSF
FT                   LIVVNVVLDTMTQIQTYLFSSKYEGLMKKIKLKN"
FT   gene            complement(819219..819671)
FT                   /gene="rplO"
FT                   /locus_tag="RT0632"
FT   CDS_pept        complement(819219..819671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="RT0632"
FT                   /product="50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:RT0632"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04095"
FT                   /db_xref="GOA:Q68W97"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W97"
FT                   /protein_id="AAU04095.1"
FT                   /translation="MKLNELYNNIGAKKNKKRIARGIGSGKGKTAGRGIKGQKSRSGVA
FT                   IKGFEGGQTPMIKRLPKRGFKCISTKKYNIINIYNIEKALTDGRLSTNNIITKEKLIEI
FT                   GLINNKNLVKLLSICSDDFASPLSLKLDAYSSKAKYLIEKAGGQLL"
FT   gene            complement(819685..819876)
FT                   /gene="rpmD"
FT                   /locus_tag="RT0633"
FT   CDS_pept        complement(819685..819876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="RT0633"
FT                   /product="50S ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:RT0633"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04096"
FT                   /db_xref="GOA:Q68W96"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W96"
FT                   /protein_id="AAU04096.1"
FT                   /translation="MNNKVNNIKITQIKSAIGCKYDQRLTLIGLGLNKINKSVILENTN
FT                   SIKGMVKKVKHLLEIKNM"
FT   gene            complement(819914..820441)
FT                   /gene="rpsE"
FT                   /locus_tag="RT0634"
FT   CDS_pept        complement(819914..820441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="RT0634"
FT                   /product="30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:RT0634"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04097"
FT                   /db_xref="GOA:Q68W95"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W95"
FT                   /protein_id="AAU04097.1"
FT                   /translation="MSKVKKNEEALSEVLVDVNRVTKVVKGGRRFAFSAYVVVGDKAGR
FT                   VGAGHGKAKEVNEARGKAKQAAKKRMMKVPLYQNRTIHHDVVGKSGAAKVILRRAKAGT
FT                   GVIAGGSMRAIFDSLGVHDIVAKSIGSTNVYAMISATFDALNKLASPKSIAIRRGKKVH
FT                   EISVKSYIQVNK"
FT   gene            complement(820458..820814)
FT                   /gene="rplR"
FT                   /locus_tag="RT0635"
FT   CDS_pept        complement(820458..820814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="RT0635"
FT                   /product="50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:RT0635"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04098"
FT                   /db_xref="GOA:Q68W94"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W94"
FT                   /protein_id="AAU04098.1"
FT                   /translation="MRSAKLKFEKRKSRIRHKISRTSNRVRLSVFKSGRHIYAQIIDDS
FT                   KSITIASASTLDKTIKKIKKSHCNVENAIKIGREIAKKANSAGIKEVVFDRGGYKYHGI
FT                   IKALADAAREKITF"
FT   gene            complement(820830..821363)
FT                   /gene="rplF"
FT                   /locus_tag="RT0636"
FT   CDS_pept        complement(820830..821363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="RT0636"
FT                   /product="50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:RT0636"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04099"
FT                   /db_xref="GOA:Q68W93"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W93"
FT                   /protein_id="AAU04099.1"
FT                   /translation="MSRVGKLPITIPEGVKVGLNDLEVKISGPKGELSKTFKGNIAIIM
FT                   EENKLVVKPLAVNKNARSMWGTARSIIYNMVTGVKEGFKLKLEINGVGYRAMVKGKYLN
FT                   LMLAKSHNTKIEIPSNIKIDLPKQNIILLEGIDKEKLGQFASIIIKQRPPEPYKGKGIK
FT                   FENKFIQRKEGKKN"
FT   gene            complement(821372..821770)
FT                   /gene="rpsH"
FT                   /locus_tag="RT0637"
FT   CDS_pept        complement(821372..821770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="RT0637"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:RT0637"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04100"
FT                   /db_xref="GOA:Q68W92"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W92"
FT                   /protein_id="AAU04100.1"
FT                   /translation="MSMTDNVADMLTRIRNAYKSKLINVSFPSSKIKNSILDVLQKEGY
FT                   IKDYVITQKNNISYTKVALKYSINGEASICEIRRVSKPGKRVYSAIKDLKGYYNNMGIY
FT                   ILSTPYGVMSDREAHIKNVGGEVICKVF"
FT   gene            complement(821789..822094)
FT                   /gene="rpsN"
FT                   /locus_tag="RT0638"
FT   CDS_pept        complement(821789..822094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="RT0638"
FT                   /product="30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:RT0638"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04101"
FT                   /db_xref="GOA:Q68W91"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W91"
FT                   /protein_id="AAU04101.1"
FT                   /translation="MAKVSAIQKNKSRQKKSQRLHNKRSALKSKIYDKSLSLEQRFSLI
FT                   IALAQLPRNSSSTRIRNRCELTGRPRGVTRKFGISRNKLRELIGRGLVPGVVKASW"
FT   gene            complement(822112..822651)
FT                   /gene="rplE"
FT                   /locus_tag="RT0639"
FT   CDS_pept        complement(822112..822651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="RT0639"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:RT0639"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04102"
FT                   /db_xref="GOA:Q68W90"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W90"
FT                   /protein_id="AAU04102.1"
FT                   /translation="MLRFKELYKKKIIESLKKEFSFKNQHEIPQIKKIVINMGVGEAIA
FT                   DSKVINNALNDLTLISGQKPIVTLARKSIATFKLRENMKIGCKVTLRKDRMYDFLERLV
FT                   IVALPRVKEFRGFSYKSFDGKGNFTFGLKEQIVFPEINYDKIDTIRGMDITIVTSAKTD
FT                   QESKFLLSGFNLPFYN"
FT   gene            complement(822638..822979)
FT                   /gene="rplX"
FT                   /locus_tag="RT0640"
FT   CDS_pept        complement(822638..822979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="RT0640"
FT                   /product="50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:RT0640"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04103"
FT                   /db_xref="GOA:Q68W89"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W89"
FT                   /protein_id="AAU04103.1"
FT                   /translation="MIKLKVKKGDEVIVVTGKYKGKKGKVLKVFIDENTVIVSGVNLVK
FT                   KHTKPNKMSEGGIITKESPIHISNVAHIDPKTGNPTKVAFKFLEDGSKVRIAKKSGEII
FT                   GKVGNDVKI"
FT   gene            complement(822976..823344)
FT                   /gene="rplN"
FT                   /locus_tag="RT0641"
FT   CDS_pept        complement(822976..823344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="RT0641"
FT                   /product="50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:RT0641"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04104"
FT                   /db_xref="GOA:Q68W88"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W88"
FT                   /protein_id="AAU04104.1"
FT                   /translation="MIQMQSILEVADNSGAKKVMCIKVLGGSHHMMAKLGDVIVVSIKE
FT                   AIPGGKVKKGDVYKGVIVRTKTGVVRSDGSTIKFDKNALVLLNKQDEPIGTRVFGPVTR
FT                   ELRAKKYVRIMSLAEEVL"
FT   gene            complement(823405..823653)
FT                   /gene="rpsQ"
FT                   /locus_tag="RT0642"
FT   CDS_pept        complement(823405..823653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="RT0642"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:RT0642"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04105"
FT                   /db_xref="GOA:Q68W87"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W87"
FT                   /protein_id="AAU04105.1"
FT                   /translation="MRNIKMPKRVLQGVVISSKTDKTVTVKVERKFKHPIYKKFVKVSK
FT                   KYAAHDIENKYREGDKVSIVESRPISKTKTWVVVNVE"
FT   gene            complement(823640..823855)
FT                   /gene="rpmC"
FT                   /locus_tag="RT0643"
FT   CDS_pept        complement(823640..823855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="RT0643"
FT                   /product="50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:RT0643"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04106"
FT                   /db_xref="GOA:Q68W86"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W86"
FT                   /protein_id="AAU04106.1"
FT                   /translation="MNDLKLLRSKLSTETIEELYKNLNLLKKELFNLRFQQALGELKNT
FT                   SRFSLVKKSIARIKTELTKRSNSEEY"
FT   gene            complement(823848..824258)
FT                   /gene="rplP"
FT                   /locus_tag="RT0644"
FT   CDS_pept        complement(823848..824258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="RT0644"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:RT0644"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04107"
FT                   /db_xref="GOA:Q68W85"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W85"
FT                   /protein_id="AAU04107.1"
FT                   /translation="MLAPKKQKFRKAHKGRVMSKAKAGMTLAFGSFGLKSIDGWRVTAR
FT                   QIEAGRKAATRCMKRQGRLWIRIFPDVPVSKKPAEVRMGKGKGAPEFFAVRVSPGRIMF
FT                   EIEGVEENIALRALELASAKLPVRTRIVRRYE"
FT   gene            complement(824273..824926)
FT                   /gene="rpsC"
FT                   /locus_tag="RT0645"
FT   CDS_pept        complement(824273..824926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="RT0645"
FT                   /product="30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:RT0645"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04108"
FT                   /db_xref="GOA:Q68W84"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W84"
FT                   /protein_id="AAU04108.1"
FT                   /translation="MGQKVCAHGFRVGPTLIKDWDSILYAEKHYKTLFIQDLKIRDLIN
FT                   KWFNQAQISRVLIERPSNKSIIININAKKPNIIIGKNGSEIDKLKKAIENMTFLKEVYI
FT                   NIHEVRKFNIDAAIVAQTIAAQLEKRVSFRKAMKTAIQASFKQGGQGIRVSCSGRLGGA
FT                   EIARTEWYIEGRMPLHTLRADIDYSTAEAITTYGVIGVKVWIYKGEYKENKRYN"
FT   gene            complement(824928..825287)
FT                   /gene="rplV"
FT                   /locus_tag="RT0646"
FT   CDS_pept        complement(824928..825287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="RT0646"
FT                   /product="50S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:RT0646"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04109"
FT                   /db_xref="GOA:Q68W83"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W83"
FT                   /protein_id="AAU04109.1"
FT                   /translation="MIQENKNFATAKAKSIRVSPRKLNLVASFIRNMKVSEALIQLTFS
FT                   PKRIAKIVKDCLRSAVANAENNLGLDIDRLIITKATVGKSVVMKRIMPRAKGRATRINK
FT                   FFSNLDITVTEKEDN"
FT   gene            complement(825296..825574)
FT                   /gene="rpsS"
FT                   /locus_tag="RT0647"
FT   CDS_pept        complement(825296..825574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="RT0647"
FT                   /product="30S ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:RT0647"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04110"
FT                   /db_xref="GOA:Q68W82"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W82"
FT                   /protein_id="AAU04110.1"
FT                   /translation="MARSIWKGPFVDGYLIKKVQKLMKSGKSEMIKTWSRRSTILPLFV
FT                   GFTFSVHNGNKFIPVYINEEMVGRKLGEFAPTRTFHGHGADKKVKRK"
FT   gene            complement(825599..826420)
FT                   /gene="rplB"
FT                   /locus_tag="RT0648"
FT   CDS_pept        complement(825599..826420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="RT0648"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:RT0648"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04111"
FT                   /db_xref="GOA:Q68W81"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W81"
FT                   /protein_id="AAU04111.1"
FT                   /translation="MALKNFNPITPSLRELVQVDKTNLWKGRPLKSLTKGMSKTGGRNQ
FT                   QGRITSWHRGGGHKKLYRVIDFKRKKIDIFAVVERIEYDPNRTAFIALIKYDDGEYSYI
FT                   LAPQKLSIGDRVISSQAADIKIGNCLPLKSIPIGTTLHNVEMKVGKGGQIARSAGTSVE
FT                   LVGKDSGYAQIKLRSGEFRLVPLDCKATIGSISNPDQKNINLGKAGRNRWLGWRPHVRG
FT                   VAMNPIDHPHGGGEGKTSGGRHPVTPWGFSTKGKKTRKNKRTSKFIVKKRK"
FT   gene            complement(826421..826717)
FT                   /gene="rplW"
FT                   /locus_tag="RT0649"
FT   CDS_pept        complement(826421..826717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="RT0649"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:RT0649"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04112"
FT                   /db_xref="GOA:Q68W80"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W80"
FT                   /protein_id="AAU04112.1"
FT                   /translation="MSVYKYYDLIKKPIITEKTTSISEQNKYTFYVNKFAKKLTIKKAI
FT                   EAIFKVKVKKVNILNIQGKKKRFKGIIGTQINQKKAIVTLEKDHNIDYAGGIK"
FT   gene            complement(826714..827337)
FT                   /gene="rplD"
FT                   /locus_tag="RT0650"
FT   CDS_pept        complement(826714..827337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="RT0650"
FT                   /product="50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:RT0650"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04113"
FT                   /db_xref="GOA:Q68W79"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W79"
FT                   /protein_id="AAU04113.1"
FT                   /translation="MKTKILSLANEEVGEITLNKDIFAVEFIRDDIIKQVIDWQRAKAM
FT                   SGNHKTKTVSEVSGTTKKPFKQKGTGNARQGSLRSIQMRGGGISHGPKVRSHAIKLPKK
FT                   VRKLGLIHALSEKCAAGKLLIINSLKLEKPKTSVLVNLLNKFQGQSFFIIDGNKVDTNF
FT                   SLATKNIYNTLIVPQIGANVYDIIRHEYVLLSQEAVSFLEERLR"
FT   gene            complement(827577..828224)
FT                   /gene="rplC"
FT                   /locus_tag="RT0651"
FT   CDS_pept        complement(827577..828224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="RT0651"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:RT0651"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04114"
FT                   /db_xref="GOA:Q68W78"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W78"
FT                   /protein_id="AAU04114.1"
FT                   /translation="MRTGIIAQKIGMTSVFNDKGERISLTLVKVDGCQVVGHKTLAKHG
FT                   YNALVIGVKDQKISRVTKPMKQVFANAKISPKTKLKEFRISEDNFIDIASILEVDHFSV
FT                   GQFVDITATTIGKGFAGSMKRHNFRGLEASHGVSISHRSHGSTGQRQDPGKVFKGKKMA
FT                   GHMGCNQVTIQNLKIFAIDTNRKLIMIQGSIPGHKNSYLLVKDAIKKASITI"
FT   gene            complement(828225..828542)
FT                   /gene="rpsJ"
FT                   /locus_tag="RT0652"
FT   CDS_pept        complement(828225..828542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="RT0652"
FT                   /product="30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:RT0652"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04115"
FT                   /db_xref="GOA:Q68W77"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W77"
FT                   /protein_id="AAU04115.1"
FT                   /translation="MKNKIKIRLKSFDHRSLDQATKEIVSAVKRTFATINGPIPLPRKI
FT                   ERFTVNRSPHVHKKSREQFEIRKHKRLLVIDDPNPAVVDALSKVDLAAGVDVVIELENG
FT                   E"
FT   gene            complement(828636..829820)
FT                   /gene="tuf"
FT                   /locus_tag="RT0653"
FT   CDS_pept        complement(828636..829820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="RT0653"
FT                   /product="elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:RT0653"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04116"
FT                   /db_xref="GOA:Q8KT95"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8KT95"
FT                   /protein_id="AAU04116.1"
FT                   /translation="MAKAKFERTKPHVNIGTIGHVDHGKTSLTAAITIILAKTGGAKAT
FT                   AYDQIDAAPEEKERGITISTAHVEYETNNRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLAKQVGVPAMVVFLNKVDMVDDPDLLELVEMEVRELLSKYGF
FT                   PGNEIPIIKGSALQALEGKPEGEKAINELMNAVDSYIPQPIRATDKPFLMPIEDVFSIS
FT                   GRGTVVTGRVESGIIKVGEEIEIVGLKNTQKTTCTGVEMFRKLLDEGQSGDNVGILLRG
FT                   TKREEVERGQVLAKPGSIKPHDKFEAEVYVLSKEEGGRHTPFTNDYRPQFYFRTTDVTG
FT                   TIKLPFDKQMVMPGDNATFSVELIKPIAMQEGLKFSIREGGRTVGAGVVTRINN"
FT   gene            complement(829903..829976)
FT                   /gene="tRNA-Gly"
FT                   /locus_tag="RT0654"
FT   tRNA            complement(829903..829976)
FT                   /gene="tRNA-Gly"
FT                   /locus_tag="RT0654"
FT                   /product="tRNA-Gly"
FT                   /note="codon recognized: GGA"
FT   gene            complement(830072..830157)
FT                   /gene="tRNA-Tyr"
FT                   /locus_tag="RT0655"
FT   tRNA            complement(830072..830157)
FT                   /gene="tRNA-Tyr"
FT                   /locus_tag="RT0655"
FT                   /product="tRNA-Tyr"
FT                   /note="codon recognized: UAC"
FT   gene            830323..831069
FT                   /locus_tag="RT0656"
FT   CDS_pept        830323..831069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0656"
FT                   /product="tRNA/rRNA methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RT0656"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04117"
FT                   /db_xref="GOA:Q68W75"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q68W75"
FT                   /protein_id="AAU04117.1"
FT                   /translation="MMVFNKMQNKQLNYQNSYYMYGKHPVFSAINNPKRQIENILCTRE
FT                   IFDINKKLIGTRPYEIVNNYIISKLLKHQTHQGIAAKVRPIFSYNLDDIDINNPQCKIV
FT                   ILDQITDTQNIGAIIRSAAAFYINAIILPQDNSPNESGSIAKAACGTLELIPIIKVTNL
FT                   CSYMNYLKKRGFWIIGVTGYANEYFTDKFISDKIALVFGAEDKGMRRLVKETCDYLAKI
FT                   PISKSVESLNVANAASIIFHSLHKSF"
FT   gene            831141..831549
FT                   /pseudo
FT                   /locus_tag="RTPG33"
FT                   /note="pseudogene of hypothetical protein RC1011"
FT   gene            831550..832935
FT                   /gene="fumC"
FT                   /locus_tag="RT0657"
FT   CDS_pept        831550..832935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fumC"
FT                   /locus_tag="RT0657"
FT                   /product="Fumarase"
FT                   /EC_number="4.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:RT0657"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04118"
FT                   /db_xref="GOA:Q68W74"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W74"
FT                   /protein_id="AAU04118.1"
FT                   /translation="MKNYRIESDSFGEIQIEEKFYWGAQTQRSLNNFKISKQKMPKILI
FT                   HALAILKKCAAQVNYEFGDLEYKIATSIDKAIDRILAGEFEDNFPLVVWQTGSGTQTNM
FT                   NMNEVIASIANEELTGKKGGKSPVHPNDHVNKGQSSNDSFPTAMHIATVLATKQQLIPA
FT                   LNNLLTYLQDKSKDWDKIIKIGRTHLQDATPLTLKQEFSGYITQIEYALERIEDALKKV
FT                   YLLAQGGTAVGTGINSKIGFDIKFAEKVAEFTQQPFKTAPNKFESLAAHDALVEFSGTL
FT                   NTISVSLMKIANDIRLLGSGPRCGLGELHLPENEPGSSIMPGKVNPTQVEALTMVCTQV
FT                   MGNHVTVTIAGSNGHLELNVFKPVIIYNILQSIELLSDSVNSFVTHCVKGLEPNIERIN
FT                   ALRDKSLMLVTVLNPHIGYDNAAKIAKEAYKYGITLKEAAKKLNFLSEEEFDKIVIPEK
FT                   MIS"
FT   gene            833288..834646
FT                   /gene="ftsZ"
FT                   /locus_tag="RT0658"
FT   CDS_pept        833288..834646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="RT0658"
FT                   /product="cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:RT0658"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04119"
FT                   /db_xref="GOA:Q68W73"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W73"
FT                   /protein_id="AAU04119.1"
FT                   /translation="MILNIKAPENIVLKPTITVFGVGGAGSNAVNNMIHANLQGANFVV
FT                   ANTDAQSLEHSLCINKIQLGVSTTRGLGAGASPEVGALAAQESENEIRSSLENSNMVFI
FT                   TAGMGGGTGTGSAPIIARIAKELGILTVGVVTKPFHFEGGHRMKTADKGLIELQQFVDT
FT                   LIVIPNQNLFRIANEQTTFADAFKMADDVLHAGVRGVTDLMIMPGLINLDFADIKAVMS
FT                   EMGKAMMGTGEDSGEDRAIKAAESAISNPLLDHSSMCGARGVLINITGGPDMTLFEVDN
FT                   AANRIREEVDNIDANIIFGSTFNPELKGIIRVSVVATGIDADKVPKYKLAIDENTNTVP
FT                   KETYNESMIQHTQIEEIPAFNNYSTENIEITDSSIKQNYTENEQELRLHVNAVNKPENN
FT                   SQKSSFLWKIWGSLRASNNQTLERKNVIVNTLDQDNKESDIHDIPAFLRKKRD"
FT   gene            complement(835303..835875)
FT                   /locus_tag="RT0659"
FT   CDS_pept        complement(835303..835875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0659"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0659"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04120"
FT                   /db_xref="GOA:Q68W72"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:Q68W72"
FT                   /protein_id="AAU04120.1"
FT                   /translation="MFIQTEDTPNPDAIKFFPGQEISIDQPVFFSELAEVKGRSTLAES
FT                   LFHINNVKSVFFGSDFITVTKHAGGNWQVIKPEILMVIMDHFISGFPVFNENTKIDNEK
FT                   HNIDMLSEIEKQIIETIETRVRPFVTQDGGDIIYKGFESGVVKLALRGACLGCPSSTIT
FT                   LKNGIESMLRHFIPEVQEVQAVEEDFE"
FT   gene            complement(835915..837141)
FT                   /gene="ampG2"
FT                   /locus_tag="RT0660"
FT   CDS_pept        complement(835915..837141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampG2"
FT                   /locus_tag="RT0660"
FT                   /product="murein peptide permease protein AmpG"
FT                   /db_xref="EnsemblGenomes-Gn:RT0660"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04121"
FT                   /db_xref="GOA:Q68W71"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W71"
FT                   /protein_id="AAU04121.1"
FT                   /translation="MNFKCVQFQSIFNILFILIISFPGGLIYLLTGSTLSFWLRESEFD
FT                   KITIGLFGLVNFIYILKFLWGPLLEKISFSTLSNRGYKYCLVITLINCIVCVYVLTSFN
FT                   PNTNFTPFVLCLIVLAFFSSIYDMLIQSSQMLLITDKNWGISEAACTTGFRIGILISGS
FT                   GALYLSTIISWQDVYRTMAILCIPSLLLIIFYPLKFKDKMIANDFDKFFSAFYDFIKKP
FT                   KWIVIISFMLLYRLQDSFLSIMPNMFYLDIGYTKQDLAIGYKAFGMCAAIFGGVIGGFL
FT                   CRKYEYSYLLKRVLIYHALSSLSFIYLYFLNQDIISLYIAVFCQEFTKGLTMSPFFSYQ
FT                   LKCCSSRYCITQIALITSITNVGTILIGSISGYAATYLGWSYFFIVAGLCFIPAYILIL
FT                   YLPKTINSV"
FT   gene            complement(837222..838445)
FT                   /gene="rhlE"
FT                   /locus_tag="RT0661"
FT   CDS_pept        complement(837222..838445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhlE"
FT                   /locus_tag="RT0661"
FT                   /product="probable ATP-dependent RNA helicase RhlE"
FT                   /db_xref="EnsemblGenomes-Gn:RT0661"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04122"
FT                   /db_xref="GOA:Q68W70"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q68W70"
FT                   /protein_id="AAU04122.1"
FT                   /translation="MKNFNLSEELIIALETMNITEPTEIQKQSIPVAMSGADILASSQT
FT                   GSGKTLAYLLPLIDAFIKNKTTALILVPTRELATQIHSTLNKVTIAYKINSAVLIGGEP
FT                   MFKQFMQLKKNPKVIIGTPGRIIEHLNRRSLKIEHIGIIVLDEMDRMLDMGMKEQLEDI
FT                   NKFLPEKRQVLMFSATMPKHIIAVSQKYLNNPVRIMVGATNKAAAEIKQELMHVSNKEK
FT                   FSELTKQLGNRVGSVIIFVKTKRSADQLAKMLKYENHKAEAIHGDLSQSQRARVILSFR
FT                   KLNHRIMVATDVAARGLDIPHTQHVINYDLPMCPEDYLHRIGRTGRAGAIGHALSFISP
FT                   DDVVRWRAIDRLVNKGESTPRSTFRSDKKKRKRSFDKRTSIGDNKKFNSFDNNCRRTFD
FT                   CNRYRSTI"
FT   gene            complement(838856..839068)
FT                   /gene="cspA"
FT                   /locus_tag="RT0662"
FT   CDS_pept        complement(838856..839068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspA"
FT                   /locus_tag="RT0662"
FT                   /product="cold shock protein CspA"
FT                   /db_xref="EnsemblGenomes-Gn:RT0662"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04123"
FT                   /db_xref="GOA:Q68W69"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68W69"
FT                   /protein_id="AAU04123.1"
FT                   /translation="MATNIVGKVKWYNSTKNFGFIEQDNGGKDVFVHKSAIEAAGLHSL
FT                   KERQEVIFDIEEKQGKAYAINLRVK"
FT   gene            839451..839536
FT                   /gene="tRNA-Leu"
FT                   /locus_tag="RT0663"
FT   tRNA            839451..839536
FT                   /gene="tRNA-Leu"
FT                   /locus_tag="RT0663"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: UUA"
FT   gene            841537..841782
FT                   /locus_tag="RT0664"
FT   CDS_pept        841537..841782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0664"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0664"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04124"
FT                   /db_xref="UniProtKB/TrEMBL:Q68W25"
FT                   /protein_id="AAU04124.1"
FT