(data stored in ACNUC28527 zone)

EMBL: AE017225

ID   AE017225; SV 1; circular; genomic DNA; STD; PRO; 5228663 BP.
XX
AC   AE017225;
XX
PR   Project:PRJNA10878;
XX
DT   28-JUN-2004 (Rel. 80, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Bacillus anthracis str. Sterne, complete genome.
XX
KW   .
XX
OS   Bacillus anthracis str. Sterne
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus;
OC   Bacillus cereus group.
XX
RN   [1]
RP   1-5228663
RA   Brettin T.S., Bruce D., Challacombe J.F., Gilna P., Han C., Hill K.,
RA   Hitchcock P., Jackson P., Keim P., Longmire J., Lucas S., Okinaka R.,
RA   Richardson P., Rubin E., Tice H.;
RT   "Complete genome sequence of Bacillus anthracis Sterne";
RL   Unpublished.
XX
RN   [2]
RP   1-5228663
RA   Brettin T.S., Bruce D., Challacombe J.F., Gilna P., Han C., Hill K.,
RA   Hitchcock P., Jackson P., Keim P., Longmire J., Lucas S., Okinaka R.,
RA   Richardson P., Rubin E., Tice H.;
RT   ;
RL   Submitted (12-JAN-2004) to the INSDC.
RL   Joint Genome Institute, Department of Energy, 2800 Mitchell Drive, Walnut
RL   Creek, CA 94598, USA
XX
DR   MD5; 8dd4810a16d533adc73220e4d6a70123.
DR   BioSample; SAMN02598266.
DR   EnsemblGenomes-Gn; EBG00000307490.
DR   EnsemblGenomes-Gn; EBG00000307491.
DR   EnsemblGenomes-Gn; EBG00000307492.
DR   EnsemblGenomes-Gn; EBG00000307493.
DR   EnsemblGenomes-Gn; EBG00000307494.
DR   EnsemblGenomes-Gn; EBG00000307495.
DR   EnsemblGenomes-Gn; EBG00000307496.
DR   EnsemblGenomes-Gn; EBG00000307497.
DR   EnsemblGenomes-Gn; EBG00000307498.
DR   EnsemblGenomes-Gn; EBG00000307499.
DR   EnsemblGenomes-Gn; EBG00000307500.
DR   EnsemblGenomes-Gn; EBG00000307501.
DR   EnsemblGenomes-Gn; EBG00000307502.
DR   EnsemblGenomes-Gn; EBG00000307503.
DR   EnsemblGenomes-Gn; EBG00000307504.
DR   EnsemblGenomes-Gn; EBG00000307505.
DR   EnsemblGenomes-Gn; EBG00000307506.
DR   EnsemblGenomes-Gn; EBG00000307507.
DR   EnsemblGenomes-Gn; EBG00000307508.
DR   EnsemblGenomes-Gn; EBG00000307509.
DR   EnsemblGenomes-Gn; EBG00000307510.
DR   EnsemblGenomes-Gn; EBG00000307511.
DR   EnsemblGenomes-Gn; EBG00000307512.
DR   EnsemblGenomes-Gn; EBG00000307513.
DR   EnsemblGenomes-Gn; EBG00000307514.
DR   EnsemblGenomes-Gn; EBG00000307515.
DR   EnsemblGenomes-Gn; EBG00000307516.
DR   EnsemblGenomes-Gn; EBG00000307517.
DR   EnsemblGenomes-Gn; EBG00000307518.
DR   EnsemblGenomes-Gn; EBG00000307519.
DR   EnsemblGenomes-Gn; EBG00000307520.
DR   EnsemblGenomes-Gn; EBG00000307521.
DR   EnsemblGenomes-Gn; EBG00000307522.
DR   EnsemblGenomes-Gn; EBG00000307523.
DR   EnsemblGenomes-Gn; EBG00000307524.
DR   EnsemblGenomes-Gn; EBG00000307525.
DR   EnsemblGenomes-Gn; EBG00000307526.
DR   EnsemblGenomes-Gn; EBG00000307527.
DR   EnsemblGenomes-Gn; EBG00000307528.
DR   EnsemblGenomes-Gn; EBG00000307529.
DR   EnsemblGenomes-Gn; EBG00000307530.
DR   EnsemblGenomes-Gn; EBG00000307531.
DR   EnsemblGenomes-Gn; EBG00000307532.
DR   EnsemblGenomes-Gn; EBG00000307533.
DR   EnsemblGenomes-Gn; EBG00000307534.
DR   EnsemblGenomes-Gn; EBG00000307535.
DR   EnsemblGenomes-Gn; EBG00000307536.
DR   EnsemblGenomes-Gn; EBG00000307537.
DR   EnsemblGenomes-Gn; EBG00000307538.
DR   EnsemblGenomes-Gn; EBG00000307539.
DR   EnsemblGenomes-Gn; EBG00000307540.
DR   EnsemblGenomes-Gn; EBG00000307541.
DR   EnsemblGenomes-Gn; EBG00000307542.
DR   EnsemblGenomes-Gn; EBG00000307543.
DR   EnsemblGenomes-Gn; EBG00000307544.
DR   EnsemblGenomes-Gn; EBG00000307545.
DR   EnsemblGenomes-Gn; EBG00000307546.
DR   EnsemblGenomes-Gn; EBG00000307547.
DR   EnsemblGenomes-Gn; EBG00000307548.
DR   EnsemblGenomes-Gn; EBG00000307549.
DR   EnsemblGenomes-Gn; EBG00000307550.
DR   EnsemblGenomes-Gn; EBG00000307551.
DR   EnsemblGenomes-Gn; EBG00000307552.
DR   EnsemblGenomes-Gn; EBG00000307553.
DR   EnsemblGenomes-Gn; EBG00000307554.
DR   EnsemblGenomes-Gn; EBG00000307555.
DR   EnsemblGenomes-Gn; EBG00000307556.
DR   EnsemblGenomes-Gn; EBG00000307557.
DR   EnsemblGenomes-Gn; EBG00000307558.
DR   EnsemblGenomes-Gn; EBG00000307559.
DR   EnsemblGenomes-Gn; EBG00000307560.
DR   EnsemblGenomes-Gn; EBG00000307561.
DR   EnsemblGenomes-Gn; EBG00000307562.
DR   EnsemblGenomes-Gn; EBG00000307563.
DR   EnsemblGenomes-Gn; EBG00000307564.
DR   EnsemblGenomes-Gn; EBG00000307565.
DR   EnsemblGenomes-Gn; EBG00000307566.
DR   EnsemblGenomes-Gn; EBG00000307567.
DR   EnsemblGenomes-Gn; EBG00000307568.
DR   EnsemblGenomes-Gn; EBG00000307569.
DR   EnsemblGenomes-Gn; EBG00000307570.
DR   EnsemblGenomes-Gn; EBG00000307571.
DR   EnsemblGenomes-Gn; EBG00000307572.
DR   EnsemblGenomes-Gn; EBG00000307573.
DR   EnsemblGenomes-Gn; EBG00000307574.
DR   EnsemblGenomes-Gn; EBG00000307575.
DR   EnsemblGenomes-Gn; EBG00000307576.
DR   EnsemblGenomes-Gn; EBG00000307577.
DR   EnsemblGenomes-Gn; EBG00000307578.
DR   EnsemblGenomes-Gn; EBG00000307579.
DR   EnsemblGenomes-Gn; EBG00000307580.
DR   EnsemblGenomes-Gn; EBG00000307581.
DR   EnsemblGenomes-Gn; EBG00000307582.
DR   EnsemblGenomes-Gn; EBG00000307583.
DR   EnsemblGenomes-Gn; EBG00000307584.
DR   EnsemblGenomes-Gn; EBG00001157383.
DR   EnsemblGenomes-Gn; EBG00001157384.
DR   EnsemblGenomes-Gn; EBG00001157385.
DR   EnsemblGenomes-Gn; EBG00001157386.
DR   EnsemblGenomes-Gn; EBG00001157387.
DR   EnsemblGenomes-Gn; EBG00001157388.
DR   EnsemblGenomes-Gn; EBG00001157389.
DR   EnsemblGenomes-Gn; EBG00001157390.
DR   EnsemblGenomes-Gn; EBG00001157391.
DR   EnsemblGenomes-Gn; EBG00001157392.
DR   EnsemblGenomes-Gn; EBG00001157393.
DR   EnsemblGenomes-Gn; EBG00001157394.
DR   EnsemblGenomes-Gn; EBG00001157395.
DR   EnsemblGenomes-Gn; EBG00001157396.
DR   EnsemblGenomes-Gn; EBG00001157397.
DR   EnsemblGenomes-Gn; EBG00001157398.
DR   EnsemblGenomes-Gn; EBG00001157399.
DR   EnsemblGenomes-Gn; EBG00001157400.
DR   EnsemblGenomes-Gn; EBG00001157401.
DR   EnsemblGenomes-Gn; EBG00001157402.
DR   EnsemblGenomes-Gn; EBG00001157403.
DR   EnsemblGenomes-Gn; EBG00001157404.
DR   EnsemblGenomes-Gn; EBG00001157405.
DR   EnsemblGenomes-Gn; EBG00001157406.
DR   EnsemblGenomes-Gn; EBG00001157407.
DR   EnsemblGenomes-Gn; EBG00001157408.
DR   EnsemblGenomes-Gn; EBG00001157409.
DR   EnsemblGenomes-Gn; EBG00001157410.
DR   EnsemblGenomes-Gn; EBG00001157411.
DR   EnsemblGenomes-Gn; EBG00001157412.
DR   EnsemblGenomes-Gn; EBG00001157413.
DR   EnsemblGenomes-Gn; EBG00001157414.
DR   EnsemblGenomes-Gn; EBG00001157415.
DR   EnsemblGenomes-Gn; EBG00001157416.
DR   EnsemblGenomes-Gn; EBG00001157417.
DR   EnsemblGenomes-Gn; EBG00001157418.
DR   EnsemblGenomes-Gn; EBG00001157419.
DR   EnsemblGenomes-Gn; EBG00001157420.
DR   EnsemblGenomes-Gn; EBG00001157421.
DR   EnsemblGenomes-Gn; EBG00001157422.
DR   EnsemblGenomes-Gn; EBG00001157423.
DR   EnsemblGenomes-Gn; EBG00001157424.
DR   EnsemblGenomes-Gn; EBG00001157425.
DR   EnsemblGenomes-Gn; EBG00001157426.
DR   EnsemblGenomes-Gn; EBG00001157427.
DR   EnsemblGenomes-Gn; EBG00001157428.
DR   EnsemblGenomes-Gn; EBG00001157429.
DR   EnsemblGenomes-Gn; EBG00001157430.
DR   EnsemblGenomes-Gn; EBG00001157431.
DR   EnsemblGenomes-Gn; EBG00001157432.
DR   EnsemblGenomes-Gn; EBG00001157433.
DR   EnsemblGenomes-Gn; EBG00001157434.
DR   EnsemblGenomes-Gn; EBG00001157435.
DR   EnsemblGenomes-Gn; EBG00001157436.
DR   EnsemblGenomes-Gn; EBG00001157437.
DR   EnsemblGenomes-Gn; EBG00001157438.
DR   EnsemblGenomes-Gn; EBG00001157439.
DR   EnsemblGenomes-Gn; EBG00001157440.
DR   EnsemblGenomes-Gn; EBG00001157441.
DR   EnsemblGenomes-Gn; EBG00001157442.
DR   EnsemblGenomes-Gn; EBG00001157443.
DR   EnsemblGenomes-Gn; EBG00001157444.
DR   EnsemblGenomes-Gn; EBG00001157445.
DR   EnsemblGenomes-Gn; EBG00001157446.
DR   EnsemblGenomes-Gn; EBG00001157447.
DR   EnsemblGenomes-Gn; EBG00001157448.
DR   EnsemblGenomes-Gn; EBG00001157449.
DR   EnsemblGenomes-Gn; EBG00001157450.
DR   EnsemblGenomes-Gn; EBG00001157451.
DR   EnsemblGenomes-Gn; EBG00001157452.
DR   EnsemblGenomes-Gn; EBG00001157453.
DR   EnsemblGenomes-Gn; EBG00001157454.
DR   EnsemblGenomes-Gn; EBG00001157455.
DR   EnsemblGenomes-Gn; EBG00001157456.
DR   EnsemblGenomes-Gn; EBG00001157457.
DR   EnsemblGenomes-Gn; EBG00001157458.
DR   EnsemblGenomes-Gn; EBG00001157459.
DR   EnsemblGenomes-Gn; EBG00001157460.
DR   EnsemblGenomes-Gn; EBG00001157461.
DR   EnsemblGenomes-Gn; EBG00001157462.
DR   EnsemblGenomes-Gn; EBG00001157463.
DR   EnsemblGenomes-Gn; EBG00001157464.
DR   EnsemblGenomes-Gn; EBG00001157465.
DR   EnsemblGenomes-Gn; EBG00001157466.
DR   EnsemblGenomes-Gn; EBG00001157467.
DR   EnsemblGenomes-Gn; EBG00001157468.
DR   EnsemblGenomes-Gn; EBG00001157469.
DR   EnsemblGenomes-Gn; EBG00001157470.
DR   EnsemblGenomes-Gn; EBG00001157471.
DR   EnsemblGenomes-Gn; EBG00001157472.
DR   EnsemblGenomes-Gn; EBG00001157473.
DR   EnsemblGenomes-Gn; EBG00001157474.
DR   EnsemblGenomes-Gn; EBG00001157475.
DR   EnsemblGenomes-Gn; EBG00001157476.
DR   EnsemblGenomes-Gn; EBG00001157477.
DR   EnsemblGenomes-Gn; EBG00001157478.
DR   EnsemblGenomes-Gn; EBG00001157479.
DR   EnsemblGenomes-Gn; EBG00001157480.
DR   EnsemblGenomes-Gn; EBG00001157481.
DR   EnsemblGenomes-Gn; EBG00001157482.
DR   EnsemblGenomes-Gn; EBG00001157483.
DR   EnsemblGenomes-Gn; EBG00001157484.
DR   EnsemblGenomes-Gn; EBG00001157485.
DR   EnsemblGenomes-Gn; EBG00001157486.
DR   EnsemblGenomes-Gn; EBG00001157487.
DR   EnsemblGenomes-Gn; EBG00001157488.
DR   EnsemblGenomes-Gn; EBG00001157489.
DR   EnsemblGenomes-Gn; EBG00001157490.
DR   EnsemblGenomes-Gn; EBG00001157491.
DR   EnsemblGenomes-Gn; EBG00001157492.
DR   EnsemblGenomes-Gn; EBG00001157493.
DR   EnsemblGenomes-Gn; EBG00001157494.
DR   EnsemblGenomes-Gn; EBG00001157495.
DR   EnsemblGenomes-Gn; EBG00001157496.
DR   EnsemblGenomes-Gn; EBG00001157497.
DR   EnsemblGenomes-Gn; EBG00001157498.
DR   EnsemblGenomes-Gn; EBG00001157499.
DR   EnsemblGenomes-Gn; EBG00001157500.
DR   EnsemblGenomes-Gn; EBG00001157501.
DR   EnsemblGenomes-Gn; EBG00001157502.
DR   EnsemblGenomes-Gn; EBG00001157503.
DR   EnsemblGenomes-Gn; EBG00001157504.
DR   EnsemblGenomes-Gn; EBG00001157505.
DR   EnsemblGenomes-Gn; EBG00001157506.
DR   EnsemblGenomes-Gn; EBG00001157507.
DR   EnsemblGenomes-Gn; EBG00001157508.
DR   EnsemblGenomes-Gn; EBG00001157509.
DR   EnsemblGenomes-Gn; EBG00001157510.
DR   EnsemblGenomes-Gn; EBG00001157511.
DR   EnsemblGenomes-Gn; EBG00001157512.
DR   EnsemblGenomes-Gn; EBG00001157513.
DR   EnsemblGenomes-Gn; EBG00001157514.
DR   EnsemblGenomes-Gn; EBG00001157515.
DR   EnsemblGenomes-Gn; EBG00001157516.
DR   EnsemblGenomes-Gn; EBG00001157517.
DR   EnsemblGenomes-Gn; EBG00001157518.
DR   EnsemblGenomes-Gn; EBG00001157519.
DR   EnsemblGenomes-Gn; EBG00001157520.
DR   EnsemblGenomes-Gn; EBG00001157521.
DR   EnsemblGenomes-Gn; EBG00001157522.
DR   EnsemblGenomes-Gn; EBG00001157523.
DR   EnsemblGenomes-Gn; EBG00001157524.
DR   EnsemblGenomes-Gn; EBG00001157525.
DR   EnsemblGenomes-Gn; EBG00001157526.
DR   EnsemblGenomes-Gn; EBG00001157527.
DR   EnsemblGenomes-Gn; EBG00001157528.
DR   EnsemblGenomes-Gn; EBG00001157529.
DR   EnsemblGenomes-Gn; EBG00001157530.
DR   EnsemblGenomes-Gn; EBG00001157531.
DR   EnsemblGenomes-Gn; EBG00001157532.
DR   EnsemblGenomes-Gn; EBG00001157533.
DR   EnsemblGenomes-Gn; EBG00001157534.
DR   EnsemblGenomes-Gn; EBG00001157535.
DR   EnsemblGenomes-Gn; EBG00001157536.
DR   EnsemblGenomes-Gn; EBG00001157537.
DR   EnsemblGenomes-Gn; EBG00001157538.
DR   EnsemblGenomes-Gn; EBG00001157539.
DR   EnsemblGenomes-Gn; EBG00001157540.
DR   EnsemblGenomes-Gn; EBG00001157541.
DR   EnsemblGenomes-Gn; EBG00001157542.
DR   EnsemblGenomes-Gn; EBG00001157543.
DR   EnsemblGenomes-Gn; EBG00001157544.
DR   EnsemblGenomes-Gn; EBG00001157545.
DR   EnsemblGenomes-Gn; EBG00001157546.
DR   EnsemblGenomes-Gn; EBG00001157547.
DR   EnsemblGenomes-Gn; EBG00001157548.
DR   EnsemblGenomes-Gn; EBG00001157549.
DR   EnsemblGenomes-Gn; EBG00001157550.
DR   EnsemblGenomes-Gn; rRNA-16s-1.
DR   EnsemblGenomes-Gn; rRNA-16s-10.
DR   EnsemblGenomes-Gn; rRNA-16s-11.
DR   EnsemblGenomes-Gn; rRNA-16s-2.
DR   EnsemblGenomes-Gn; rRNA-16s-3.
DR   EnsemblGenomes-Gn; rRNA-16s-4.
DR   EnsemblGenomes-Gn; rRNA-16s-5.
DR   EnsemblGenomes-Gn; rRNA-16s-6.
DR   EnsemblGenomes-Gn; rRNA-16s-7.
DR   EnsemblGenomes-Gn; rRNA-16s-8.
DR   EnsemblGenomes-Gn; rRNA-16s-9.
DR   EnsemblGenomes-Gn; rRNA-23s-1.
DR   EnsemblGenomes-Gn; rRNA-23s-10.
DR   EnsemblGenomes-Gn; rRNA-23s-11.
DR   EnsemblGenomes-Gn; rRNA-23s-2.
DR   EnsemblGenomes-Gn; rRNA-23s-3.
DR   EnsemblGenomes-Gn; rRNA-23s-4.
DR   EnsemblGenomes-Gn; rRNA-23s-5.
DR   EnsemblGenomes-Gn; rRNA-23s-6.
DR   EnsemblGenomes-Gn; rRNA-23s-7.
DR   EnsemblGenomes-Gn; rRNA-23s-8.
DR   EnsemblGenomes-Gn; rRNA-23s-9.
DR   EnsemblGenomes-Gn; rRNA-5s-1.
DR   EnsemblGenomes-Gn; rRNA-5s-10.
DR   EnsemblGenomes-Gn; rRNA-5s-11.
DR   EnsemblGenomes-Gn; rRNA-5s-2.
DR   EnsemblGenomes-Gn; rRNA-5s-3.
DR   EnsemblGenomes-Gn; rRNA-5s-4.
DR   EnsemblGenomes-Gn; rRNA-5s-5.
DR   EnsemblGenomes-Gn; rRNA-5s-6.
DR   EnsemblGenomes-Gn; rRNA-5s-7.
DR   EnsemblGenomes-Gn; rRNA-5s-8.
DR   EnsemblGenomes-Gn; rRNA-5s-9.
DR   EnsemblGenomes-Tr; EBT00000114126.
DR   EnsemblGenomes-Tr; EBT00000114127.
DR   EnsemblGenomes-Tr; EBT00000114128.
DR   EnsemblGenomes-Tr; EBT00000114129.
DR   EnsemblGenomes-Tr; EBT00000114130.
DR   EnsemblGenomes-Tr; EBT00000114131.
DR   EnsemblGenomes-Tr; EBT00000114132.
DR   EnsemblGenomes-Tr; EBT00000114133.
DR   EnsemblGenomes-Tr; EBT00000114135.
DR   EnsemblGenomes-Tr; EBT00000114136.
DR   EnsemblGenomes-Tr; EBT00000114137.
DR   EnsemblGenomes-Tr; EBT00000114138.
DR   EnsemblGenomes-Tr; EBT00000114140.
DR   EnsemblGenomes-Tr; EBT00000114141.
DR   EnsemblGenomes-Tr; EBT00000114142.
DR   EnsemblGenomes-Tr; EBT00000114144.
DR   EnsemblGenomes-Tr; EBT00000114145.
DR   EnsemblGenomes-Tr; EBT00000114146.
DR   EnsemblGenomes-Tr; EBT00000114147.
DR   EnsemblGenomes-Tr; EBT00000114148.
DR   EnsemblGenomes-Tr; EBT00000114152.
DR   EnsemblGenomes-Tr; EBT00000114157.
DR   EnsemblGenomes-Tr; EBT00000114158.
DR   EnsemblGenomes-Tr; EBT00000114160.
DR   EnsemblGenomes-Tr; EBT00000114161.
DR   EnsemblGenomes-Tr; EBT00000114162.
DR   EnsemblGenomes-Tr; EBT00000114163.
DR   EnsemblGenomes-Tr; EBT00000114164.
DR   EnsemblGenomes-Tr; EBT00000114166.
DR   EnsemblGenomes-Tr; EBT00000114171.
DR   EnsemblGenomes-Tr; EBT00000114172.
DR   EnsemblGenomes-Tr; EBT00000114173.
DR   EnsemblGenomes-Tr; EBT00000114174.
DR   EnsemblGenomes-Tr; EBT00000114175.
DR   EnsemblGenomes-Tr; EBT00000114176.
DR   EnsemblGenomes-Tr; EBT00000114177.
DR   EnsemblGenomes-Tr; EBT00000114179.
DR   EnsemblGenomes-Tr; EBT00000114181.
DR   EnsemblGenomes-Tr; EBT00000114182.
DR   EnsemblGenomes-Tr; EBT00000114183.
DR   EnsemblGenomes-Tr; EBT00000114184.
DR   EnsemblGenomes-Tr; EBT00000114185.
DR   EnsemblGenomes-Tr; EBT00000114186.
DR   EnsemblGenomes-Tr; EBT00000114187.
DR   EnsemblGenomes-Tr; EBT00000114189.
DR   EnsemblGenomes-Tr; EBT00000114190.
DR   EnsemblGenomes-Tr; EBT00000114191.
DR   EnsemblGenomes-Tr; EBT00000114192.
DR   EnsemblGenomes-Tr; EBT00000114193.
DR   EnsemblGenomes-Tr; EBT00000114194.
DR   EnsemblGenomes-Tr; EBT00000114195.
DR   EnsemblGenomes-Tr; EBT00000114196.
DR   EnsemblGenomes-Tr; EBT00000114197.
DR   EnsemblGenomes-Tr; EBT00000114198.
DR   EnsemblGenomes-Tr; EBT00000114199.
DR   EnsemblGenomes-Tr; EBT00000114200.
DR   EnsemblGenomes-Tr; EBT00000114201.
DR   EnsemblGenomes-Tr; EBT00000114202.
DR   EnsemblGenomes-Tr; EBT00000114203.
DR   EnsemblGenomes-Tr; EBT00000114205.
DR   EnsemblGenomes-Tr; EBT00000114206.
DR   EnsemblGenomes-Tr; EBT00000114207.
DR   EnsemblGenomes-Tr; EBT00000114208.
DR   EnsemblGenomes-Tr; EBT00000114209.
DR   EnsemblGenomes-Tr; EBT00000114210.
DR   EnsemblGenomes-Tr; EBT00000114211.
DR   EnsemblGenomes-Tr; EBT00000114214.
DR   EnsemblGenomes-Tr; EBT00000114215.
DR   EnsemblGenomes-Tr; EBT00000114218.
DR   EnsemblGenomes-Tr; EBT00000114219.
DR   EnsemblGenomes-Tr; EBT00000114221.
DR   EnsemblGenomes-Tr; EBT00000114222.
DR   EnsemblGenomes-Tr; EBT00000114223.
DR   EnsemblGenomes-Tr; EBT00000114224.
DR   EnsemblGenomes-Tr; EBT00000114225.
DR   EnsemblGenomes-Tr; EBT00000114227.
DR   EnsemblGenomes-Tr; EBT00000114228.
DR   EnsemblGenomes-Tr; EBT00000114229.
DR   EnsemblGenomes-Tr; EBT00000114230.
DR   EnsemblGenomes-Tr; EBT00000114231.
DR   EnsemblGenomes-Tr; EBT00000114232.
DR   EnsemblGenomes-Tr; EBT00000114233.
DR   EnsemblGenomes-Tr; EBT00000114234.
DR   EnsemblGenomes-Tr; EBT00000114235.
DR   EnsemblGenomes-Tr; EBT00000114237.
DR   EnsemblGenomes-Tr; EBT00000114238.
DR   EnsemblGenomes-Tr; EBT00000114239.
DR   EnsemblGenomes-Tr; EBT00000114242.
DR   EnsemblGenomes-Tr; EBT00000114243.
DR   EnsemblGenomes-Tr; EBT00000114244.
DR   EnsemblGenomes-Tr; EBT00000114246.
DR   EnsemblGenomes-Tr; EBT00000114248.
DR   EnsemblGenomes-Tr; EBT00000114251.
DR   EnsemblGenomes-Tr; EBT00000114252.
DR   EnsemblGenomes-Tr; EBT00000114253.
DR   EnsemblGenomes-Tr; EBT00001746289.
DR   EnsemblGenomes-Tr; EBT00001746290.
DR   EnsemblGenomes-Tr; EBT00001746291.
DR   EnsemblGenomes-Tr; EBT00001746292.
DR   EnsemblGenomes-Tr; EBT00001746293.
DR   EnsemblGenomes-Tr; EBT00001746294.
DR   EnsemblGenomes-Tr; EBT00001746295.
DR   EnsemblGenomes-Tr; EBT00001746296.
DR   EnsemblGenomes-Tr; EBT00001746297.
DR   EnsemblGenomes-Tr; EBT00001746298.
DR   EnsemblGenomes-Tr; EBT00001746299.
DR   EnsemblGenomes-Tr; EBT00001746300.
DR   EnsemblGenomes-Tr; EBT00001746301.
DR   EnsemblGenomes-Tr; EBT00001746302.
DR   EnsemblGenomes-Tr; EBT00001746303.
DR   EnsemblGenomes-Tr; EBT00001746304.
DR   EnsemblGenomes-Tr; EBT00001746305.
DR   EnsemblGenomes-Tr; EBT00001746306.
DR   EnsemblGenomes-Tr; EBT00001746307.
DR   EnsemblGenomes-Tr; EBT00001746308.
DR   EnsemblGenomes-Tr; EBT00001746309.
DR   EnsemblGenomes-Tr; EBT00001746310.
DR   EnsemblGenomes-Tr; EBT00001746311.
DR   EnsemblGenomes-Tr; EBT00001746312.
DR   EnsemblGenomes-Tr; EBT00001746313.
DR   EnsemblGenomes-Tr; EBT00001746314.
DR   EnsemblGenomes-Tr; EBT00001746315.
DR   EnsemblGenomes-Tr; EBT00001746316.
DR   EnsemblGenomes-Tr; EBT00001746317.
DR   EnsemblGenomes-Tr; EBT00001746318.
DR   EnsemblGenomes-Tr; EBT00001746319.
DR   EnsemblGenomes-Tr; EBT00001746320.
DR   EnsemblGenomes-Tr; EBT00001746321.
DR   EnsemblGenomes-Tr; EBT00001746322.
DR   EnsemblGenomes-Tr; EBT00001746323.
DR   EnsemblGenomes-Tr; EBT00001746324.
DR   EnsemblGenomes-Tr; EBT00001746325.
DR   EnsemblGenomes-Tr; EBT00001746326.
DR   EnsemblGenomes-Tr; EBT00001746327.
DR   EnsemblGenomes-Tr; EBT00001746328.
DR   EnsemblGenomes-Tr; EBT00001746329.
DR   EnsemblGenomes-Tr; EBT00001746330.
DR   EnsemblGenomes-Tr; EBT00001746331.
DR   EnsemblGenomes-Tr; EBT00001746332.
DR   EnsemblGenomes-Tr; EBT00001746333.
DR   EnsemblGenomes-Tr; EBT00001746334.
DR   EnsemblGenomes-Tr; EBT00001746335.
DR   EnsemblGenomes-Tr; EBT00001746336.
DR   EnsemblGenomes-Tr; EBT00001746337.
DR   EnsemblGenomes-Tr; EBT00001746338.
DR   EnsemblGenomes-Tr; EBT00001746339.
DR   EnsemblGenomes-Tr; EBT00001746340.
DR   EnsemblGenomes-Tr; EBT00001746341.
DR   EnsemblGenomes-Tr; EBT00001746342.
DR   EnsemblGenomes-Tr; EBT00001746343.
DR   EnsemblGenomes-Tr; EBT00001746344.
DR   EnsemblGenomes-Tr; EBT00001746345.
DR   EnsemblGenomes-Tr; EBT00001746346.
DR   EnsemblGenomes-Tr; EBT00001746347.
DR   EnsemblGenomes-Tr; EBT00001746348.
DR   EnsemblGenomes-Tr; EBT00001746349.
DR   EnsemblGenomes-Tr; EBT00001746350.
DR   EnsemblGenomes-Tr; EBT00001746351.
DR   EnsemblGenomes-Tr; EBT00001746352.
DR   EnsemblGenomes-Tr; EBT00001746353.
DR   EnsemblGenomes-Tr; EBT00001746354.
DR   EnsemblGenomes-Tr; EBT00001746355.
DR   EnsemblGenomes-Tr; EBT00001746356.
DR   EnsemblGenomes-Tr; EBT00001746357.
DR   EnsemblGenomes-Tr; EBT00001746358.
DR   EnsemblGenomes-Tr; EBT00001746359.
DR   EnsemblGenomes-Tr; EBT00001746360.
DR   EnsemblGenomes-Tr; EBT00001746361.
DR   EnsemblGenomes-Tr; EBT00001746362.
DR   EnsemblGenomes-Tr; EBT00001746363.
DR   EnsemblGenomes-Tr; EBT00001746364.
DR   EnsemblGenomes-Tr; EBT00001746365.
DR   EnsemblGenomes-Tr; EBT00001746366.
DR   EnsemblGenomes-Tr; EBT00001746367.
DR   EnsemblGenomes-Tr; EBT00001746368.
DR   EnsemblGenomes-Tr; EBT00001746369.
DR   EnsemblGenomes-Tr; EBT00001746370.
DR   EnsemblGenomes-Tr; EBT00001746371.
DR   EnsemblGenomes-Tr; EBT00001746372.
DR   EnsemblGenomes-Tr; EBT00001746373.
DR   EnsemblGenomes-Tr; EBT00001746374.
DR   EnsemblGenomes-Tr; EBT00001746375.
DR   EnsemblGenomes-Tr; EBT00001746376.
DR   EnsemblGenomes-Tr; EBT00001746377.
DR   EnsemblGenomes-Tr; EBT00001746378.
DR   EnsemblGenomes-Tr; EBT00001746379.
DR   EnsemblGenomes-Tr; EBT00001746380.
DR   EnsemblGenomes-Tr; EBT00001746381.
DR   EnsemblGenomes-Tr; EBT00001746382.
DR   EnsemblGenomes-Tr; EBT00001746383.
DR   EnsemblGenomes-Tr; EBT00001746384.
DR   EnsemblGenomes-Tr; EBT00001746385.
DR   EnsemblGenomes-Tr; EBT00001746386.
DR   EnsemblGenomes-Tr; EBT00001746387.
DR   EnsemblGenomes-Tr; EBT00001746388.
DR   EnsemblGenomes-Tr; EBT00001746389.
DR   EnsemblGenomes-Tr; EBT00001746390.
DR   EnsemblGenomes-Tr; EBT00001746391.
DR   EnsemblGenomes-Tr; EBT00001746392.
DR   EnsemblGenomes-Tr; EBT00001746393.
DR   EnsemblGenomes-Tr; EBT00001746394.
DR   EnsemblGenomes-Tr; EBT00001746395.
DR   EnsemblGenomes-Tr; EBT00001746396.
DR   EnsemblGenomes-Tr; EBT00001746397.
DR   EnsemblGenomes-Tr; EBT00001746398.
DR   EnsemblGenomes-Tr; EBT00001746399.
DR   EnsemblGenomes-Tr; EBT00001746400.
DR   EnsemblGenomes-Tr; EBT00001746401.
DR   EnsemblGenomes-Tr; EBT00001746402.
DR   EnsemblGenomes-Tr; EBT00001746403.
DR   EnsemblGenomes-Tr; EBT00001746404.
DR   EnsemblGenomes-Tr; EBT00001746405.
DR   EnsemblGenomes-Tr; EBT00001746406.
DR   EnsemblGenomes-Tr; EBT00001746407.
DR   EnsemblGenomes-Tr; EBT00001746408.
DR   EnsemblGenomes-Tr; EBT00001746409.
DR   EnsemblGenomes-Tr; EBT00001746410.
DR   EnsemblGenomes-Tr; EBT00001746411.
DR   EnsemblGenomes-Tr; EBT00001746412.
DR   EnsemblGenomes-Tr; EBT00001746413.
DR   EnsemblGenomes-Tr; EBT00001746414.
DR   EnsemblGenomes-Tr; EBT00001746415.
DR   EnsemblGenomes-Tr; EBT00001746416.
DR   EnsemblGenomes-Tr; EBT00001746417.
DR   EnsemblGenomes-Tr; EBT00001746418.
DR   EnsemblGenomes-Tr; EBT00001746419.
DR   EnsemblGenomes-Tr; EBT00001746420.
DR   EnsemblGenomes-Tr; EBT00001746421.
DR   EnsemblGenomes-Tr; EBT00001746422.
DR   EnsemblGenomes-Tr; EBT00001746423.
DR   EnsemblGenomes-Tr; EBT00001746424.
DR   EnsemblGenomes-Tr; EBT00001746425.
DR   EnsemblGenomes-Tr; EBT00001746426.
DR   EnsemblGenomes-Tr; EBT00001746427.
DR   EnsemblGenomes-Tr; EBT00001746428.
DR   EnsemblGenomes-Tr; EBT00001746429.
DR   EnsemblGenomes-Tr; EBT00001746430.
DR   EnsemblGenomes-Tr; EBT00001746431.
DR   EnsemblGenomes-Tr; EBT00001746432.
DR   EnsemblGenomes-Tr; EBT00001746433.
DR   EnsemblGenomes-Tr; EBT00001746434.
DR   EnsemblGenomes-Tr; EBT00001746435.
DR   EnsemblGenomes-Tr; EBT00001746436.
DR   EnsemblGenomes-Tr; EBT00001746437.
DR   EnsemblGenomes-Tr; EBT00001746438.
DR   EnsemblGenomes-Tr; EBT00001746439.
DR   EnsemblGenomes-Tr; EBT00001746440.
DR   EnsemblGenomes-Tr; EBT00001746441.
DR   EnsemblGenomes-Tr; EBT00001746442.
DR   EnsemblGenomes-Tr; EBT00001746443.
DR   EnsemblGenomes-Tr; EBT00001746444.
DR   EnsemblGenomes-Tr; EBT00001746445.
DR   EnsemblGenomes-Tr; EBT00001746446.
DR   EnsemblGenomes-Tr; EBT00001746447.
DR   EnsemblGenomes-Tr; EBT00001746448.
DR   EnsemblGenomes-Tr; EBT00001746449.
DR   EnsemblGenomes-Tr; EBT00001746450.
DR   EnsemblGenomes-Tr; EBT00001746451.
DR   EnsemblGenomes-Tr; EBT00001746452.
DR   EnsemblGenomes-Tr; EBT00001746453.
DR   EnsemblGenomes-Tr; EBT00001746454.
DR   EnsemblGenomes-Tr; EBT00001746455.
DR   EnsemblGenomes-Tr; EBT00001746456.
DR   EnsemblGenomes-Tr; rRNA-16s-1-1.
DR   EnsemblGenomes-Tr; rRNA-16s-10-1.
DR   EnsemblGenomes-Tr; rRNA-16s-11-1.
DR   EnsemblGenomes-Tr; rRNA-16s-2-1.
DR   EnsemblGenomes-Tr; rRNA-16s-3-1.
DR   EnsemblGenomes-Tr; rRNA-16s-4-1.
DR   EnsemblGenomes-Tr; rRNA-16s-5-1.
DR   EnsemblGenomes-Tr; rRNA-16s-6-1.
DR   EnsemblGenomes-Tr; rRNA-16s-7-1.
DR   EnsemblGenomes-Tr; rRNA-16s-8-1.
DR   EnsemblGenomes-Tr; rRNA-16s-9-1.
DR   EnsemblGenomes-Tr; rRNA-23s-1-1.
DR   EnsemblGenomes-Tr; rRNA-23s-10-1.
DR   EnsemblGenomes-Tr; rRNA-23s-11-1.
DR   EnsemblGenomes-Tr; rRNA-23s-2-1.
DR   EnsemblGenomes-Tr; rRNA-23s-3-1.
DR   EnsemblGenomes-Tr; rRNA-23s-4-1.
DR   EnsemblGenomes-Tr; rRNA-23s-5-1.
DR   EnsemblGenomes-Tr; rRNA-23s-6-1.
DR   EnsemblGenomes-Tr; rRNA-23s-7-1.
DR   EnsemblGenomes-Tr; rRNA-23s-8-1.
DR   EnsemblGenomes-Tr; rRNA-23s-9-1.
DR   EnsemblGenomes-Tr; rRNA-5s-1-1.
DR   EnsemblGenomes-Tr; rRNA-5s-10-1.
DR   EnsemblGenomes-Tr; rRNA-5s-11-1.
DR   EnsemblGenomes-Tr; rRNA-5s-2-1.
DR   EnsemblGenomes-Tr; rRNA-5s-3-1.
DR   EnsemblGenomes-Tr; rRNA-5s-4-1.
DR   EnsemblGenomes-Tr; rRNA-5s-5-1.
DR   EnsemblGenomes-Tr; rRNA-5s-6-1.
DR   EnsemblGenomes-Tr; rRNA-5s-7-1.
DR   EnsemblGenomes-Tr; rRNA-5s-8-1.
DR   EnsemblGenomes-Tr; rRNA-5s-9-1.
DR   EuropePMC; PMC1352193; 16391023.
DR   EuropePMC; PMC1489381; 16820519.
DR   EuropePMC; PMC1594716; 16954291.
DR   EuropePMC; PMC2258589; 18083867.
DR   EuropePMC; PMC2582132; 19023421.
DR   EuropePMC; PMC2586003; 18657585.
DR   EuropePMC; PMC2612278; 18955476.
DR   EuropePMC; PMC2772482; 19767427.
DR   EuropePMC; PMC2936356; 20723231.
DR   EuropePMC; PMC3039983; 21340017.
DR   EuropePMC; PMC3133050; 21296958.
DR   EuropePMC; PMC3133313; 21571994.
DR   EuropePMC; PMC3295808; 22413024.
DR   EuropePMC; PMC4595212; 26445214.
DR   EuropePMC; PMC4651027; 26512126.
DR   EuropePMC; PMC5413331; 28400473.
DR   EuropePMC; PMC5863238; 16611136.
DR   EuropePMC; PMC5875183; 15870453.
DR   EuropePMC; PMC6245597; 30458766.
DR   EuropePMC; PMC6374410; 30760727.
DR   GOA; Q81SD1.
DR   GOA; Q81Y87.
DR   GOA; Q81YW1.
DR   InterPro; IPR012610; SASP_SspH.
DR   InterPro; IPR012611; SASP_SspK.
DR   InterPro; IPR012612; SASP_SspN.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00516; ylbH.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01410; BsrC.
DR   RFAM; RF01411; BsrF.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01764; yjdF.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01820; RsaE.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; AE017225.
DR   SILVA-SSU; AE017225.
DR   StrainInfo; 322641; 0.
DR   UniProtKB/Swiss-Prot; Q81SD1; SSPH2_BACAN.
DR   UniProtKB/Swiss-Prot; Q81Y87; SSPN_BACAN.
DR   UniProtKB/Swiss-Prot; Q81YW1; SSPK_BACAN.
XX
CC   The Sterne strain of Bacillus anthracis is lacking the plasmid
CC   pXO2, resulting in an avirulent phenotype that maintains the main
CC   anthrax toxin. Prevention of anthrax in cattle can be accomplished
CC   by vaccination with living spores of the Sterne strain.  Most
CC   livestock vaccines in use throughout the world are derivatives of
CC   the live spore vaccine formulated by Sterne in 1937 and still use
CC   descendants of his strain 34F2 (Anthrax: the disease in relation to
CC   vaccines. Hambleton, P, Carnabm J, and Melling J. Vaccine 1984
CC   2:125-132 and Anthrax vaccines: past, present and future. Turnbull,
CC   PC. Vaccine 1991 9(8):533-539).   Plasmid and fosmid libraries were
CC   prepared at the Joint Genome Institute in Los Alamos (JGI-LANL),
CC   NM. Shotgun sequencing was performed at the JGI Production Genomics
CC   Facility (JGI-PGF) in Walnut Creek, CA. to a coverage of 16x.
CC   Finishing was performed at JGI-LANL starting with 39 contigs and 15
CC   scaffolds. Repetitive regions were identified, assembled and
CC   finished individually using a local software package called RepFin.
CC   Twenty four gaps were closed with primer walks and 15 by PCR. Gene
CC   predictions were performed using Glimmer and tRNAs were identified
CC   using tRNAScan-SE. Basic analysis of the gene predictions was
CC   performed by searching the coding sequence against the PFam,
CC   BLOCKS, and Prodom databases. For the most part, gene definitions
CC   were transferred directly from the TIGR Bacillus anthracis Ames
CC   GenBank records using a bi-directional best hit mapping between the
CC   two genomes. A total of 5415 features have been annotated on the
CC   sequence record.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5228663
FT                   /organism="Bacillus anthracis str. Sterne"
FT                   /strain="Sterne"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:260799"
FT   gene            408..1748
FT                   /locus_tag="BAS0001"
FT   CDS_pept        408..1748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52343"
FT                   /db_xref="GOA:Q81W35"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81W35"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52343.1"
FT                   /translation="MENISDLWNSALKELEKKVSKPSYETWLKSTTAHNLKKDVLTITA
FT                   PNEFARDWLESHYSELISETLYDLTGAKLAIRFIIPQSQAEEEIDLPPAKPNAAQDDSN
FT                   HLPQSMLNPKYTFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHA
FT                   IGHYVIEHNPNAKVVYLSSEKFTNEFINSIRDNKAVDFRNKYRNVDVLLIDDIQFLAGK
FT                   EQTQEEFFHTFNALHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETR
FT                   IAILRKKAKAEGLDIPNEVMLYIANQIDSNIRELEGALIRVVAYSSLINKDINADLAAE
FT                   ALKDIIPNSKPKIISIYDIQKAVGDVYQVKLEDFKAKKRTKSVAFPRQIAMYLSRELTD
FT                   SSLPKIGEEFGGRDHTTVIHAHEKISKLLKTDTQLQKQVEEINDILK"
FT   gene            1927..3066
FT                   /locus_tag="BAS0002"
FT   CDS_pept        1927..3066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52344"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52344.1"
FT                   /translation="MRFSIQKDYLVRSVQDVMKAVSFRTTIPILTGIKVVATEEGVTLT
FT                   GSDADISIESFIPVEEDGKEIVEVKQSGSIVLQAKYFSEIVKKLPKETVEISVENHLMT
FT                   KITSGKSEFNLNGLDSAEYPLLPQIEEHHVFKIPTDLLKHMIRQTVFAVSTSETRPILT
FT                   GVNWKVYNSELTCIATDSHRLALRKAKIEGIVDEFQANVVIPGKSLNELSKILDESEEM
FT                   VDIVITEYQVLFRTKHLLFFSRLLEGNYPDTTRLIPAESKTDIFVNTKEFLQAIDRASL
FT                   LARDGRNNVVKLSTLEQAMLEISSNSPEIGKVVEEVQCEKVDGEELKISFSAKYMMDAL
FT                   KALDSTEIKISFTGAMRPFLIRTVNDESIIQLILPVRTY"
FT   gene            3194..3406
FT                   /locus_tag="BAS0003"
FT   CDS_pept        3194..3406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0003"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52345"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52345.1"
FT                   /translation="MKRIKISTEYITLGQFLKLADVIDTGGAVKWFLQEYEVYVNQELE
FT                   NRRGRKLYANDIIEIPGSGSFQVQS"
FT   gene            3419..4546
FT                   /locus_tag="BAS0004"
FT   CDS_pept        3419..4546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52346"
FT                   /db_xref="GOA:Q6I535"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6I535"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52346.1"
FT                   /translation="MFISEIQLKNYRNYEKLELSFEDKVNVIIGENAQGKTNLMEAIYV
FT                   LAMAKSHRTSNDRELIRWDEDFGQIKGKLQKRNSSLSLELNISKKGKKAKLNQLEQQKL
FT                   SQYIGVMNVVMFAPEDLNLVKGSPQVRRRFLDMELGQIAPVYLYELSQYQKVLTQRNHL
FT                   LKKMQGNSKNEETMLDVFTLQLIEHGTKILRKRFEFLHLLQEWAAPIHRGISRGLEELE
FT                   IVYKPSVDVSESMDLSKIKEVYYESFQSVKQREIFRGTTLIGPHRDDLQFFVNSKNVQV
FT                   FGSQGQQRTTALSLKLAEIELIYSEVKEYPILLLDDVLSELDDYRQSHLLNTIQGKVQT
FT                   FVTTTSVDGIEHETLKEAKTIHVTNGTVDCEIDRA"
FT   gene            4585..6507
FT                   /locus_tag="BAS0005"
FT   CDS_pept        4585..6507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0005"
FT                   /product="DNA gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52347"
FT                   /db_xref="GOA:Q9X3Y6"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9X3Y6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52347.1"
FT                   /translation="MEQKQMQENSYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLV
FT                   WEIVDNSIDEALAGYCDEINVSIEEDNSIRVTDNGRGIPVGIQEKMGRPAVEVIMTVLH
FT                   AGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHREGKIHYQKYERGIPVADLKVIG
FT                   DTDQTGTITRFKPDPEIFQETTVYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEF
FT                   HYEGGIKSYVEHLNRSKQPIHEEPVYVEGSKDGIQVEVSLQYNEGYTNNIYSFTNNIHT
FT                   YEGGTHEVGFKTALTRVINDYGRKNSILKDADSNLTGEDVREGLTAIVSIKHPNPQFEG
FT                   QTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVEKGTMAARARVAAKKARELTR
FT                   RKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIIN
FT                   VEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLT
FT                   FFYRYMRQIIEHGYIYIAQPPLFKVQQGKKIQYAYNEKELEKILAELPAQPKPGIQRYK
FT                   GLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYV
FT                   KNLDI"
FT   gene            6596..9067
FT                   /locus_tag="BAS0006"
FT   CDS_pept        6596..9067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0006"
FT                   /product="DNA gyrase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52348"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52348.1"
FT                   /translation="MSDNQQQARIREINISHEMRTSFLDYAMSVIVSRALPDVRDGLKP
FT                   VHRRVLYAMNDLGITADKAYKKSARIVGEVIGKYHPHGDSAVYETMVRMAQDFSQRYML
FT                   VDGHGNFGSVDGDSAAAMRYTEARMSKISMELIRDISKNTIDYQDNYDGSEREPIVLPA
FT                   RFPNLLVNGTTGIAVGMATNIPPHQLGEVIDGVLALSHNPDITIAELMECIPGPDFPTA
FT                   GLILGRSGIRRAYETGRGSIILRAKVEIEEKSNGKQSIIVTELPYQVNKARLIEKIAEL
FT                   VRDKKIEGITDLRDESDRNGMRIVMEVRRDANANVLLNNLYKHTALQTSFGINMLSLVN
FT                   GEPQVLNLKQNLYHYLEHQKVVIRRRTAYELEKAEARAHILEGLRIALDHLDEVITLIR
FT                   SSKTAEIAKQGLMERFGLSEKQAQAILDMRLQRLTGLEREKIEQEYQDLMKLIAELKAI
FT                   LADEEKVLEIIREELTEVKERFNDKRRTEITIGGMESIEDEDLIPEQNIAITLTHNGYI
FT                   KRLPASTYKTQNRGGRGVQGMGTNDDDFVEHLLTTSTHDHILFFTNKGKVYRTKGYEIP
FT                   EYSRTAKGIPIINLLGVDKGEWINAIIPIREFGDDEFLFFTTKQGISKRTPLSSFANIR
FT                   TNGLIAISLREEDEVISVRLTSGDKDIIVGTSNGMLIRFNEQDVRSMGRNAAGVKAITL
FT                   GEEDQVVGMEIVEEDVNVLIVTKNGYGKRTPIDEYRLQSRGGKGLKTCNITDKNGKLVA
FT                   VKSVTGEEDIMLITAAGVIIRMPVDQISQMGRNTQGVRLIRLEDEQEVATVAKAQKDDE
FT                   EETSEEVSSEE"
FT   gene            9336..10845
FT                   /locus_tag="rRNA-16s-1"
FT   rRNA            9336..10845
FT                   /locus_tag="rRNA-16s-1"
FT                   /product="16S ribosomal RNA"
FT   gene            10993..11072
FT                   /locus_tag="tRNA-Ile-2"
FT   tRNA            10993..11072
FT                   /locus_tag="tRNA-Ile-2"
FT                   /product="tRNA-Ile"
FT   gene            11078..11156
FT                   /locus_tag="tRNA-Ala-2"
FT   tRNA            11078..11156
FT                   /locus_tag="tRNA-Ala-2"
FT                   /product="tRNA-Ala"
FT   gene            11248..14158
FT                   /locus_tag="rRNA-23s-1"
FT   rRNA            11248..14158
FT                   /locus_tag="rRNA-23s-1"
FT                   /product="23S ribosomal RNA"
FT   gene            14204..14322
FT                   /locus_tag="rRNA-5s-1"
FT   rRNA            14204..14322
FT                   /locus_tag="rRNA-5s-1"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(14354..15298)
FT                   /locus_tag="BAS0009"
FT   CDS_pept        complement(14354..15298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0009"
FT                   /product="conserved hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52349"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52349.1"
FT                   /translation="MYNVILPVVMKNPPYKMLKKSFENCYPFIYYLEHGKNYYELYKVA
FT                   PFSIQPMLLFYGISQLFKACLLTIDPNYPESTTVLAHGVTTRKRKKQGYQFLEDEVKVQ
FT                   KNGLFTHVAEQLFHMKHLESEKFNMLDLMGNIPELQNLFRYSQRGATLYKIDSPNTNEL
FT                   SFSVNILDRLHMTTERFSRYIESICKHLSIQHVPRKTSASNLLFTAPIQSWNPIYSTPL
FT                   YYEYLADTYYLPLTTDPRNPKPALPELLVHYLLLYNLSMISRYETDWWYDLLGSYGSED
FT                   YPFIYQFLTISAQKVPYYISSFLLAEPGLFHGK"
FT   gene            15469..16932
FT                   /locus_tag="BAS0011"
FT   CDS_pept        15469..16932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0011"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52350"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52350.1"
FT                   /translation="MWESKFVKEGLTFDDVLLVPAKSDVLPREVSVKTVLSESLQLNIP
FT                   LISAGMDTVTEADMAIAMARQGGLGIIHKNMSIEQQAEQVDKVKRSESGVISDPFFLTP
FT                   EHQVYDAEHLMGKYRISGVPVVNNLDERKLVGIITNRDMRFIQDYSIKISDVMTKEQLI
FT                   TAPVGTTLSEAEKILQKYKIEKLPLVDNNGVLQGLITIKDIEKVIEFPNSAKDKQGRLL
FT                   VGAAVGVTADAMTRIDALVKASVDAIVLDTAHGHSQGVIDKVKEVRAKYPSLNIIAGNV
FT                   ATAEATKALIEAGANVVKVGIGPGSICTTRVVAGVGVPQLTAVYDCATEARKHGIPVIA
FT                   DGGIKYSGDMVKALAAGAHVVMLGSMFAGVAESPGETEIYQGRQFKVYRGMGSVGAMEK
FT                   GSKDRYFQEGNKKLVPEGIEGRVPYKGPLADTVHQLVGGLRAGMGYCGAQDLEFLRENA
FT                   QFIRMSGAGLLESHPHHVQITKEAPNYSL"
FT   gene            17037..18353
FT                   /locus_tag="BAS0012"
FT   CDS_pept        17037..18353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0012"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52351"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52351.1"
FT                   /translation="MKGMFCKRFIALVTMLTLVCSMLLPYSNASAETGSALNIEAGAAI
FT                   LVEANSGKILYQKNADELLSIASMTKMMSEYLVHEAVDKGKLKWDQKIKVSEYAYKVSQ
FT                   DASLSNVALENGGSYTVKELYEAMAIFSANGATIALAEAIAGKEVDFVKMMNDKSKELG
FT                   LKNYKFVNSTGLTNKDLKGMHPEGTTADEENKMSAKDVATLAQHLIKDYPKVLDTAKIP
FT                   KKEFRPEKEKFAMSNWNWMLKGLVKEYDGVDGLKTGSTPEAGDCFTGTVERNGMRFISV
FT                   VIKTSSHTARFDETKKLYDYGFANFEMKQMYKKGSSVKGQETVRVENAKDKDVAVQTKQ
FT                   AISLPVPKGSKEVYKTELKESSKGQEAPIKKGAALGQMVITPKDTNDPGFLTGKSLQVD
FT                   LVTTSEVEEANWFTRAMRGIGSFFSGIWNSAVDTVKGWF"
FT   gene            18515..19402
FT                   /locus_tag="BAS0013"
FT   CDS_pept        18515..19402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0013"
FT                   /product="pyridoxine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52352"
FT                   /db_xref="GOA:Q81W27"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81W27"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52352.1"
FT                   /translation="MTNVTGTERVKRGMAEMQKGGVIMDVINAEQAKIAEEAGAVAIMA
FT                   LERVPADIRAAGGVSRMADPTIVEEVMGAVSIPVMAKCRIGHLVEARVLESLGVDYIDE
FT                   SEVLTPADEVYHLNKRDYTVPFVCGCRDIGEAARRIAEGASMLRTKGEPGTGNIVEAVR
FT                   HMRQVNAEIRQVASLREDELMTYAKNTGAPYEVLLEIKRLGRLPVVNFAAGGVATPADA
FT                   ALMMQLGADGVFVGSGIFKSENPAKFARAIVEATTHYEDYELIASLSKGLGNAMKGIEI
FT                   STLLPEQRMQERGW"
FT   gene            19421..20011
FT                   /locus_tag="BAS0014"
FT   CDS_pept        19421..20011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0014"
FT                   /product="glutamine amidotransferase, SNO family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52353"
FT                   /db_xref="GOA:Q81W26"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81W26"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52353.1"
FT                   /translation="MVKIGVLGLQGAVREHVKSVEASGAEAVVVKRIEQLEEIDGLILP
FT                   GGESTTMRRLIDKYDFMEPLRTFAKSGKPMFGTCAGMILLAKTLIGYDEAHIGAMDITV
FT                   ERNAFGRQKDSFEAALSIKGVGEDFVGVFIRAPYVVDVADDVEVLSTHGDRMVAVKQGP
FT                   FLAASFHPELTDDHRVTAYFVEMVKEAKMKKVV"
FT   gene            20339..21613
FT                   /locus_tag="BAS0015"
FT   CDS_pept        20339..21613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0015"
FT                   /product="seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52354"
FT                   /db_xref="GOA:Q81W25"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81W25"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52354.1"
FT                   /translation="MLDIKFLRTNFEEVKAKLQHRGEDLTDFGRFEELDTRRRELLVQT
FT                   EELKSKRNEVSQQISVLKREKKDAEALILEMREVGEKVKDLDNELRTVEEDLERLMLSI
FT                   PNIPHESAPVGETEDDNVVARTWGEVKEFAFEPKPHWDLATDLGILDFERAGKVTGSRF
FT                   VFYKGAGARLERALISFMLDLHTDEHGYEEVLPPYMVNRASMTGTGQLPKFEEDAFRIE
FT                   SEDYFLIPTAEVPVTNMHRDEILNKEQLPIRYAAFSSCFRSEAGSAGRDTRGLIRQHQF
FT                   NKVELVKFVKPEDSYEELEKLTNDAERVLQLLELPYRVMSMCTGDLGFTAAKKYDIEVW
FT                   IPSYGTYREISSCSNFEAFQARRANIRFRREPNGKPEHVHTLNGSGLAIGRTVAAILEN
FT                   YQQEDGTIIIPEVLRPYMGGKTVIK"
FT   gene            21770..21865
FT                   /locus_tag="tRNA-Ser-1"
FT   tRNA            21770..21865
FT                   /locus_tag="tRNA-Ser-1"
FT                   /product="tRNA-Ser"
FT   gene            21870..22421
FT                   /locus_tag="BAS0016"
FT   CDS_pept        21870..22421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52355"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52355.1"
FT                   /translation="MTTAHISGDWRTRYQHVTSFYFKTNHKVWCKDIMSLLHTHIPMII
FT                   FIDMKGVNMDLIIQTFPLDGKTLYYVQCPVCKNNRILNSGANVSRIISDDTFRKLCGCT
FT                   CDVKQTATKVEAPKKVKKEAVKKEAAPKRTGKVLTAVINGKEMTVKEIAEAYDISTSTV
FT                   RQRINAGKSESEIIAPTKKK"
FT   gene            complement(22457..23125)
FT                   /locus_tag="BAS0017"
FT   CDS_pept        complement(22457..23125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0017"
FT                   /product="deoxynucleoside kinase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52356"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52356.1"
FT                   /translation="MNLRQKYDIPNDAVITIAGTVGVGKSTMTTALANALGYRTSFEKV
FT                   DSNPYLDKFYADFTRWSFHLQVYFLAERFKEQKRIFEYGGGFVQDRSIYEDTGIFAKMH
FT                   HEKGTMTETDYETYKGLFDAMVMTPYFPHPDLLIYLEGSFDDIVDRIQERGRPMEQQTP
FT                   IEYWKEMHGRYENWINNFNSCPVLRLNINEYDILKDGDSIEPIIKKIGHFLKQTRKLVK
FT                   "
FT   gene            complement(23128..23763)
FT                   /locus_tag="BAS0018"
FT   CDS_pept        complement(23128..23763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0018"
FT                   /product="deoxynucleoside kinase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52357"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52357.1"
FT                   /translation="MTGVPFITVEGPIGVGKTSLAKEISTHMQLHLLKEIVDENPFLGK
FT                   FYEDIDEWSFQTEMFFLCNRYKQLEDINIKYLNQRKPVVADYHIFKNVIFASRTLKDSQ
FT                   YDKYMQIYRILTQDMPVPNVIVYLTASLETLQRRIAMRGREFEKNMDPNYLLQLTKDYE
FT                   TAMDAFKKDHPDIPVLKFNGDDMDFVKNPDDLNVILSALQNTLLKESK"
FT   gene            complement(23889..24428)
FT                   /locus_tag="BAS0019"
FT   CDS_pept        complement(23889..24428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0019"
FT                   /product="isochorismatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52358"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52358.1"
FT                   /translation="MKNTALLIIDMINDFQFSHGPILAKKCEMITNPILQLKKTMKSFG
FT                   YPIIYINDHYQLWRSDIDQLITHCTNEYSENIIHKIAPSSDDYIFIKPHYSAFYETPLN
FT                   SLLGYLKIENLILTGVAGNICILFTANDAHMRNYTLYVPQDCIASNHDQDNLHALKIME
FT                   TTLKANIVPSSQIKFN"
FT   gene            24536..25036
FT                   /locus_tag="BAS0020"
FT   CDS_pept        24536..25036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0020"
FT                   /product="cytidine/deoxycytidylate deaminase zinc-binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52359"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52359.1"
FT                   /translation="MERDQDIYFMQLAIEEAKKAEAIQEVPIGAVIVLNGEVISAAHNL
FT                   RETEQRSIAHAELLAIDEACKKLGTWRLEDATLYVTLEPCPMCAGGIVLSRVKRVVYGA
FT                   GDPKGGCAGTLMNLLTDERFNHQCEVVAGVLEEECGTLLTNFFRELRKKRKAIKKLEKS
FT                   NEN"
FT   gene            25513..27201
FT                   /locus_tag="BAS0021"
FT   CDS_pept        25513..27201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0021"
FT                   /product="DNA polymerase III, gamma and tau subunits"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52360"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52360.1"
FT                   /translation="MSYQALYRTWRPQKFEDVVGQKHVTKTLQNALLQEKVSHAYLFSG
FT                   PRGTGKTTIAKVFAKAINCEHAPVAEPCNECPSCLGITQGSISDVLEIDAASNNGVDEI
FT                   RDIRDKVKYAPSAVEYKVYIIDEVHMLSMGAFNALLKTLEEPPGHVIFILATTEPHKIP
FT                   PTIISRCQRFEFRKISVNDIVERLSTVVTNEGTQVEDEALQIVARAAEGGMRDALSLID
FT                   QAISYSDERVTTEDVLAVTGSVSQQYLGNLVECIRENDVSRALRIIDEMMGKGKDPVRF
FT                   MEDFIYYYRDMLLYQTSPQLEHMLERVMVDEQFRMLSEEMQPEVIYEIIHTLSKGQQEM
FT                   KWTNHPRIFLEVVMVQLCQQFMMQANGADRLQAIMNRMQQLEKELEQVKKNGVPVGVQQ
FT                   EVKETRAAPKPVRTGSMKIPVGRVNEVLKQAKRQDLEQLKAVWGELLGRLKAYNKVAFA
FT                   VLLENSEPVAASDDTYVLAFQYEIHCKMASENREAMDTVEQALFELLSKKLNMIAIPKS
FT                   EWGKIREDFLKREGGSSEESPEKKEDPLIEEAIKLVGQELIEIKE"
FT   gene            27224..27553
FT                   /locus_tag="BAS0022"
FT   CDS_pept        27224..27553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0022"
FT                   /product="conserved hypothetical protein TIGR00103"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52361"
FT                   /db_xref="GOA:Q81W17"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81W17"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52361.1"
FT                   /translation="MMRGGMGNMNNMMKQMQKMQKEMAKAQEELGEKTVEGTAGGGMIT
FT                   VIANGHKQILEVKVKEEVVDPEDIEMLQDLVLAATNDALKKADELSNSTMGKFTKGLNL
FT                   PGGMF"
FT   gene            27568..28164
FT                   /locus_tag="BAS0023"
FT   CDS_pept        27568..28164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0023"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52362"
FT                   /db_xref="GOA:Q81W16"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81W16"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52362.1"
FT                   /translation="MHYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLDMKEDDVLGFAK
FT                   ALVNAKRDLAYCSVCGHITDRDPCYICNDSHRDQSVVCVVQEPKDVIAMEKMKEYQGVY
FT                   HVLRGAISPMGGIGPEDINIPQLLKRLHDETVQEVILATNPNIEGEATAMYISRLLKPT
FT                   GIKVTRIAHGLPVGGDLEYADEVTLSKALEGRREV"
FT   gene            28179..28400
FT                   /locus_tag="BAS0024"
FT   CDS_pept        28179..28400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0024"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52363"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52363.1"
FT                   /translation="MFFQKKGKLRKEYDDNLIVLLEKVKNEWLRQKRMVEQSVEPSQDV
FT                   LCSLKIAEAKYFFLLKEAKRRPVKMEQW"
FT   gene            28615..28884
FT                   /locus_tag="BAS0025"
FT   CDS_pept        28615..28884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0025"
FT                   /product="sigma-k factor processing regulatory protein
FT                   BofA"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52364"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52364.1"
FT                   /translation="MNSTIIIVGILALVFIFLVFGVSSKPLRFIGKALFHVTLGVALLF
FT                   IVNVVGTYFDFHIPINLGTATITSLLGLPGVAALVVIKLYIMPR"
FT   gene            29130..30639
FT                   /locus_tag="rRNA-16s-2"
FT   rRNA            29130..30639
FT                   /locus_tag="rRNA-16s-2"
FT                   /product="16S ribosomal RNA"
FT   gene            30787..30866
FT                   /locus_tag="tRNA-Ile-4"
FT   tRNA            30787..30866
FT                   /locus_tag="tRNA-Ile-4"
FT                   /product="tRNA-Ile"
FT   gene            30872..30950
FT                   /locus_tag="tRNA-Ala-4"
FT   tRNA            30872..30950
FT                   /locus_tag="tRNA-Ala-4"
FT                   /product="tRNA-Ala"
FT   gene            31042..33952
FT                   /locus_tag="rRNA-23s-2"
FT   rRNA            31042..33952
FT                   /locus_tag="rRNA-23s-2"
FT                   /product="23S ribosomal RNA"
FT   gene            33998..34116
FT                   /locus_tag="rRNA-5s-2"
FT   rRNA            33998..34116
FT                   /locus_tag="rRNA-5s-2"
FT                   /product="5S ribosomal RNA"
FT   gene            34304..34483
FT                   /locus_tag="BAS0027"
FT   CDS_pept        34304..34483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0027"
FT                   /product="csfB protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52365"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52365.1"
FT                   /translation="MKSQNEVCIVCETERKEGIYVYNNLICYECEKDMVNTETDDPKYI
FT                   YYLKQLRKLEVSYF"
FT   gene            34555..35976
FT                   /locus_tag="BAS0028"
FT   CDS_pept        34555..35976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0028"
FT                   /product="lysine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52366"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52366.1"
FT                   /translation="MNQNRIPLYEALIEFKERRRLSFHVPGHKNGLNFPQEVVEEFKDI
FT                   LSIDVTELSGLDDLHSPFECIDEAQQLLADVYGVNKSYFLINGSTVGNLAMILSCCGEH
FT                   DIVLVQRNCHKSIINGLKLAGANPIFLDPWIDEAYNVPVGIHDEIIKEAIEKYPNAKAL
FT                   ILTHPNYYGMGMDLEASIAYAHTHKIPVLVDEAHGAHFCLGGAFPQSALAYGADMVVHS
FT                   AHKTLPAMTMGSYLHINSRLVKEEKVSTYLSMLQSSSPSYPIMASLDIARFTIARIKEK
FT                   GHDEIVEFLQEFKEELSTIPQIAILQYPLQDGLKITVQTRCRLSGYELQSVFEKVGIYT
FT                   EMADPYNVLFILPLQVNKKYMKAIEMIRVALQYYEVKDKTESIRYTYKGEISPLPYTYK
FT                   QLEEYETKVVPIEEAVGMVAAEMVIPYPPGIPLIMYGERITSGHKEQIMYLEKAGARFQ
FT                   GSRKYMKVYDIESRF"
FT   gene            35978..36604
FT                   /locus_tag="BAS0029"
FT   CDS_pept        35978..36604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0029"
FT                   /product="thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52367"
FT                   /db_xref="GOA:Q81W11"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81W11"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52367.1"
FT                   /translation="MKGLFVTIEGPEGSGKTTLIQSLLPYFEQKEQKVMATREPGGIAI
FT                   SEDIRTILHKQEYTMMEARTEALLYAAARRQHLVEKVMPALNEDYLVLCDRFIDSSLAY
FT                   QGYARGLGMDKVFEINRFATEDCMPSLTIYLDIEPEVGLARIAKDAGREVNRLDMEDIS
FT                   FHKRVREGYLQVVERFSDRIVLVNADQPMEKLIEEVIQVIEDKLL"
FT   gene            36640..37623
FT                   /locus_tag="BAS0030"
FT   CDS_pept        36640..37623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0030"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52368"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52368.1"
FT                   /translation="MTKTWEQLSAIQPIGVKMLMNSIAKERISHAYLLEGEKGTGKFAT
FT                   AIQMAKSFLCSQRNRVEPCHVCTNCKRIDSGNHPNLHIVKPDGLSIKKQQIHDLQEEFS
FT                   KTGLEANKKVYIIEHADRMTANAANALLKFLEEPSSDTTAILLTEQSHQILNTILSRCQ
FT                   VVTFRPLPTESLIRRLQDEGITVSLSTLAAQLTNSFDEALTLCNDEWFAQARALVIKLC
FT                   EALEKDKASIFFVQEKWGKHFGEKEQLQQGLDMLLLIYKDLLYVQLGEEDRLVFREQKE
FT                   MFESFSYAQKRIVSALFNILEAKNRINANVNAQLVFEQLVLRLQEG"
FT   gene            37620..38456
FT                   /locus_tag="BAS0031"
FT   CDS_pept        37620..38456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52369"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52369.1"
FT                   /translation="MTVLYDVVGVRFKKAGKVYYFDPNQFDISENEFVIVETVRGIEYG
FT                   KVVITKKQVDENDVVLPLKKVIRIANENDRTIVEENKHAAKEAYQVCQQKVVEHNLDMK
FT                   LVDVEYTFDRNKIIFYFTADGRIDFRELVKDLAAIFRTRIELRQIGVRDEAKMLGGIGP
FT                   CGRMLCCSTFLGDFEPVSIKMAKDQNLSLNPAKISGLCGRLMCCLKYENDEYEAAKEQL
FT                   PDLDQRIQTPHGTGRVIGLNILERLIQVELVDKERIVEYTLDELVNKGVVSSQTTD"
FT   gene            38456..38821
FT                   /locus_tag="BAS0032"
FT   CDS_pept        38456..38821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0032"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52370"
FT                   /db_xref="GOA:Q6I511"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6I511"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52370.1"
FT                   /translation="MRWVLVEKKDIFASVSSMEEQIGHLYKQLGELKQHLAELLEENQH
FT                   IKMENENLRHRFEEVQIKEKQKTQKRKEVKPKTDIGEGYDNLARLYQEGFHICNLHYGS
FT                   VRKEGDCLFCLSFLNKK"
FT   gene            38942..39682
FT                   /locus_tag="BAS0033"
FT   CDS_pept        38942..39682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0033"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52371"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52371.1"
FT                   /translation="MNLYEDERLDYLLAQDMKIIQSPSVFNFSLDAVLLADFAWVPIQK
FT                   GNLLDLCTGNAVVPLLLSTRTKGNITGVEIQERLYDMGIRSVQYNKLEERIHLIHGDLK
FT                   DMPEKLGRHQYDVVTCNPPYFQTPVTSEKNMNEHLAIARHEIMCTLEDVVSASSQLVKQ
FT                   GGKVAFVHRPGRLLDIVTLMRKYKIEPKRVRFVYPKAGKEANTLLIEGIKDGNADLKIL
FT                   PPLFVYEENNEYTKEIRSILYGEE"
FT   gene            39669..39959
FT                   /locus_tag="BAS0034"
FT   CDS_pept        39669..39959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0034"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52372"
FT                   /db_xref="GOA:Q81W06"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81W06"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52372.1"
FT                   /translation="MEKNKHCFYVVECSDGSYYAGYTNHIEKRIGTHNSGRGAKYTRAR
FT                   LPVVLKYVEFHEDKRTAMQAEYYFKQLNRKQKEEYMQKGERYVATKKLSTK"
FT   gene            39928..40803
FT                   /locus_tag="BAS0035"
FT   CDS_pept        39928..40803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0035"
FT                   /product="conserved hypothetical protein TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52373"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52373.1"
FT                   /translation="MWQQKSFQQNEKGVLYLVPTPIGNLEDMTFRAIRILKEADLIAAE
FT                   DTRQTKKLCNYFEIETPVMSYHEHNKEVSGKKILEKLDEGKTVALVSDAGMPCISDPGY
FT                   DIVVEAVAEQYHVIPLPGANAALTALIASGLQTKQFYFYGFLQRNKKERKMELEKLRYV
FT                   QTTMMFYEAPHRLDDTLISMQEVLGNREIVLCRELTKKFEEFIRGTVEEAIEWTKQNEV
FT                   RGEFCILVAGSTEEPAPEEQWWESISVYNHIEHYINEKGMNSKEAIKTVAKDRDLSKRD
FT                   VYQIYHVDKK"
FT   gene            complement(40824..41108)
FT                   /locus_tag="BAS0036"
FT   CDS_pept        complement(40824..41108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0036"
FT                   /product="transition state transcriptional regulatory
FT                   protein AbrB"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52374"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52374.1"
FT                   /translation="MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIIL
FT                   KKYKPNMTCQVTGEVSDGNLFLAEGKIILSKEGAEQILNELQDYIETAK"
FT   gene            41599..43581
FT                   /locus_tag="BAS0037"
FT   CDS_pept        41599..43581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0037"
FT                   /product="methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52375"
FT                   /db_xref="GOA:Q81W03"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81W03"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52375.1"
FT                   /translation="MTEENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKCMQGYN
FT                   VHYLTGTDEHGQKIQKKAEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHK
FT                   DVVEKIFKQLVDQGDIYLDEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHD
FT                   VELVREESYFFRMGKYVDRLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSF
FT                   DWGVRVPGNPKHVIYVWVDALSNYITALGYGTENEEMYKKFWPADVHLVGKEIVRFHTI
FT                   YWPIILMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPVILIDRYGLDALRYYLLRE
FT                   VPFGSDGVFTPEGFVERINFDLANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETL
FT                   VTFAKDTLKKVEEAMENMEFSVALSSIWQLVSRTNKYIDETQPWVLAKDEDDREKLASV
FT                   MAHLAEVLRQTGIMLMPFLTVAPSKMFAQLGLTDEAHTSWGSLSTIGCIPAGTKVEKGQ
FT                   PIFPRLEMDVEVAYIKEQMKASAPKVEEKKEEEPKAEEITIDDFFKVELRVAEVLSAEP
FT                   VKKADKLLKIQLDLGTEKRQVVSGIAKFYSPEDLKGKKVICVTNLKPVKLRGELSQGMI
FT                   LAGEENGVLSLASIDQNIPNGTKIK"
FT   gene            43747..44514
FT                   /locus_tag="BAS0038"
FT   CDS_pept        43747..44514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0038"
FT                   /product="deoxyribonuclease, TatD family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52376"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52376.1"
FT                   /translation="MLFDTHSHLNAEQFEEDLQEVIARMKEAGVTYTVVVGFDEATIKK
FT                   AIELAEAYDFIYAAVGWHPVDAIDMTEEHLAWLEELASHPKVVALGEMGLDYHWDKSPK
FT                   EIQKEVFRKQITLAKKVKLPIIIHNRDATQDIVDILEEENAAEVGGIMHCFSGSVEVAE
FT                   RCVDMNFLISLGGPVTFKNAKKPKEVATEIPLEKLLIETDCPYLTPHPFRGKRNEPSYV
FT                   KLVAEEIANLKGISYEEVAEITTKNAKALFGVE"
FT   gene            44729..45286
FT                   /locus_tag="BAS0039"
FT   CDS_pept        44729..45286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0039"
FT                   /product="primase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52377"
FT                   /db_xref="GOA:Q81W01"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81W01"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52377.1"
FT                   /translation="MKIKEIIVVEGKDDTVAIKRAVDADTIETNGSAIGDHVIEQVKLA
FT                   LQKRGVIIFTDPDYPGERIRKIISDKVPGCKHAFLPKEEALAKRKKGVGIEHASNESIR
FT                   RALENIHEEMEAYTSEISWSDLVDAGLVGGEMAKSRRERMGKLLKIGYTNAKQLHKRLQ
FT                   MFQVSKESFAEAYKQVIQEERK"
FT   gene            45283..46161
FT                   /locus_tag="BAS0040"
FT   CDS_pept        45283..46161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0040"
FT                   /product="dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52378"
FT                   /db_xref="GOA:Q81W00"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81W00"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52378.1"
FT                   /translation="MKDIATPNRTKDIVEKYGFSFKKSLGQNFLIDTNVLNRIVDHAEI
FT                   GSESGAIEIGPGIGALTEQLAKRAKKVVAFEIDQRLLPILDETLAPYGNVTVINKDVLK
FT                   ADVHEVFSEQFEEGQDVMVVANLPYYITTPILFKLLEEKLPVRGFVVMMQKEVGDRLAA
FT                   KPGTKEYGSLSIAIQYYTEVETVMTVPRTVFVPQPNVDSAIIRLLKRPKPVVEVTDETF
FT                   FFEVVRASFAQRRKTLMNNLSNNLNGFPKDKELLDRILTEVGIDPKRRGETLSIEEFAT
FT                   LSNALVLHKLS"
FT   gene            46272..47135
FT                   /locus_tag="BAS0041"
FT   CDS_pept        46272..47135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0041"
FT                   /product="yabG protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52379"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52379.1"
FT                   /translation="MALHVGELVERYSHNRDILFRIIEIKGEIAILFGEEIRLVADAPL
FT                   EDLISIDQREHKKRAKREKETMERTYRLFQQDYVLMKQRHEHTSTGGYTSEVNYFQMPG
FT                   RVLHIDGDPLYLRKCLDLYNKIGVPVQGIHCKETEMHEKVVDLIDHFRPDILVITGHDA
FT                   YTKSKGVKGDLAAYRHSRHFVQAVREVRKKYPSLDQLVIFAGACQSHFEALIRAGANFA
FT                   SSPSRINIHALDPVYVVGKISFTSFMERVNVWDVVRNTITGEKGLGGIETRGILRTGLP
FT                   FQHYEE"
FT   gene            47374..47634
FT                   /locus_tag="BAS0042"
FT   CDS_pept        47374..47634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0042"
FT                   /product="veg protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52380"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52380.1"
FT                   /translation="MSKRLDEIKSELDHHLGQRLMLKANSGRRKTVEQSGVLAETYRSV
FT                   FVVQLDQQEDALQRVSYSYADVLTETVELTFYGEPHNEVIL"
FT   gene            47726..47905
FT                   /locus_tag="BAS0043"
FT   CDS_pept        47726..47905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0043"
FT                   /product="small, acid-soluble spore protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52381"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52381.1"
FT                   /translation="MSRRRGVMSNQFKEELAKELGFYDVVQKEGWGGIRAKDAGNMVKR
FT                   AIEIAEQQLMKQNQ"
FT   gene            48093..48971
FT                   /locus_tag="BAS0044"
FT   CDS_pept        48093..48971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0044"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52382"
FT                   /db_xref="GOA:Q81VZ6"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VZ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52382.1"
FT                   /translation="MNRLKLLVKAPAKINLSLDVLGKRQDGYHEVKMIMTTIDLADRLE
FT                   LMELAEDRIEILSHNRYVPDDQRNLAYQAAKLLKEKFNVKKGVSITIEKTIPVAAGLAG
FT                   GSSDAAATLRGLNKLWNLGLTIDQLAELGAEIGSDVSFCVYGGTAIATGRGEQIEHIKT
FT                   PPSCWVILAKPHIGVFTADVYGNLKLNRVTHPNVDKMVDVINAGDYKGICDTVGNVLED
FT                   VTFAMHPEVARIKAQMKRFGADAVLMSGSGPTVFGLVHHDSRMHRIYNGLKGFCEQVYA
FT                   VRLLGERETLE"
FT   gene            49026..49874
FT                   /locus_tag="BAS0045"
FT   CDS_pept        49026..49874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0045"
FT                   /product="pur operon repressor PurR"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52383"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52383.1"
FT                   /translation="MKIRRSTRLVDMTYYLLQNPRQLVSLTFFAERYQSAKSSISEDLV
FT                   IIKQTFEQQGVGTLQTIPGAAGGVKYIPYISEEEADLIIGELCSLFENPDRILPGGYLY
FT                   MTDLLSNPRHINGAGRLFASVFARQPIDAVMTVATKGIPLAYAVANYLDVPVVIARKDN
FT                   KVTEGPTVSINYVSGSSKRIQTMTLAKRSLPEGSNVLIIDDFMKAGGTIQGMMSMLEEF
FT                   KANVVGIGVLVESTDIEERLINNFVSLIRLSEVDVKEKAIQVEKGNYSLAPFDEGIVEA
FT                   E"
FT   gene            49997..50371
FT                   /locus_tag="BAS0046"
FT   CDS_pept        49997..50371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0046"
FT                   /product="endoribonuclease L-PSP, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52384"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52384.1"
FT                   /translation="MKVVQTNNAPQAIGPYSQGIIVNNMFYSSGQIPLTASGELVAGDV
FT                   TVQTEQVFQNLQAVLEEAGASFDTVVKTTVFLKDMDDFNAVNEVYGSYFSAHKPARSCV
FT                   QVAKLPKDVSVEIEVIALVK"
FT   gene            50470..50817
FT                   /locus_tag="BAS0047"
FT   CDS_pept        50470..50817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0047"
FT                   /product="stage V sporulation protein G"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52385"
FT                   /db_xref="GOA:Q81VZ2"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VZ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52385.1"
FT                   /translation="MWNLYKYIAYLEKGGEHKMEVTDVRLRRVNTEGRMRAIASITLDH
FT                   EFVVHDIRVIDGNNGLFVAMPSKRTPDGEFRDIAHPINSGTRSKIQDAVLTEYHRLGEL
FT                   EEVEFEEAGAS"
FT   gene            51140..52519
FT                   /locus_tag="BAS0048"
FT   CDS_pept        51140..52519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0048"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52386"
FT                   /db_xref="GOA:Q81VZ1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VZ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52386.1"
FT                   /translation="MSNRFAVILAAGKGTRMKSKLYKVLHPVCGKPMVQHVVDQVSQLG
FT                   LQKLVTVVGHGAEMVQEQLGNVSEFALQAEQLGTAHAVDQAAGVLANEEGTTLVICGDT
FT                   PLITAETMEALLQQHKEAGAMATVLTAYIEEPAGYGRIVRNENGHVEKIVEHKDANEKE
FT                   LAIKEINTGTYCFDNKALFASLSKVSNDNVQGEYYLPDVIEILKNEGHIVSAYQTEHFD
FT                   ETLGVNDRVALSQAEIIMKNRINRKNMVNGVTIIDPSNTYISADAIIGSDTVLHPGTII
FT                   EGNTVIGSDCEIGPHTVIRDSEIGDRTTIRQSTVHDSKLGTEVSVGPFAHIRPDSVIGD
FT                   EVRVGNFVEIKKTVFGNRSKASHLSYIGDAQVGEDVNLGCGSITVNYDGKNKFKTVIGN
FT                   GVFIGCNSNLVAPVTVEDGAYVAAGSTITENVPSKALSVARARQVNKEDYVDQLLNKKK
FT                   S"
FT   gene            52538..53491
FT                   /locus_tag="BAS0049"
FT   CDS_pept        52538..53491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0049"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52387"
FT                   /db_xref="GOA:Q81VZ0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VZ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52387.1"
FT                   /translation="MSTQYLNSNLKVFSLNSNKELAEQIAKHIGVGLGKCSVDRFSDGE
FT                   VQINIEESIRGCDVFIIQSTSFPVNEHIMELLIMIDALKRASAKTINIVIPYYGYARQD
FT                   RKARSREPITSKLVANLLETAGATRVITLDLHAPQIQGFFDIPIDHLMGVPILSDYFET
FT                   KGLKDIVIVSPDHGGVTRARKMADRLKAPIAIIDKRRPRPNVSEVMNIIGNIEGKTAIL
FT                   IDDIIDTAGTITLAANALVENGASEVYACCTHPVLSGPAIERIQNSNIKELVVTNSIVL
FT                   PEEKKIDKVHELSVAPLIGEAIIRVYEEESVSVLFN"
FT   gene            53564..54124
FT                   /locus_tag="BAS0050"
FT   CDS_pept        53564..54124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0050"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52388"
FT                   /db_xref="GOA:Q81VY9"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VY9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52388.1"
FT                   /translation="MKLIVGLGNPGREYELTRHNIGFMAIDELAKRWNISLNEQKFKGL
FT                   FGAGFVNGEKVILLKPLTYMNLSGESIRPLMDYYKIDVEDFVVLYDDLDIPVGKLRLRM
FT                   KGSAGGHNGVKSTISHLGTQEFQRIRMGIDRPKNGMKVVDYVLGRFTSEEIPDVNHSIE
FT                   KAADACEEWLNKPFLQIMNTFNS"
FT   gene            54195..54419
FT                   /locus_tag="BAS0051"
FT   CDS_pept        54195..54419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0051"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52389"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52389.1"
FT                   /translation="MEGYYYCRHCGSNVGSVTAEKVYSDVLFQLTEQEVVEMIHFHENG
FT                   NIYIKTICELCQETLASYPEYYEYEKFLQ"
FT   gene            54525..58055
FT                   /locus_tag="BAS0052"
FT   CDS_pept        54525..58055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0052"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52390"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52390.1"
FT                   /translation="MIGLLEQFYKNEEIQSVINGLEDGLKEQLVSGMATSSRSFLMAAL
FT                   YKKTKKSQLIVTHNLYQAQKVHEDLVALLGEKDVWLYPVNELIASELGVASPELKAQRI
FT                   EVLNRLAAGEHGIIVAPVAGLRRFLPMKELWKQRQIEISLGQEIDLDTFLHTLHHIGYE
FT                   RKSMVEAPGEFSLRGGILDIYPLTEELPFRIEFFDTEVDSIRLFDVDEQRSQDKKESVR
FT                   FGPATEFLFSQEELKSGIKHLEEGLTKTMQKLSDDKLKTTVLETVSHEIEMLKNGQSIE
FT                   QMFKYLSIFYNEPASLIDYLPEDGVVILDEISRIQETASHLESEEAEWYISLLGEGTII
FT                   QDLSFSHSFEEFLHHKKRSFVYLTLFLRHIAHTHPQNIVNVTCKTMQDFHGQMQLLKTE
FT                   IDRWNEGHFTTVVLGTDDERVKKLQHILSDYDIDADIVEGTDILLPGRLQIAVGDLHAG
FT                   FEMPMQKLVVITEKELFHKKVKKSQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFL
FT                   GIETLEINGVHKDYLNIKYQGNDKLYVPIEQIDQVQKYVGSEGKDPKVYKLGGNDWKKV
FT                   KTKVEKSVQDIADDLIKLYAEREASKGYAYTPDTAEQQEFESSFPYQETEDQLRSIEEI
FT                   KKDMERGRPMDRLLCGDVGYGKTEVAIRAAFKAIMDEKQVAILVPTTILAQQHYETIRE
FT                   RFQDYPINIGLLSRFRTRKQQNETIKGLKDGTVDIVIGTHRILSKDVTYKDLGLLIIDE
FT                   EQRFGVTHKEKIKQLKANVDVLTLTATPIPRTLHMSMLGVRDLSVIETPPENRFPVQTY
FT                   VVEYNPALMREAIERELARGGQVYFLYNRVEDIERKADEISMLVPDARVTYAHGKMNES
FT                   ELESVMLSFLEGQHDVLVSTTIIETGVDIPNVNTLIVFDADRMGLSQLYQLRGRVGRSN
FT                   RVAYAYFAYKRDKVLSEVAEKRLQAIKEFTELGSGFKIAMRDLSIRGAGNLLGAEQHGF
FT                   IDSVGFDLYSQMLKDAIEQRRGTDGVENTVNVEIDLEVDAYLPDAYISDSKQKIMMYKQ
FT                   FRGVSAIEDIEELQEEMIDRFGDYPQEVGYLLQIANIKVLAMKEQIELIKQNKFEVTIL
FT                   FSEQASQNIDGGKLFMLGNSFGRMIGLGMEGSQLKIVMKTNGLETSKWLTIAENLLKGL
FT                   PDVKKEVINA"
FT   gene            58191..58727
FT                   /locus_tag="BAS0053"
FT   CDS_pept        58191..58727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0053"
FT                   /product="stage V sporulation protein T"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52391"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52391.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRDGEVI
FT                   LKKYSPISELGDFAKEYAEALYDSLGHNVLVCDRDSIIAVSGVSKKEYLNKSVGDLIEK
FT                   TMEERKSVIMTDESDVSIIDGVTEKVHSYTVGPIVANGDPIGAVIIFSKEAIISEIEHK
FT                   AVNTAASFLAKQMEQ"
FT   gene            58958..60559
FT                   /locus_tag="BAS0054"
FT   CDS_pept        58958..60559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0054"
FT                   /product="stage V sporulation protein B, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52392"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52392.1"
FT                   /translation="MESKKYQAFWRGAIILTIASFVTKVLSAFYRIPYQNIAGDIGFYI
FT                   YQQIYPFYGFCLILATYGFPIIISKMVAERLERGKKQEAEEIICVSFWFLLGIGFIGFF
FT                   TLFFGAEVIATAMGDIHLDKLLRVISFSFILMPFLSVARGYFQGFNNMVPTAVSQVIEQ
FT                   TIRVSIIVFLSLFLIAHEFDLYTVGAGAMLGSIAGGLIGIIVLILYMRHDFRSIFFKSV
FT                   KRIKGKKKIIKILFWQGLAICVSNLVLIFIQMADSVSFYSLLIGAGEPAESAKVLKGVY
FT                   DRSIPLMQLGTVVTTSFSLSLIPIITAAKERGDLTFIREKVRLAMKITFVIGFAAAIGL
FT                   TCIIQPTNIMLFENSDGSDVLSILSLSILFSSLSITTASILQGLGQTLKPAIFVVFGGC
FT                   LKLVLNYILMPYFGAKGAAIATLVALIVISVLNSMLLMRAVSESLIDKRNMLGIVISGF
FT                   SMGFVLIMFMRVLQMSGLVMDTSHRGVATFEALLGVAIGGLAYMFLILKLRVFTKAEIG
FT                   TVMKKEKKEGSLKKSG"
FT   gene            60572..62032
FT                   /locus_tag="BAS0055"
FT   CDS_pept        60572..62032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0055"
FT                   /product="tetrapyrrole methylase family protein/MazG family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52393"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52393.1"
FT                   /translation="MSGIITILGLGAGELDQLTMGVYRKIKEADHMFVRTKEHPVIEEL
FT                   EKEGIQYTAFDNVYEAHDTFEIVYETIANTLIEKAEGTEIIYAVPGHPLVAERTVQLLL
FT                   EKGEVANIEVRIEGGQSFLDPMFASLKIDPIEGFQLIDATSFERGQLELRQHLIFCQVY
FT                   DAFVASDVKLTLMEMLPDDYEVYIVTAAGTSFEQVKKVPLYMLDHETELNNLTSVYVPP
FT                   VQERASLYQQFDVLREIIADLRGPNGCPWDKKQTHQSLKKYLIEEAYEVLEAIDEEDDD
FT                   HLVEELGDILLQVMLHAQIGEDEGWFSIDDIIRTLSEKMVRRHPHVFGNTDVDNADEVI
FT                   ANWEEIKKQEKGFVKESVLDGVPKSLPQLLRAYEIQKKAGKVGFDWVDVQPMIEKALEE
FT                   WQEFQQEVTNMDEAKMLSEFGDLLFAFVNIARHYKIDPEEALHSTNEKFVGRFLYMEAK
FT                   VAEMNKEMQDLSLEQLDVLWEEAKQTER"
FT   gene            62047..62322
FT                   /locus_tag="BAS0056"
FT   CDS_pept        62047..62322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0056"
FT                   /product="S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52394"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52394.1"
FT                   /translation="MRLDKFLKVSRLIKRRTLAKEVADQGRISINGQVAKASSDVKVAD
FT                   ELTIRFGQKIVTVKINELKETTKKEDAANMYSLVREEKVKAEEGLF"
FT   gene            62363..62689
FT                   /locus_tag="BAS0057"
FT   CDS_pept        62363..62689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0057"
FT                   /product="yabP protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52395"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52395.1"
FT                   /translation="MYGGIYVNNGYSPMSSNQQNVSVEHDIIMRGRRVIDITGVKQVES
FT                   FDSEEFLLETVMGFLTIRGQNLQMKNLDVEKGVVSIKGKVHEMLYIDENQGEKTKGFFS
FT                   KLFK"
FT   gene            62686..63339
FT                   /locus_tag="BAS0058"
FT   CDS_pept        62686..63339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0058"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52396"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52396.1"
FT                   /translation="MSLTIQLYTMLSMIGMGAWIGASLDTYQRFLKRQERKRWLVFIHD
FT                   ILFWIVQALFVFYVLLLVNEAELRIYVFLALLCGFAAYQSLLKAIYMRLLNFLIYIFVQ
FT                   TTHFFVQIIKLLMIKPVIIIAQLFIAFILFLFRILLSIGHVLWKMVIWILLFIWKVFFW
FT                   PVRFIASLIWKLLPNRVKLFIMKHVGFLQYIAKLKGHIFQLWERIKKKLGGPRK"
FT   gene            63336..63695
FT                   /locus_tag="BAS0059"
FT   CDS_pept        63336..63695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0059"
FT                   /product="cell division protein DivIC"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52397"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52397.1"
FT                   /translation="MRELRQRTIEKQSPNPVKEHIIQTDENRKRLYRRLAVFLVFAFTI
FT                   IASISVTFYQQNSSIKAKEAKVKDMKKELDSLTNKEKSLKDEVQKLNDEEYVLKIARRD
FT                   YFFSGKGEIIFPVSK"
FT   gene            63783..64265
FT                   /locus_tag="BAS0060"
FT   CDS_pept        63783..64265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0060"
FT                   /product="S1 RNA binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52398"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52398.1"
FT                   /translation="MSIEVGSKLQGKVTGITNFGAFVELPEGLTGLVHISEVADNYVKD
FT                   INDHLKVGDQVEVKVINVEKDGKIGLSIKKAKEREKTEGDRPRGEYQRGGDQQRSGRPQ
FT                   RNRSFNRDNRGGGNDRAPKETFEQKMARFLKDSEDRLTSLKRNTESKRGGRGARRG"
FT   gene            64426..64502
FT                   /locus_tag="tRNA-Met-6"
FT   tRNA            64426..64502
FT                   /locus_tag="tRNA-Met-6"
FT                   /product="tRNA-Met"
FT   gene            64513..64587
FT                   /locus_tag="tRNA-Glu-5"
FT   tRNA            64513..64587
FT                   /locus_tag="tRNA-Glu-5"
FT                   /product="tRNA-Glu"
FT   gene            64889..67315
FT                   /locus_tag="BAS0061"
FT   CDS_pept        64889..67315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0061"
FT                   /product="stage II sporulation protein E"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52399"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52399.1"
FT                   /translation="MNEGQLGGVKWTSKLRMKFEQVFFRWGFIIVVIGFLLGRAYILTN
FT                   ILPFALPFFAAVYVMKRDKMPLAFLALMGGALSVSIDNLFFTFASIFTFFIYNIFFSRF
FT                   TRKTVGLVPFQVFISALTAHLVVVYFAQQTVTMYDLLVSTIEAGLSFVLTMIFLQSVPL
FT                   LVERKGKQQALETEEIVCLIILLASVLTGTTDWFVYDASIQHIFTRYLVLVFAFIAGAA
FT                   TGSTVGVVTGLILSLANVSSLSQLSLLAFSGLLGGLLKEGKRIGVSLGLLIGTSLITLY
FT                   VDKQTNIVTTLIESGVAIAFFLLTPKLVMDRIAKFMPGTQEHSQDQQQYLRRMRDVTAN
FT                   KINQFANVFAALSNSFSVYGYVEEEDKETEADLFLSTITAKTCQTCFKKDQCWVVNFDK
FT                   TYDYMKQIMSETEEGTLQHNRKLVREWDKHCVRGKKVTDLVAGELDHFYEGQKLRKQMK
FT                   ENRRIVAEQLLGVSKVMEDFAKEIQRERENHQVQEEQILQAFRDFGVEIEHVDIYCLDR
FT                   GSIDIEMLIPVASNEHGECEKLVAPMLSDILKENIVVKHEEKSSYPNGHSLISFGSAKT
FT                   YSLDTGLATAAKGGGFVSGDSYAMMDLSVGKYALAISDGMGNGQRAHMESKETVKLLQK
FT                   ILQSGIDEEIAIKSINSILSLRTTEEMFTTLDLAMVDLRDASAKFLKIGSTPSFVKRAN
FT                   NILKIEASNLPMGIIEDVEVDVVGEQLKTGDILIMMSDGIFEGAQHVENHELWMKRKIK
FT                   ELQTEDPQEIADIIMEEVIRSGDGYINDDMTIVVAKVKKNMPKWATIPIVGMQAQ"
FT   gene            67549..68979
FT                   /locus_tag="BAS0062"
FT   CDS_pept        67549..68979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0062"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52400"
FT                   /db_xref="GOA:Q81VX7"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VX7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52400.1"
FT                   /translation="MKDTFVEKVDDFVRQHDVLKERSTIVVGVSGGPDSLALLYYLLEK
FT                   RAAKQFEIVVAHVDHMFRGDESHEDLQFVQDLCKGLGVICETIRINVSQYQKQYGMNAQ
FT                   VAARECRYAFLERIMKKYDARYVALGHHGDDQVETILMRLVRGSTPKGYAGIAVKRPFH
FT                   NGYLIRPLLGVTKEEIVNYCNELKIIPRIDPSNKKEVYTRNRLRKYVLPHLKEENPQVH
FT                   EKFQKFSMQMQEDEAYLQELAFEKMNKVITKKSDKQISLSIPTFESMSMPLQRRGIQLI
FT                   LNYLYEYKIPSSLSSIHIDKVIEFFKRTQPSGSLDFPGDLKIVRAYEECSFGFKQEIVS
FT                   PFLQDLSVPGTITLSNGDKLVTEVSEDIPSDMNETVFVAKYNDISYPIRIRSRENGDRM
FT                   SIQGMNGTKKIKAIFIEAKVPREKREEWPVVCDASGNIIWLPLLKRSAFAISKETAKKD
FT                   KYMIIHYKSKESSGRIMK"
FT   gene            68976..69518
FT                   /locus_tag="BAS0063"
FT   CDS_pept        68976..69518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0063"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52401"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52401.1"
FT                   /translation="MMNQDIEKVLISEEQIQEKVLELGAIIAEDYKNTVPLAIGVLKGA
FT                   MPFMADLLKRTDTYLEMDFMAVSSYGHSTVSTGEVKILKDLDTSVEGRDILIVEDIIDS
FT                   GLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQ
FT                   YRNLPYVGVLKPSVYSN"
FT   gene            69604..71505
FT                   /locus_tag="BAS0064"
FT   CDS_pept        69604..71505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0064"
FT                   /product="cell division protein FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52402"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52402.1"
FT                   /translation="MNRIFRNTIFYLLIFLVVIGIVSYFNGSTQKTTSVSYDKFITKLE
FT                   KGEVRNVQLQPKNGVFEVKGQFNNSSQGEQFVTYAPNTEELQKKINDKAQGAEVKYQPA
FT                   EETSAWVTFFTSIIPFVIIFILFFFLLNQAQGGGSRVMNFGKSKAKLYNDEKKKVRFRD
FT                   VAGADEEKQELVEVVEFLKDPRKFAEVGARIPKGVLLVGPPGTGKTLLARAVAGEAGVP
FT                   FFSISGSDFVEMFVGVGASRVRDLFENAKKNAPCIIFIDEIDAVGRQRGAGLGGGHDER
FT                   EQTLNQLLVEMDGFGANEGIIIIAATNRPDILDPALLRPGRFDRQITVDRPDVNGREAV
FT                   LKVHARNKPLDENINLRAIATRTPGFSGADLENLLNEAALVAARQDKKKIDMSDIDEAT
FT                   DRVIAGPAKKSRVISEKERNIVAFHEAGHTVIGVVLDEADVVHKVTIVPRGQAGGYAVM
FT                   LPKEDRYFMTKPELLDKITGLLGGRVAEEIVFGEVSTGAHNDFQRATGIARRMVTEFGM
FT                   SDKLGPMQFGSSQGGQVFLGRDFHSEQNYSDAIAHEIDMEMQTIMKECYARAKQILTDN
FT                   RDKLDLIAKTLLEVETLDAEQINHLCDYGRLPERPTSSADVKVNINMKKDDEESEDK"
FT   gene            71730..72518
FT                   /locus_tag="BAS0065"
FT   CDS_pept        71730..72518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0065"
FT                   /product="transcriptional activator, putative, Baf family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52403"
FT                   /db_xref="GOA:Q81VX4"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="PDB:2H3G"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VX4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52403.1"
FT                   /translation="MIFVLDVGNTNAVLGVFEEGELRQHWRMETDRHKTEDEYGMLVKQ
FT                   LLEHEGLSFEDVKGIIVSSVVPPIMFALERMCEKYFKIKPLVVGPGIKTGLNIKYENPR
FT                   EVGADRIVNAVAGIHLYGSPLIIVDFGTATTYCYINEEKHYMGGVITPGIMISAEALYS
FT                   RAAKLPRIEITKPSSVVGKNTVSAMQSGILYGYVGQVEGIVKRMKEEAKQEPKVIATGG
FT                   LAKLISEESNVIDVVDPFLTLKGLYMLYERNANLQHEKGE"
FT   gene            72525..73400
FT                   /locus_tag="BAS0066"
FT   CDS_pept        72525..73400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0066"
FT                   /product="chaperonin, 33 kDa"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52404"
FT                   /db_xref="GOA:Q81VX3"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VX3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52404.1"
FT                   /translation="MKDYLVKALAFDGEVRAYSVRTTNTVSEAQRRHDTWRTASAALGR
FT                   SLTAGTMMGAMLKGDQKLTIKVEGNGPIGPILVDAHANGDVRGYVTNPHVDFEGTEQGK
FT                   LRVYQAVGTEGFVTVIKDIGMREPFIGQSPIVSGELGEDFTYYFAVSEQTPSSVGVGVL
FT                   VNGDDSILAAGGFILQIMPGAQEETISFIEERLQKIPPVSTLIEQGLSPEELLYAVLGE
FT                   DKVKVLETMDVQFNCTCSRERIESVLISLGKTELEQVREEEEETEVHCHFCNERYKFSK
FT                   EDITNLIENL"
FT   gene            73505..74428
FT                   /locus_tag="BAS0067"
FT   CDS_pept        73505..74428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0067"
FT                   /product="cysteine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52405"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52405.1"
FT                   /translation="MRVAQSVSELIGKTPIVKLNRIVESDSADIYLKLEFMNPGSSVKD
FT                   RIALAMIEDAEKKGLLKEGDTIIEPTSGNTGIGLAMVAAAKGYKAILVMPETMSVERRN
FT                   LLRAYGAELVLTPGPEGMGGAIRQATELAKEHGYFIPQQFKNQSNPEIHRLTTGPEIVE
FT                   QMGDQLDAFIAGIGTGGTITGAGEVLKEAYKDIKIYAVEPADSPVLSGGKPGPHKIQGI
FT                   GAGFVPETLDVEVYDEIIQVKTEQAFEYARRVAKEEGILVGISSGAVIYAATEVAKKLG
FT                   KGKKVLVIIPSNGERYLSTPLYQFES"
FT   gene            74649..76046
FT                   /locus_tag="BAS0068"
FT   CDS_pept        74649..76046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0068"
FT                   /product="para-aminobenzoate synthase, component I"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52406"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52406.1"
FT                   /translation="MQRRKSLALSIPYQLDFFKQYKFLSKDKPQHILLESGRGGRYNIV
FT                   GLNPVAVIRGKGEALHISESGKETIKQGNPLDLMQEYMERWKTDYNPEYPPFQGGAIGY
FT                   FSYDCIRYIEKLPSLAEDDINIPDIFFLLFDDVFVYDQKEKVLWIITHYVDKHEEAKER
FT                   LNEWKILWATEAPEVTIPFACPEKKNEAVAFTEESFMKAVECIQEYIGAGDVFQVNLST
FT                   RQERTLQTHPLEIYTSLREINPSPYMGYLELGDFQIVSGSPELLIKKQGTEVSTRPIAG
FT                   TRSRGANEQEDEELARELIENEKERAEHVMLVDLERNDLGRVCKYGTVEVDEFMVIEKY
FT                   SHVMHIVSNVRGEVEEDKDAFDLVKAVFPGGTITGAPKIRTMEIIEELEPVRRGIYTGS
FT                   IGWIGYSGDTELNIVIRTLLAKDGKAHVQAGAGIVIDSNPENEYKESLKKAIALWRAKE
FT                   RSEETVR"
FT   gene            76052..76639
FT                   /locus_tag="BAS0069"
FT   CDS_pept        76052..76639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0069"
FT                   /product="para-aminobenzoate synthase glutamine
FT                   amidotransferase, component II"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52407"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52407.1"
FT                   /translation="MILMIDNYDSFTFNLVQFLGELGQELVVKRNDEVTISDIENMKPD
FT                   FLMISPGPCSPNEAGISMDVIRYFAGKIPIFGVCLGHQSIAQVFGGEVVRAERLMHGKT
FT                   SPMHHDGKTIFSDIPNPFTATRYHSLIVKKETLPDCLEVTSWTEEGEIMALRHTTLPIE
FT                   GVQFHPESIMTSHGKELLQNFIRKYSPSVTSC"
FT   gene            76633..77505
FT                   /locus_tag="BAS0070"
FT   CDS_pept        76633..77505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0070"
FT                   /product="4-amino-4-deoxychorismate lyase PabC"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52408"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52408.1"
FT                   /translation="MLIYVNGQYVKSSEARISPYDHGYLYGLGVFETFRIYNGHPFLLD
FT                   DHYDRLIDALDTLQIKWTMTKDEVLLILKNLLIKNKLENAYVRFNVSAGIDEIGLQTEM
FT                   YEEPSVIVFIKPLAAPGEVAEKEGVVLKQVRNTPEGAARLKSHHYLNNILGKREIGNVV
FT                   NKEGIFLTETGYVAEGIVSNLFFVKGDILYTPSLETGILNGITRAFIIKVAEELGIKVK
FT                   EGFFTKDELLSADEVFVTNSIQEIVPLNRIEERDFPGKVGMVTKRFINLYEMQREKLWS
FT                   RNELRRGDV"
FT   gene            77498..78340
FT                   /locus_tag="BAS0071"
FT   CDS_pept        77498..78340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0071"
FT                   /product="dihydropteroate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52409"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52409.1"
FT                   /translation="MCSLKWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEV
FT                   DAAVRHAKEMRDEGAHIIDIGGESTRPGFAKVSVEEEIKRVVPMIQAVSKEVKLPISID
FT                   TYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADM
FT                   IADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSR
FT                   KSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGKGVK"
FT   gene            78341..78703
FT                   /locus_tag="BAS0072"
FT   CDS_pept        78341..78703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0072"
FT                   /product="dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52410"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52410.1"
FT                   /translation="MDKIYIHDMEFYGYHGVFPEENKLGQRFKVDLTVELDLKRAGESD
FT                   DLEHSVNYGELFELCRKVVEDRTYKLVESIAENIATDILKQYESISRCTIKVIKPDPPI
FT                   PGHYRAVAVEITRERP"
FT   gene            78700..79215
FT                   /locus_tag="BAS0073"
FT   CDS_pept        78700..79215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0073"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52411"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52411.1"
FT                   /translation="MNNIAYIALGSNIGERYTYLTEAIQFLNKNPYIKVEDVSSVYETE
FT                   PVGYTDQSCFLNLVIKISTNLSPQELLKVTQKVENDLGRKREIRWGPRTIDLDILLYNQ
FT                   ENIEAENLIVPHPRMFERAFVIVPLLEINQDIKQNISRSQVEEMKRREGVTVWKQKNGE
FT                   DAFVLFEN"
FT   gene            79167..79370
FT                   /locus_tag="BAS0074"
FT   CDS_pept        79167..79370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0074"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52412"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52412.1"
FT                   /translation="MEAEKWGRRIRAFRKLKGYTQEGFAKELGVSVSVLGEVERGNRSP
FT                   SQDFVVEVAKALKVSIDELMPK"
FT   gene            79418..80392
FT                   /locus_tag="BAS0075"
FT   CDS_pept        79418..80392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0075"
FT                   /product="TIM-barrel protein, putative, NifR3 family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52413"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52413.1"
FT                   /translation="MKNPVVLAPMAGVCNSAFRLTVKEFGAGLVCAEMVSDKAILLNNK
FT                   RTLDMLYIDEREKPLSLQIFGGEKETLVDAAKYVDQYTTADIIDINMGCPVPKIVKCDA
FT                   GAKWLLDPNKIYEMVAAVVDAVEKPVTVKMRIGWDEDHIFAIENAKAVERAGGQVVAVH
FT                   GRTRVQMYEGKADWDIIKQVKQAVNIPVIGNGDVATPQDAKRMLDEIGVDGVMIGRAAL
FT                   GDPWMIYRTVKYLETGELMPEPTVREKIDVCMLHLDRLIDLKNESVAVREMRKHAAWYL
FT                   KGIRGNANVRNGINACNTREDLANVLGVFVEEVEAKQQTIHVG"
FT   gene            80552..82051
FT                   /locus_tag="BAS0076"
FT   CDS_pept        80552..82051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0076"
FT                   /product="lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52414"
FT                   /db_xref="GOA:Q81VW3"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VW3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52414.1"
FT                   /translation="MDNMNHEELNDQLLVRREKLHNLREQGIDPFGKRFERTNATNDLL
FT                   SLYGEFSKEELEEKEISVSIAGRIMTKRGKGKAGFAHIQDLHGQVQIYVRKDAVGDEEY
FT                   ELFKTADLGDLVGIEGKVFKTNVGELSVKATGFTLLTKSLRPLPDKYHGLKDVEQRYRQ
FT                   RYLDLITSMESRETFVTRSKIIREMRRYLDDNGYLEVETPMMHAIAGGASARPFITHHN
FT                   ALDMELYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADY
FT                   KDIMKLTENMVAHIAKQVLGTTTIQYGDYEINLEPEWTRLHMVDAIKEHSGADFWNPMS
FT                   VEEARELAKEHNVEIKDTMEVGHIINEFFEQKVEDKLIQPTFIYGHPVEISPLAKKNDE
FT                   DPRFTDRFELFIVAREHANAFTELNDPIDQKERFEAQLKEREQGNDEAHMMDDDYIEAL
FT                   EYGMPPTGGLGIGIDRLVMLLTNAPSIRDVLLFPAMRHKQD"
FT   gene            82452..83961
FT                   /locus_tag="rRNA-16s-3"
FT   rRNA            82452..83961
FT                   /locus_tag="rRNA-16s-3"
FT                   /product="16S ribosomal RNA"
FT   gene            84197..87047
FT                   /locus_tag="rRNA-23s-3"
FT   rRNA            84197..87047
FT                   /locus_tag="rRNA-23s-3"
FT                   /product="23S ribosomal RNA"
FT   gene            87094..87212
FT                   /locus_tag="rRNA-5s-3"
FT   rRNA            87094..87212
FT                   /locus_tag="rRNA-5s-3"
FT                   /product="5S ribosomal RNA"
FT   gene            87416..87877
FT                   /locus_tag="BAS0078"
FT   CDS_pept        87416..87877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0078"
FT                   /product="transcriptional regulator CtsR"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52415"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52415.1"
FT                   /translation="MRNISDIIEQYLKQVIDLSNNNVIEIKRNEIADRFECVPSQINYV
FT                   INTRFTLERGFVVESKRGGGGYIRIIKVKLHDDIDIIDQMLHMIDHSVAQGNAESMIIR
FT                   LIEEGIITNREAKLMLSVLDRSVLSMDVPSRDELRARILCAMLRTLKYK"
FT   gene            88051..88599
FT                   /locus_tag="BAS0079"
FT   CDS_pept        88051..88599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0079"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52416"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52416.1"
FT                   /translation="MTCQNCNIRPATLHYTKVINEKKAEVHLCEQCAEQSGYTSFFQSS
FT                   QSNFSFHDLFAGLLHGESTMFEEGKNGFSNTSILRCPDCKMTYEQFTKVGRFGCASCYD
FT                   TFKEHLKPLLKRLHGGHTDHCGKIPERIEGNIHLKKELDELKLILKQYVQKEEFEKAAE
FT                   VRDKIRNLENQLSEYREGE"
FT   gene            88604..89668
FT                   /locus_tag="BAS0080"
FT   CDS_pept        88604..89668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0080"
FT                   /product="phosphotransferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52417"
FT                   /db_xref="GOA:Q81VW0"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VW0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52417.1"
FT                   /translation="MSLDKIMNEAISPWMKGDGPDSDIVLSSRIRLARNFKKYQFSTMQ
FT                   NEEETKQIQELFKKEFINKTVEPFGEFELLKMNELTPLQRRVLVEKHLISPNLAGTEYG
FT                   ACLLSESEHISVMLNEEDHIRIQCLFSGLQLSEALQSANQIDNWIEKEVEYAFDESLGY
FT                   ITSCPTNVGTGLRASVMIHLPGLVLTKRISRIIQVIQKLGLVVRGIYGEGSEALGNIFQ
FT                   VSNQMTLGKSEEDIIADLKSVIQQIIQQEKMARELIVQNSSIELEDKVYRSYGILANSR
FT                   LIQSAEAANCLSDLRLGIDLGYIQGISRNILTELMVLTQPGILQQYAGGPLGPEERDYR
FT                   RATLIRERLRIEKN"
FT   gene            89691..92126
FT                   /locus_tag="BAS0081"
FT   CDS_pept        89691..92126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0081"
FT                   /product="negative regulator of genetic competence
FT                   ClpC/MecB"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52418"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52418.1"
FT                   /translation="MMFGRFTERAQKVLALSQEEAIRIGHNNIGTEHILLGLVREGEGI
FT                   AAKALIALGLSPEKVQKEVEALIGRGTEASQTVHYTPRAKKVIELSMDEARKLGHSYVG
FT                   TEHILLGLIREGEGVAARVLNNLGVSLNKARQQVLQLLGSNEASSGHQGGSSTNANTPT
FT                   LDSLARDLTVVARENRLDPVIGRGKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGL
FT                   AQQIVNNEVPETLRDKRVMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNIILFIDE
FT                   LHTLIGAGGAEGAIDASNILKPSLARGELQCIGATTLDEYRKYIEKDAALERRFQPIHV
FT                   DEPSLDESTQILKGLRDRYEAHHRVSITDDAIDAAVKLSDRYITDRFLPDKAIDLIDEA
FT                   ASKVRLRSYTTPPNLKELEVKLEEIRKEKDAAVQSQEFEKAASLRDMEQRLREKLEDTK
FT                   RQWKEQQGKENSEVTVEDIANVVSTWTRIPVSKLAQTETDKLLNLESILHDRVIGQDEA
FT                   VVAVAKAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARALAESMFGDEDAMIRIDMS
FT                   EYMEKHSTSRLVGSPPGYVGYEEGGQLTEKVRRKPYSVVLLDEVEKAHPDVFNILLQVL
FT                   EDGRLTDSKGRTVDFRNTIVIMTSNVGAEALKRNKHLGFNVQDESRDYSDMKGKVMDEL
FT                   KKAFRPEFLNRIDEIIVFHMLEKKHIQEIVTLMVNQLVNRLKEQEIELHLTEGAISAIA
FT                   DKGFDREYGARPLRRAIQKHVEDRLSEELLKGAIEKGQKVIFDVEGESFVIHSAEKVK"
FT   gene            92223..93599
FT                   /locus_tag="BAS0082"
FT   CDS_pept        92223..93599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0082"
FT                   /product="DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52419"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52419.1"
FT                   /translation="MAKKKTKFTCQECGYQSPKYMGKCPGCGQWNTLVEEMEPVVSSRR
FT                   LNYANAIQTEVTKPRRLTEVETKSEARIETKFQEFNRVLGGGIVDGSLVLIGGDPGIGK
FT                   STLLLQISSQLADSSYDVLYISGEESAKQIKLRADRLHVNGSNLFVVSETDLQRIATHI
FT                   EEMNPAFVVIDSIQTIHLPEVTSAPGSVAQVRECTAELMKLAKTKGIPIFIVGHVTKEG
FT                   AIAGPRMLEHMVDAVLYFEGDRHHTYRILRAVKNRFGSTNEMGIFEMKELGLAEVLNPS
FT                   EIFLEERPVGVAGSTVVASMEGTRPVLVEIQALISPTSFGNPRRMATGIDHNRVSLIMA
FT                   VLEKRTGLLLQNQDAYLKVAGGLKLDEPAIDLAVALSIASSFRDKSTAPTDAVIGEVGL
FT                   TGEIRRVSRIEQRVQEAAKLGFQRAIIPRKNLGGWTIPDGIEVVGVSNLGEALRLTLGG
FT                   "
FT   gene            93603..94676
FT                   /locus_tag="BAS0083"
FT   CDS_pept        93603..94676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0083"
FT                   /product="DNA-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52420"
FT                   /db_xref="GOA:Q81VV7"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VV7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52420.1"
FT                   /translation="MEENKQRVKSMINILQLVAPGTPLREGIDNVLRAQTGGLIVLGYN
FT                   EQIKSIVDGGFHINCAFSPASLYELAKMDGALILNETGSKILIANAQLVPESSIDSIET
FT                   GMRHRTAERVAKQTGSLVVAISQRRNVITLYQGNLRYTLKDIGVILTKANQAIQTLEKY
FT                   KAVWNDGITNLGILEFEEVVTMSEVVHVLHSVEMVLRIKNEILSYIHELGTEGRLIRLQ
FT                   LTELLADLEAEAALLIKDYYQEKTQDHHQILKKLQELANTQLLEDSDLVKLLGYPGQTS
FT                   LEESVTPRGYRITSKISRVPPLIIENLINRFKTLQGVCRATINELDDVEGIGEVRAKKI
FT                   REGLKRIQEHLYMSRHN"
FT   gene            94837..95946
FT                   /locus_tag="BAS0084"
FT   CDS_pept        94837..95946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0084"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52421"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52421.1"
FT                   /translation="MLKRIVQLFFLVIGGALGIYLIPKVINVLDIGAVPLLEGSYVRAI
FT                   IGAIILFLTTFWLVDYIVQLIKHIEEALVKAPVADVLFGTLGLISGLIVAYLILIPIRE
FT                   FTIPVISTVLQVFFTLLLGYLGFQVGFKKRNELLGLFTLPQRGKKKNNNSENEEPENEV
FT                   EESLAHWKILDTSVIIDGRIADICQTKFLEGTIVIPQFVLEELQHIADSSDALKRNRGR
FT                   RGLDILNRIQKEMPIPVEIYEGDFDDIQEVDSKLVKLAKITGGTVVTNDFNLNKVSELQ
FT                   GVTVLNINDLANAIKPVVLPGEELSVYVVKDGKEQNQGVAYLDDGTMIVVEDGREYVGS
FT                   QLDVLVTSVLQTSAGRMIFAKRKLLEKAL"
FT   gene            95963..96643
FT                   /locus_tag="BAS0085"
FT   CDS_pept        95963..96643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0085"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52422"
FT                   /db_xref="GOA:Q81VV5"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VV5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52422.1"
FT                   /translation="MYTLIIPAAGQGKRMGAGKNKLFLLINEVPIIVHTLRAFEKDKAC
FT                   KNIIMAINEEERPYFEELMQKYPVEKPVQFIQGGAERQDSVYNAIQHTTDVEYVLVHDG
FT                   ARPFVTNKVIQDVLTAAEKYGASICAVPVKDTVKKVEQGVVVETVERSQLKAVQTPQGF
FT                   SVSLLLEAHRSAKQSCFLGTDDASLVERIGKQVGVVEGSYYNIKVTTPEDLLIAESFLH
FT                   VQKK"
FT   gene            96758..97234
FT                   /locus_tag="BAS0086"
FT   CDS_pept        96758..97234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0086"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52423"
FT                   /db_xref="GOA:Q81VV4"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VV4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52423.1"
FT                   /translation="MFRIGQGFDVHEFAEGRPLIIGGITIPHEKGLIGHSDADVLLHTI
FT                   ADACLGAIAAGDIGKHFPDTDPAFKDADSAVLLQKVWEFVREQGYELGNLDCTIIAQKP
FT                   KMAPHIESMRKRISELLETSIDNINVKATTTEKLGFTGREEGIASQAVVLLQKK"
FT   gene            97324..98781
FT                   /locus_tag="BAS0087"
FT   CDS_pept        97324..98781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0087"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52424"
FT                   /db_xref="GOA:Q81VV3"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VV3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52424.1"
FT                   /translation="MEKQVRVRYAPSPTGHLHIGNARTALFNYLFARHQDGKFIIRIED
FT                   TDVKRNVAGGEESQLKYLKWLGMDWDEGVDVGGEFGPYRQTERLDIYKKLYEDLLERGL
FT                   AYKCYMTEEELEAEREGQIARGETPRYAGNHRDLTEAQVKEFEAEGRIPSIRFRVPADR
FT                   DYTFKDIVKDEVAFHSNDFGDFVIVKKDGIPTYNFAVAVDDHLMEITHVLRGDDHISNT
FT                   PKQMMIYEAFGWDIPQFGHMTLIVNESRKKLSKRDESIIQFIEQYKELGYLPEAIFNFI
FT                   ALLGWSPVGEEEIFSQEEFIKMFDAARLSKSPALFDSQKLKWMNNQYMKKQDLDTVVEL
FT                   SLPHLVKAGRIGETLSEQEQAWIRDVIALYHEQMSFGAEIVELSEMFFKDHVDYEEEGQ
FT                   EVLKGEQVPEVLRAFAGQVEALEAMEPAAIKAAIKAVQKETGHKGKNLFMPIRVATTGQ
FT                   THGPELPNAIALLGKEKVLNRLQKVIG"
FT   gene            99214..99879
FT                   /locus_tag="BAS0088"
FT   CDS_pept        99214..99879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0088"
FT                   /product="serine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52425"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52425.1"
FT                   /translation="MFKRLREDIEVVFEQDPAARSYFEVILTYSGLHAVWAHRIAHAFY
FT                   KKNFFFIARWISQVSRFFTGIEIHPGATIGRRFFIDHGMGVVIGETCEIGDNVTIYQGV
FT                   TLGGTGKEKGKRHPTIQDNVLIATGAKVLGSITVGENSKIGAGSVVLKEVPAHSTVVGI
FT                   PGRVVIQNGVKIGQELNHSDLPDPIFDKLKVMEVELDKLKKQLEVKVERKDKNDYSHL"
FT   gene            99860..101257
FT                   /locus_tag="BAS0089"
FT   CDS_pept        99860..101257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0089"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52426"
FT                   /db_xref="GOA:Q81VV1"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VV1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52426.1"
FT                   /translation="MTIHIYNTLTRQKEEFTPLEENKVKMYVCGPTVYNYIHIGNARPP
FT                   MVFDTVRRYLEYKGYDVQYVSNFTDVDDKLIKAANELGEDVPTIADRFVEAYFEDVTAL
FT                   GCKHATVHPRVTENMDIIIEFIQELVNKGYAYESEGDVYFRTKEFEGYGKLSHQPIADL
FT                   RHGARIEVGEKKQDPLDFALWKAAKEGEIFWESPWGQGRPGWHIECSAMARKYLGDTID
FT                   IHAGGQDLAFPHHENEIAQSEALTGKTFARYWMHNGYININNEKMSKSLGNFILVHDII
FT                   KQYDPQLIRFFMLSVHYRHPINFSEELLQSTNNGLERIKTAYGNLKHRMESSTDLTDHN
FT                   EKWLADLEKFQTAFEEAMNDDFNTANAITELYNVANHANQYLLEEHTSTVVIEAYVKQL
FT                   ETLFDILGLELAQEELLDEEIEALIQKRIEARKNRDFALSDQIRDDLKDRNIILEDTAQ
FT                   GTRWKRG"
FT   gene            101260..101667
FT                   /locus_tag="BAS0090"
FT   CDS_pept        101260..101667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0090"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52427"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52427.1"
FT                   /translation="MIDAKQLNSLALAYMGDAVYEQYIRYHLLQKGKVRPNQLHRLGTS
FT                   FVSAKAQAKVVYHLLETAFLTEEEEAVLRRGRNANSGTVPKNTDVQTYRHSTAFEALIG
FT                   YHHLLNNRERLDEIVYKAIAVLEEKEGGTSS"
FT   gene            101664..102407
FT                   /locus_tag="BAS0091"
FT   CDS_pept        101664..102407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0091"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52428"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52428.1"
FT                   /translation="MSSEYIIGRNPVIEALRSGRDINKIWIAEGAAKGQVQIVLALAKE
FT                   NKIILQHAPKKKLDQLVEGNHQGVIAQVAAYQYAELEDLFKVAEKRNEDPFFLILDEIE
FT                   DPHNLGSIMRTADATGAHGIIIPKRRAVGLTASVAKASTGAIEYIPVARVTNLSRTIDE
FT                   LKERGLWIAGTDAKGKTDYRNLDGKMPIGLVIGSEGKGMSRIIGEKCDFLITLPMVGKV
FT                   TSLNASVAASLLMYEVYRKRNEIGK"
FT   gene            102411..102923
FT                   /locus_tag="BAS0092"
FT   CDS_pept        102411..102923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0092"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52429"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52429.1"
FT                   /translation="MNDILIVDGYNIIGAWGDLKKLRDVDLQSSRDALIDKMADYQGYT
FT                   GTKVMIVFDAYTVHGIEKKMKQSRVEVIFTRKNQTADEKIEQLAIELRNINTQIYVATS
FT                   DYTEQWVIFAQGALRKSARELELEVQAMEQQVRRRTQDTKEKQPAMRKIFSKDITEKLE
FT                   KLRRGER"
FT   gene            102991..103647
FT                   /locus_tag="BAS0093"
FT   CDS_pept        102991..103647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0093"
FT                   /product="RNA polymerase sigma-30 factor"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52430"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52430.1"
FT                   /translation="MEAGFVSVGDVTFRDLEDEAIVELVRKGNTDALEYLIHKYKNFVR
FT                   AKSRSYFLVGADREDIVQEGMIGLFKAIRDYKEDKLSSFKAFAELCITRQIITAIKTAT
FT                   RQKHIPLNSYVSLDKPIYDEESDRTLLDVISEAKVTDPEEMIISQEEYTDIESKISELL
FT                   SDLERKVLSLYLDGRSYQEISEQLNRHVKSIDNALQRVKRKLERYMEMRESTTSN"
FT   gene            103779..103925
FT                   /locus_tag="BAS0094"
FT   CDS_pept        103779..103925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0094"
FT                   /product="ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52431"
FT                   /db_xref="GOA:Q81VU6"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VU6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52431.1"
FT                   /translation="MRKKVVLSCEECKNRNYSTMKDTSSVERLEIKKFCKTCNQHTVHK
FT                   ETK"
FT   gene            103958..104137
FT                   /locus_tag="BAS0095"
FT   CDS_pept        103958..104137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0095"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52432"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52432.1"
FT                   /translation="MRLTNFFGDVGREMKKVSWPKKDELLRSTATVIATVVFFAIFFAV
FT                   VDMGISSLIRLILG"
FT   gene            104269..104802
FT                   /locus_tag="BAS0096"
FT   CDS_pept        104269..104802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0096"
FT                   /product="transcription antitermination protein NusG"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52433"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52433.1"
FT                   /translation="MEKSWYVVHTYSGYENKVKANLEKRVESMGMQDKIFRVVVPEEVE
FT                   VEMKNGKEKLMKRKVFPGYVLVELIMTDDSWYVVRNTPGVTGFVGSSGSGSKPSPLLEE
FT                   EVVTIMKHMGMDNEVVDFDFELHETVRVNEGPFADYTGAIEEIDVEKKKVSVLVDMFGR
FT                   ETPVELDFHQIEKL"
FT   gene            104970..105395
FT                   /locus_tag="BAS0097"
FT   CDS_pept        104970..105395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0097"
FT                   /product="ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52434"
FT                   /db_xref="GOA:Q81VU3"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VU3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52434.1"
FT                   /translation="MAKKVIKMVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNAR
FT                   TADQAGLIIPVEITVFEDRSFTFITKTPPAAVLLKKVAGIESGSGEPNRNKVATVKRDK
FT                   VREIAETKMPDLNAASVEAAMRMVEGTARSMGIVIED"
FT   gene            105573..106265
FT                   /locus_tag="BAS0098"
FT   CDS_pept        105573..106265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0098"
FT                   /product="ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52435"
FT                   /db_xref="GOA:Q81VU2"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VU2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52435.1"
FT                   /translation="MAKRGKKYVEAAKLVDRAAAYSATEAVELVKKTNTAKFDATVEAA
FT                   FRLGVDPKKADQQIRGAVVLPHGTGKVQRVLVFAKGEKAKEAEAAGADFVGDADYIGKI
FT                   QQGWFDFDVVVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTFDVTKAVNEIKAGKVEY
FT                   RVDKAGNIHVPIGKVSFEDAKLVENFRTIADTLQKVKPAAAKGTYMKNVTVASTMGPGV
FT                   RVDVSTLA"
FT   gene            106498..106998
FT                   /locus_tag="BAS0099"
FT   CDS_pept        106498..106998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0099"
FT                   /product="ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52436"
FT                   /db_xref="GOA:Q81VU1"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VU1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52436.1"
FT                   /translation="MSKVIETKQQVVTEIADKLRASKSTIVVDYRGLTVSEATELRKQL
FT                   REAGVEFKVYKNSLTRRAAESAEMAELNEFLTGPNAIAFSNEDVVAPAKVLNDFAKDHE
FT                   ALEIKAGVIEGKLVTLDEVKAIATLPSREGLLSMLLSVLQAPIRNLALATKAVADQKEE
FT                   QGA"
FT   gene            107066..107425
FT                   /locus_tag="BAS0100"
FT   CDS_pept        107066..107425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0100"
FT                   /product="ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52437"
FT                   /db_xref="GOA:Q81VU0"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VU0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52437.1"
FT                   /translation="MTKEQIIEAVKSMTVLELNDLVKAIEEEFGVTAAAPVAVAGGAGE
FT                   AAAEKTEFDVELTSAGAQKIKVIKVVREITGLGLKEAKELVDNTPKVIKEAAAKEEAEE
FT                   IKAKLEEVGAAVEVK"
FT   gene            107500..108099
FT                   /locus_tag="BAS0101"
FT   CDS_pept        107500..108099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0101"
FT                   /product="ybxB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52438"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52438.1"
FT                   /translation="MADHYFSNDPSSKSDRKRWEFTLRGSRFTFLSDRGVFSKNEVDFG
FT                   SRLLIEAFQVPDIKGDILDVGCGYGPIGLSLAKEFQDRKVHMVDVNERALELAKENAAN
FT                   NRIGNVHIFQSSVYENVDGMYAAILSNPPIRAGKDIVHEILEKAVEHLVPGGELWIVIQ
FT                   KKQGAPSALKKLEEVFSEVEVVEKKKGYYIIKSKKR"
FT   gene            108392..111925
FT                   /locus_tag="BAS0102"
FT   CDS_pept        108392..111925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0102"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52439"
FT                   /db_xref="GOA:Q81VT8"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VT8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52439.1"
FT                   /translation="MTGQLVQYGRHRQRRSYARISEVLELPNLIEIQTSSYQWFLDEGL
FT                   REMFQDISPIEDFTGNLSLEFIDYSLGEPKYSVDECKERDVTYAAPLRVKVRLINKETG
FT                   EVKEQDVFMGDFPLMTETGTFVINGAERVIVSQLVRSPSVYYSGKVDKNGKRGFTATVI
FT                   PNRGAWLEYETDAKDVVYVRIDRTRKLPVTVLLRALGFGSDQEITELLGDNEYLSNTLE
FT                   KDNTDSTEKALLEIYERLRPGEPPTVENAKSLLVSRFFDPKRYDLANVGRYKINKKLHI
FT                   KNRLFNQRLAETLVDPETGEILAAEGTILDRRTLDRILPYLEKNIGFKTAKPMGGVVEG
FT                   DVELQSIKIYAPESEGERVINVIGNANITRDVKHITPGDILASISYFFNLLYKVGDTDD
FT                   IDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQDTNAITPQALINIRPVIAAIK
FT                   EFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLTRERAGFEVRDVHYSHYGRMCPIE
FT                   TPEGPNIGLINSLSSFAKVNEFGFIETPYRRVDPETGLVTGHVDYLTADEEDNYVVAQA
FT                   NMKLSEEGEFLDEDIVARFRGENIVTNKERIDYMDVSPKQVVSAATACIPFLENDDSNR
FT                   ALMGANMQRQAVPLMNPESPIVGTGMEYVSAKDSGAAVICKHPGIVERVEAREVWVRRY
FT                   VEVDGQTVKGDLDRYKMQKFIRSNQGTCYNQRPIVSVGNEVVKGEILADGPSMELGELA
FT                   LGRNVLVGFMTWDGYNYEDAIIMSERLVKDDVYTSIHIEEYESEARDTKLGPEEITRDI
FT                   PNVGEDALRNLDERGIIRVGAEVKDGDLLVGKVTPKGVTELTAEERLLHAIFGEKAREV
FT                   RDTSLRVPHGGGGIILDVKVFNREDGDELPPGVNQLVRAYIVQKRKISEGDKMAGRHGN
FT                   KGVISRILPEEDMPYLPDGTPIDIMLNPLGVPSRMNIGQVLELHLGMAARYLGIHIATP
FT                   VFDGAREEDVWGTIEEAGMANDAKTILYDGRTGEPFDNRVSVGVMYMIKLAHMVDDKLH
FT                   ARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVKSDDVIGRVK
FT                   TYEAIVKGENVPEPGVPESFKVLIKELQSLGMDVKMMSSDDTEIEMRDTEDDDDHQSAD
FT                   KLNVEVETTKE"
FT   gene            111963..115574
FT                   /locus_tag="BAS0103"
FT   CDS_pept        111963..115574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0103"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52440"
FT                   /db_xref="GOA:P77819"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:P77819"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52440.1"
FT                   /translation="MIDVNNFEYMKIGLASPDKIRSWSYGEVKKPETINYRTLKPEKDG
FT                   LFCERIFGPQKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLVLDMSPRALEEVIYFASYVVTESGDTPLDKKQLLSEKEYRAYRDRYG
FT                   STFQAAMGAEAIKKLLQDIDLDKEVDFLKEELKTAQGQRRTRAIKRLEVLEAFRNSGNE
FT                   PSWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVEKGLAHNIKSAKRKIERVQPEVWD
FT                   VLESVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVH
FT                   VPLSSEAQAEARLLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLEREGAIGEGMVFK
FT                   DANEALLAYQNGYVHLHTRVAVAASAVNNVTFTEEQKNMLLLTTVGKLIFNEILPESFP
FT                   YINEPTNSNLEKETPAKYFVEKGANIKEIIASREEVAPFSKKILGNIIAEVFKRFKITE
FT                   TSRMLDRMKNLGFKYSTKAGITVGVSDILVLGEKDEILHEAQAKVDNVIKQFRRGLITE
FT                   EERYDRVISIWSNAKDVIQGKLMKSLNKRNPIFMMSDSGARGNASNFTQLAGMRGLMAN
FT                   PSGRIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVI
FT                   VREDDCGTDRGLLIGAIKEGNEVIESLYDRLVGRFARKTVKHPETGEVLVAENQLITED
FT                   IAHIVENSGVETVNIRSAFTCNTRHGVCKKCYGRNLATGTDVEVGEAVGIIAAQSIGEP
FT                   GTQLTMRTFHTGGVAGDDITQGLPRIQEIFEARNPKGQAVISEIDGVIAAINDVKDRQE
FT                   VVVQGEVEARTYAIPYGARLKVIPGQKISHGKELTEGSIDPKELLKVTDITAVQEYLLR
FT                   EVQKVYRMQGVEIGDKHVEVMVRQMLRKVRVSDAGETDVLPGTLLDIHQFTDANAKVLL
FT                   QGKQPATARPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVII
FT                   GKLVPAGTGMNRYRKVDLVKTTQDDMNVENDEVYVEQ"
FT   gene            115655..115936
FT                   /locus_tag="BAS0104"
FT   CDS_pept        115655..115936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0104"
FT                   /product="ribosomal protein L7A family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52441"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52441.1"
FT                   /translation="MLLNDALEDIYMSYQKVSNAENVVVGHKRTLEAIKNGIVKEVVIA
FT                   EDADMRLTHVIIRTALQHNIPITKVESVRKLGKVAGIQVGASAIGIIS"
FT   gene            116051..116473
FT                   /locus_tag="BAS0105"
FT   CDS_pept        116051..116473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0105"
FT                   /product="ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52442"
FT                   /db_xref="GOA:Q81VT5"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VT5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52442.1"
FT                   /translation="MPTINQLVRNGRTDKVWKSKSPALNKGFNSLKKKSTDISAPQKRG
FT                   VCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIVRGALDTAGVDKRMQGRSKYGTKKPKAAKK"
FT   gene            116503..116973
FT                   /locus_tag="BAS0106"
FT   CDS_pept        116503..116973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0106"
FT                   /product="ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52443"
FT                   /db_xref="GOA:Q81VT4"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VT4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52443.1"
FT                   /translation="MPRKGPVAKRDVLPDPMYNSKLVTRLINKMMVDGKKGKSQTILYN
FT                   AFDIVSERTGKEPMEVFEQALKNIMPVLEVRARRVGGANYQVPVEVRPERRTTLGLRWL
FT                   VNYARLRGEKTMEERLANEILDAANNAGASVKKREDTHKMAEANKAFAHYRW"
FT   gene            117181..119259
FT                   /locus_tag="BAS0107"
FT   CDS_pept        117181..119259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0107"
FT                   /product="translation elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52444"
FT                   /db_xref="GOA:Q81VT3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VT3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52444.1"
FT                   /translation="MAREFSLENTRNIGIMAHIDAGKTTATERILYYTGRIHKIGETHE
FT                   GASQMDWMEQEQERGITITSAATTAQWKGHRVNIIDTPGHVDFTVEVERSLRVLDGAVA
FT                   VLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKIGADFLYSVGTIHDRLQANAHPIQ
FT                   LPIGAEDEFNGIIDLVEECAYMYGNDLGTDIQRVEIPEEHKELAEEYRGKLIEAVAELD
FT                   EEMMMKYLEGEEITVEELKAGIRKATTSVEFFPVICGSAFKNKGVQILLDAVIDYLPSP
FT                   LDVPAIKGIVPDTDEEVERKSSDEEPFAALAFKIMTDPYVGKLTFFRVYSGVLNSGSYV
FT                   KNSTKGKRERVGRILQMHANSREEISTVYAGDIAAAVGLKDTTTGDTLCDEKSLVILES
FT                   MEFPEPVISVAIEPKSKADQDKMGTALSKLSEEDPTFRAHTDQETGQTIIAGMGELHLD
FT                   IIVDRMRREFKVEANVGAPQVAYRETFRAAAKVEGKFARQSGGRGQFGHVWIEFEPNEE
FT                   GKGFEFENKIVGGVVPREYIPAVGAGLEDALKNGVLAGYPVVDIKAALVDGSYHDVDSS
FT                   EMAFKIAASMALKAAVSKCNPVILEPMMKVEVVIPEEYMGDIMGDVTSRRGRVEGMEAR
FT                   GNAQVVRAMVPLSEMFGYATSLRSNTQGRGTFSMVFDHYEEVPKSVSEEIIKKNKGE"
FT   gene            119377..120564
FT                   /locus_tag="BAS0108"
FT   CDS_pept        119377..120564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0108"
FT                   /product="translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52445"
FT                   /db_xref="GOA:Q81VT2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VT2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52445.1"
FT                   /translation="MAKAKFERSKPHVNIGTIGHVDHGKTTLTAAITTVLAKAGGAEAR
FT                   GYDQIDAAPEERERGITISTAHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGGIL
FT                   VVSAADGPMPQTREHILLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYGF
FT                   PGDDIPVIKGSALKALQGEADWEAKIIELMAEVDAYIPTPERETDKPFLMPVEDVFSIT
FT                   GRGTVATGRVERGIVKVGDVVEIIGLAEENASTTVTGVEMFRKLLDQAQAGDNIGALLR
FT                   GVAREDIQRGQVLAKSGSVKAHAKFKAEVFVLSKEEGGRHTPFFANYRPQFYFRTTDVT
FT                   GIIQLPEGTEMVMPGDNIEMTIELIAPIAIEEGTKFSIREGGRTVGYGVVATIVE"
FT   gene            120963..121271
FT                   /locus_tag="BAS0109"
FT   CDS_pept        120963..121271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0109"
FT                   /product="ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52446"
FT                   /db_xref="GOA:Q81VT1"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VT1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52446.1"
FT                   /translation="MAKEKIRIRLKAYDHRILDQSADKIVETAKRSGATVSGPIPLPTE
FT                   KTVYTILRAVHKYKDSREQFEMRTHKRLIDIVSPTPQTVDSLMRLDLPSGVDIEIKL"
FT   gene            121306..121938
FT                   /locus_tag="BAS0110"
FT   CDS_pept        121306..121938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0110"
FT                   /product="ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52447"
FT                   /db_xref="GOA:Q81VT0"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VT0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52447.1"
FT                   /translation="MTKGILGRKIGMTQVFAENGELIPVTVIAANPNVVLQKKTTETDG
FT                   YNAIQLGFEDKREKLTNKPEQGHTAKASTTPKRFIREIRDADVDGLEVGQEVKVDVFAT
FT                   GEIVDVTGISKGKGFQGVIKRHGQSRGPMSHGSRYHRRPGSMGPVAPNRVFKGKKLAGR
FT                   MGGDQVTIQNLEIVQVDTERNLLLVKGNVPGAKKSLVVVQGAVKVSK"
FT   gene            121964..122587
FT                   /locus_tag="BAS0111"
FT   CDS_pept        121964..122587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0111"
FT                   /product="ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52448"
FT                   /db_xref="GOA:Q81VS9"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VS9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52448.1"
FT                   /translation="MPKVTVYNQTGSQVGEIELAEAIFGIEPNEAVLFEAVMMQRASLR
FT                   QGTHKVKTRSEVRGGGRKPWRQKGTGRARQGSIRSPQWRGGGTVFGPTPRSYAYKLPKK
FT                   VRRLAIKSALATKVVENNIVVLEDLVLNAPKTKDMLAVLKGLTVEKKALIVTADANESV
FT                   ELSARNIPGVTVITADGVNVLDVLHHDKLIMTKAAVEKVEEVLA"
FT   gene            122587..122877
FT                   /locus_tag="BAS0112"
FT   CDS_pept        122587..122877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0112"
FT                   /product="ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52449"
FT                   /db_xref="GOA:Q81VS8"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VS8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52449.1"
FT                   /translation="MRDPRDIIKRPVITERSMEMMAEKKYTFDVDVKSNKTEVKDALEA
FT                   IFGVKVEKVNIMNYKPKAKRVGRHAGFTSRRRKAIVKLTADSKEIEIFQGV"
FT   gene            122906..123736
FT                   /locus_tag="BAS0113"
FT   CDS_pept        122906..123736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0113"
FT                   /product="ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52450"
FT                   /db_xref="GOA:Q81VS7"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VS7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52450.1"
FT                   /translation="MGIKKYNPTTNGRRNMTTNDFAEITTDRPEKSLLAPLSKKAGRNN
FT                   QGKITVRHQGGGHKRQYRIIDFKRNKDGIPGRVATIEYDPNRSANIALINYVDGEKRYI
FT                   LAPKNLEVGMEIMSGAEADIKIGNALPLINIPVGTVVHNIELKPGRGGQLVRSAGTSAQ
FT                   VLGKEGKYVLVRLTSGEVRLVLSACRATVGQVGNESHELIKIGKAGRSRWLGKRPTVRG
FT                   SVMNPVDHPHGGGEGRSPIGRKSPMSPWGKPTLGFKTRKKNKASDKFIVRRRKK"
FT   gene            123797..124075
FT                   /locus_tag="BAS0114"
FT   CDS_pept        123797..124075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0114"
FT                   /product="ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52451"
FT                   /db_xref="GOA:Q81VS6"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VS6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52451.1"
FT                   /translation="MARSLKKGPFVDDHLMSKIAKLNETEQKQVVKTWSRRSTIFPQFI
FT                   GHTIAVYDGRKHVPVYVTEDMVGHKLGEFAPTRTYKGHDADDKKTRR"
FT   gene            124093..124434
FT                   /locus_tag="BAS0115"
FT   CDS_pept        124093..124434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0115"
FT                   /product="ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52452"
FT                   /db_xref="GOA:Q81VS5"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VS5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52452.1"
FT                   /translation="MQAKAVARTVRIAPRKVRLVVDLIRGKQVGEAIAILNHTPKTASP
FT                   VVEKVLKSAIANAEHNYEMDINSLVVEKVFVDEGPTLKRFRPRAMGRASQINKRTSHIT
FT                   VVVSEKKEG"
FT   gene            124438..125097
FT                   /locus_tag="BAS0116"
FT   CDS_pept        124438..125097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0116"
FT                   /product="ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52453"
FT                   /db_xref="GOA:Q81VS4"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VS4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52453.1"
FT                   /translation="MGQKVNPIGLRVGVIRDWESRWFAEKDYATLLHEDIKIREYINVR
FT                   LKDSAVAKVEIERAANRVNVTIHTAKPGMVIGKGGTEVEALRKALNQLTGKRVHINILE
FT                   VKRADLNAKLVGENIARQLENRVSFRRAQKQVIQRAMRAGAKGIKTQVSGRLGGADIAR
FT                   AESYSEGTVPLHTLRADIDYAAVEADTTYGKLGVKVWIYRGEVLPTKKKASEEGGK"
FT   gene            125099..125533
FT                   /locus_tag="BAS0117"
FT   CDS_pept        125099..125533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0117"
FT                   /product="ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52454"
FT                   /db_xref="GOA:Q81VS3"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VS3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52454.1"
FT                   /translation="MLMPKRVKYRREHRGKMRGRAKGGTEIAFGEFGLQAQAASWITNR
FT                   QIEAARRAMTRYMKRGGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKIMF
FT                   EIAGVSEEVAREALRLAAHKLPVKCKFVKREENGGESNEN"
FT   gene            125523..125723
FT                   /locus_tag="BAS0118"
FT   CDS_pept        125523..125723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0118"
FT                   /product="ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52455"
FT                   /db_xref="GOA:Q81VS2"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VS2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52455.1"
FT                   /translation="MKTNDIRELTTAEIETKVKALKEELFNLRFQLATGQLENPTRIRE
FT                   VRKAIARMKTVVREREIGINR"
FT   gene            125744..126007
FT                   /locus_tag="BAS0119"
FT   CDS_pept        125744..126007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0119"
FT                   /product="ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52456"
FT                   /db_xref="GOA:Q81VS1"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VS1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52456.1"
FT                   /translation="MSERNQRKVYTGRVVSDKMDKTITVLVETYKTHSLYGKRVKYSKK
FT                   YKAHDEQNQAKLGDIVKIMETRPLSATKRFRLVEIVEEAVII"
FT   gene            126051..126419
FT                   /locus_tag="BAS0120"
FT   CDS_pept        126051..126419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0120"
FT                   /product="ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52457"
FT                   /db_xref="GOA:Q81VS0"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VS0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52457.1"
FT                   /translation="MIQQESRLKVADNSGARELLTIKVLGGSGRKYANIGDIIVATVKQ
FT                   ATPGGVVKKGDVVKAVVVRTKSGARRPDGSYIKFDENAAVIIKDDKSPRGTRIFGPVAR
FT                   ELRDSNFMKIVSLAPEVL"
FT   gene            126458..126769
FT                   /locus_tag="BAS0121"
FT   CDS_pept        126458..126769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0121"
FT                   /product="ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52458"
FT                   /db_xref="GOA:Q81VR9"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VR9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52458.1"
FT                   /translation="MHVKKGDKVQVITGKDKGKQGVILVAFPKQNRVIVEGVNIVKKHS
FT                   KPSQLNPQGGIITKEAPIHVSNVMILDPKTGEPTRVGFKVEDGKKVRIAKKSGELLDK"
FT   gene            126796..127335
FT                   /locus_tag="BAS0122"
FT   CDS_pept        126796..127335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0122"
FT                   /product="ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52459"
FT                   /db_xref="GOA:Q81VR8"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VR8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52459.1"
FT                   /translation="MNRLKEKFQKEITPALVSKFNYKSVMQVPKIEKIVINTGVGDAVS
FT                   NSKTLDNAVEELTQITGQKPVVTRAKKSIAGFRLREGMPIGAKVTLRGEQMYEFFDKLV
FT                   SVSLPRVRDFRGVSKKSFDGRGNYTLGVKEQLIFPEIDYDKVSKVRGMDIVIVTTAKTD
FT                   EEARELLTQFGMPFQK"
FT   gene            127369..127554
FT                   /locus_tag="BAS0123"
FT   CDS_pept        127369..127554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0123"
FT                   /product="ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52460"
FT                   /db_xref="GOA:Q81VR7"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VR7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52460.1"
FT                   /translation="MAKKSMIAKQKRTPKFKVQEYTRCERCGRPHSVYRKFKLCRICFR
FT                   ELAYKGQIPGVKKASW"
FT   gene            127584..127982
FT                   /locus_tag="BAS0124"
FT   CDS_pept        127584..127982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0124"
FT                   /product="ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52461"
FT                   /db_xref="GOA:Q81VR6"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="PDB:4PDB"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VR6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52461.1"
FT                   /translation="MVMTDPIADMLTRIRNANMVRHEKLEVPASKIKKEIAELLKREGF
FT                   IRDVEYIEDNKQGILRIFLKYGANNERVITGLKRISKPGLRVYAKADEVPRVLNGLGIA
FT                   LVSTSKGVMTDKDARQLQTGGEVVAYVW"
FT   gene            128015..128554
FT                   /locus_tag="BAS0125"
FT   CDS_pept        128015..128554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0125"
FT                   /product="ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52462"
FT                   /db_xref="GOA:Q81VR5"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VR5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52462.1"
FT                   /translation="MSRIGKKILEIPAGVTITVAEDNTVTVKGPKGELTRTFNADMLIK
FT                   IEENTLTVERPSEQKEHRALHGTTRALIGNMVEGVTEGFARGLELVGVGYRAQKQGDKL
FT                   VLSVGYSHPVEMTPEAGLEVEVPAPTKIVIKGIDKQRVGEFAANIRAVRAPEPYKGKGI
FT                   RYEGEVVRRKEGKTAK"
FT   gene            128586..128948
FT                   /locus_tag="BAS0126"
FT   CDS_pept        128586..128948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0126"
FT                   /product="ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52463"
FT                   /db_xref="GOA:Q81VR4"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VR4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52463.1"
FT                   /translation="MITKADKNATRKKRHARVRAKLTGTAERPRLNVFRSNQHIYAQVI
FT                   DDVNGVTLVSASTLDKDLALNGTSNIEAATKVGESVAKRAVEKGVKEVVFDRGGYLYHG
FT                   RVKALAEAAREAGLQF"
FT   gene            128970..129470
FT                   /locus_tag="BAS0127"
FT   CDS_pept        128970..129470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0127"
FT                   /product="ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52464"
FT                   /db_xref="GOA:Q81VR3"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VR3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52464.1"
FT                   /translation="MHRIDPSKLELEERVVTINRVAKVVKGGRRFRFAALVVVGDKNGH
FT                   VGFGTGKAQEVPDAIRKAIEDAKKNLIAVPLVGTTIPHTINGHFGAGEVFLKPAAEGTG
FT                   VIAGGPVRAVLELAGVQDILSKSLGSNTPINMIRATVNGLSELKRAEDVAKLRGKSVEE
FT                   LLG"
FT   gene            129484..129666
FT                   /locus_tag="BAS0128"
FT   CDS_pept        129484..129666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0128"
FT                   /product="ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52465"
FT                   /db_xref="GOA:Q81VR2"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VR2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52465.1"
FT                   /translation="MAKKLEITLTRSVIGRPQDQRATVEALGLKKLNSTVVKEETPAIL
FT                   GMINKVSHLVTVKEA"
FT   gene            129700..130140
FT                   /locus_tag="BAS0129"
FT   CDS_pept        129700..130140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0129"
FT                   /product="ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52466"
FT                   /db_xref="GOA:Q81VR1"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VR1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52466.1"
FT                   /translation="MKLHELKPAEGSRKVRNRVGRGIGSGNGKTAGKGHKGQNARSGGG
FT                   VRLGFEGGQTPLFRRLPKRGFTNINRKEFAIVNLSTLNRFEDGTEVTPELLLETGVISK
FT                   LNDGVKILASGAVEKKLTVKAHKFSSSAKEAIEAAGGSVEVI"
FT   gene            130140..131441
FT                   /locus_tag="BAS0130"
FT   CDS_pept        130140..131441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0130"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52467"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52467.1"
FT                   /translation="MFRTISNFMRVAEIRRKILFTLAMLIVFRIGTFIPVPFTNGDVLK
FT                   AQDQLNALGILNTFGGGALKNFSIFAMGIMPYITASIIVQLLQMDVVPKFSEWAKQGEM
FT                   GRRKLTQFTRYFTIVLAFIQGFGMSIGFNGMVGGQLILNPGWSTYLYIATVLTAGTAFL
FT                   MWLGEQITAKGVGNGISILIFGGIAAAIPSVISQVYQQQFQNIGDQLFMSIVKVALILL
FT                   AVLAVIVGVIFIQQAVRKIPIQYAKRVTGGNGGYAGAQNTHLPLKVNSAGVIPVIFAVS
FT                   FLITPPTIAQFFPKHDVSQWIIANFNYSHPVGMIIYVALIVAFTYFYAFVQVNPEQMSE
FT                   NLNKQGGYVPGIRPGKNTEQYLTKILYRLTFVGSIFLAAIAILPVIFTKLGNLPPSAQI
FT                   GGTSMLIVVGVALETMKQLESQLVKRHYKGFIKQ"
FT   gene            131498..132148
FT                   /locus_tag="BAS0131"
FT   CDS_pept        131498..132148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0131"
FT                   /product="adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52468"
FT                   /db_xref="GOA:Q81VQ9"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VQ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52468.1"
FT                   /translation="MNLILMGLPGAGKGTQAEQIVAKYNIPHISTGDMFRAAMKAETEM
FT                   GLQAKSFIDKGALVPDEVTIGIVRERLSQEDCVRGFLLDGFPRTVAQASALEEIMKDLG
FT                   KKIDYVLNINVDSGLLLKRLTGRRICKECGATYHLEFNAPAKADVCDKCGGELYQRSDD
FT                   NEETVANRLDVNIKQTKPLLDFYEELGYLQSINGEQDINKVFADIDVLIGGLA"
FT   gene            132148..132894
FT                   /locus_tag="BAS0132"
FT   CDS_pept        132148..132894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0132"
FT                   /product="methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52469"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52469.1"
FT                   /translation="MIICKTPREIEIMREAGRIVALTHQELKQHITPGITTKELDQIAE
FT                   KTIQKYGATPSFKGYNGFPGSICASVNEELVHGIPGKRKLKEGDIISIDIGAKYNGYHG
FT                   DSAWTYPVGNISESVQKLLDVTEKSLYLGLEQVKPGERLSNISHAVQTHAEENGFSIVR
FT                   EYVGHGIGQDLHEDPQIPHYGPPNRGPRLKPGMVICVEPMVNQGRRYVKTLSDDWTVVT
FT                   VDGKWCAHFEHTIALTEAGYEILTTL"
FT   gene            132963..133181
FT                   /locus_tag="BAS0133"
FT   CDS_pept        132963..133181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0133"
FT                   /product="translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52470"
FT                   /db_xref="GOA:Q81VQ7"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VQ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52470.1"
FT                   /translation="MAKDDVIEVEGTVLETLPNAMFKVELENGHVVLAHVSGKIRMNFI
FT                   RILPGDKVTVELSPYDLNRGRITYRFK"
FT   gene            133217..133330
FT                   /locus_tag="BAS0134"
FT   CDS_pept        133217..133330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0134"
FT                   /product="ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52471"
FT                   /db_xref="GOA:Q81VQ6"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VQ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52471.1"
FT                   /translation="MKVRPSVKPICEKCKVIRRRGKVMVICENPKHKQKQG"
FT   gene            133352..133717
FT                   /locus_tag="BAS0135"
FT   CDS_pept        133352..133717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0135"
FT                   /product="ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52472"
FT                   /db_xref="GOA:P62176"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62176"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52472.1"
FT                   /translation="MARIAGVDIPRDKRVVISLTYVFGIGRTTAEKILAEAGISEETRV
FT                   RDLTEDELGRIRDIIDRIKVEGDLRREVSLNIKRLMEIGSYRGLRHRRGLPVRGQNSKN
FT                   NARTRKGPRRTVANKKK"
FT   gene            133742..134131
FT                   /locus_tag="BAS0136"
FT   CDS_pept        133742..134131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0136"
FT                   /product="ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52473"
FT                   /db_xref="GOA:Q81VQ5"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VQ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52473.1"
FT                   /translation="MARKTNTRKKRVKKNIEAGVAHIRSTFNNTIVTLTDTHGNALSWS
FT                   SAGALGFRGSRKSTPFAAQMAAETAAKAAMEHGLKTLEVTVKGPGAGREAAIRALQAAG
FT                   LEVTAIRDVTPVPHNGCRPPKRRRV"
FT   gene            134312..135256
FT                   /locus_tag="BAS0137"
FT   CDS_pept        134312..135256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0137"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52474"
FT                   /db_xref="GOA:Q81VQ4"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VQ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52474.1"
FT                   /translation="MIEIEKPKIETVELNEDAKYGKFVIEPLERGYGTTLGNSLRRILL
FT                   SSLPGAAVTAIQIDGVLHEFSTVEGVVEDVTTIILNLKKLALKIYSEEEKTLEIDVQGE
FT                   GIVTAADITHDSDVEILNPDLHIATLAKDAHFRVRLTAKRGRGYTPADANKSEDQPIGV
FT                   IPIDSIYTPVSRVTYQVEKTRVGQVANYDKLTLDVWTDGSIGPKEAISLGAKILTEHLN
FT                   IFVGLTDEAQNAEIMVEKEEDQKEKVLEMTIEELDLSVRSYNCLKRAGINTVQELANKT
FT                   EEDMMKVRNLGRKSLEEVKHKLEELGLGLRKDD"
FT   gene            135292..135654
FT                   /locus_tag="BAS0138"
FT   CDS_pept        135292..135654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0138"
FT                   /product="ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52475"
FT                   /db_xref="GOA:Q81VQ3"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VQ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52475.1"
FT                   /translation="MAYRKLGRTSAQRKAMLRDLATDLIINERIQTTETRAKELRSVVE
FT                   KMITLGKRGDLHARRQAAAFIRNEVANAETGQDALQKLFADVAPRYAERQGGYTRIAKI
FT                   GPRRGDAAPMVIIELV"
FT   gene            135698..136600
FT                   /locus_tag="BAS0139"
FT   CDS_pept        135698..136600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0139"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52476"
FT                   /db_xref="GOA:Q81VQ2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VQ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52476.1"
FT                   /translation="MALFLKYKNRLTWRRKGCLVLKKEKLRTENISFQYPGAATYALKD
FT                   VSFSLFEGEWVSVIGQNGSGKSTLAKLLNGLFLPEAGTITVNDTMILSEETVWDVRKQI
FT                   GMVFQNPDNQFVGTTVQDDVVFGLENIGMPREQMVERLNQALRLVRMEDFLNDEPHSLS
FT                   GGQKQRVAIAGVLALQPSILILDEATSMLDPQGRREVVETVRQLVNEKGITVLSITHDL
FT                   EEAAQSDRVIILNKGEILEEGTPEQIFKSSHMLQEIGLDVPFSVKIAELLKRNEILLQN
FT                   THLTMESLVNELWRLHSKK"
FT   gene            136576..137457
FT                   /locus_tag="BAS0140"
FT   CDS_pept        136576..137457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0140"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52477"
FT                   /db_xref="GOA:Q81VQ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VQ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52477.1"
FT                   /translation="MEITFQKVEHRYQYKTPFERRALYDVDVSFPSGGYYAIIGHTGSG
FT                   KSTMIQHLNGLLQPTNGTVQIGEHFISAGKKEKKLKPLRKKVGVVFQFPEHQLFEETVE
FT                   KDICFGPTNFGVSEEAAKQKAREAIELVGLEPELLARSPFELSGGQMRRVAIAGVLAME
FT                   PEVLVLDEPTAGLDPKGQNELMEMFYKLHKEKGLTVILVTHNMEDAAKYAEQIVVMHKG
FT                   TVFLQGSAEEVFSHADELEKIGVDLPMSLKYKRAIEEKFGISIPKATLSLEDLTHEVVQ
FT                   VLRKGGHESCSS"
FT   gene            137445..138239
FT                   /locus_tag="BAS0141"
FT   CDS_pept        137445..138239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0141"
FT                   /product="cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52478"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52478.1"
FT                   /translation="MQQLIIGRYIPGNSLIHQLDPRTKLLIVFLYVFVVFLANNAISYG
FT                   FLFLYALIALFFAKVPIRYVLSGLKPILWIFLFTFFLHIFTNKEGEVLFQLGWFSIHEK
FT                   GLEQGIYISIRFFVIILMTTLLTLTTTPIEITDGLETLLKPLKRIKVPVHEIALMMSIS
FT                   LRFIPTLMDETSKIMKAQSSRGIDFAGGPIKDRMKAIISLLVPLFISAFKRAEDLAIAM
FT                   EARGYQSGEGRTKFRQLRWKTSDTVTIISLLCLACILAWVRS"
FT   gene            138254..138997
FT                   /locus_tag="BAS0142"
FT   CDS_pept        138254..138997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0142"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52479"
FT                   /db_xref="GOA:Q6I4Q2"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6I4Q2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52479.1"
FT                   /translation="MDRIKCTVAYDGMHFCGYQIQPQHRTVQQEIEKALQKLHKGELVR
FT                   VQASGRTDSTVHAKGQVIHFDTPLSLEEWQWSNALNTMLPDDIVITQVEKKTEEFHARY
FT                   GVERKEYRYRVLVSKTADVFRRNYVYQYPYPLEVNSIRKAIPYFIGTHDFTSFCSAKTD
FT                   KKDKVRTIYEIELIEQDDELIFRFVGNGFLYNMVRIIVGTLLNVGQGKLDPDSIPEILA
FT                   KQNRQFAGKMAPGHGLYLWQVNYNN"
FT   gene            139150..139587
FT                   /locus_tag="BAS0143"
FT   CDS_pept        139150..139587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0143"
FT                   /product="ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52480"
FT                   /db_xref="GOA:Q81VP9"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VP9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52480.1"
FT                   /translation="MRTTFMAKANEVERKWYVVDAEGQTLGRLASEVASILRGKNKPTF
FT                   TPHVDTGDHVIIINAEKIHLTGNKLNDKIYYRHTNHPGGLKQRTALEMRTNYPVQMLEL
FT                   AIKGMLPKGRLGRQVSKKLNVYAGAEHPHQAQKPEVYELRG"
FT   gene            139609..140001
FT                   /locus_tag="BAS0144"
FT   CDS_pept        139609..140001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0144"
FT                   /product="ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52481"
FT                   /db_xref="GOA:Q81VP8"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VP8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52481.1"
FT                   /translation="MAQVQYYGTGRRKSSVARVRLVSGEGRVIINGRDFENYIPFAALR
FT                   EVVKQPLVATETLGNYDVLVNVNGGGYTGQAGAIRHGISRALLKADPEYRLTLKRAGLL
FT                   TRDARMKERKKYGLKGARRAPQFSKR"
FT   gene            140164..140592
FT                   /locus_tag="BAS0145"
FT   CDS_pept        140164..140592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0145"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52482"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52482.1"
FT                   /translation="MNVIVSLQEKQKEKQLKYERKMLRELSLKTLRSNIRDAFQMQELH
FT                   RQYEDYCIELGIESYLLGARYSKFGYYGESFFDVKYRALEEEQQLTETLFQFLTSMTMR
FT                   EIKLQDEELLFESCQQFIGLWWQEGYEKGERRYRLKLH"
FT   gene            140659..141372
FT                   /locus_tag="BAS0146"
FT   CDS_pept        140659..141372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0146"
FT                   /product="germination-specific N-acetylmuramoyl-L-alanine
FT                   amidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52483"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52483.1"
FT                   /translation="MKRIRIISFALAAVILFFLVKQEFQIIKSWRAWNLPLSGKVIVLD
FT                   AGHGGPDGGAVGGKDIVEKDITLEITKKVQDYLQEQGALVILTREGDYDLAQKDTKSYS
FT                   RRKAEDLKKRVEIINKPDVDFFASIHLNALTSSGSKGAQTFYYRSSIENERAAKFIQAE
FT                   LRTSLENTNRSAKTISHVYLLKYAKTPGALIEAGFLSNVNERYMLNSEKYQQKVAAAVY
FT                   RGILRYFTEKGNPPE"
FT   gene            141517..142581
FT                   /locus_tag="BAS0147"
FT   CDS_pept        141517..142581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0147"
FT                   /product="mrp protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52484"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52484.1"
FT                   /translation="MVMKEQVVEALEGIVDPFLHKTLKETGAIKEVTVKPEKKHVSVKI
FT                   AIVKTGTAEQMQLQSGIVKLVKELGAATVGLRFAEFTEEELAQFAPEQEEQTESLLSPN
FT                   SKTTFLAVASGKGGVGKSTVSVNLAIALARLGKKVGIIDADIYGFSVPDMMGIEKRPVV
FT                   RGDKIIPVERLGVKVISMGFFVEDNAPVIWRGPMLGKMLNHFFTEVEWGDLDYLVLDLP
FT                   PGTGDVALDLHSMLPACKEIIVTTPHPTAAFVAARAGAMALRTEHSILGVVENMAYFES
FT                   KTTGEKEYVFGRGGGDKLATELQTEVLGRIPLQQPDWNKEDFAPSVYEDTHTTGLIYRT
FT                   IAETVIDKTAFAQK"
FT   gene            complement(142638..143255)
FT                   /locus_tag="BAS0148"
FT   CDS_pept        complement(142638..143255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0148"
FT                   /product="spore germination protein GerD"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52485"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52485.1"
FT                   /translation="MKRMLLVLTSSFLFLVLVACAQEKEAKSELDYDQTKKMIVDILKT
FT                   DQGKKAIQDVLTDEKMKQALILDETVVKKTIEDAMVSDKGQQFWEKLFKDPEFSSKFAK
FT                   SMGKEQTALMKTLLKDPEYQAGVIEIMKNPEVEKMMLQTMKSKEYRQYLQQVLTETAES
FT                   PLFQAKMIDIISKGVQKAEKSGSDKKEAGGEGGSQEGKKEQQ"
FT   gene            143395..144006
FT                   /locus_tag="BAS0149"
FT   CDS_pept        143395..144006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0149"
FT                   /product="kinb signaling pathway activation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52486"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52486.1"
FT                   /translation="MNSRKWVRLFFTTLFLGGISTVIIGFVLEWDKYAKFFQNFDGKEI
FT                   LAVSFWLMGVGFIFSVISQMGFFAYLTIHRFGLGMFRSSSLWNIVQLFFIAFVLFDFVY
FT                   LRSVLIANGEVSLGNNILVAGVLFMFGAIVAYIKSKETNKKAFVPALFFMVVVTILEWV
FT                   PALRINDTDWLYLMVIPLLLCNAYQLLILHRLIGKTSKSA"
FT   gene            complement(144111..144875)
FT                   /locus_tag="BAS0150"
FT   CDS_pept        complement(144111..144875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0150"
FT                   /product="polysaccharide deacetylase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52487"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52487.1"
FT                   /translation="MFFFFITSKRNFKHISLIVILSLFTAWLLFLKTYSHESAFSTATG
FT                   PKVIYKGDTSKKQVAFTFDISWGDKKAIPILDTLKERDIKNATFFLSAAWAERHPDVVE
FT                   RIIKDGHEIGSMGYNYTSYTSLETNEIRRDLLRAQDVFTKLGVKQIKLLRPPSGDFNKA
FT                   TLKIAESLGYTVVHWSNNSNDWKNPGVNKIVSTVSNNLKGGDIVLLHASDSALQTNKAL
FT                   PLLLQKLKSDGYEQISVSQLISNTSTKSKDVQ"
FT   gene            145046..145264
FT                   /locus_tag="BAS0151"
FT   CDS_pept        145046..145264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0151"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52488"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52488.1"
FT                   /translation="MLGFMLTKEEKKEMEYILKRELEELLFDFEDERIHDVVKKAMEER
FT                   YKIIFCLFRRVANAEDCIRYVRKRTFY"
FT   gene            145516..147025
FT                   /locus_tag="rRNA-16s-4"
FT   rRNA            145516..147025
FT                   /locus_tag="rRNA-16s-4"
FT                   /product="16S ribosomal RNA"
FT   gene            147201..150111
FT                   /locus_tag="rRNA-23s-4"
FT   rRNA            147201..150111
FT                   /locus_tag="rRNA-23s-4"
FT                   /product="23S ribosomal RNA"
FT   gene            150195..150313
FT                   /locus_tag="rRNA-5s-4"
FT   rRNA            150195..150313
FT                   /locus_tag="rRNA-5s-4"
FT                   /product="5S ribosomal RNA"
FT   gene            150320..150397
FT                   /locus_tag="tRNA-Asn-4"
FT   tRNA            150320..150397
FT                   /locus_tag="tRNA-Asn-4"
FT                   /product="tRNA-Asn"
FT   gene            150399..150474
FT                   /locus_tag="tRNA-Thr-5"
FT   tRNA            150399..150474
FT                   /locus_tag="tRNA-Thr-5"
FT                   /product="tRNA-Thr"
FT   gene            150496..150573
FT                   /locus_tag="tRNA-Glu-4"
FT   tRNA            150496..150573
FT                   /locus_tag="tRNA-Glu-4"
FT                   /product="tRNA-Glu"
FT   gene            150576..150654
FT                   /locus_tag="tRNA-Val-5"
FT   tRNA            150576..150654
FT                   /locus_tag="tRNA-Val-5"
FT                   /product="tRNA-Val"
FT   gene            150669..150755
FT                   /locus_tag="tRNA-Tyr-2"
FT   tRNA            150669..150755
FT                   /locus_tag="tRNA-Tyr-2"
FT                   /product="tRNA-Tyr"
FT   gene            150818..150895
FT                   /locus_tag="tRNA-Gln-4"
FT   tRNA            150818..150895
FT                   /locus_tag="tRNA-Gln-4"
FT                   /product="tRNA-Gln"
FT   gene            150898..150976
FT                   /locus_tag="tRNA-Lys-4"
FT   tRNA            150898..150976
FT                   /locus_tag="tRNA-Lys-4"
FT                   /product="tRNA-Lys"
FT   gene            150979..151053
FT                   /locus_tag="tRNA-Gly-3"
FT   tRNA            150979..151053
FT                   /locus_tag="tRNA-Gly-3"
FT                   /product="tRNA-Gly"
FT   gene            151061..151136
FT                   /locus_tag="tRNA-Ala-1"
FT   tRNA            151061..151136
FT                   /locus_tag="tRNA-Ala-1"
FT                   /product="tRNA-Ala"
FT   gene            151248..151457
FT                   /locus_tag="BAS0153"
FT   CDS_pept        151248..151457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0153"
FT                   /product="glycerate kinase, N-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52489"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52489.1"
FT                   /translation="MKVVIASDSYKESLKAIEVCEAIERGFEAIFPKAEYVKIPIGDGG
FT                   EGTVDSLVDAARGENYITSCNRAA"
FT   gene            151369..152394
FT                   /locus_tag="BAS0154"
FT   CDS_pept        151369..152394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0154"
FT                   /product="glycerate kinase C-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52490"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52490.1"
FT                   /translation="MEMEEKERLIHLLMPQGGRIISLHVTGPLRERVQAFYGMSKDKKT
FT                   AFIEMAAASGLQHVPVKKRNPLVTTTKGTGELILHALDEGAEHIILGLGGSATNDGGAG
FT                   MLSALGVRFINGKGEVIDPFGGTLHSIVSIDFSQMDSRLKHIKIEAACDVDNPLVGIRG
FT                   ASFVFGRQKGADEEMMKELDENLKHYAHILKQYLYCDVSKIPGAGAAGGMGAAVIAVLK
FT                   GNLRRGIEIVLDYTNFDKHIEGADLIITGEGRIDEQTAYGKAPVGVAERAKHFHIPVIA
FT                   IGGSVSPNYTAVHEKGIDAVFSITPSPMTLEEAYKVAEENIEMTAKNIAAVWKIASEKH
FT                   F"
FT   gene            152604..153497
FT                   /locus_tag="BAS0155"
FT   CDS_pept        152604..153497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0155"
FT                   /product="arginase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52491"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52491.1"
FT                   /translation="MKKEISVIGVPMDLGQMRRGVDMGPSAIRYAGVIERIEEIGYDVK
FT                   DMGDICIEREKEVDVNTSLRNLTQVATVCNELASKVDHIIEEGRFPLVLGGDHSIAIGT
FT                   LAGVAKHYKNLGVIWYDAHGDLNTEETSPSGNIHGMSLAASLGYGHPTLVDLYGAYPKV
FT                   KKENVVIIGARALDEGEKDFIRNEGIKVFTMHEIDRMGMTAVMEETIEYLSHTDGVHLS
FT                   LDLDGLDPHDAPGVGTPVIGGLSYRESHLAMEMLAEADIVTSAEFVEVNMILDERNRTA
FT                   TTAVALMGSLFGEKLK"
FT   gene            153746..154567
FT                   /locus_tag="BAS0156"
FT   CDS_pept        153746..154567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0156"
FT                   /product="conserved hypothetical protein TIGR00159"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52492"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52492.1"
FT                   /translation="MPFEDTTILKYLSTALDIAVVWFIIYKLILIIRGTKAVQLLKGIT
FT                   VIIVVRMISIFLELRTLYWLTEQVLTWGFLAVIIIFQPELRRALEQLGRGSLFSRTGTH
FT                   EDDEPEMVATAIAKATEYMGKRRIGALITLSKETGMGDYVETGIPLNANVSSELLINIF
FT                   IPNTPLHDGAVIMQGSTIKAAACYLPLSESPFISKELGTRHRAAMGVSEVTDSITVVVS
FT                   EETGQISLTKNGKLHRDLKTEQLKDMLLAEFSANEKTTSSSLWNWRRKRHG"
FT   gene            154560..156050
FT                   /locus_tag="BAS0157"
FT   CDS_pept        154560..156050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0157"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52493"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52493.1"
FT                   /translation="MDKLMENHWFLKGISLLLACMLFMSATLTEKNTTSGILPFANDAK
FT                   ETLTNYAINVKYDEEKYIVSGIPAEGVKVKLEGPKAAVATAKAKKQFDIPVDLRDSEKG
FT                   TYEVSLKTNGLPDDVKGTVQPSTIKVTLHEKARKYVHVDLKLSNEDQMPAGAILEKSSL
FT                   KPDTVEVVGTKEEIESISSAKAYVDLKGVNKTVTKTPEVTLYNKEGKRLNVRTSPSKIS
FT                   VTLNVATQATANNTEKTVPIAYTKKGSLPEGLAVTNISVEPREVTIAGPKDILDNIQSI
FT                   EGVEVDLSQLTESTTFDTSVLLPKGVTSAKPNQVKVSVGVQKTKQTKTRTIDGISIQKN
FT                   GLSKDVTAQLLSPQDGKISVDISGETSIVDKIIANQITAVINLQNVSPGTKDVAIQVSG
FT                   PSNISIEPKQKSAKVTIVKKENPDKEVQGNGEQPNSNNNQDNQDNQTEKPKNPEPEPNP
FT                   DPDPEKEKEPEQNKDKETSQEPTVDNQKEPEKGANHNG"
FT   gene            156043..157389
FT                   /locus_tag="BAS0158"
FT   CDS_pept        156043..157389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0158"
FT                   /product="phosphoglucosamine mutase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52494"
FT                   /db_xref="GOA:Q81VN7"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="PDB:3PDK"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VN7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52494.1"
FT                   /translation="MGKYFGTDGVRGVANKELTPELAFKIGRFGGYVLTKDTDRPKVII
FT                   GRDTRISGHMLEGALVAGLLSTGAEVMRLGVISTPGVAYLTKALDAQAGVMISASHNPV
FT                   QDNGIKFFGSDGFKLTDEQEAEIEALLDKEVDELPRPTGTNLGQVSDYFEGGQKYLQYI
FT                   KQTVEEDFSGLHIALDCAHGATSSLAPYLFADLEADISTMGTSPNGMNINDGVGSTHPE
FT                   VLAELVKEKGADIGLAFDGDGDRLIAVDEKGNIVDGDQIMFICAKYMKETGQLKHNTVV
FT                   STVMSNLGFYKALEANGITSDKTAVGDRYVMEEMKRGGYNLGGEQSGHIILLDYITTGD
FT                   GMLSALQLVNIMKMTKKPLSELAGEMTKFPQLLVNVRVTDKKLALENEKIKEIIRVVEE
FT                   EMNGDGRILVRPSGTEPLIRVMAEAPTQEVCDAYVHRIVEVVKAEVGAE"
FT   gene            157677..157862
FT                   /locus_tag="BAS0159"
FT   CDS_pept        157677..157862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52495"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52495.1"
FT                   /translation="MREKERIQTSCISIYGLKPNREEGESRYKLTGLAICNPFFSINKN
FT                   GIGLCRYMFAEQRKHL"
FT   gene            157875..159677
FT                   /locus_tag="BAS0160"
FT   CDS_pept        157875..159677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0160"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase (isomerizing)"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52496"
FT                   /db_xref="GOA:Q81VN5"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VN5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52496.1"
FT                   /translation="MCGIVGFIGEQDAKEILLKGLEKLEYRGYDSAGIAVQAENGVVVY
FT                   KEKGRIAKLREIVDENVAASVGIGHTRWATHGVPSKVNAHPHQSTSKRFTLVHNGVIEN
FT                   YELVKKEYLQDVTFVSETDTEVIVQLMEQQVSTGLSVEEAFRNTLSLLHGSYAIGLLDA
FT                   ENPNMIYVAKNKSPLLVGVGDNFNVVASDAMAMLQVTDQFIELMDKEIVIVMKESITIK
FT                   NLQGETIERAPFTAELDASDIEKGTYPHFMLKEIDEQPLVIRNIIQKYQDENGEIELDQ
FT                   DIRNAILDSDRIYIIACGTSYHAGLVGKQFIEKFAKMPVEVHVASEFSYNMPLLTERPF
FT                   FIYISQSGETADSRAVLVQTNEMGHKALTITNVPGSTLSREADYTLPLYAGPEIAVAST
FT                   KAYTAQLAVLSILAADIAKAKGEVLGFDLTHELGLVANAMIELCDQKEEMDALAKQFLA
FT                   TTRNCFFIGRSVDFYVGLEGALKLKEISYIQAEGFAGGELKHGTIALIENGTPVIALAT
FT                   QEHVNLGIRGNVKEVVARGANPCIISMKGLEMEGDSFVLPAVHEALAPLVAVIPLQLIS
FT                   YYAALHRECDVDKPRNLAKSVTVE"
FT   gene            160041..160850
FT                   /locus_tag="BAS0161"
FT   CDS_pept        160041..160850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0161"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52497"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52497.1"
FT                   /translation="MSIVKNGTLQVIGASIYYEVRGSGPILLLIHGGGGDADKFHNIAD
FT                   HLAKWYTVVTYDRRGHSRSNLVNKNEDYHVHTHSEDAHRLLANLTKEPAYVFGSSSGAV
FT                   IGLDLCIRHPEQVQLLIPHEPVLLQLLSENELKQAINFLEDLKGNHQNEVMKLLSNIDD
FT                   SNSEPSKDMLTERLLGNSTYFTEYEIPGILSYTLNIDALKSLLKPASIQVRPAGGSISR
FT                   ETFPYHCAFNLAEHLGTEFAEFPGHHVGYNTVHHKEFAERLHDVIEN"
FT   gene            161257..161988
FT                   /locus_tag="BAS0162"
FT   CDS_pept        161257..161988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0162"
FT                   /product="gluconate operon transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52498"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52498.1"
FT                   /translation="MTKSMEFLYPEKWLSKASTGDRVASELRMRIIAGVIESGTILSEN
FT                   KIAADFSVSRSPVREALKLLVSENIIRLERMGAVVIGLTEKEIEEIYDVRLLIETFIFE
FT                   RLGKMDTNDLVRELNKIMEMMKIAIKYHDSDEFSYQDLLFHETIIRTIEHSYILMIWNN
FT                   LKPVMESLILLSMRTRFKEKYEDFERIIKNHELYIKAIESKDRALMIEALHQNFDDVQG
FT                   KVEDLWMSQQMLSKGVEQGHE"
FT   gene            161981..162511
FT                   /locus_tag="BAS0163"
FT   CDS_pept        161981..162511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0163"
FT                   /product="gluconate kinase, N-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52499"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52499.1"
FT                   /translation="MSSYMLGIDIGTTSTKAVLFTEKGEVIQTENIGYPLRTPDISTAE
FT                   QDPEEIFQAVLQAISNITKQHSDKKPSFISFSSAMHSVIAMDENDQPLTPCITWADNRS
FT                   EAWAHKIKDELNGHAVYRRTGTPIHPMSPLSKITWIVNAHPEIAIRTKKYIGIKEYIFK
FT                   KFFDQYVVDHSIA"
FT   gene            162515..163516
FT                   /locus_tag="BAS0164"
FT   CDS_pept        162515..163516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0164"
FT                   /product="gluconate kinase, C-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52500"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52500.1"
FT                   /translation="MGMMNLKTLDWDEEALKIAGITSAQLSKLVPTTKIFSNCNPDLAQ
FT                   KIGIDSQTPFVIGASDGVLSNLGVNAIRKGEIAVTIGTSGAIRTIIDKPQTDKKGRIFC
FT                   YALTEKHWVIGGPVNNGGMVLRWIRDELASSEVETAKRLGIDPYDVLTKIAERVRPGAD
FT                   GLLFHPYLTGERAPLWNPDVRGSFFGLTMSHKKEHMIRAALEGVIYNLYTVFLALTECM
FT                   DGPVTRIQATGGFARSDVWRQMMSDIFASEVVVPKSYESSCLGACILGLYATGKIDSFE
FT                   IVSEMVGSTYKHTPKEEATKEYRQLLPIFINLSRALEDDYTRIANYQRNLIK"
FT   gene            163636..164982
FT                   /locus_tag="BAS0165"
FT   CDS_pept        163636..164982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0165"
FT                   /product="gluconate permease"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52501"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52501.1"
FT                   /translation="MPLVIVAIGILALLLLIMRFKLNTFISLIIVSVGVALALGMPPEK
FT                   IFKTIEAGLGGTLGHLALVFGLGAMLGKLLSDSGGAQRIAMTLVKKFGEKNIQWAVVTA
FT                   SFIIGIALFFEVGLVLLIPIVFAISRELKVSILYLGISMAAALSVTHGFLPPHPGPTAI
FT                   AGELHANIGEVLLYGFMIAVPTVVLAGPVFTKLAKKLVPEAFTKTGNIQSLGEQKVFKL
FT                   EETPGFGISVFTALLPVLLMAVATIITLLQKTMGFKDNSLLATIEFIGNADTAMLISLL
FT                   VAIYTMGLARNIPIKSVMESCTTAISNIGMMLLIIGGGGAFKQVLIDGGVGNYVAELFK
FT                   GTSLSPILLAWIIAAILRISLGSATVAALTTVGLVIPMLGQSDVNLALVVLATGAGSLI
FT                   ASHVNDAGFWMFKEYFGLSMKETFATWTLLETIVSVAGLGFTLLLSLFV"
FT   gene            165247..166656
FT                   /locus_tag="BAS0166"
FT   CDS_pept        165247..166656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0166"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52502"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52502.1"
FT                   /translation="MENLQIGVVGVGVMGKSLALNFESKGYSVALYDISKEKVDETIEE
FT                   NRGKNLVGTHIVEEFVNSLESPRKILLMVNAGEITDKAIDSLVPHLDKGDILIDGGNTY
FT                   FVDTIRRNKRLAEEGINFIGAGVSGGEEGALKGPSIMPGGQKDAYEKVKDMLENISAKV
FT                   NNEPCCSYIGPNGAGHYVKMVHNGIEYGDMQLICEAYFFLKQTLDLTAEEFHEIFAEWN
FT                   KGELNSYLIEITADIFKKKDEETGKPLVDVILDTAGQKGTGKWTSQSALDLGISLPIIT
FT                   ESVFARCISALKEERVNASKVLSGPKDKTAIGVEKAELIEAVRQALYMSKICSYAQGFT
FT                   QLKAASEEYNWNLDFGSISMLWRGGCIIRAAFLQNIKEAYETNTDLPNLLLDPYFKEIV
FT                   ESYQGGLRQIISMAVQQGIPIPAFSAAISYYDSYRTAKLPANLLQAQRDYFGAHTYKRV
FT                   DKEGTFHTKWI"
FT   gene            166996..168963
FT                   /locus_tag="BAS0167"
FT   CDS_pept        166996..168963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0167"
FT                   /product="prolyl oligopeptidase family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52503"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52503.1"
FT                   /translation="MMKVSEKTYLSIEEIISLPTVSSTNISDDGKNVAFVKRTANWEDN
FT                   TYRNHVWIYEKDKGKSYPLTTGDIDSIHPLWSPDSKSIAYLSSGGDGDMKNQIFVKSLD
FT                   DYSKVKITDEKEGISNFKWDPTGKGFYYITQSKECEEIKKRKELYGDFQHVGKEHQNNC
FT                   LCYIEMEKVIQNDKEEREINGVYQLTGGKDFYIHGFDISDNGKKVVCMATPSLNDHMNG
FT                   DLYILDVEARELQQMNVDKLLGGSACFSPEGNKICYSASIREKEYYRNHIQESTLEIYD
FT                   MNTGEVIQPLTNFDSMVMPLQWTAKGILIRWQDKTNYFIGLLAEDGTVETLREKVDGFI
FT                   MDASITRDGNHITYNKAITNETFEIYLDDKKITNENSLFEGKLKSNREIISWRSSDGLE
FT                   IEGVLSTPVEFDANKKYPLLVVIHGGPAWASFPIFSNCFNEKYPIEQFVEKGFIVLEPN
FT                   YRGSSGYGNEFLKANYRKQGLADYDDVISGVDELVEKGMVDKDRVGVMGWSNGGYISAF
FT                   CSTFSSRFKAISVGGGITNWSTHYVNTDIPYFIRMYLGNTPWNDPDIYKRTSPMTYIKS
FT                   ACTPTLIQHGEKDARIPITNAYELHQGLKDMEVDTELIIFKGMAYSSDQPGVHVAIMKQ
FT                   NLMWFSHYILGESMEDFSTI"
FT   gene            169082..169648
FT                   /locus_tag="BAS0168"
FT   CDS_pept        169082..169648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0168"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52504"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52504.1"
FT                   /translation="MTENKNELSVEQREELLKVLQARFEKNMNRHEGLEWAKVETKLAT
FT                   NNEKLWTLNEMEVTGGEPDVVGYDEEKDEYTFYDCSKESPKGRRSLCYDLEALESRKKH
FT                   KPENNAIDVAAAMGIELLTEQQYRELQKLGDFDMKSSSWVQTPSDIRELGGALFCDYRF
FT                   GHVFVYHNGADSYYAARGFRGSLRV"
FT   gene            complement(169720..170226)
FT                   /locus_tag="BAS0169"
FT   CDS_pept        complement(169720..170226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0169"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52505"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52505.1"
FT                   /translation="MVINFLRTDKRAAFILLFLRLYIGYTWLAAGIGKVFGQSFDASGF
FT                   LKGAIAQASGDHPAVQSWWADFLQHFVLPNADLFSFLVQWGEILVGLGLILGGLTKTAA
FT                   FFGIIMNLAFLLSGTVSVNPNLLILTMFILVAGQNAGRIGLDGYVFPKLFRKNSHGTYK
FT                   LSKTA"
FT   gene            complement(170467..171381)
FT                   /locus_tag="BAS0170"
FT   CDS_pept        complement(170467..171381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52506"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52506.1"
FT                   /translation="MDTSLKNALKKAQRKQLLKIIITSILVVIILIPIIYKVGNYFAAK
FT                   GSMRLHEQLFLYNSIAEPNVQIDSQVTSSSSMFGGNITSNRSKNINGYVVKWNTLTSPY
FT                   NWFRSNIDYNEVIPGTHWGRSNTESYNYDKQTKNKVATFYNPAIKEYYDGVKNELSAVS
FT                   KMENYVAEVAISFDQPYTLKEIQTKIPDNLNIVWLYMVSPIRDESGGPAGMPVYGFEPG
FT                   TPLEESYKGFFDSLKQYNDGYDKDIQKFLKSNENKPFDQVKILGVMLTGKTENFKALEN
FT                   QNFIRGASVGVTAQIVPYIKPEK"
FT   gene            complement(171381..171872)
FT                   /locus_tag="BAS0171"
FT   CDS_pept        complement(171381..171872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0171"
FT                   /product="RNA polymerase sigma-70 factor, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52507"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52507.1"
FT                   /translation="MGKENILTSYLINLGEKVFKLLLAKGAIKEDAEDIIQNTFYKVYT
FT                   LLDDLTENNIRPWFFRVALNEYIDLKRKKEQQNIYLTEEIYSKLQYTDRELDAVLNKDE
FT                   IFYLLKDIKLEYKEAFFLKYYYDFTYEEIALILDIRVNSVKQKLHRARKTIHSTVGGKP
FT                   "
FT   gene            complement(172013..173062)
FT                   /locus_tag="BAS0172"
FT   CDS_pept        complement(172013..173062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52508"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52508.1"
FT                   /translation="MEKETGGKTKVLFENKEPQVYKSEDVSVSMNSYTLVELNGFHTDF
FT                   NIPFNRQTEGGVILVNYSVKNSSAKDIYYMPALDISFTGAQKVYSNYKDLIPKEDQLPT
FT                   KLAPTNDYLVKAGETISGYIAYPFGKDDLAKISSLSTVSVTVPTAQANKGKFDAPIGSP
FT                   GSFSLSLNKQGAEKVATDKAFYQDKATANNMGDKKMLKEKSSINNSQELGAVNVTLDGY
FT                   QFTQFTPNSVEAPRFANFKNGIVLLTVKFKLDNKDTQDVSLSPISSTLRVNDGTQYTIN
FT                   EGMLLNYDYNASVKTGTSGELLQVFILDQEQYEKIWKEKSFEIELGPMRNKEAKDISQG
FT                   KKAKFTLPK"
FT   gene            complement(172972..173313)
FT                   /locus_tag="BAS0173"
FT   CDS_pept        complement(172972..173313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0173"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52509"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52509.1"
FT                   /translation="MSKKLLSLFSAVIVAAFVITGCGQSDTTNKEQKENAAKENKTEKT
FT                   DTTKENKPEEKNPKTRKLKIKRRKIPLLAPAIILNLFPTWKKKQAEKQKFFLKIRNHKS
FT                   INLKMFQYR"
FT   gene            173894..174529
FT                   /locus_tag="BAS0174"
FT   CDS_pept        173894..174529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0174"
FT                   /product="3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52510"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52510.1"
FT                   /translation="MPWGVDQSEQIQLQEELLKNGVKVSSMELDLTQNDAPKELINKVT
FT                   EQLGYPHILINNAAYSTNNDFSNLTAEELDKHYMVNIRATTLLSSQFARGFDKKSGGRI
FT                   VNMTSGQFQGPMVGELAYATTKGAIDALTSSLSAEVAHLGITVNAINPGPTDTGWMTEE
FT                   IKQGLKPMFPFGRIGEPKDAARLIKFLVSEEAEWITGQVIHSEGGFKR"
FT   gene            complement(174567..175235)
FT                   /locus_tag="BAS0175"
FT   CDS_pept        complement(174567..175235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0175"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52511"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52511.1"
FT                   /translation="MENKSFLDEWGKVIWEATIQTFQMTSISLFISILIALPLGVTLVL
FT                   TRPGGQHENKIIYSILNTIINIIRSLPFIILLFFILPFTKFLMGTSIGVQGVIVPLVVF
FT                   TAPYIARLMETALLEVDRGVIEAYQAMGVSTIQIIWHVMVKEARPSLVLGLTIATIGLI
FT                   GATAMAGLVGAGGLGDLAYRFGHLRYEPEVMYATVFILIILVQGLQSLGNGIARRLKKD
FT                   "
FT   gene            complement(175210..176250)
FT                   /locus_tag="BAS0176"
FT   CDS_pept        complement(175210..176250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0176"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52512"
FT                   /db_xref="GOA:Q81VM2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VM2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52512.1"
FT                   /translation="MIELKNVSKVFTTKKGNVEALKSTSLQVKKGEVFGIIGYSGAGKS
FT                   TLIRCVNLLEKPTTGNIIVNEQDLTTLSTKELAKARQKIGMIFQGFNLLKTVTVYENIA
FT                   LPLRLAGVPKLEIEKRVEKYLRIVDLFNRKDAYPSELSGGQKQRVAIARALSHEPEVLL
FT                   SDEATSALDPETTDSILDLLLKINEEIGITILLITHEMNVIQRICDRVAVMEHGAVVES
FT                   GTVKDIFTNPQHVTTKKFVNSAFAAKIPAEVQKELQRTGEIVTLSFIGNSSGEPALAVA
FT                   TKRFQVYPNILSGNITQLKHEAYGKLVIHMQGEQNEINHALSFLQEQGIIVEGGRTDYG
FT                   KQVLFG"
FT   gene            complement(176263..177075)
FT                   /locus_tag="BAS0177"
FT   CDS_pept        complement(176263..177075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0177"
FT                   /product="ABC transporter, substrate-binding protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52513"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52513.1"
FT                   /translation="MKKVLLSIVSGAVLLLGACSAGSDKEVKALDEKKITVGVTGGPHE
FT                   QIFEKVKEVAAKDGLEIDVKVFNDYVAPNVSLDEKSLDVNSYQTKSYLDVFKAERNMKL
FT                   TEVFSTVTFPMGVYSKSLKDVKDLKDGDAIAVPNDPTNELRALKLFEKAGVLKVDPKAT
FT                   EKATAKDVIENPKNLKIVELEASQLPTQLSEVKAAAINTNFALGAKLSPAKDSIFREGK
FT                   DSPYVNWVVVRTENKDDAVVNKLKKAYQSKEVKEFIEKKFDGSVLPSW"
FT   gene            complement(177355..178263)
FT                   /locus_tag="BAS0178"
FT   CDS_pept        complement(177355..178263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0178"
FT                   /product="alcohol dehydrogenase, zinc-containing"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52514"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52514.1"
FT                   /translation="MKAIICTQYGPPNVLQLQNIEKPIPKKNEVLVKIHATSVSTGDCR
FT                   IRGFNSPLLFWIPMRLILGLRKPRNPILGVELAGEIEDIGTDVTQFKKGDQIFALTELN
FT                   LGGYAEYTCVHESGLITLKPTNVTYEEAAVIPFGGTSALHFLRKSRIKKGQQVLIYGAS
FT                   GSVGTAAIQLAKYFGATVTAVCSNSNFELVQSLGADKVIDYTKEDFTKRRERYDIIFDA
FT                   VGKHKKSLCKQVLAPNGKYVSVNGMMAKVSKEDMILLKKLTETEHLKPVIDRTYRLEEI
FT                   AEAHMYVEIGHKKGNVSITLK"
FT   gene            178409..179173
FT                   /locus_tag="BAS0179"
FT   CDS_pept        178409..179173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0179"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52515"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52515.1"
FT                   /translation="MKKIIFVSSLVLAISLGVGCSNEKTAKTDEPKKESVQKEKELTAK
FT                   DVFKKTNEAFKNEEHVTMTYGVGVKAEGTEMDIVKAKMQLEPKTKNSRSEMNISGTDVV
FT                   VYTVDGKVAGEVKKPNTGEVITVPEEQLNAGGMKATQDIIDKLEVPEVVLDKMKLEKSG
FT                   DKYKLKFTLKGQETESMLTSMDETQKKMLQAQNAKIEEVDAEYIITKDFKYESAKIDMI
FT                   MSSNGKDKAHIITNAKYTSYEKFDPIQLPAAK"
FT   gene            179285..180721
FT                   /locus_tag="BAS0180"
FT   CDS_pept        179285..180721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0180"
FT                   /product="oxidoreductase, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52516"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52516.1"
FT                   /translation="MKKGKIAVVTVAYTVLLATSVHTYKKQLDHPIMSDVGKLLPTKIK
FT                   RVESATDEHSLIKLVQDANVSGEKISIAGMQHSQGGQTYYPHGTMLDMKGYNKILEFDP
FT                   EKKRITVQSGVTWNDIQKKVNPYGLAVQVMQSQNIFTVGGSLSVNVHGRDIRHEALIDT
FT                   VESFRLLMADGIVRNVSREENADLFPYVIGGYGLFGVILDVTLKLTNDELYETHTKMLD
FT                   YKEYTSYFKEKVKKDANVRMHLARISVAPNSFLREMYVTDYTLAQNQNMREEYSELKEE
FT                   TIIAAPKFLLGLSRYSDWGKNTFWDIQRSYFERTDGKYETRNNVMRSDSTFMEYENPNR
FT                   TEVLQEYFVPIDSFTEYIDDLRNVLNEEEFNLLNITIRYVEKNENAVLSYAKDDMFALV
FT                   LLINQGRSENEIKKTEGVIQKMIDVTLKHNGSYYLPYYSYPTKEQLKRAYPRIEEFLGK
FT                   KKEADPKERFVNLFYREYTK"
FT   gene            180718..181251
FT                   /locus_tag="BAS0181"
FT   CDS_pept        180718..181251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0181"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52517"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52517.1"
FT                   /translation="MTYRRFVASQSIIMMAGSMVFPFYILLLRNVGNSFSQFGWAYGLF
FT                   ALTSALVYPLVGKLSDRVGDQKLLIIYAWTMAILMLCFPIATEVWHVYILQILMGVLGA
FT                   VQRNTEKTSLARKVVQENAGYEIGKYHVWTSIGGAVAIIATGYLVDFFTIGTIFYIASI
FT                   LYVVSGVVLSSKKI"
FT   gene            181330..183051
FT                   /locus_tag="BAS0182"
FT   CDS_pept        181330..183051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0182"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52518"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52518.1"
FT                   /translation="MKFLILAILTLFLIPWTRRSGSKLRAVDKKGDEKVVKGKKSSILV
FT                   IPVLFWIGIAIYEYFWLIDDRADSILTHYSVAVAILIGLVLFSQDQIGKLEGTLKGLLM
FT                   FVLLASYGYFGYLHDIVISQTKYDSVVKIEKDISEPFTENDQPFTVPPKTAENKMKKVF
FT                   GDIPKVAYFELGELTPQMVNGEALYVAPIEVSGFFKARKAETIPGYVTMSGTNPDAEAK
FT                   LHLGYKMKYVPSMFFGNNLERVVRQAEPNLIFKGKPKFEVDDKGKPYYTMTYGEFISGR
FT                   SGFEIEGVVVVDAQTGEVKRYDKGKAPKFIDGVLNHETASTLNTYFGKYIHGFWNTKFS
FT                   QTDMKIPTEWGTKEGVTPIFGKDGTLYYFTDFTSPKEGVDSALGYSLIDARTGKLYYYN
FT                   GKEVKGIMDGSAASEVVDNSFKREKWHGTMPVIYNVYGKPSWIVPVIDDGGLVRAHTVI
FT                   YASNAKIFATGSTQKEALENYKNALSGSGDSFRPTSSSKEAQKEGVVQRVYKEKTGENT
FT                   IVYVLLENEQKVFMIPAKKFPYAMFTEVGDPIQITYLDTGEAMSSVSKFTNSNLNK"
FT   gene            183179..184429
FT                   /locus_tag="BAS0183"
FT   CDS_pept        183179..184429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0183"
FT                   /product="drug resistance transporter, Bcr/CflA family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52519"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52519.1"
FT                   /translation="MNEVNQEIYKPVKTNRLWMILVLGTLTAIGPLSIDMYLPSLPKLT
FT                   DDLQTGASLAQLTLTACLLGLSVGQLFVGSISDIYGRRKPLIIALIIYVASSLLCAVAP
FT                   SIWTLVLLRFLQGASGSAGIVISRAMVRDMYSGSEMTKFFSLLMLVNGAAPILAPIIGG
FT                   QLLQFTTWRGVFIVLGAISVFMLISATFVLRETLPPEERETGGLSGTLATYGKLLKDRL
FT                   FMGYALSQGLVTAAMFAYISGSPFVLQNIYGASPQQFSLFFAINGIGIIIASQVTGRLA
FT                   GKVNEKTLFVSGIVIAAVGGLSLLLTILLGIGLIGVLCSLFLVVSSVGVVSTTGFSLAM
FT                   RNQKQAAGTASALLGLLQFISGALVAPLVGIGGSNTALPMGIVIALCEIGAVLCYLFMA
FT                   RRSEKQFELQARQNLEV"
FT   gene            184680..185180
FT                   /locus_tag="BAS0184"
FT   CDS_pept        184680..185180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0184"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52520"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52520.1"
FT                   /translation="MKKALGIAVMGSMILLAGCNGSKDTKEPKEKVEQSTEQTEEMKEY
FT                   RAVHEKYDLKMNKEINNALQLFEVAKEKGGKEITTATYKEDVQKVTTSMLEDIDHIRKE
FT                   IRVPKSKEQEHEVYVGFLNESEQAMKKLQKLAKEDSSLIRDIEINFATASTYYKRFQAE
FT                   TKK"
FT   gene            complement(185197..185412)
FT                   /locus_tag="BAS0185"
FT   CDS_pept        complement(185197..185412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52521"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52521.1"
FT                   /translation="MDPLLLATIGLPLTIVILVIIGFYKLFIKKKSITSFYTPFDNITG
FT                   QTISEFHEEQKVLVSEDEDGDGKKKK"
FT   gene            185821..186744
FT                   /locus_tag="BAS0186"
FT   CDS_pept        185821..186744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0186"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52522"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52522.1"
FT                   /translation="MEVYVIKKLSVMVFTLWVITTVTFLIMHIIPGDPFSSDAKIFPEE
FT                   VIQNMRAKYHLDEPLWNQYVAYLDGVVHFDFGESVQSTGQGVSEIITTGFGPSAIIGLQ
FT                   ALIISLLVGIAAGTFAALYHGKVIDYSVSLLAILGISIPSFILAPLFIQVFAIQFELLP
FT                   VASWGTFEHTVLPSFALALGPIAVITRFVRSNMIEVLQSDYIKLARAKGIPIKKIIIRH
FT                   ALRNAIVPVLTFVGPLMAGLLTGTFVIEKIFSIPGLGKYFVDSIFNRDYPVIMGTTIFY
FT                   SALLILCIFITDIIHRIVDPRIRSIT"
FT   gene            186761..187765
FT                   /locus_tag="BAS0187"
FT   CDS_pept        186761..187765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0187"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52523"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52523.1"
FT                   /translation="MGAYEINNQLLTNEEKKELTINKDQQKISRKKEVFRKFVSNPIAV
FT                   LGSVTLLLIIVFSLIGESLTPFTASEQVKKATNLPPSSEHWFGTDDLGRDIWARTWAGG
FT                   KISLTVGLVAAALDIGLGVLIGGFSGYVRGRNCLGTLIDEWIIRGIEVLYGIPYLLIVI
FT                   LLLIVMKPGLFTIIIALALTGWIGMARLIRAQVLSLKQREFVIAAERLGTSHMKIIYGH
FT                   LIPNLTGIIIVNLSFTIPAAIFSESFLSFIGLGVQSPAASWGTMTNDALGTLLSGEWWQ
FT                   LFFPAIMIALIMFAFNAIGDGLQDAIDPKIIKRNRKEKKHGASLIFRKRNISR"
FT   gene            187722..188732
FT                   /locus_tag="BAS0188"
FT   CDS_pept        187722..188732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0188"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52524"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52524.1"
FT                   /translation="MAQVLSLENVTLAVEKENSKQAIVKHVSFFINEGEIVALVGESGS
FT                   GKSVTAQSIIGLNQESIQFDDGNISFESKDLTNLQESEWNQIRGKDISFIFQDPLSSLN
FT                   PTMKVGRQITEVILQHEKKSKKEAKEIAINLLNDLGIHEAEKRFEQYPHQLSGGMRQRI
FT                   CLAIAFACHPKLVIADEPTTALDVTIQKQIMGLLKERKEKQNTSILLITHDLALVREVA
FT                   DRVVVMYGGRIVEKGTIQEVIGSPKHPYTKSLLQAIPNMDDAEKVLRAIEGTTPSIETL
FT                   NSFGCPFVNRCPVAIQECIHRFPERTTYSAEHSSHCWQHVLEHDRAKSKEKVNVS"
FT   gene            188729..189502
FT                   /locus_tag="BAS0189"
FT   CDS_pept        188729..189502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0189"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52525"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52525.1"
FT                   /translation="MTTDLITVKQVTKTYGSKNKEIAALKDISLAIPKGTTLGIIGESG
FT                   SGKTTLGKLIAGIESPTSGEIDYNGQVVHKLKAAHKRDFLQKVQFIFQDSTAALNPRWK
FT                   VRDSVTEGYISFGLGDKGLKDKVAGDALERVGLDRRYINRYPHEFSGGQRQRIAIARAL
FT                   LCEPEVLILDEPISALDVSLQIQIVHLLQKIQREQGYTYLFIAHDLPMVHYLCEKVAVL
FT                   YKGELVEFGNTDEVFRNPQHSYTKTLLASTPKISG"
FT   gene            189516..191126
FT                   /locus_tag="BAS0190"
FT   CDS_pept        189516..191126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0190"
FT                   /product="oligopeptide ABC transporter,
FT                   oligopeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52526"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52526.1"
FT                   /translation="MKKFLLFVIMTVLAITSVACGKKETQKASAGKGEGDRLVTNISSD
FT                   PYTLDAAISTDSTSGYVIGHLFSSLYTQDSDGKYQNELAEKEEVNADGTEYTIHLKKDI
FT                   KWSDGSPITANDFEFAWKRLLNPKTGSMNATEMYFIKGAEAYNTGKGEEGQVGIQVVDP
FT                   QTLKITLEHPVSSIKQKLASSLFIPLSKKSIDDNNKLKTNPKELITNGPFTLKEWKHNQ
FT                   AITVQKNKEYYDKKVTLKEIEFRIIPDSKTAYQLYKSKELDLLSGLPQEMIEKEKGNKE
FT                   YKRVAGFSSYIYSFNVEKEPFTNAKVRKAFSLAVDRKFIVEKLYKNNAQEAYAFVPEGA
FT                   KTQGGRDFRKEKGDYVKFDPEEAKKLLEEGMKEQGWSTLPAVTLKFTTDTQHKKVAEAM
FT                   QEMFKKNLGVDIKLENKEWKSYIDTYKQSDFQLAYMGWGGSLLDPITKLDLYAGDGLNN
FT                   YAKWHNKEFDALVKEAEVEQNEDKRFDLLHKAEDIMFTDSPLIPIIFPSDSYLQKESVS
FT                   GLQYYVGSKPDLRYVKIKK"
FT   gene            complement(191143..191610)
FT                   /locus_tag="BAS0191"
FT   CDS_pept        complement(191143..191610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0191"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52527"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52527.1"
FT                   /translation="MRTLLSVLLALMLVPALTGCKAPAKEDTTSNKKTTEEAKNETPAD
FT                   LKLNFNEFSLDADYQDTKKDYEADYKNVAADKKMEAKIEDHKADVNLTGDEAITKLSPL
FT                   LQELKFDKGTPDQEVIDQVLNVFKLDKDYQKFELEVVFSDGTKKEYKREIK"
FT   gene            191782..192681
FT                   /locus_tag="BAS0192"
FT   CDS_pept        191782..192681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0192"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52528"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52528.1"
FT                   /translation="MHEEYKEMIKKAIEYIENHLHEELTTERVASHSAVSMYHFHRIFQ
FT                   RYIGMSVTDYIRKRRLTHAAQVLVSTERAVIDIAMQYGFSSQEAFTRAFKRMFQLPPKK
FT                   YRKYFQSFYIEREGVSMQKGIPKGWILSGSHPAEYEMGLDYEVVHQGKVSAYIKAKENV
FT                   THGGFSTLMQMFRADKYVGKRLRFTAFVKSENVRDWAGLWMRVDGKETEPFAMDNMQNR
FT                   PIKNTNNWQSYSVVLDIKEGALGIAFGVLLSGEGCVWLDSIRFDEVDEKIPTTDLAENF
FT                   YETLLEEPVNLQFEEVEK"
FT   gene            192700..192891
FT                   /locus_tag="BAS0193"
FT   CDS_pept        192700..192891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0193"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52529"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52529.1"
FT                   /translation="MLKYVKLISISLVISSCIMGINYLVSYIWSGHTPSLTWKTYLMFL
FT                   FIFMMSFSSMQKEGEEDY"
FT   gene            192958..193236
FT                   /locus_tag="BAS0194"
FT   CDS_pept        192958..193236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0194"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52530"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52530.1"
FT                   /translation="MIFNIISLSLQLVSSGVIVPHEMLSKTYQTIGELFPATYAANGYY
FT                   TIIFGGVSLERNIISLLVIVLVTQSVAVMTLAIKGIVKGRSSVVKEA"
FT   gene            complement(193281..194921)
FT                   /locus_tag="BAS0195"
FT   CDS_pept        complement(193281..194921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0195"
FT                   /product="oligopeptide ABC transporter,
FT                   oligopeptide-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52531"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52531.1"
FT                   /translation="MKKKVVPVVASVLGASLLLTACGGNKDNASGAKANDKAPDKQAIN
FT                   LSFASEIPTMDVAKATDGESMNVMRNVFEGLYAMGEDNKPIPGVAESVDVSADKTKYTF
FT                   HLRDSKWSNGTPVTAKDFVFAWQRAVNPDTAAEYAFLFFDIKNAKQINQKQLPVDQLGI
FT                   KAVDDKTLEVQLDRPVPYFLSLTTFSTFLPINEEYLKSQGDKYGLETNHLIYNGAFTLD
FT                   NWKHEQSFQLKKNPNYWDAKTVKLEEINFNVVKDKSTEVNLYDSGQIDRVALTAEFVDK
FT                   YKGDPNFKERAEVGIQFLRLNQKNETLKNQHARLAINGAMNKKAYVETILNNGAVPAEG
FT                   MIPAKFAKSPDGNDFRKENGNLVKDDVKTAKENWKKAKQELGTDKVTIELLTSDNALAK
FT                   KTGEYLKGELEKNLDGLTVNLKPQPRKQQLKLLLSGDYEIGIDGWGPDFADPITFLDLF
FT                   TTDSAYNFDKYSNKEYDELIHKVKTDLAGDEKARFEAMKQAEKILLQDGAVAPLYQQGR
FT                   SYLQRSFIKGLVTTDFGGEFNYKWTEVAK"
FT   gene            complement(195309..196949)
FT                   /locus_tag="BAS0196"
FT   CDS_pept        complement(195309..196949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0196"
FT                   /product="oligopeptide ABC transporter,
FT                   oligopeptide-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52532"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52532.1"
FT                   /translation="MKKKFVPGIASVVGVSILLTGCGSYKNEASGANAKDEAPSKQVLN
FT                   LSSPTEIRTMDTARATDTDSGQVMRNVFEGLYNLGEGNKPIPGVAKSHEVSGDKTKYTF
FT                   HLRDSKWSNGTPVTAKDFVFAWQRAVDPATASEYAFLFFDIKNATKINNKELPADQLGV
FT                   KAVDDHTFEVELERPVPYFISLTAFPTFLPINEEFFKAQGDKYALEDNTILYNGAFTLS
FT                   DWKHEQSFKFKKNPTYWDKDTVKLEEINFNVVKEKSTEVNLFESKQLDRIKLTSDFVDK
FT                   YKKDANFKERPNVGVQFLRMNQQNKVLQNVSARQAIDQTIDRKSFVNTLLNDGSTPTFG
FT                   LVPKNFAKGPDGKDFRTINGDLTKVDTKSAQELWKKAKQELGSEKITLELLTSDADLDK
FT                   KTGEFLKGQLEKNLDGLTVNVKPQPRKQQVSLLLKGDYEIGIDGWSPDFADPITFLELF
FT                   TTNNPYNLDHYSNKEFDKTIEKVKTTLAGDEKARWEALLASEKILFKDSVIAPLYQKGE
FT                   SYLERSYVKGIVQVDFAGQLNFKWAQIEK"
FT   gene            complement(197341..198174)
FT                   /locus_tag="BAS0197"
FT   CDS_pept        complement(197341..198174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0197"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52533"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52533.1"
FT                   /translation="MSLTSLKDYTTLHNGVKMPWFGLGVFKVEDGSQVIDSVKAAIKNG
FT                   YRSIDTAAIYQNEEGVGQAIRESGVSREELFITSKVWNSDQGYETTLQAFETTLEKLGL
FT                   EYLDLYLVHWPVKGKYTESWKALEKLYKDGRVRAIGVSNFHIHHLQDVFEIAEIKPMVN
FT                   QVEYHPRLAQEELHAFCKEHNIQLEAWSPLMQGQLLDNPTLQDIAKKYNKSTAQIILRW
FT                   DLQNEVVTIPKSIKEHRIIENANIFDFELSSDDMKAIQALNEDHRVGPDPDNFNF"
FT   gene            complement(198242..198979)
FT                   /locus_tag="BAS0198"
FT   CDS_pept        complement(198242..198979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0198"
FT                   /product="pyrroline-5-carboxylate reductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52534"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52534.1"
FT                   /translation="MLTKHRILFIGAGRMAEAIFSGLLKTSKEYIEEIIVSNRSNVEKL
FT                   DQLRARYNVSTTTDWKQHVTSVDTIVLAMPPSAHEELLAELSPLLSNQLVVTVAAGISP
FT                   SYLEERLPGGTPVAWIMPNTAAEIGKSISLYTMGQFVNETHQETLQLLLRGIGTSQLCT
FT                   EEEVHQLTAVTGSAPAFLYYFAESLIEATKSYGVDEATAKHLVIQMISGSASMLEQTQD
FT                   PANLREQVTTPGGSTAEGLKALY"
FT   gene            199167..199817
FT                   /locus_tag="BAS0199"
FT   CDS_pept        199167..199817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0199"
FT                   /product="nucleoside transporter, PnuC family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52535"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52535.1"
FT                   /translation="MIRSPLFLLITSIICVLVGLYIQSSYIEIFASVMGIINVWLLARE
FT                   KVSNFLFGMITVAVFLYIFITQGLYAMAVLAAFQFIFNVYGWYHWIARSGEEEVKATVR
FT                   LDLKGWIFYIIFILVAWIGWGYYQVHYLESTSPYLDALNAVLGLVAQFMLSRKILENWH
FT                   LWILYNVVSISIYISTGLYVMLILAVINLFICVAGLLEWKNNYKGQKHTNNYI"
FT   gene            complement(199885..200736)
FT                   /locus_tag="BAS0200"
FT   CDS_pept        complement(199885..200736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0200"
FT                   /product="transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52536"
FT                   /db_xref="GOA:Q81VJ7"
FT                   /db_xref="InterPro:IPR010651"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VJ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52536.1"
FT                   /translation="MDILLALLPAIAWGNILLVSVKMGGGAYSQTVGMTIGALFFATIM
FT                   YVFTQPALTMTILIVGFISGLFWALGQVNQLKTVEKLGVSTTVTISTGMQLVATSIFGV
FT                   IAFREWTTTTTIILGTIAILLIVVGVVFTSLDDKENAQPPGQLKKGLLTLIVSTFGYLV
FT                   YVIIIRWYNIDGWSAILPQAVGMFVGAVVLTSKHKPFNKYAIRNALSGLLWGTGNLFLL
FT                   LSLPRVGVATSFPLSQTGIVISTFGAIVFLGEKKTKRQLIFIALGSVLIIGGAVLLGMT
FT                   KA"
FT   gene            complement(201023..201712)
FT                   /locus_tag="BAS0201"
FT   CDS_pept        complement(201023..201712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0201"
FT                   /product="molybdenum ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52537"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52537.1"
FT                   /translation="MSFDIILSPIFLSLRVAACATIIVTILGTIIGRALARSSWRYKVI
FT                   LETIFLLPMVLPPTVIGFFLIIIFGNNSPIGMWIESIFQQSIMFTSTAAIIASTVVAFP
FT                   LMYQSAKTGFSIANVQIEESARDLGASEYQVFLHVTLPLAFPALLSGMILSFVRALGEF
FT                   GATLMFAGNIPGKTQTIPTAIYMAIDASNMQLAWTLVVITISMSLLFLLCIQLINKRIT
FT                   NSSGSFF"
FT   gene            complement(201718..201972)
FT                   /locus_tag="BAS0202"
FT   CDS_pept        complement(201718..201972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0202"
FT                   /product="molybdate-binding protein (carboxy terminus)"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52538"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52538.1"
FT                   /translation="MRQVLTYVETGNVDAGIVYKTDALISDKVKIGETAATTSHEPIHY
FT                   PLGVIKESKHKKEATSFYEYLQSKDAQSIFKKYGFTVLP"
FT   gene            complement(201957..202523)
FT                   /locus_tag="BAS0203"
FT   CDS_pept        complement(201957..202523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0203"
FT                   /product="molybdate-binding protein (amino terminus)"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52539"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52539.1"
FT                   /translation="MNKFTLRSIGALILSFLLIFSVACTSGDKKEKSTATEGKTVELTI
FT                   SAAASLQDALKEIETKYKEKEPNIKLSFNFGASGALQQQIEQGAPADLFFSAAEDKFQT
FT                   LVKKGFINEKEGKNLLGNELVLVVPKDSSLTKIQDLKDEKIKKSHLAHLNLYLRENTQK
FT                   LLSHMKIFGMTFKIKSYLQKMCAKC"
FT   gene            202685..203605
FT                   /locus_tag="BAS0204"
FT   CDS_pept        202685..203605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0204"
FT                   /product="molybdopterin biosynthesis protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52540"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52540.1"
FT                   /translation="MDHHSYTTEEVAKRLKVSKLTVYDLIKKGELPSYRVGRQMRIDAA
FT                   DLEQYIKQMKTGKVQVTPVKNDSNSISNTCIISGQELTLDMLAKRIENRLPSSNILRAY
FT                   QGSLTSLVKMYQGEGSIVSLHLFDGETGTYNVPYVKRILVGQPCTMINLLSRNVGFYVQ
FT                   KGNPKNIKTWADLSQSSIRFVNREKGSGIRVLVDEQLRIQNLNKERISGYEWEESNHLG
FT                   VATQVANEKADVGVGSEKFSQIVNVDFIPIMKEQYDLVILKNKENEELIEVVKDILQSE
FT                   EFHNELKAIGGYDMTKTGQIIYEIK"
FT   gene            complement(204178..205044)
FT                   /locus_tag="BAS0205"
FT   CDS_pept        complement(204178..205044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0205"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52541"
FT                   /db_xref="GOA:Q81VJ1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VJ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52541.1"
FT                   /translation="MELRDLQIFQSVADQGSVSSAAKELNYVQSNVTARIKQLENELKT
FT                   PLFYRHKRGMTLTAEGRKMLVYVNKILQDVDELKQVFLDSETPSGILKIGTVETVSTLP
FT                   TILSSYYKSYPNVDLSLQAGLTEELIREVLDHQLDGAFISGPIKHPLIEQYDVSTEKLM
FT                   LVTQNKTFHIEEFTTTPLLVFNQGCGYRSKLERWLKDEGLLPKRIMEFNILETLLNSVA
FT                   LGLGITLVPQSAVHHLSKAGKVHCHAIPEKYGSISTVFIRRKDSYMTNSMRSFLKTIEE
FT                   HHHINML"
FT   gene            205187..206140
FT                   /locus_tag="BAS0206"
FT   CDS_pept        205187..206140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0206"
FT                   /product="transporter, EamA family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52542"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52542.1"
FT                   /translation="MIIGALACLIASMSWGAMFPVADHALEYIDPFYFSLIRYGAVAIM
FT                   LIILLLMKEGKQAFRLEGRGKLLVFFGTMAFTVYNVLIFLGQMLMGKSGVMVASIMEAL
FT                   MPMISICILWGYKHVKPKKYMITSMLIAFIGAVFVITKGDMSFFLTLKDNMFSLACIFV
FT                   GVVGWVIYTMGGQTCSDWSTLRYSTLTCVFGTTVTGIITIIITAFGYVSVPNMGTISIV
FT                   KYDLLFMMTLPGIVALLAWNYGVKILSSINGILFINFVPITTLVIMMMQGYQITMFDIV
FT                   GTLLVIAALIRNNVCQRKEENINKRILEKEQLRQAV"
FT   gene            206670..207275
FT                   /locus_tag="BAS0207"
FT   CDS_pept        206670..207275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0207"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52543"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52543.1"
FT                   /translation="MYKPITFSLKYIFKTAGKVEVQGREKLPEGGPYVVACTHTSFMDV
FT                   LMLATGMYPTEIHYMAKKELFEGKFKNWFFKNVNAFPVDRANPGPSTLKIPSRLLKEGK
FT                   VVGIFPSGTRSTEDVSLKAGAVTIAMRSNVPLIPAAYIGPSSVKELIKGKRAQLIFGDP
FT                   IQIDAEEQIDRKTAMKMMTDQLNEKFEGLKEALQSNQK"
FT   gene            207750..208727
FT                   /locus_tag="BAS0208"
FT   CDS_pept        207750..208727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0208"
FT                   /product="sugar-binding transcriptional regulator, LacI
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52544"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52544.1"
FT                   /translation="MANIKDIAKMAGVSVTTVSRVLNDHPYVSEEKRKAVIEIVEKLNY
FT                   SQNANAVHLSKGKTNIVGVILPYINHPSFDAMVGGMMEGALTHNYRVLLCQTNYNKKEE
FT                   MKSLHMLKTKQLDGLIICSRANDWEIIEPYASYGTIIACEDNDISNISSVYTNHSAAFQ
FT                   LGMNHLIEKGYKKIGYCTGRKLGPSSQKRFDVYKQQLQSIDEEVNEEWIFTECFTLEDG
FT                   VRVAHKLKGMQNLPEALIVAGDEVAIGVMTEVGKLGIQVPEDLAIIGLDNQPISQVLQL
FT                   TTIDQNLKEIGKTAFEMFYRHISDKSSKQEKVEIPYELVERSTV"
FT   gene            208876..209205
FT                   /locus_tag="BAS0209"
FT   CDS_pept        208876..209205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52545"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52545.1"
FT                   /translation="MNELLLSVKKYLENDENIVAFVIGIFEKDNFTLCYQHGIFVATTR
FT                   RLLFYGKFPYYPSTFKEYSYLHIDSIDFCPYFEFTCNHETVRAKCIQKGNVEQFVRTVR
FT                   TNMNN"
FT   gene            209324..210160
FT                   /locus_tag="BAS0210"
FT   CDS_pept        209324..210160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0210"
FT                   /product="yitT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52546"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52546.1"
FT                   /translation="MVNQRIKEITLITIGSLLFAIGINYFAIPNRLSEGGIIGLTVVTY
FT                   YLFDWSPGIVNFAINAILLAIGYKFFDKKTMVYTILGIVETSLFLYVTEHIEYHVNSDT
FT                   LLAALFAGLFVGIGLGCMFKAGGTSGGSAILAQLANQYLGWSVGKGVLIIDIVVIAGSV
FT                   FIIGQEKAMYTLVAVFIGAKVIDFIVEGMDTKTAVTIISNQPDLIREAITKNMTRGVTV
FT                   LEGRGGYTGKNKEVLYVVINKQELVKLKQVISRVDEDAFVVIHDVRDVLGGGFKAS"
FT   gene            210298..210654
FT                   /locus_tag="BAS0211"
FT   CDS_pept        210298..210654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0211"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52547"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52547.1"
FT                   /translation="MKKKMITTIIAMLVIVVMLLPTKLGPVIDKYNPFYKTKEYYTVVN
FT                   TIGQHVGDEWYEYEFIAFDERGKEQKIKKTVKHMLKRDEMLKVYAKGRYGELIEEIEAV
FT                   NIPINAKSKLLSMR"
FT   gene            211398..212162
FT                   /locus_tag="BAS0212"
FT   CDS_pept        211398..212162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0212"
FT                   /product="deoxyribonuclease, TatD family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52548"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52548.1"
FT                   /translation="MKWIDSHIHVDQYKDEEKSRLLKDVENSKEIQGLIAVSMNYQSSK
FT                   EILSLAKRYSFVHPAVGFHPEQPIHKEECEKIYKLIEDHVEDIVAIGEVGLPYYLRKED
FT                   EHIAINSYISVLQRFVELASKYDLPIVLHAVYEDADVVCDLLEKHKVSRAHFHWFKGSE
FT                   TTMERMMRNGYYISITPDVLHKEKIRKIVSYYPLEYMMVETDGPWGFQEGVMTHPGMIR
FT                   EVLKEISVIKNVAVDKVAETIYENTIQFYLKG"
FT   gene            complement(212265..213914)
FT                   /locus_tag="BAS0213"
FT   CDS_pept        complement(212265..213914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0213"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52549"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52549.1"
FT                   /translation="MKKWLLLLFSLLLLIPVPISAQKNENPKVLILYSSSDDQITSDTQ
FT                   ILNTQVGHFTNNITIKSIKQLAEITDKSSYTHVIYIGEKQEELPTETKEFLENFSGPLL
FT                   VLGQNIEKLSKRFSFITLKNEDINSDTIEYPTRKLKNTLEDERSIKILDTNGTILANAL
FT                   KGKNTYPLIVQQNNSYYVATPNLFDWMSHYIGEVLFSYFGQKPTNNKVEAYLRLEDVHP
FT                   AADINQLKEIAELLKEKKMPYMITVIPVYTDPETGKTLHLKDKPELVDLLRSMQDDGAT
FT                   IIMHGYTHQFYDSETGEGFEFWDVKTDQPIRQPKHEKPKTKDDFPNIEAYNTYVKKGEE
FT                   FEEKYTTDHIEKGIQELVDAKLYPVAFEAPHYTMSQKGYEILSRYFSTYVGQLQLSDTT
FT                   WKSMHSPAYRSTPSFLNGMKLMPETVGFIEEDKPHAIAKMKANAVSVAKLSDGVIGAFY
FT                   HPYLGVKPLKEVLKDLESIPNIEWIDLQKETNEVKMKDIHITTNKDGIHVEKPTSASDV
FT                   MDYIKQYGFFLILGFLVIVFLLLLRRAKKLES"
FT   gene            214165..214698
FT                   /locus_tag="BAS0214"
FT   CDS_pept        214165..214698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0214"
FT                   /product="invasion protein IagB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52550"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52550.1"
FT                   /translation="MKKFFVGFLVVLGVYLYFQGKSEGMGKLVNETSYVDSEEAKQMKQ
FT                   IIIEEAKKVNLPEWIPLTIAEHESRLNPRSVGDNGTSFGLFQLHRGGGLAPDHLTDDEL
FT                   KDPRTNAQIAMPHLMKGYKRGVQKGLTDFALLKYIANTSGWPGNLGPEWTDNNMKYNVG
FT                   LEDVYYRNKGIIKE"
FT   gene            complement(214714..215496)
FT                   /locus_tag="BAS0215"
FT   CDS_pept        complement(214714..215496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0215"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52551"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52551.1"
FT                   /translation="MDTQQLYFLNDIGKQKPESIRNRSAACPFCDRENLTDILATEGPI
FT                   IWLKNKFPTLKDTFQTVLIETDNCEDHIATYTEEHMRSLIRFSVKHWLDLQKNEEFKSV
FT                   ILYKNHGPFSGGSLHHAHMQIIGMKYVNYLDNVEQDNFQGVIVQKNKNIELNISDRPII
FT                   GFTEFNIIVKDIECIDEMANYIQQTVRYILTDFHKGCSSYNLFFYHVSGKIICKVVPRF
FT                   VVSPLYVGYKIPQVSTKLEDVKIQLAEYFTKRHDDPQK"
FT   gene            216123..216314
FT                   /locus_tag="BAS0216"
FT   CDS_pept        216123..216314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52552"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52552.1"
FT                   /translation="MGKYNKEVSIKFRTKEVNEMKRSLAARAKFLDFIYFCRAIFHDVV
FT                   VNGIRLSFFNNCIVAIER"
FT   gene            216439..218319
FT                   /locus_tag="BAS0217"
FT   CDS_pept        216439..218319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0217"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52553"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52553.1"
FT                   /translation="MTICSVNNVTKSFGGNIIFENISLEIKNGERVGLVGRNGSGKTTI
FT                   FQLLTGMESLDAGAIHMKKGTRIGHVAQIPKFDESMTVYEVLSSAFKIEKELEREMRTL
FT                   EKDMAEEQESSVLQKLMERYGIIQEKFAFLGGYEIEANIMKVANGLQVTELFPRSFLEL
FT                   SGGEQTKVSLAYMLLQKPDLLLLDEPTNHLDLFAVEWLEQFLKEYNGTVMVISHDRYFL
FT                   DEVVTKIFDLEDGEIHVYHTNYSRFVEEKEERLLQEFQAYQEQQKKIKKMKEAIKRLRE
FT                   WANQANPPNEGLHKRARSMERALERMQKLKKPILERKQIGLQFEGQDRSGKDVVVIKEV
FT                   SKGFADHPLFNEVNLHVRFQERAAIVGRNGTGKTTLLKLLLEEIEPDAGEIRIGSSVKI
FT                   GYLSQHAYGNMKSDVLEAFREYVAVTEGEARHILAKFLFYGPAVFKKVTQLSGGEKMRL
FT                   RLAQLMYQDINFLILDEPTNHLDIESREVLEEALEQYNGTILAVSHDRYFLNKLFEKTY
FT                   WIDEHKLFEFAGNYAWARQKWEERLETQVIKQQRQGRKSIETAPVKKKEARNIEEIETE
FT                   LMHVEEDIYTLECTMEHVVDIKRLEQLYEEKTKKELLRAELYNELENIVE"
FT   gene            219276..220955
FT                   /locus_tag="BAS0218"
FT   CDS_pept        219276..220955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0218"
FT                   /product="oligopeptide ABC transporter,
FT                   oligopeptide-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52554"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52554.1"
FT                   /translation="MLSACGGQEDTASTEPVKKQDLKDAKIESIPATDKKKSPEKANQR
FT                   KDTFITAISKPGGVFLPYFQENGWDGNVTSVIFASLVTTDKQSKPIPDLAEKWDISADQ
FT                   LTYTFHLRKNLKFSDGSPLTADDVAFTLTLLHDKAYEGGLDIAQYAVKGGKEYKEGKTT
FT                   SIEGIQVVDPQTIKITTEKVNSQALTNLGGPVLSKAYYGKDYKQNTSLDYLKALYGQPI
FT                   AAGPYKFEKYVPGQEVRFVSNEHYYAGKPKIKNFIYKITSGDTGFQLFQTGELDYSGFR
FT                   ANPENIDQLKGLEFANINLESSSDIAYIYVNNKKSYLKDKKVRQALTYGLDRKKYVDTA
FT                   LQGYGSVANVPIAPVSWAYTEEGINKYPHDVEKAKKLLDEAGWKVGSDGVREKDGQKLK
FT                   LTYYASNTGKTNDIFIPIAKESYKEIGVELNPELMDFNTMLSKVGKGDYDLAAVSTPGI
FT                   SDPSEVVSEYLSTNPKSDTGYNNPKVDELIVKGIGTTDIEKRKAIYKELYKELYKELSD
FT                   DPPVILLNYRKLLYAHNARIKGIDPEKYDSISSNLPVLSIEQ"
FT   gene            221097..222020
FT                   /locus_tag="BAS0219"
FT   CDS_pept        221097..222020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0219"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52555"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52555.1"
FT                   /translation="MIPTLFGTSIIIFFLFALLPGDYIDSNPKLTPERAQELRELYGLN
FT                   KPIIERYFHWLVNALHGDFGFSLQYQEPVTSLLNKFIWNTFIVAVAALFFTWIIALIIG
FT                   VISATKQHSWFDRLVTIGVFAAMSFPSFFIGLFLIKLLAVDLKLLPIGGMIDIGSNSTG
FT                   IAYILEVLRHMILPVFILTLLGVGSLTRYFRTGMLDVIRQDYIRTARAKGLKERTVIYK
FT                   HALKNAILPAITLLAFELPGLFSGAIIIEQIFNWPGIGSIQLEALNFRDYTVLMAFTMF
FT                   LSCLTIMANFLADIVYAFVDPRIRLK"
FT   gene            222033..222956
FT                   /locus_tag="BAS0220"
FT   CDS_pept        222033..222956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0220"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52556"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52556.1"
FT                   /translation="METITPIIEKKKERKKRNESSPWRQAYKKIKKNKMALCGLYVLIF
FT                   MFLFSFIGPIFSPYADGKVQVTQINKPPSLSHWLGTDQLGRDILTRLMQAGRISLTIGL
FT                   ASMLLSVILGALLGAIAGFYRGVVDHLIMRVADVLMSIPGLPLLIIMGAILSEWKLPSE
FT                   YRLYVVMIILSLVGWPGLARLVRGQILTLREQAFMQAADVLGLKDSRKIIHHLIPNVFP
FT                   LLIVVATLGVAGSILSESALSYLGLGVVPPTPPWGNMISAANSLIDFQKRPWLWIPPGF
FT                   AIFITVVSINLLGDALRDALDPKMRR"
FT   gene            222967..223947
FT                   /locus_tag="BAS0221"
FT   CDS_pept        222967..223947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0221"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52557"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52557.1"
FT                   /translation="MSKAVVELKDLQTHFQTEEGTVKAVNHVSFSVREGETVCVVGESG
FT                   CGKSVTALSIMGLIAESGSVVGGDILYEGKSLLGMKEKELRSLRGNDIAMIFQEPMTSL
FT                   NPVFTVGEQIVETLREHELLSKNEAYKKAIELIRKVGIARADEIVHSYPHELSGGMLQR
FT                   IMIAVALSCNPKLLIADEPTTALDVTIQAQILDLLRQIKREFKTSILLITHDLGVVAEM
FT                   ADYVVVMYGGKVIEEAPVLEIFQNPKHPYTKGLLKSKPVMGKRIDKLYSIPGQVPNLVG
FT                   LDEFCYFSGRCEHCMEICKEEAPNLNVHDENHKVACWLYEERAGQ"
FT   gene            223944..224954
FT                   /locus_tag="BAS0222"
FT   CDS_pept        223944..224954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0222"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52558"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52558.1"
FT                   /translation="MSEPLLEVKNLKTYFPIKGGIFSRTVGHVKAVDGVSFTIKKGEVF
FT                   GLVGESGSGKTTIGKTILRLVQKTEGEVKFKGHDVHSLSKEELRKHRPNMQLVFQDPFS
FT                   SLNPRMRIGEALGEPMLAHGLATKENVREKVTEVLELCGLAPYHIDRYPHEFSGGQRQR
FT                   IVIARAMVLNPEFIVADEPVAALDVSIQAQIINLFSELQEKKGLSYLFISHDLSVVEHL
FT                   CTKIGIMYLGTIVETAPRDELFTNPLHPYTKALLSAVPIPDPTVKRERIILEGDIPSPA
FT                   NPPSGCCFHTRCPFATDICKQTGNSVMLVKSTLLLVIMYKREGLFQKLKESFFIY"
FT   gene            complement(224944..225636)
FT                   /locus_tag="BAS0223"
FT   CDS_pept        complement(224944..225636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0223"
FT                   /product="haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52559"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52559.1"
FT                   /translation="MERAMGAIVYVDGKVINSRCLQNDKVYKLAKLLESEGFPYKLYTN
FT                   KGVYSPYTWQDQVMQAFEENKHALDVTLEELERITEKQKKSNLITDFQKIEDVVNNPEL
FT                   EISKFFILTFNAGHRAQLLSMLQEDTDIMVTASAPTNLEIMDKNGHKGNGLKQMAAHFN
FT                   IPIEDTVAIGDNFNDVPMLEAAGLSVAMGNAEEDVKKLCDVVTLTNNEHGVAHAIEQFV
FT                   LKQTSSSK"
FT   gene            complement(225587..225904)
FT                   /locus_tag="BAS0224"
FT   CDS_pept        complement(225587..225904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0224"
FT                   /product="hydrolase (amino terminus)"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52560"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52560.1"
FT                   /translation="MRDKIQSFQDKFICFLYITMYNKNKEVVILKLIALDMDGTLLSSN
FT                   LEISKENLQAIQTAKEAGHIVMICSGRAKEDALKLLEEYKLSLPVGASNGGNCLCGWKS
FT                   N"
FT   gene            225922..226119
FT                   /locus_tag="BAS0225"
FT   CDS_pept        225922..226119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52561"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52561.1"
FT                   /translation="MIDSTLLMKDLSYFVTKVEGGMGMFRYMTVILHECYKRGFSRKCI
FT                   KSRFLKVFIKKRKKSVIKFT"
FT   gene            226839..227957
FT                   /locus_tag="BAS0226"
FT   CDS_pept        226839..227957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0226"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52562"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52562.1"
FT                   /translation="MKQKSMDTLAAQMEDFFPVRDVDHLEFYVGNAKQSSYYLARAFGF
FT                   KIVAYSGLETGNREKVSYVLVQKNMRFVVSGALSSDNRIAEFVKTHGDGVKDVALLVDD
FT                   VDKAYSEAVKRGAVAIAPPVELTDENGTLKKAVIGTYGDTIHTLVERKNYKGTFMPGFQ
FT                   KAEFDIPFEESGLIAVDHVVGNVEKMEEWVSYYENVMGFKQMIHFDDDDISTEYSALMS
FT                   KVMTNGSRIKFPINEPADGKRKSQIQEYLEFYNGAGVQHLALLTNDIVKTVEALRANGV
FT                   EFLDTPDTYYDELTARVGKIDEEIDKLKELKILVDRDDEGYLLQIFTKPIVDRPTLFIE
FT                   IIQRKGSRGFGEGNFKALFESIEREQERRGNL"
FT   gene            228024..228980
FT                   /locus_tag="BAS0227"
FT   CDS_pept        228024..228980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0227"
FT                   /product="fumarylacetoacetate hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52563"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52563.1"
FT                   /translation="MKFVTFRLPSKEMRAGWLEGDKVIDMNLASDGKLPSSMFAFLEKA
FT                   DEYVEVLRNIKNPEKGIYSLEEVQLAAAIPNPSSIRDFYAFEQHVKTARGRRGLDVVPE
FT                   WYDIPVFYFTNHRAVIGPNDVVIGPKKSEKIDYELEIACVIGKEGRNISREQAEEYIFG
FT                   YCIMNDWSARDLQATEMKVGLGPAKGKDFATSLGAHLVTKEELDVYRNGDRYELEMTAH
FT                   VNGKLLSKGNFQDIYYTFAEMIERASEDVTLYPGDVIGSGTVGTGCILELGTEEWLQDG
FT                   DVVELTITGLGTLRNTVKKEKEAGDEHVLSSHGGATS"
FT   gene            228946..230118
FT                   /locus_tag="BAS0228"
FT   CDS_pept        228946..230118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0228"
FT                   /product="homogentisate 1,2-dioxygenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52564"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52564.1"
FT                   /translation="MFYRHMGELPHKRHVQFRKKDGSLYREQVMGTKGFSGTQSILYHH
FT                   YMPTEVGHAALSHSCQLQYEEDVVLSHRHFRTKENKKSGDAVSGRNFILGNEDLLIGVV
FT                   TPTEKMNYFYRNGDGDEMLFVHYGTGKIETMFGTIHYRKGDYVTIPIGTIYRVIPDEGE
FT                   TKFLVVEANSQITTPRRYRNEYGQLLEHSPFCERDIRGPEKLETYDEKGEFVVMTKSRG
FT                   YMHKHVLGHHPLDVVGWDGYLYPWVFNVEDFEPITGRIHQPPPVHQTFEGHNFVICSFV
FT                   PRLYDYHPESIPAPYYHSNVNSDEVLYYVEGNFMSRKGVEEGSITLHPSGIPHGPHPGK
FT                   TEASIGKKETLELAVMIDTFRPLRIVKQAHETEDEKYMYSWIEEGSYTVK"
FT   gene            230352..231623
FT                   /locus_tag="BAS0229"
FT   CDS_pept        230352..231623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0229"
FT                   /product="major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52565"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52565.1"
FT                   /translation="MKNTWRELREMDRNVWIRFIGETLNGIAMMMLMPFFALYLKDKVD
FT                   SLLQVGVIMALSPIAASFGSIIGGRIADIYGRKPIMIFSMTSNALLMLGFLFIEGFIPY
FT                   AILSVFLGLSNSLFHPAASAMVADVTAPEKRTEAYGLLRMGHNIGAAIGPIMGASVVML
FT                   SKNLVFIIASSTMLFYALLVFVLIQETMPKSANKEEDNEKESGVVWKIVLRDKALMIYL
FT                   LAGIIISMGFSQTEGMLPLHFDNEMKDIFGTNNPYPYLMALNGLLVVLFQFQISKWATD
FT                   KPVGKTMLYGACLFGIGLFFIGWLPKWFGGLDTNATIILIMLLFVYAIYTLGEMIMSPV
FT                   QMTFVANLAPEHLRGTYMGAASLQWITGNAFGPLLGGFLLDRLLGHFLFTILAIGCVVA
FT                   GVVYISLDRLVEQRQKGTLTKQSS"
FT   gene            232006..232482
FT                   /locus_tag="BAS0230"
FT   CDS_pept        232006..232482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0230"
FT                   /product="D-alanine-D-alanine ligase, N-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52566"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52566.1"
FT                   /translation="MTKIKLGLLYGGKSAEHQVSLQTALAAIKALNQDKFEIHPIYITE
FT                   QGQWIRGERIEGEVANVEVLKMSGAENAISPLSLSTEIIPSANAEENAIDVIFPLLHGP
FT                   NGEDGTVQGLLELMNIPYVGNGVLASAAGMDKVVMKNIFAEAGLKTSEICIIHS"
FT   gene            232817..233092
FT                   /locus_tag="BAS0231"
FT   CDS_pept        232817..233092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0231"
FT                   /product="D-alanine--D-alanine ligase, C-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52567"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52567.1"
FT                   /translation="MTEEESNVIKRDAIVAFQSLDGAGLTRADFFLTKDGEVYINEVNT
FT                   MPGFTPFSMFPLLWQHTGLPYPELIEELIRLAMERHEEKQKIKYTI"
FT   gene            233153..234529
FT                   /locus_tag="BAS0232"
FT   CDS_pept        233153..234529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0232"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl-D-alanyl ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52568"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52568.1"
FT                   /translation="MINRTLKQVEQMINGTGLAEQYEGITIQGVSIDTRKIEKGNLYVP
FT                   IQGERFDGHAFVDKAVENGAVATLWVKDVANPPENLPVIFVEDTLSALQMLAKNYRDQL
FT                   DVKVIGVTGSNGKTSTKDIVTSLLATKFKVQKTEGNFNNHIGLPLTILNLEENTEVAVL
FT                   EMGMSSRGEIEFLSKLARPNAAIITNIGEAHLMDLGSREAIAEAKLEIVTGLQEGGVFV
FT                   YNGDEPLLTNRVPEMNLIAETVTFGDARANDYYPTTVTLQATGTHFKMNREENISFYLP
FT                   VLGKHNVYNTLASMAIAKYFGVTWEEMKEGLVTLQMTGMRMEIVKTDSGLTIINDAYNA
FT                   SPTAMEAAFHLMNGLDGFSKKIVVLGDMLELGDQEVQFHYEVGKLIDPAKISYVFTYGK
FT                   LGAQIAEGAKINFPNERVKAYDNKEELVKELQAVVDTKDVVLVKASRGMKLEEVITMLK
FT                   "
FT   gene            234834..236420
FT                   /locus_tag="BAS0233"
FT   CDS_pept        234834..236420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0233"
FT                   /product="ATP-dependent RNA helicase, DEAD/DEAH box family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52569"
FT                   /db_xref="GOA:Q81VG0"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030880"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VG0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52569.1"
FT                   /translation="MTTFRELGLSDSLLQSVESMGFEEATPIQAETIPHALQGKDIIGQ
FT                   AQTGTGKTAAFGLPLLDKVDTHKESVQGIVIAPTRELAIQVGEELYKIGKHKRVRILPI
FT                   YGGQDINRQIRALKKHPHIIVGTPGRILDHINRKTLRLQNVETVVLDEADEMLNMGFIE
FT                   DIEAILTDVPETHQTLLFSATMPDPIRRIAERFMTEPQHIKVKAKEVTMPNIQQFYLEV
FT                   QEKKKFDVLTRLLDIQSPELAIVFGRTKRRVDELSEALNLRGYAAEGIHGDLTQAKRMS
FT                   VLRKFKEGSIEVLVATDVAARGLDISGVTHVYNFDIPQDPESYVHRIGRTGRAGKKGIA
FT                   MLFVTPRESGQLKNIERTTKRKMDRMDAPTLDEALEGQQRLIAEKLQSTIENENLAYYK
FT                   RIAEEMLEENDSVTVVAAALKMMTKEPDTTPIALTSEPPVVSRGGGSKKRGGNGGGYRD
FT                   GNRNRSRDGRGGDGRNRDRNRDGRNRDGNRDRNREGSRDGNRGRRGEGQGRPGSSNGRG
FT                   ERKHHSRKPQA"
FT   gene            236517..237479
FT                   /locus_tag="BAS0234"
FT   CDS_pept        236517..237479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0234"
FT                   /product="UV-endonuclease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52570"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52570.1"
FT                   /translation="MLVRLGHVAMSVHLKNASPSQTMTYAQFQKIDDREAAIRKLERIA
FT                   NSNLENCLRLLKHNKGHDISFFRLSSKLIPLANHEELLEWNYIRPLKENLKVLGDYAIR
FT                   MNMRIDFHPDHFVVLNSPEENIFKQSVKTLQMHRKLLKGMGIEHKQRCVMHVGGGYKDK
FT                   ELALERFIENWSNVPRGIQEMIMLENDDTTFTLEDTLYLGEKLDIPVVFDLHHHMMNHD
FT                   REDWHEDWARVVHTWESSLLPVKMHISSPREGKDPRAHADFIDVDTFLSFLKKIKGSVP
FT                   QIDCMIEAKMKDESLFQLMRDLSEQTDVEIIDGASFYIK"
FT   gene            complement(237472..238044)
FT                   /locus_tag="BAS0235"
FT   CDS_pept        complement(237472..238044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0235"
FT                   /product="rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52571"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52571.1"
FT                   /translation="MLIPSARISLQPIAISLLLIQFIMIMLGDFFLFPMAAYHEYIANG
FT                   EWWRLITSLFVHVDLQHFLSNSICLFVLGSSIEKQLGRFSFIIIFFLSGILGNIFSYLI
FT                   MPHEYIHAGASGGIFGLLGAQLFLLYSRYRSSNPKDIAIFSIMICILLLFTFFNPSANP
FT                   ISHLTGLVIGGICTPLLIKKLDGAELI"
FT   gene            238137..238496
FT                   /locus_tag="BAS0236"
FT   CDS_pept        238137..238496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0236"
FT                   /product="holo-(acyl-carrier-protein) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52572"
FT                   /db_xref="GOA:Q81JG3"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="PDB:3HYK"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81JG3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52572.1"
FT                   /translation="MIVGIGIDIIELNRIEKMLDGKLKFMERILTENERNVAKGLKGSR
FT                   LTEFVAGRFAAKEAYSKAVGTGIGKEVSFLDIEVRNDDRGKPILITSTEHIVHLSISHS
FT                   KEFAVAQVVLESSSS"
FT   gene            238590..239603
FT                   /locus_tag="BAS0237"
FT   CDS_pept        238590..239603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0237"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52573"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52573.1"
FT                   /translation="MKRRLFLVLVGLLTVFVLAGCMEKKQDDVVRDLEAKVKGLKSYQA
FT                   EAKLSIKTGNEPQEYKVEIWHKEPSFYRVNLQNAKKDQSQIILRNEEGVFVLTPALNKS
FT                   FRFQSDWPQNSSQAYLYESLVRDILQDKKNLTFEKTDKHYIFKTKTNYQHQNMLPRQEI
FT                   TLKKSDLTPVSVKLMDNDQNVLVKVDFSKVKFDAKFDKGAFDTKQNMSRAQVDVQTTAK
FT                   EDKPFAILYPRDTPQGMTLKDEKELKTDSGKRAILTYTGSKKSFTLIQEKAKVAEASSA
FT                   ISVSGELVDLGFTIGALTKDSLTWSHNGVEYMLVSKGLEPKELLMVARSVTEKQVK"
FT   gene            239722..240891
FT                   /locus_tag="BAS0238"
FT   CDS_pept        239722..240891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0238"
FT                   /product="alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52574"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52574.1"
FT                   /translation="MEEAPFYRDTWVEVDLDAIYNNVTHIKEFIPSDVEIFAVVKGNAY
FT                   GHDYVPVAKIALEAGATRLAVAFLDEALVLRRAGITAPILVLGPSPPRDINVAAENDVA
FT                   LTVFQKEWVDEAIKLWDGSSTMKYHINFDSGMGRIGIRERKELKGFLKSLEGAPFLELE
FT                   GVYTHFATADEVETSYFDKQYNTFLEQLSWLKEFGVDPKFVHTANSAATLRFQGITFNA
FT                   VRIGIAMYGLSPSVEIRPFLPFKLEPALSLHTKVAHIKQVIKGDGISYNVTYRTKTEEW
FT                   IATVAIGYADGWLRRLQGFEVLVNGKRVPIVGRVTMDQFMIHLPCEVPLGTKVTLIGRQ
FT                   GDEYISATEVAEYSGTINYEIITTISFRVPRIFIRNGKVVEVINYLNDI"
FT   gene            241201..241488
FT                   /locus_tag="BAS0239"
FT   CDS_pept        241201..241488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0239"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52575"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52575.1"
FT                   /translation="MSESSVTTEIVVRLPKQMVTELDGIGKQENKNRHELICQATQLLL
FT                   RQHKTKKRYQHESMRRGYIEMGKINLGIASEAFLAEYEAAHTVERLVSGG"
FT   gene            241493..241843
FT                   /locus_tag="BAS0240"
FT   CDS_pept        241493..241843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0240"
FT                   /product="transcriptional regulator, PemK family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52576"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52576.1"
FT                   /translation="MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVA
FT                   AITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQIRTIDKQRLTDKITHLDEVMMIRVD
FT                   EALQISLGLIDF"
FT   gene            241905..244079
FT                   /locus_tag="BAS0241"
FT   CDS_pept        241905..244079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0241"
FT                   /product="S1 RNA binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52577"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52577.1"
FT                   /translation="MYMEMVDNRQALMKMLVKELGFTEKQVRHVIQLTEEGNTVPFIAR
FT                   YRKEWTGSLDEVQIRTILERWQYIMQLEDRKEEVLRLIDEKGKLTGELRQQILKATKLQ
FT                   EVEDLYRPYKEKRRTKATIAKEKGLEPLAEWLLLYTKEDPNQKAMEFINAEKEVQSAEE
FT                   ALQGAQDIIAEIVSDEAAYRSWIRNVTFRKGVMSSVVKDEEKDEKNIYEMYYDYEEPLQ
FT                   KVVPHRVLAMNRGEKEDILRVSVVPPVDEIVTFLYKKVIRDNDSKSAQYVKLAIEDGYK
FT                   RLIQSSIEREIRKELTETAEEQAIHIFSENLRNLLLQPPMKGKVVLAVDPAYRTGCKLA
FT                   IVDDTGKVLYIDVIYPHPPVRKYEDAKAKVLSIIDKYQVEMIAIGNGTASRESEEFIVD
FT                   VLQNVKREVFYIIVNEAGASVYSASDLAREEFPDLQVEERSAVSIGRRLQDPLAELVKI
FT                   DPKSVGVGQYQHDVSQKRLNESLTFVVETAVNQVGVNVNTASVALLQYVSGLSKTVAKN
FT                   IVAKREEEGKFTKRTDLKKIPRLGAKTYEQCIGFLRILEGANPLDRTGIHPEQYKNVEL
FT                   LLKSLGLSKDDVGQPQLQKSLEEVEISKLSEETGIGEPTLVDIIDALISPERDMRDELP
FT                   KPLLKKGILKLEDLKRGMELEGTVRNVVDFGAFVDVGVKQDGLVHISKLSKQYVKHPLD
FT                   VVSVGQIVKVWVDDIDTKKGRVALSMLPIE"
FT   gene            244449..244907
FT                   /locus_tag="BAS0242"
FT   CDS_pept        244449..244907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0242"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52578"
FT                   /db_xref="GOA:Q81VF1"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023524"
FT                   /db_xref="InterPro:IPR035240"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VF1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52578.1"
FT                   /translation="MDEQEIQRLVEEVSLQYFGMPFLHKAMFNSRLRTTGGRYLLNTHN
FT                   IELNYRYYEMYGKEELVGIVKHELCHYHLHITGRGYKHRDKDFRELLKAVDAPRFCKRM
FT                   VNAEKEKRVYVYECMECLLQYVRRRQINTKRYVCGKCKGKLNLIKKTS"
FT   gene            245022..245099
FT                   /locus_tag="tRNA-Asn-1"
FT   tRNA            245022..245099
FT                   /locus_tag="tRNA-Asn-1"
FT                   /product="tRNA-Asn"
FT   gene            245100..245193
FT                   /locus_tag="tRNA-Ser-7"
FT   tRNA            245100..245193
FT                   /locus_tag="tRNA-Ser-7"
FT                   /product="tRNA-Ser"
FT   gene            245199..245276
FT                   /locus_tag="tRNA-Glu-7"
FT   tRNA            245199..245276
FT                   /locus_tag="tRNA-Glu-7"
FT                   /product="tRNA-Glu"
FT   gene            245278..245356
FT                   /locus_tag="tRNA-Val-3"
FT   tRNA            245278..245356
FT                   /locus_tag="tRNA-Val-3"
FT                   /product="tRNA-Val"
FT   gene            245400..245478
FT                   /locus_tag="tRNA-Asp-3"
FT   tRNA            245400..245478
FT                   /locus_tag="tRNA-Asp-3"
FT                   /product="tRNA-Asp"
FT   gene            245564..245641
FT                   /locus_tag="tRNA-Gln-2"
FT   tRNA            245564..245641
FT                   /locus_tag="tRNA-Gln-2"
FT                   /product="tRNA-Gln"
FT   gene            245644..245719
FT                   /locus_tag="tRNA-Lys-2"
FT   tRNA            245644..245719
FT                   /locus_tag="tRNA-Lys-2"
FT                   /product="tRNA-Lys"
FT   gene            245734..245822
FT                   /locus_tag="tRNA-Leu-4"
FT   tRNA            245734..245822
FT                   /locus_tag="tRNA-Leu-4"
FT                   /product="tRNA-Leu"
FT   gene            245915..245994
FT                   /locus_tag="tRNA-Arg-2"
FT   tRNA            245915..245994
FT                   /locus_tag="tRNA-Arg-2"
FT                   /product="tRNA-Arg"
FT   gene            245996..246075
FT                   /locus_tag="tRNA-Pro-1"
FT   tRNA            245996..246075
FT                   /locus_tag="tRNA-Pro-1"
FT                   /product="tRNA-Pro"
FT   gene            246074..246147
FT                   /locus_tag="tRNA-Gly-6"
FT   tRNA            246074..246147
FT                   /locus_tag="tRNA-Gly-6"
FT                   /product="tRNA-Gly"
FT   gene            246248..247757
FT                   /locus_tag="rRNA-16s-5"
FT   rRNA            246248..247757
FT                   /locus_tag="rRNA-16s-5"
FT                   /product="16S ribosomal RNA"
FT   gene            247933..250843
FT                   /locus_tag="rRNA-23s-5"
FT   rRNA            247933..250843
FT                   /locus_tag="rRNA-23s-5"
FT                   /product="23S ribosomal RNA"
FT   gene            250890..251008
FT                   /locus_tag="rRNA-5s-5"
FT   rRNA            250890..251008
FT                   /locus_tag="rRNA-5s-5"
FT                   /product="5S ribosomal RNA"
FT   gene            251018..251097
FT                   /locus_tag="tRNA-Met-7"
FT   tRNA            251018..251097
FT                   /locus_tag="tRNA-Met-7"
FT                   /product="tRNA-Met"
FT   gene            251098..251176
FT                   /locus_tag="tRNA-Asp-4"
FT   tRNA            251098..251176
FT                   /locus_tag="tRNA-Asp-4"
FT                   /product="tRNA-Asp"
FT   gene            251348..251821
FT                   /locus_tag="BAS0244"
FT   CDS_pept        251348..251821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0244"
FT                   /product="conserved hypothetical protein TIGR00150"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52579"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52579.1"
FT                   /translation="MSKYEITTKSSEETQKLSEKLGELVRAQDVIILEGDLGAGKTTFT
FT                   KGLAKGLGVKRVVNSPTFNIIKEYKGRLPLYHMDVYRLAESEEDLGFDEYFYGEGITVV
FT                   EWAHLIEAYLPNEKLQISLFHAGDDTRNIVLEPIGNRYIRLCEELLQDESTSN"
FT   gene            251802..252494
FT                   /locus_tag="BAS0245"
FT   CDS_pept        251802..252494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0245"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52580"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52580.1"
FT                   /translation="MKVLAIDTSNYVMGVSLIEEGNVIGEIITNLTKNHSVRLMPAVEQ
FT                   LLKECGVKPKELTKIVVAAGPGSYTGVRIGVTAAKTLAWSLQIPIVGVSSLEVVAANGA
FT                   NFNGLISPLFDGRRGQIYTGLYTYEGEDLTSIEEDRIILIVDWLQMLKDKGKPVLFIGN
FT                   DVKLHKETIIEHLGDQAVFAPVTKNNPRPSELAFLGLQKEEQDVHSFVPSYLRLAEAET
FT                   KWLESQNK"
FT   gene            252514..252951
FT                   /locus_tag="BAS0246"
FT   CDS_pept        252514..252951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0246"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52581"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52581.1"
FT                   /translation="MIFRKMELDDIAQIVAIEEASFSTPWTADAFHRELTMNEHAHYVV
FT                   LEKDGRVIGYCGLWIIIDESHITNIAILPEYRGLKLGDALLKEVISEAKTLGVKTMTLE
FT                   VRVSNEVAKQLYRKYGFQNGGIRKRYYADNQEDGLVMWVNI"
FT   gene            252936..253967
FT                   /locus_tag="BAS0247"
FT   CDS_pept        252936..253967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0247"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52582"
FT                   /db_xref="GOA:Q6I4E9"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6I4E9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52582.1"
FT                   /translation="MGEYIMEKNTIILGIETSCDETAVAVVKNGTEIIANVVASQIESH
FT                   KRFGGVVPEIASRHHVEEITVVLEEALKEANITFDDIDAIAVTEGPGLVGALLIGVNAA
FT                   KAVAFAHDIPLVGVHHIAGHIYANRLVKEVQFPLLSLVVSGGHTELVYMKEHGSFEVIG
FT                   ETRDDAAGEAYDKVARTLSMPYPGGPHIDRLAHEGKPTIDLPRAWLEPDSYDFSFSGLK
FT                   SAVINTVHNAKQRGIEIAPEDLAASFQESVIDVLVTKASRAADAYNVKQVLLAGGVAAN
FT                   KGLRARLETEFAQKENVELIIPPLSLCTDNAAMIAAAGTIAYEQGKRATLALNANPGLD
FT                   IEA"
FT   gene            complement(254449..256425)
FT                   /locus_tag="BAS0248"
FT   CDS_pept        complement(254449..256425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0248"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52583"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52583.1"
FT                   /translation="MIEKYKHGKVKKLFEVKTLILLQVNALSKLYGAETILANIKLEVQ
FT                   TKDRIALVGRNGAGKSTLLKIIAGELSHDGGEIIKPKDVSMGYLAQNTGLETSLTIWDE
FT                   MLTVFTHLQQMETKLRRLEQEMGKEENFSNEATYERLLADYDQLQLDYKDQGGYQYEAD
FT                   IRSILSGLGFPVETHQTTISTLSGGQKTRLALGKLLLTKPDLLILDEPTNHLDIETLTW
FT                   LEQYLQGYPGAILIVSHDRYFLDKLVTQVYEISNKESRRFVGNYSKYLDLKSALYEQEM
FT                   KRYEKQQDEIAKLEDFVQKNIARASTTKRAQSRRKQLDRMELLTRPLGDSKSASFHFDI
FT                   EKQSGNDVLQVKDATIGYDKDPIIEHVTMRLTRGDSVALVGPNGIGKSTLLKSIVNKLP
FT                   LLHGDVSFGSNVSVGYYDQEQANLTSSKRVLNELWDEYPLQPEKEIRTILGNFLFTGDD
FT                   VLKPVSSLSGGQKARLALAKLMMQKSNLLILDEPTNHLDLNSKEILENALIDYPGTLLF
FT                   VSHDRYFINRVTTTVIELSTEGAQEYLGDYDYYVEKKNEMIERAELEQEDETPVQKTVA
FT                   QEKLNYLEEKERKKLERQRTRKIEELEQNIVQFEEEIATLEDQLCLPEIYADYEKASEI
FT                   TTKKQTLQEQLDACMAEWEELHV"
FT   gene            256559..257188
FT                   /locus_tag="BAS0249"
FT   CDS_pept        256559..257188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0249"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52584"
FT                   /db_xref="GOA:Q81VE5"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VE5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52584.1"
FT                   /translation="MEQQKIPQATAKRLPLYYRFIQNLSLSGKQRVSSAELSEAVKVDS
FT                   ATIRRDFSYFGALGKKGYGYNVNYLLSFFRETLDQDDITRVALIGVGNLGTAFLHYNFT
FT                   KNNNTKIEMAFDVSEEKVGTEIGGIPVYHLDELEERLSSDIQVAILTVPATVAQSVADR
FT                   LAETNVHGILNFTPARLNVSDNIRIHHIDLAVELQTLVYFLKNYPQ"
FT   gene            complement(257218..257409)
FT                   /locus_tag="BAS0250"
FT   CDS_pept        complement(257218..257409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0250"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52585"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52585.1"
FT                   /translation="MRNSPLFMAALYFLLGCIFTHLAIRNVTDTIWNMWTILFAVMATI
FT                   DFNLALRLILVKFTKKKQ"
FT   gene            complement(257406..258155)
FT                   /locus_tag="BAS0251"
FT   CDS_pept        complement(257406..258155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0251"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52586"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52586.1"
FT                   /translation="MKKQYWWVIVTYILMQLSSIAGLPLLLKTGLYDNRGFTREEKFQL
FT                   ITGHWAIISFFIALCIVLWLLRTDIRDRHLDTKRSTVPATIGWIFIGFFLAFFSQSIAG
FT                   MIEMYVLGIKPGSENTARLMDIARTTPWFLIVISIIGPILEEIVFRKILFGTLYKKFNF
FT                   FIAAIISSLVFAAIHFDFTHLLVYTAMGLVFAFLYVKTKRIIVPIAAHVAMNTLVAIAQ
FT                   VLVSNEQIQEMIKEAEKMQGFIGGFLV"
FT   gene            258556..258840
FT                   /locus_tag="BAS0252"
FT   CDS_pept        258556..258840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0252"
FT                   /product="chaperonin, 10 kDa"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52587"
FT                   /db_xref="GOA:Q81VE2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VE2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52587.1"
FT                   /translation="MLKPLGDRVVIELVQAEEKTASGIVLPDTAKEKPQEGKVIAVGTG
FT                   RVLENGERVALEVAAGDLIIFSKYAGTEVKYEGTDYLILRESDILAVIG"
FT   gene            258879..260513
FT                   /locus_tag="BAS0253"
FT   CDS_pept        258879..260513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0253"
FT                   /product="chaperonin, 60 kDa"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52588"
FT                   /db_xref="GOA:Q81VE1"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VE1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52588.1"
FT                   /translation="MAKDIKFSEEARRSMLRGVDTLANAVKVTLGPKGRNVVLEKKFGS
FT                   PLITNDGVTIAKEIELEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLK
FT                   NVTAGANPMGLRKGIEKAVVAAVEELKTISKPIEGKSSIAQVAAISAADEEVGQLIAEA
FT                   MERVGNDGVITLEESKGFTTELDVVEGMQFDRGYASPYMITDSDKMEAVLDNPYILITD
FT                   KKISNIQEILPVLEQVVQQGKPLLIIAEDVEGEALATLVVNKLRGTFNVVAVKAPGFGD
FT                   RRKAMLEDIAILTGGEVITEELGRDLKSATVESLGRAGKVVVTKENTTVVEGVGSTEQI
FT                   EARIGQIRAQLEETTSEFDREKLQERLAKLVGGVAVIKVGAATETELKERKLRIEDALN
FT                   STRAAVEEGIVAGGGTSLMNVYTKVASIVAEGDEATGINIVLRALEEPVRQIAINAGLE
FT                   GSVVVERLKGEKVGVGFNAATGEWVNMLETGIVDPAKVTRSALQNAASVAAMFLTTEAV
FT                   VADKPEPNAPAMPDMGGMGMGGMGGMM"
FT   gene            260912..262459
FT                   /locus_tag="BAS0254"
FT   CDS_pept        260912..262459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0254"
FT                   /product="GMP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52589"
FT                   /db_xref="GOA:Q81VE0"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VE0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52589.1"
FT                   /translation="MIILKKQHDTIIVLDFGSQYNQLIARRIREFGVYSELHPHTITAE
FT                   EIKAMNPKGIIFSGGPNSVYGEGALHCDEKIFDLGLPIFGICYGMQLMTQQFGGTVERA
FT                   NHREYGKAVLKVENESKLYANLPEEQVVWMSHGDLVTGLPEGFVVDATSESCPIAGMSN
FT                   EAKNLYGVQFHPEVRHSEHGNDLIKNFVFGVCGCSEGWNMENFIEVELEKIRETVGDKK
FT                   VLCALSGGVDSSVVAVLIHKAIGDQLTCIFVDHGLLRKGEAEGVMKTFSEGFHMNVIKV
FT                   DAKERFMNKLKGVEDPEQKRKIIGNEFIYVFDDEASKLEGMDFLAQGTLYTDIVESGTA
FT                   TAQTIKSHHNVGGLPEDMQFKLIEPLNTLFKDEVRVLGSELGIPDEIVWRQPFPGPGLG
FT                   IRVLGEITEEKLEIVRESDAILREEIIKAGLDREIWQYFTALPGMRSVGVMGDERTYDY
FT                   TVGIRAVTSIDGMTADWARIPWDVLEKISVRIVNEVKHVNRIVYDVTSKPPATIEWE"
FT   gene            262844..264169
FT                   /locus_tag="BAS0255"
FT   CDS_pept        262844..264169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0255"
FT                   /product="xanthine/uracil permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52590"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52590.1"
FT                   /translation="MKRYFQFDELGTNYKTEFIAGLTTFLSMAYVLFVNPATLSLGNVK
FT                   GLPAGTGMDPGAVFVATALAAAIGSLIMGIFAKYPIALAPGMGINAFFAYTAVLTMGIP
FT                   WQTAIAGTLMSGIIFIILTASGIREKIINAIPSELKFAVAAGIGLFIAFLGFQNAGIIV
FT                   KNDAVLVGLGDLTKGTTLLAIFGVVTTIIFMIKKVNGAVFYGMILTAILGVATGLIDTP
FT                   KAVVGAIPSLEPTFGAALTHFGDIFTVQMGIVIITFFFIDFFDTAGTLVAVANQAGLMK
FT                   NNKLPRAGKALFADAIATVIGAILGTSTTTSYIESSAGVAAGGRSGFTAVVTAGFFLLA
FT                   LFFSPLLSVVTPAVTAPALIIVGILMVSSLGEIDWKKFEIAVPAFFTIISMPLTYSIAT
FT                   GIAIGFIFYPITMVVSGRRKEIHPIMYVMGVLFVLYFIYVRK"
FT   gene            264314..265015
FT                   /locus_tag="BAS0256"
FT   CDS_pept        264314..265015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0256"
FT                   /product="DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52591"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52591.1"
FT                   /translation="MAHETILVVDDEKEIRNLITIYLKNEGYKVLQAGDGEEGLRLLEE
FT                   NEVHLVVLDIMMPKVDGIHMCMKIREEKEMPIIMLSAKTQDMDKILGLTTGADDYVTKP
FT                   FNPLELIARIKSQLRRYMKMNGFAIQNEDELEIGEMKINISTHKVIVEGEEVKLTPREF
FT                   SILELLARNPGMVFSAEQIYEKVWNERSFQSDNTVMVHIRKVREKIEENPRKPRYIKTV
FT                   WGVGYKIEKDI"
FT   gene            264999..266504
FT                   /locus_tag="BAS0257"
FT   CDS_pept        264999..266504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0257"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52592"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52592.1"
FT                   /translation="MKKIFNPFTYIRKARQLIEKLVKGVRKSIRIQLITTFAACALLGV
FT                   FFAKGAAPFFENANRQATIDYRAGMEQINHEAQRAANSSVHENKLEAISNMIEMENQNL
FT                   ERGSRALKILVTDESGKVLYKTKQAQEEQIDLHNTIRNAASFAINYSNGRDVFENTRKE
FT                   FIAFSPITIEDKNLYMFVSGIPDGVVMYDTQEGPFPFLIGVLVFIFSFFYITKRKMKQI
FT                   EAMAEGVKEIEKGNLAYRIEKKGEDEIASLTENINNMAEELMNNIEKERKLEKQKNELI
FT                   TNVSHDLRTPLTSIMGYLRLLRDSKYENKEQHDEYTRIAFAKSEQLKNLIEDLFEYTKL
FT                   TNEQVVLEKQEVCVNELLEQLIEELVPQAEEHGLTFVKKFPEERAYAAIDSEKMVRVFD
FT                   NLLMNAIKYSKDDGEIKVSLQRQRWEIQIVIANHSEEFTREELASLFERFYKKDQSRSR
FT                   VTEGSGLGLAIAKSIVELQGGSIRAEYKDGIIQFIVSLPIIER"
FT   gene            266827..268336
FT                   /locus_tag="rRNA-16s-6"
FT   rRNA            266827..268336
FT                   /locus_tag="rRNA-16s-6"
FT                   /product="16S ribosomal RNA"
FT   gene            268512..271422
FT                   /locus_tag="rRNA-23s-6"
FT   rRNA            268512..271422
FT                   /locus_tag="rRNA-23s-6"
FT                   /product="23S ribosomal RNA"
FT   gene            271469..271587
FT                   /locus_tag="rRNA-5s-6"
FT   rRNA            271469..271587
FT                   /locus_tag="rRNA-5s-6"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(271722..272675)
FT                   /locus_tag="BAS0259"
FT   CDS_pept        complement(271722..272675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0259"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52593"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52593.1"
FT                   /translation="MKIIAFYLPQFHQIKENDRWWGKGFTEWTNTKSARPLFSKHYQPR
FT                   EPYQDFYYDLTDPSVRKWQAEIAKAHGIYGFCYYHYWFKGKRLLETPFNEVLKTGEPDF
FT                   PFCLSWANEPWTKTWDGLDSHILMPQNYGELSDWKEHFDYLLQAFQDERYIRIDDKPLF
FT                   IIYRPGHIPDCEQMLNYWNILAQENGLKGIYFVETLNSFPLPNIHGFDASIQFEPFYTI
FT                   AHDSSSDINKTIYESGKQINAWDYDKVWMYILKRSPSEKKTFPGAFVDWDNTARRKDLN
FT                   SSIFLGSTPEKFTIYLSKQIYRTYSLYNSEFLFMNA"
FT   gene            complement(272908..273780)
FT                   /locus_tag="BAS0260"
FT   CDS_pept        complement(272908..273780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0260"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52594"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52594.1"
FT                   /translation="MNNFKLGNDFDNLVSPLSDVELLNLFIQSCSQTKINGTPVPMFPP
FT                   EEIQQQFVGASYEHALYEAYLFYSHVKTYAQNLGVPLNKERKILDFGCGWGRIIRFFFK
FT                   DIRDENLLGIDVDPAMINICNETLGRGIYKTANPQPPVEFISDNSLDIIFAYSVFSHLS
FT                   EETAEHWIKEFSRILRPGGIFIATTQARYFLDYCQQFKEHPEFIQTGWHKTLSQAFPDI
FT                   NRAISDYESGNFVHSPTGAGNVRNSRFYGETVIPRTYIKNHYEKYLKLRDFFDDVNRLP
FT                   QALFVLQKD"
FT   gene            complement(273807..274529)
FT                   /locus_tag="BAS0261"
FT   CDS_pept        complement(273807..274529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0261"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52595"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52595.1"
FT                   /translation="MEGNLKHNNGYCVICEKEATFIEHNDWLRDHYLCSTCHSIPRQRA
FT                   LVHVLNTLFPKWDSYHIHESSPGGITTQLLIKNCKNYTYSQYFKNYPLVQYFQGIRCEN
FT                   LENMTFQNESFDLFITQDVFEHVMEPEKAFKEIERVLKPGGAHVFTVPWYPTLPKTLQR
FT                   ARNNKDGIEYMEEPIYHGNPIDEKGALVTFDWGQDMIEYIYTHANMYTIVYLQKDRSLG
FT                   LDAEFLHVFISKKHEHNF"
FT   gene            complement(274833..275627)
FT                   /locus_tag="BAS0262"
FT   CDS_pept        complement(274833..275627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52596"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52596.1"
FT                   /translation="MKNINQKFLEYIILHKDRIPHFHKDFPLILFWSHRSGCTALANWF
FT                   FFQIGLFPEAKKYNDFIHYYEFWVYKNNPNYIQAVHSGLLEAKKHVCKLVRNPYTRAVS
FT                   SFLLLADNPYASPQWDSIRKCFYNDKHSKQGISFKQFLYYVQTLGSNSQVIDMHFSQQY
FT                   VQGEEAFIQSYIPLEDFNKQIPKTENEYGLIKSDLTKLTSSGHHRAHKMVYTGSYAELS
FT                   ITDEAFPRFPTYASFYDKETMDLVTEIYAKDFEMYPYTKGIF"
FT   gene            276059..276832
FT                   /locus_tag="BAS0263"
FT   CDS_pept        276059..276832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0263"
FT                   /product="UDP-glucose 4-epimerase, C-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52597"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52597.1"
FT                   /translation="MLKIYIALANVDIIIYLAATSNVATSIEDVFGDINSSFFFLNFME
FT                   SVKNFPIKKIVLASSGGTVYGEPEYLPIDEDHPLKPLSPYGITKVSLENYLYFYKKKYG
FT                   IDYVVCRYSNPYGKYQNPLKKVGAINCFLYQHLSNERINIYGNPQEIIRDYIYIDDLVE
FT                   ITIQLSQLNRLKSCVYNIGSGKGLSLKRIIVELEKLTERKVDFICYKQKQENVQKIILN
FT                   IDRVRRECNWEPKVDFKSGIRLNKLWIEEFLYSKK"
FT   gene            complement(276873..277646)
FT                   /locus_tag="BAS0264"
FT   CDS_pept        complement(276873..277646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0264"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52598"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52598.1"
FT                   /translation="MKEFIETNKDLISQIAQNYNVNASIHPEDHIFQFLVTNPVFPSKK
FT                   EAIDYYFKDGRKSAETLLDLMTSFYPPVDTPIKLLEFASGYGCVTRHLLNLQTNLRITA
FT                   CDIHEEAITFLERTLHTSSILSHPEPEQIKLSSTYDIVFGLSFFSHMPDTTWFRWLQTL
FT                   YNAVSPGGLFIFTTHGYQSKKYFGFPDLNKQGYWFLPSSEQLDLDVHQYGQTIVSPSYV
FT                   CDKIKLLPYNPIIKKYTEGFWWEHQDLWVIQKEIK"
FT   gene            complement(277714..278148)
FT                   /locus_tag="BAS0265"
FT   CDS_pept        complement(277714..278148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52599"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52599.1"
FT                   /translation="MANHYLDYTNDIDKEKWQSSYVRKGIDEIQDTLLIKNTIPNVSSV
FT                   VFKNIDIKTTAKQLEKFKIASDWFFYVSILKEGNIYFNPKPLNYHRRHKNSVTRAEDSY
FT                   SHYSEVVQMQNFIKETFTIDDISKKKMYAYRKYLKAYLKV"
FT   gene            complement(278314..279645)
FT                   /locus_tag="BAS0266"
FT   CDS_pept        complement(278314..279645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0266"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52600"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52600.1"
FT                   /translation="MHVNKKIIYVSHDAHFHGAQLLSLHTIKALKENFHYSVAIISIRT
FT                   GILIHDFQKYGPVYCLEEDYPTENKVESLIKKLLSQDYTIAICSTVISGDIVALLAKHN
FT                   IKVISLIHELPHLIQQYSAEGKARKIAESAHKIVFPSQYVYEKFHTITQLDHQKCHILP
FT                   QGLFNHNPYKNNIAKARNELRKKHNLPLDSKIILGVGFADHRKGIDLFSLIAYSVRKIH
FT                   KNIHFIWVGKTDVHFLNTLSQRYTAHFTLVEPTPDIGLYNAGADLYLLTSREDPFPNVV
FT                   LEALDTKVPVIGFKNAGGFGDVVTEQTGALVDYLNLPMMLEKIYEFIGDEDLRLQKGTF
FT                   GQELIEKNFNFLHYIYQLLNLLEHNYKKISVIVPNYNYEKYLSERVKSILNQTYPLYEL
FT                   IFLDDASTDNSVSIFEKLLSNENKHHLKIQQIINDKNSGSVFKQ"
FT   gene            280125..281634
FT                   /locus_tag="rRNA-16s-7"
FT   rRNA            280125..281634
FT                   /locus_tag="rRNA-16s-7"
FT                   /product="16S ribosomal RNA"
FT   gene            281810..284720
FT                   /locus_tag="rRNA-23s-7"
FT   rRNA            281810..284720
FT                   /locus_tag="rRNA-23s-7"
FT                   /product="23S ribosomal RNA"
FT   gene            284768..284886
FT                   /locus_tag="rRNA-5s-7"
FT   rRNA            284768..284886
FT                   /locus_tag="rRNA-5s-7"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(285334..286131)
FT                   /locus_tag="BAS0269"
FT   CDS_pept        complement(285334..286131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0269"
FT                   /product="bacitracin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52601"
FT                   /db_xref="GOA:Q81VC9"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VC9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52601.1"
FT                   /translation="MSDIITAFILGIVEGLAEFLPISSTGHLILVGHLLGFEGERAKTF
FT                   EIVIQLGAILAIAILYHKRLVSLCNLKPLLRKEKKFNAFHVFLGVFPAVVAGLLLHDVI
FT                   KTYLFQPYTVVIGLVAGAILMIFAEVKKQEATSYSLDDLTYRQALTIGLFQCLAVYPGF
FT                   SRAGSTISGGLLAKVNYKTASEFSFLIALPVMVGATGLDLLKSWTYLSVDDIPMFAVGF
FT                   ITSFIVAMLAVVTFLKLLEKIGLKPFAYYRILLAILFTVFVLL"
FT   gene            complement(286149..286895)
FT                   /locus_tag="BAS0270"
FT   CDS_pept        complement(286149..286895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0270"
FT                   /product="bacitracin ABC transporter, permease protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52602"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52602.1"
FT                   /translation="MEQLVNLFYTELLKLKRSNMFLISIIGAGVAPFLVVVASYIHIKT
FT                   KQPTPTIWFHQLFTEVNLYTTLVIGFPLYGVVVAYLFTREYAEDTLKNLLTIPVSRISF
FT                   IISKFIILFLWIMMLTLVAWSLTLILGLLGNFPGFNTTLLLGSFLKFLICGGLLFLLSS
FT                   PIVLLTLVMKSYVPPIILTVIITMTNLMLVNSKHKDLFPWTATLDIANNELQPTYPPEY
FT                   SYIIIVTTAIFGFIATLFYFKRVDIH"
FT   gene            complement(286879..287808)
FT                   /locus_tag="BAS0271"
FT   CDS_pept        complement(286879..287808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0271"
FT                   /product="bacitracin ABC transporter, ATP-binding protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52603"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52603.1"
FT                   /translation="MSPINTIIKTTNLTKVYGKQKSVDNLNINVQQGEIYGFIGRNGAG
FT                   KTTTIRMLLGLIKPTSGTIEIFGEDLFQNQKDILSRIGSIVEVPGFYENLTAKENLLIN
FT                   AKIIGVYKKNAIEDTLEIVGLQHETKKLVGKYSLGMKQRLGIARALLHYPELLILDEPT
FT                   NGLDPIGIKEMRKLIHSLAQERNITILISSHILAEVEQLVDRIGIIHEGRLLEEVSLDK
FT                   LRKANRKYIEFQVNNENKAAMLLENQFQIFDYEVHDEGNIRIYSHFGQQGYINRTFVLN
FT                   DIEVLKMMISEDRLEDYFTKLVGGGTIG"
FT   gene            complement(287877..288899)
FT                   /locus_tag="BAS0272"
FT   CDS_pept        complement(287877..288899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0272"
FT                   /product="sensor histidine kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52604"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52604.1"
FT                   /translation="MKSLKIDKILFLISLQLIIYGLLHIQMDPKVKISLFITLILITMY
FT                   LFFSRIQFIQNHKSIDTKLSRALKGNLQTRLFTSNDQSLHNIVFSINELITELEKVRIK
FT                   AKRSEESRKQLLSSISHDIRTPLTSIIGYIDALKDGVAASEIEKQEYLKILYMKSNNLK
FT                   HLVDEIFNMAKLDANEFPLKEEKLDFSEVTREVLIDFLPEISKHNIKLQVLMPESTCPI
FT                   IADHLSLMRIIGNLMKNAIYYGKDGKTIGVELLETDAAYELLIWDKGPGIPKHDLQNVF
FT                   ERMYRSEQSRNSSFGGSGLGLSISKALVEKNGGHIWVESIPWERTTFGFSIPKHNTFKK
FT                   "
FT   gene            complement(288880..289593)
FT                   /locus_tag="BAS0273"
FT   CDS_pept        complement(288880..289593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0273"
FT                   /product="DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52605"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52605.1"
FT                   /translation="MKDIRILIADDDKEIRNLLKIYLERELYMVDTAIDGEVALQLFNQ
FT                   NNYSIVILDLMMPKVDGIEVCRKLRDKTNVPILMLTAKDHEVDKILGLSIGADDYITKP
FT                   FSIHEVVARVKALIRRFLVLGSNINVQEKTTLAFKGLTINLNTYTVHTNKEEISLTGKE
FT                   LELLKFFTSNPGQVFTKTQLFRNVWDDNYIEDDNTVMVHIRKLRKKIEIDPSNPKFIQT
FT                   VWGIGYKFVGEKLED"
FT   gene            290098..291607
FT                   /locus_tag="rRNA-16s-8"
FT   rRNA            290098..291607
FT                   /locus_tag="rRNA-16s-8"
FT                   /product="16S ribosomal RNA"
FT   gene            291783..294693
FT                   /locus_tag="rRNA-23s-8"
FT   rRNA            291783..294693
FT                   /locus_tag="rRNA-23s-8"
FT                   /product="23S ribosomal RNA"
FT   gene            294741..294859
FT                   /locus_tag="rRNA-5s-8"
FT   rRNA            294741..294859
FT                   /locus_tag="rRNA-5s-8"
FT                   /product="5S ribosomal RNA"
FT   gene            295555..296040
FT                   /locus_tag="BAS0275"
FT   CDS_pept        295555..296040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0275"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52606"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52606.1"
FT                   /translation="MKSLVGVIMGSTSDWETMKYACDILDELNIPYEKKVVSAHRTPDY
FT                   MFEYAETARERGLKVIIAGAGGAAHLPGMVAAKTNLPVIGVPVQSKALNGLDSLLSIVQ
FT                   MPGGVPVATVAIGKAGSTNAGLLAAQILGSFHDDIHDALELRREAIEKDVREGSELV"
FT   gene            296037..297188
FT                   /locus_tag="BAS0276"
FT   CDS_pept        296037..297188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0276"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52607"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52607.1"
FT                   /translation="MTRIILPGKTIGIIGGGQLGRMMALAAKEMGYKIAVLDPTKNSPC
FT                   AQVADIEIVASYDDLKAIQHLAEISDVVTYEFENIDYRCLQWLEKHAYLPQGSQLLSKT
FT                   QNRFTEKNAIEKAGLPVATYRLVQNQEQLTEAIAELSYPSVLKTTTGGYDGKGQVVLRS
FT                   EADVDEARKLANAAECILEKWVPFEKEVSVIVIRSVSGETKVFPVAENIHVNNILHESI
FT                   VPARITEELSQKAIAYAKVLADELELVGTLAVEMFATADGEIYINELAPRPHNSGHYTQ
FT                   DACETSQFGQHIRAICNLPLGETNLLKPVVMVNILGEHIEGVLRQVNRLTGCYLHLYGK
FT                   EEAKAQRKMGHVNILNDNIEVALEKAKSLHIWDHQEQLLEGKR"
FT   gene            297185..298492
FT                   /locus_tag="BAS0277"
FT   CDS_pept        297185..298492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0277"
FT                   /product="adenylosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52608"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52608.1"
FT                   /translation="MISRYTRPEMGAIWTEENKFKAWLEVEILACEAWAELGDIPKEDV
FT                   KKIREHASFDIDRIYEIEKETRHDVVAFTRAVSETPALGEERKWVHYGLTSTDVVDTAL
FT                   SYILKQANEIILKDLENFVSILANKAKEHKYTIMMGRTHGVHAEPTTFGLKLGLWYEEM
FT                   KRNVERFKQAANTVRVGKLSGAVGTYANIDPFVEKYVCENLGLEAAPISTQTLQRDRHA
FT                   HYMSTLALIATSIEKMAVEIRGLQKSETREVEEAFAKGQKGSSAMPHKRNPIGSENMTG
FT                   LARVIRGYMMTAYENVPLWHERDISHSSAERVILPDATIALNYMLNRFGNIVKNLTVYP
FT                   ENMKRNMTRTYGLIYSQRVMLTLIDKGMVREEAYDIVQPKAMEAWETQVQFKELVEADE
FT                   RITSKLTQEEINECFNYEHHMQHVDTIFERLGLNEA"
FT   gene            298581..299300
FT                   /locus_tag="BAS0278"
FT   CDS_pept        298581..299300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0278"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52609"
FT                   /db_xref="GOA:Q81ZH5"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZH5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52609.1"
FT                   /translation="MQKLELLYEGKAKRIYRTESADMVWVEYKDSATAFNGEKKETITG
FT                   KGRLNNEITTLLFRKLQEVGIKTHFVEKLSETEQLVKKVSIIPLEVVTRNVIAGSLSKR
FT                   LGMEEGTVLAEPIVEFYFKDDDLGDPLVTEDHIRVLNVASPEQVSVLRDMALQINQVLI
FT                   DHFASCRVRLVDFKLEFGVTDEGAIILADEISPDTCRLWDETSNEKFDKDVFRRDLGNL
FT                   TDAYEEILKRLGGISHV"
FT   gene            299293..299547
FT                   /locus_tag="BAS0279"
FT   CDS_pept        299293..299547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0279"
FT                   /product="phosphoribosylformylglycinamidine synthase, PurS
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52610"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52610.1"
FT                   /translation="MYKVKVYVTLRESVLDPQGTAVKGALHSLSFTEVQDVRIGKYMEL
FT                   TIDKSVSDLDAKVKEMCEKLLANVVMEDFRYEVEEVVAQ"
FT   gene            299544..300227
FT                   /locus_tag="BAS0280"
FT   CDS_pept        299544..300227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0280"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52611"
FT                   /db_xref="GOA:Q81ZH3"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZH3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52611.1"
FT                   /translation="MKFAVIVFPGSNCDVDMFHAIKDELGEEVDYVWHDTENLDEYDAI
FT                   LLPGGFSYGDYLRCGAISRFANAMKAVQKAAEQGKPILGVCNGFQILVESGLLPGALMR
FT                   NENLKFMCRTVQLRVENNETMFTSQYEKDEVINIPIAHGEGNYYCDEETLKQLEENNQI
FT                   AFRYVENPNGSVSDIAGIVNEKGNVLGMMPHPERAVDELLGGAEGLKVFQSILKQWRET
FT                   YVVNA"
FT   gene            300211..302430
FT                   /locus_tag="BAS0281"
FT   CDS_pept        300211..302430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0281"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52612"
FT                   /db_xref="GOA:Q81ZH2"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZH2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52612.1"
FT                   /translation="MSLMLEPNPTQIKEERIYAEMGLTDEEFAMVEKILGRLPNYTETG
FT                   LFSVMWSEHCSYKNSKPVLRKFPTTGERVLQGPGEGAGIVDIGDNQAVVFKMESHNHPS
FT                   AIEPYQGAATGVGGIIRDVFSMGARPVALLNSLRFGELQSPRVKYLFEEVVAGIAGYGN
FT                   CIGIPTVGGEVQFDPCYEGNPLVNAMCVGLINHEDIKKGQAHGAGNTVMYVGASTGRDG
FT                   IHGATFASEELSESSEAKRPAVQVGDPFMEKLLIEACLELIQSDALVGIQDMGAAGLTS
FT                   SSAEMASKAGMGIEMYLDDVPQRETGMTPYEMMLSESQERMLIVVKKGREQEIVDLFEK
FT                   YGLAAVTMGKVTEDKMLRLFHKGEMVAEVPADALAEEAPIYHKPSKEAAYFAEFQQMKM
FT                   ETPKVENYKETLFALLQQPTIASKEWVYDQYDYQVRTSTVVTPGSDAAVVRVRGTEKGL
FT                   AMTTDCNSRYIYLDPEVGGKIAVAEAARNIVCSGGEPLAITDCLNFGNPEKPEIFWQIE
FT                   KSVDGMSEACRTLQTPVIGGNVSMYNERSGEAVYPTPTVGMVGLVHDLKHVTTQEFKQA
FT                   GDLVYVIGETKAEFGGSELQKMLHGKIFGQSPSIDLDVELKRQKQVLAAIQAGLVQSAH
FT                   DVAEGGLAVAISESAIGANGLGATVKLDGEATAALFAESQSRFVITVKRENKEAFEKAV
FT                   EAIQVGEVTNTNEVTIHNEENEVLLTANVDEMRKAWKGAIPCLLK"
FT   gene            302415..303830
FT                   /locus_tag="BAS0282"
FT   CDS_pept        302415..303830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0282"
FT                   /product="amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52613"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52613.1"
FT                   /translation="MLAEIKGLNEECGVFGIWGHENAAQVSYYGLHSLQHRGQEGAGIV
FT                   VNNGEKIVGHKGLGLISEVFSRGELEGLNGKSAIGHVRYATAGGSEVANVQPLLFRFSD
FT                   HSMALAHNGNLINAKMLRRELEAEGSIFQTSSDTEVLLHLIKRSTKDSLIESVKEALNK
FT                   VKGAFAYLLLTGNEMIVALDPNGFRPLSIGKMGDAYVVASETCAFDVVGATYIRDVEPG
FT                   ELLIINDEGIHVDRFTNEVDHAICSMEYIYFARPDSNIAGINVHAARKNMGKRLAAEAP
FT                   IEADVVTGVPDSSISAAIGYAEATGIPYELGLIKNRYVGRTFIQPSQELREQGVKMKLS
FT                   AVRGVVEGKRVVMIDDSIVRGTTSKRIVRMLREAGATEVHVRIASPPLKYPCFYGIDIQ
FT                   TRKELIAANHTVEEIREMIGADSLTFLSEDGLVDAIGRPYEGKYGGLCMAYFNGDYPTA
FT                   LYDYEQELLESMK"
FT   gene            303937..304977
FT                   /locus_tag="BAS0283"
FT   CDS_pept        303937..304977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0283"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52614"
FT                   /db_xref="GOA:Q81ZH0"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="PDB:2BTU"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZH0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52614.1"
FT                   /translation="MANAYKQAGVDIEAGYEAVSRMKKHVQTTMRKEVLGGLGGFGGMF
FT                   DLSKFALEEPVLVSGTDGVGTKLMLAFMADKHDTIGIDAVAMCVNDIVVQGAEPLFFLD
FT                   YIACGKAEPSKIENIVKGISEGCRQAGCALIGGETAEMPGMYSTEEYDLAGFTVGIVDK
FT                   KKIVTGEKIEAGHVLIGLASSGIHSNGYSLVRKVLLEDGELSLDRIYGRLELPLGEELL
FT                   KPTKIYVKPILELLKNHEVYGMAHITGGGFIENIPRMLPEGIGAEIELGSWKIQPIFSL
FT                   LQEVGKLEEKEMFNIFNMGIGMVVAVKEEDAKDIVRLLEEQGETARIIGRTVQGAGVTF
FT                   NGGKAL"
FT   gene            304974..305561
FT                   /locus_tag="BAS0284"
FT   CDS_pept        304974..305561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0284"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52615"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52615.1"
FT                   /translation="MSRLAVFASGSGSNFQSLVNAVEEKRLDAEISLLVCDKPEARAVG
FT                   RANYHHIPCFAFSAKAYESKEAFEKEILNKLEEYEIDYVILAGYMRLIGPTLLEAYGGR
FT                   IINIHPSLLPSFPGKDAVGQALEAGVKVTGVTIHYVDAGMDTGPIIAQEAVVVSEGDTR
FT                   ESLQKKIQQVEHKLYVNTVNQIVQSTKEPTVN"
FT   gene            305586..307121
FT                   /locus_tag="BAS0285"
FT   CDS_pept        305586..307121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0285"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52616"
FT                   /db_xref="GOA:Q81ZG8"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZG8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52616.1"
FT                   /translation="MKKRALVSVSDKTGVVEFVKGLLEQGIEVISTGGTKKLLEENGLQ
FT                   VIGISEVTGFPEIMDGRVKTLHPNIHGGLLAVRDNETHVAQMNELGMEPIDFVVVNLYP
FT                   FKETIAKPDVTFADAIENIDIGGPTMIRSAAKNHKFVSVIVDPVDYDVVLAELKENGEV
FT                   AEETKRKLAAKVFRHTAAYDALISNYLTEQMGEESPETLTVTFEKKQDLRYGENPHQKA
FT                   TFYKAPFAATSSVAYAEQLHGKELSYNNINDADAALSIVKEFTEPAVVAVKHMNPCGVG
FT                   VGTDIHEAYTRAYEADPVSIFGGIIAANREIDKATAEKLHEIFLEIIIAPSFSKEALEV
FT                   LQSKKNLRLLTVNIEKATSASKKLTSVQGGLLVQEEDTLSLDESTISIPTKREPSEQEW
FT                   KDLKLAWKVVKHVKSNAIVLAKDDMTIGVGAGQMNRVGSAKIAITQAGEKAQGSALASD
FT                   AFFPMPDTVEEAAKAGITAIIQPGGSIRDEDSIKVADTYGIAMVFTGVRHFKH"
FT   gene            307243..308514
FT                   /locus_tag="BAS0286"
FT   CDS_pept        307243..308514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0286"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52617"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52617.1"
FT                   /translation="MNVLVIGRGGREHALAWKFAQSEKVEKVYVAPGNEGMRDVATPID
FT                   IDENDFDALVLFAKENHVELTFVGPEIPLMNGIVDRFKEEGLRVFGPNKAAAVIEGSKA
FT                   FTKELMKKYNIPTAAYETFTDYEEAVQYIEKVGAPIVIKADGLAAGKGVTVAMTLEEAL
FT                   QAAKEMLQDVKFGEASKKVVIEEFLDGQEFSLMAFVNGTTVHPMVIAQDHKRAFDGDKG
FT                   PNTGGMGAYSPVPQISESAVQEAIETVLYPTAKAMIQENRSFTGILYAGLILTNDGPKV
FT                   IEFNARFGDPETEVVLPRLENDLVDVCNAVLDESELTLQWSDEAVIGVVLAAKGYPEAY
FT                   KKGDIIKGLDALQDVIVFHAGTAMKRGDFVTNGGRVLFVACKANSLQEAKDKVYKEIGK
FT                   IESDVLFYRSDIGYRAIGHEMTRS"
FT   gene            complement(308550..308714)
FT                   /locus_tag="BAS0287"
FT   CDS_pept        complement(308550..308714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0287"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52618"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52618.1"
FT                   /translation="MAKKKSFPLRIDPELHAVIEKWANDEFRSVNAHIEYLLREMAKQK
FT                   GKLKKDKDA"
FT   gene            complement(308731..309576)
FT                   /locus_tag="BAS0288"
FT   CDS_pept        complement(308731..309576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0288"
FT                   /product="SPFH domain/band 7 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52619"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52619.1"
FT                   /translation="MKEKQVFYVNGFLGIIGILILAAIGVFFLIQEIFIGAALTIILAA
FT                   VLATGIGIVQPNQAKVITFFGNYLGTIRQNGLFLTIPFAFRQTVSLRVENFNSKKLKVN
FT                   DVDGNPIEIAAVIVYKVVDSAKAMFGVEHYDRFVEIQSETAIRHVATKYPYDNFQDETC
FT                   ITLRGNTEEISEELKRELEARLEIAGVEVLETRLTHLAYATEIAHAMLQRQQAKAVLAA
FT                   RKEIVEGAVKMAKDSIHMLDEEGVLELDDERKANMVNNLLVAIVSDKGAQPVINTGSLY
FT                   "
FT   gene            complement(309786..310163)
FT                   /locus_tag="BAS0289"
FT   CDS_pept        complement(309786..310163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0289"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52620"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52620.1"
FT                   /translation="MKQNIGTINALIRITLGLVLFGCSATKLVRKPWCTWSNILLWIGA
FT                   MKVAEGIVRFCPVVEMWKFGKYMNMGAFKMPSMNFAEKGHTKEEVNQTSNHDKPQSNGS
FT                   YDASDKEIESAIEDIILAKPL"
FT   gene            310498..311187
FT                   /locus_tag="BAS0290"
FT   CDS_pept        310498..311187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0290"
FT                   /product="pcrB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52621"
FT                   /db_xref="GOA:Q81ZG3"
FT                   /db_xref="InterPro:IPR008205"
FT                   /db_xref="InterPro:IPR038597"
FT                   /db_xref="InterPro:IPR039074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZG3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52621.1"
FT                   /translation="MYDISGWKHVFKLDPNKELSDEHLEMICESGTDAVIVGGSDGVTI
FT                   DNVLHMLVSIRRYAVPCVLEVSDVEAITPGFDFYYIPSVLNSRKVEWVTGVHHEALKEF
FT                   GDIMDWDEIFMEGYCVLNPEAKVAQLTDAKCDVTEDDVIAYARLADKLLRLPIFYLEYS
FT                   GTYGDVELVKNVKAELKQAKLYYGGGISNAEQAKEMAQHADTVVVGNIIYDDIKAALKT
FT                   VKAVKGE"
FT   gene            311188..313443
FT                   /locus_tag="BAS0291"
FT   CDS_pept        311188..313443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0291"
FT                   /product="ATP-dependent DNA helicase PcrA"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52622"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52622.1"
FT                   /translation="MQAYMSMTDRLLNGLNPQQQKAVQTTNGPLLLMAGAGSGKTRVLT
FT                   HRIAYLLGEKGVAPWNVLAITFTNKAAREMRERIDTLVGPEAEDIWISTFHSMCVRILR
FT                   RDIDHIGINRNFTILDSGDQLTVVKKIMKERNIDPKKFEPRSILAGISNAKNELLSADK
FT                   YAKKITIADPYEKLTSDVYTEYQKRLLKNNSLDFDDLIMTTIQLFERVPEVLEFYQRKF
FT                   QYIHVDEYQDTNKAQYLLVKHLAARFKNLCVVGDSDQSIYRWRGADISNILSFEKDYEN
FT                   AQVILLEQNYRSSQNILNAANAVIERNTNRKPKKLWTDNEVGSKISYYRAATEKDEAYF
FT                   VAKKIRDDIQMGKRKYTDFAVLYRTNAQSRMVEEIFLKSNIPYKIVGGTKFYDRKEIKD
FT                   ILAYLRLIGNPDDEISFARIINVPKRGIGATSIDKIINYGVQNGISLTAVFDEIEHVGV
FT                   SAKVTKAVKEFAGLLHNWVNMQEYLSVTELVEEVIEKTGYRDMLKNERTLEAEGRLENL
FT                   DEFLSVTQTFESQSEDKSLVAFLTDLALVADIDRVDEDPTAGEEVILMTMHSAKGLEFP
FT                   VVFIVGLEEGIFPHTRSLMEEDEMQEERRLAYVGITRAEEELYLSNAQMRTLFGRTSMN
FT                   AASRFITEIPTELVESLNETAPKRETSFGAKGRVASSSKTTTTTRSRSAFARPAAKTTG
FT                   GEQIGWAVGDKASHQKWGVGTVISVKGEGDAKELDIAFPSPIGVKRLLAKFAPVTKQ"
FT   gene            313459..315468
FT                   /locus_tag="BAS0292"
FT   CDS_pept        313459..315468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0292"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52623"
FT                   /db_xref="GOA:Q81ZG1"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZG1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52623.1"
FT                   /translation="MSKEIAKKRIEELRDLLNTFNYQYHVLDNPSVSDAEYDRNMQELI
FT                   KLEAENPEFMSEDSPSIRVGGTVLDIFEKVTHKSPMLSLGNAFNEGDLRDFDRRVRQGI
FT                   DDANVRYICELKIDGLAVSLHYEKGRFIQGATRGDGVTGEDITQNLKTIKAIPLRLNEE
FT                   VTLEARGEAYMPKRSFVKLNEEKEQNGEDVFANPRNAAAGSIRQLDPKIAAKRNLSMFV
FT                   YGLANVEEKTIPSHSESLDYLGELGFKTNPNRRTCETIEEVIAYVEEWQEKRPHLDYEI
FT                   DGIVIKVDDVALQESLGTTAKSPRWAIAYKFPAEEVVTRLTGIELSVGRTGVVTPTAEL
FT                   EPVRVAGTIVRRASLHNEDLIREKDIRIGDYVVVKKAGDIIPEVVNVIFDKRTGGEEEY
FT                   HMPTHCPACESELVRLEEEVALRCINPTCPAQIREGLIHFVSRNAMNIDGLGERVITQL
FT                   FDADYIRTFADLYSLTKEQLLQLERFGEKSATNLVQAIENSKENSLERLLFGLGIRHVG
FT                   AKAARTFAEHFETMDALVKATEEELKAINEIGEKMAQSVVAYFDNEDVLELLQQFKEYG
FT                   VNMTYKGIKIADLQNVESYFAGKTVVLTGKLEVMGRSEAKKKIEALGGKVTGSVSKSTD
FT                   LVVAGEAAGSKLAQAEKHNVEVWNEERFLQELNK"
FT   gene            315485..316678
FT                   /locus_tag="BAS0293"
FT   CDS_pept        315485..316678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0293"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52624"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52624.1"
FT                   /translation="MKKIALAVLSLGLLVSGCSAGADKDEKVVEKSGKAKEQVIVPNYS
FT                   ISDEYYKTTIPFEGGNARGLVVQGVSNRLDIDEFETGLMRIAKESFSTKDNVLKGGKSL
FT                   TTQYIQMLVKRKRTDAEQKELEDTLKKDAVKFPNIGLNPALGAGSESLEAKNKKNPIYI
FT                   SNILEHDYYVNKDKKDERSGIVVGLAMNSVHYYEEEHGYPREVTISNEKMLAEGKKMVP
FT                   EILKVMHQQDPETKNLPITFAIYRQAPKSSLVPGNFVSYGNVEKGSETVEDWKQINEKY
FT                   YLFPSEQAKTDNKREDLARVSNFKAKLSDYFQGDYTAVIGTGMYRDDELREIKLDIPVQ
FT                   FNGKAEIIGFTQYVAGLVMEYFPNYMKVQVTIKSVERPEAIIIREAKQDEPYVKILD"
FT   gene            316774..317544
FT                   /locus_tag="BAS0294"
FT   CDS_pept        316774..317544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0294"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52625"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52625.1"
FT                   /translation="MDELSFQVIILLIAFGFLAAFIDSVVGGGGLISLPALMFVGLPPA
FT                   SAIATNKLAATMGTFTSAIYFIRSGKVDFKIVGKLIPLTVIGAVAGALVVKFIPPDILR
FT                   PLVLVMLVFIAIYIIAKKDWGSVSTYKKMTKRKTLIFFFVILMIGFYDGFFGPGTGSFL
FT                   IFAFLLIGLDFIQAAASGKLLNFVSNIVSLITFLFLDVIHFEYGIIMGLSMIFGAYFGS
FT                   KFAVQKGVGYVRALFLLVTILLISKNVLEYTHIL"
FT   gene            317698..319245
FT                   /locus_tag="BAS0295"
FT   CDS_pept        317698..319245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0295"
FT                   /product="delta-1-pyrroline-5-carboxylate dehydrogenase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52626"
FT                   /db_xref="GOA:Q81ZF8"
FT                   /db_xref="InterPro:IPR005932"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZF8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52626.1"
FT                   /translation="MVVAYKHEPFTDFSVEANKLAFEEGLKKVESYLGQDYPLIIGGEK
FT                   ITTEDKIVSVNPANKEELVGRVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRA
FT                   AAIVRRRKHEFSAILVKEAGKPWNEADADTAEAIDFMEYYGRQMLKLKDGIPVESRPIE
FT                   YNRFFYIPLGVGVIISPWNFPFAIMAGMTTAALVSGNTVLLKPASTTPVVAAKFMEVLE
FT                   EAGLPAGVVNFVPGNGSEVGDYLVDHPRTRFISFTGSRDVGIRIYERAAKVNPGQIWLK
FT                   RVIAEMGGKDTIVVDKEADLELAAKSIVASAFGFSGQKCSACSRAVIHEDVYDHVLNRA
FT                   VELTKELTVANPAVLGTNMGPVNDQAAFDKVMSYVAIGKEEGRILAGGEGDDSKGWFIQ
FT                   PTIVADVAEDARLMKEEIFGPVVAFCKAKDFDHALAIANNTEYGLTGAVISNNRDHIEK
FT                   AREDFHVGNLYFNRGCTGAIVGYQPFGGFNMSGTDSKAGGPDYLALHMQAKTTSETL"
FT   gene            complement(319812..320375)
FT                   /locus_tag="BAS0296"
FT   CDS_pept        complement(319812..320375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0296"
FT                   /product="isochorismatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52627"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52627.1"
FT                   /translation="MKTALLLVDIQNDYFPHGKMELRNPAEASAYASQLLQLFRKKNEP
FT                   IFHIQHISIKEDATFFLPNTEGVHIHESVRPLREESVILKHYPNSFRETDLLKQLQRLA
FT                   IEHVVICGMMTHMCIDATVRAAFDFGLQCTVIHDACATKDLSFKNATIPAVYIHNTILA
FT                   SLNGVYANVMSTEEFLATKKHSLQ"
FT   gene            320848..321867
FT                   /locus_tag="BAS0297"
FT   CDS_pept        320848..321867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0297"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52628"
FT                   /db_xref="GOA:Q81ZF5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZF5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52628.1"
FT                   /translation="MISFNNVSKVYESGGQSVHAVEDVTLSVEKGEIFGIIGFSGAGKS
FT                   TLLRLVNMLERPTAGTISIDDKDITSLSTKELRKLRQRIGMIFQSFNLFNSRTVFGNIA
FT                   YPLKLAKVPKNEIKERVNELLKFVGLEDKANNYPEQLSGGQKQRVGIARALATSPDILI
FT                   CDEATSALDPETTTEILNLLKKVNREYNLTILLITHEMHVVKEICHRVAVMEKGKVIEE
FT                   GKLFDVFTQPKTTTTQNFVRSVINDHLPESVLAKIQNGGQIYRLTFTGEETGQPVLSYI
FT                   AKNYNVDVNVLYGNIIELQNVLFGNLLVELQGEQREIQKALQHLRLQVQLKEVEAHAS"
FT   gene            321857..322522
FT                   /locus_tag="BAS0298"
FT   CDS_pept        321857..322522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0298"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52629"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52629.1"
FT                   /translation="MRVDWSIFWPRILDATGDTLLMVIVTLIFATILGIPLGLLLYVTR
FT                   KGNFLENKWVFSILNIIINTIRPIPFIIFLVALSPLTRSVIGTTIGTAAAIFPMTLVAS
FT                   IGIARMVETNLVSVPKGVIEAAQAMGASPIRIVFEILVPEALAPLILGVTFMTVGLIEF
FT                   SAVAGLVGGGGLGDLAMTYGYQRFDTSVMFVTVVLLIILVQLAQNLGNYFAKVFLRRS"
FT   gene            322544..323398
FT                   /locus_tag="BAS0299"
FT   CDS_pept        322544..323398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0299"
FT                   /product="ABC transporter, substrate-binding protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52630"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52630.1"
FT                   /translation="MKKILAFALSAIVGVSALSGCSSGDTGAGAKEKVVRVGVTGTDGD
FT                   AWEILKRKAEKEGIKIKLVEFSDYTTPNKALADGDIELNSFQHIAFLEQFKKEHKLDIT
FT                   AVGTTQIAPMGLYSEKHKKANEIPDGSEIAIPNDPTNQARALKLLDAAGLLKLKKDFGL
FT                   FGDPSGIAENPKKLKITPVIAQQTPRVLKDVAASVINNGVAGQAGLDPAKDPIFLEDPK
FT                   NENAKPYINIFAARTKDKDDPTLKKVIELYHSKEVTDAIKKETNDGSISVDLSLDELEK
FT                   IVK"
FT   gene            complement(323565..324035)
FT                   /locus_tag="BAS0300"
FT   CDS_pept        complement(323565..324035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52631"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52631.1"
FT                   /translation="MLKRISTIIFWIIPLLFFIHNLEESFQMPQYLANQFSITFISSQH
FT                   FFIAISVLTLFVLVIIFLYQLNFLSSIYWIIFIQGAIFFNSVQHIILFFIYRSYNPGVI
FT                   STVFIVIFSIFFFSSQKHLIHKKQFVITLVFSLFSYPIIIWITLLLASYFHS"
FT   gene            complement(324094..324300)
FT                   /locus_tag="BAS0301"
FT   CDS_pept        complement(324094..324300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52632"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52632.1"
FT                   /translation="MEVSCMHEELLRKIIRTKIKVGMHILEELPAPIQQSAKQMLNILQ
FT                   EELSSYPNEQGHHKNNLKNIIIE"
FT   gene            complement(324278..324931)
FT                   /locus_tag="BAS0302"
FT   CDS_pept        complement(324278..324931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0302"
FT                   /product="anion-transporting ATPase, C-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52633"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52633.1"
FT                   /translation="MPLPTDDIMDELTNTLEQLGEMRDILSNREVTSIRIVVNPEKMVI
FT                   KEAQRSFTYLNLYDYNVDAIMINRVIPNTVTDPYFQAWKDTQKKYKTLIQDSFDPLPIY
FT                   EAPMFEQEVVGLPMLERVGDALFKTEPCPTEVKFNGRTQYVKKDGDEYIFVLSIPFSNK
FT                   SELTLNQKGDELIIRAGSVKRNITLPKTLTHLSIQGAKFEEDVLNIRFGGVVHA"
FT   gene            complement(324949..325458)
FT                   /locus_tag="BAS0303"
FT   CDS_pept        complement(324949..325458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0303"
FT                   /product="anion-transporting ATPase, N-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52634"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52634.1"
FT                   /translation="MMRIILYTGKGGVGKTSISAATAIQSAKQGLKTLVMSTDPAHSLG
FT                   DSFGVKLSSEPLEIRENLWAQEINTIYEMEKGWGKLQKYITLLFTSKAADDITTEELTM
FT                   FPGMEDLISLLRVLDYYKQNTYDVIIIDCAPTGETLAMLSFPDMLGWWMEKLFPIKRKV
FT                   LKLFAL"
FT   gene            complement(325535..326017)
FT                   /locus_tag="BAS0304"
FT   CDS_pept        complement(325535..326017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0304"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52635"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52635.1"
FT                   /translation="MLQYEHFLDLLLDNAKKLFYPEEWVSLDLTLSKTEVFCLLWMERN
FT                   TDITMTKIADLLDIPMSTTTGVVNRLVKKGYIERYRDENDRRIVLIRLTENGVTLVQEV
FT                   KQNAAHYFNLVTEALSEEEKAFLLQIFQKIMNHIATSQQKTEEKVSTPKMKNIPIE"
FT   gene            326628..326918
FT                   /locus_tag="BAS0305"
FT   CDS_pept        326628..326918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0305"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52636"
FT                   /db_xref="GOA:Q81ZE9"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZE9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52636.1"
FT                   /translation="MSRISVENVKHVAHLARLAITDQEAEKFQKQLDAIVTFAEQLNEL
FT                   DTTDVKPTTHVLTMKNVMREDVPEKGLPVEEVLKNAPDHKDNQIRVPAVLE"
FT   gene            326934..328391
FT                   /locus_tag="BAS0306"
FT   CDS_pept        326934..328391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0306"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52637"
FT                   /db_xref="GOA:Q81ZE8"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZE8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52637.1"
FT                   /translation="MSLFDHSVSELHKKLNNKEISVTDLVEESYKRIADVEDNVKAFLT
FT                   LDEENARAKAKELDAKIGAEDNGLLFGMPIGVKDNIVTNGLRTTCASKILANFDPIYDA
FT                   TVVQKLKAADTITIGKLNMDEFAMGSSNENSGFYATKNPWNLDYVPGGSSGGSAAAVAA
FT                   GEVLFSLGSDTGGSIRQPAAYCGVVGLKPTYGRVSRYGLVAFASSLDQIGPITRTVEDN
FT                   AYLLQAISGLDRMDATSANVEVGNYLAGLTGDVKGLRIAVPKEYLGEGVGEEARESVLA
FT                   ALKVLEGMGATWEEVSLPHSKYALATYYLLSSSEASANLSRFDGVRYGVRSDNVNNLMD
FT                   LYKNTRSEGFGDEVKRRIMLGTFALSSGYYDAYYKKAQQVRTLIKNDFENVFANYDVII
FT                   GPTTPTPAFKVGEKVDDPMTMYANDILTIPVNLAGVPAISVPCGFGANNMPLGLQIIGK
FT                   HFDEATIYRVAHAFEQATDHHTKKASL"
FT   gene            328406..329833
FT                   /locus_tag="BAS0307"
FT   CDS_pept        328406..329833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0307"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52638"
FT                   /db_xref="GOA:Q81ZE7"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZE7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52638.1"
FT                   /translation="MNLETIIGLEVHVELKTNSKIFSASPTEFGAEPNTQTSVIDLGYP
FT                   GVLPTLNKEAVNFAMKAAMALNCEIATETKFDRKNYFYPDNPKAYQISQFDKPIGENGW
FT                   IEIEVDGKKKRIGITRLHLEEDAGKSTHTADGSLVDYNRQGMPLIEIVSEPDMRTPEEA
FT                   YAYLEKLKSIIQYTGVSDCKMEEGSLRCDANISLRPVGQEKFGTKAELKNLNSFTYVQK
FT                   GLEHEQVRQEKELLSGGIIQQETRRYDEATKKTILMRVKEGSDDYRYFPEPDLVELYID
FT                   DAWKEEVRASIPELPDARKARYVAEIGLPAYDAHVLTLTKEMSDFFEAAIADGADAKLT
FT                   SNWLMGEVLAYLNKQQKELKDVALTPAGLSKMVQLIEKGTISSKIAKKVFNELIEKGGD
FT                   PEEIVKAKGLVQISDEGTLRKVVTEILDNNEQSIEDFKNGKDRAIGFLVGQIMKATKGQ
FT                   ANPPLVNKILLEEINKR"
FT   gene            330304..331209
FT                   /locus_tag="BAS0308"
FT   CDS_pept        330304..331209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0308"
FT                   /product="conserved hypothetical protein TIGR00147"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52639"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52639.1"
FT                   /translation="MMKRARIIYNPTSGRELFKKSLPEVLQKLEQAGYEASCHATTGPG
FT                   DATVAARQAADRKFDVVIAAGGDGTLNEVVNGLVGHEHRPKFGIIPVGTTNDFARAIGV
FT                   PRSIEEAADIICEGKTVPLDLGRANDTYFINIAGGGRITELTYEVPSKLKTVLGQLAYY
FT                   LKGIEMLPSLHPTYVEIEYDGKLLQEEITMFLITNTRSVGGFEKVAPYASINDGLFDLL
FT                   VLKKGSIADLIKAATQAQRGEHINNPKVLYTQANRIKVHSPDKLMINLDGEYGGDAPME
FT                   FENIYHCLELFVPEHQEDAL"
FT   gene            331349..332092
FT                   /locus_tag="BAS0309"
FT   CDS_pept        331349..332092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0309"
FT                   /product="haloacid dehalogenase/epoxide hydrolase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52640"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52640.1"
FT                   /translation="MEKVKAILFDKDGTLMDFHSIWIKVAEELVAECINLYELPKSMQP
FT                   TLLKEIGVEGVFVNPRSAIAAGTSLDVAKGLCKYITSSKEEEMHEWVSEKLFSLMYEHR
FT                   SYMKMTADLPRILQSLKDRGFILGVVTADDFAPTELFLKQYQLESFFDYVVASDTFPAQ
FT                   KPDKRIVESFCDKFHLDACEVAVVGDTPTDLHLAKNGDCYAIGVLSGTGDRQTLEPLAD
FT                   LVVQSVEDFISHSGEFIWERGKSNV"
FT   gene            332247..333611
FT                   /locus_tag="BAS0310"
FT   CDS_pept        332247..333611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0310"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52641"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52641.1"
FT                   /translation="MNTKKFAKVNEQIPGPKAASLLERRQNIVPKGVSNGIPTFVQSAN
FT                   GALVTDVDGNQYIDFAGAIGTINVGHCHPAVKEALHKQVDQYIHTGFNVMMYEPYIELA
FT                   EKLAALAPGSFDKQVLFLNSGAEAVENAVKIARKYTKRPGIIAFSKGFHGRTLMTMTMT
FT                   SKVKPYKFGFGPFAPEVYKAPFPYEYRCPEGLTEEQYDDFMIEEFKNFFISEVAPETIA
FT                   AVVMEPVQGEGGFIVPSKKFAQEVRNICSEHGILFVADEIQTGFSRTGKYFAIDHYDVV
FT                   PDLITVSKSLGAGVPISGVIGRKEIMNESAPGELGGTYAGSPLGCAAALAVLDVIEKEN
FT                   LNDRAIELGKVVMNRFEEMKNKYNCIGDVRGLGAMCAFELVQDRKTKTPDKTLTANLCT
FT                   EANKRGLLLLSAGTYGNVIRVLMPLVITDEQLEEGLTIIEESLQICYEKANTARV"
FT   gene            333724..335091
FT                   /locus_tag="BAS0311"
FT   CDS_pept        333724..335091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0311"
FT                   /product="sensory box sigma-54 dependent DNA-binding
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52642"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52642.1"
FT                   /translation="MVAEKERVLMDLQDVFEYAFDEIFVTDDKGIVVRVNSTCERHYQI
FT                   AAKELVGKHVKELQKDGIFYPSATLEVIEKKRPIELVQTTKSGEYLHVRTRPVFDDEGN
FT                   LRRVISYSRDLTELYQLRQKVEEMDNQLKTYKKELRETYEHEGLIFKSIAMQKIIETIK
FT                   KVSVVDSTVLVLGETGVGKSRLVRHLHEMSNRKNESFYEINCAALPTNLIESELFGYSG
FT                   GSFTGANREGKKGLLESAHKGTLFLDEIGEMPLEIQAKLLQVLQEKTFRPIGGRELKKV
FT                   DVRIVAATNRDLSMMVKQGTFRKDLYYRLNVIPILIPPLRERTEDILPLIYHYLQHFNE
FT                   KYGRNVKLAPSTLQMFVGYPWEGNNREIENVIERIVITADDIVTIEDLPIAMQESTVEQ
FT                   SGQSLYKMLEEVERNIILKAYKTYGSSYKVAEFLKISQSAATRKIKKLIEEEENIG"
FT   gene            335084..336535
FT                   /locus_tag="BAS0312"
FT   CDS_pept        335084..336535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0312"
FT                   /product="succinate-semialdehyde dehydrogenase (NADP+)"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52643"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52643.1"
FT                   /translation="MDKKATFVNVEKKAMYINGEWITLQEQIEVNNPATKEIFATVPKG
FT                   GVTEAKQAVDAAHEAFKSWSKLTAADRAAKLKKWFTLIDENKEEIAAIMTKEQGKPFAE
FT                   ALGEVNYANSFVEWYAEEGKRVYGEMIPASHPNKRILVMKQPVGVMAAITPWNFPAAMI
FT                   TRKVAPALAAGCTAVVKPASQTPLTALKLAELAHEADIPKGVINIVTGSAKAIADTWME
FT                   DGRVRKVSFTGSTEIGKELMASAAQTMKKVSLELGGHAPFIVMNDADLDKAVEAVIGSK
FT                   FRNAGQTCICTNRVFVQEEVYEAFVEKFEKAVGQLKVGDGFGDGTTVGPLIDENAVSKV
FT                   QEHIEDAIQKGGTVLYGGQKVAELDGHFMQPTVIGLANDTMLCMNEETFGPVAPVAKFK
FT                   TVEEVIERANHTPYGLAAYIFTKDISQAFQISEALEYGIIGLNDGLPSVAQAPFGGFKE
FT                   SGIGREGGHFGIEEYLEIKYISLGL"
FT   gene            336583..336906
FT                   /locus_tag="BAS0313"
FT   CDS_pept        336583..336906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0313"
FT                   /product="multidrug resistance protein, Smr family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52644"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52644.1"
FT                   /translation="MVYWLLLLVTIIFEVAGTIAMKLSNGLTKLVPSVLIFVFYGICFS
FT                   VFAIVVKKIHLSIAYAIWSGVGTLLITIISVYFFKEHISLFQACCILFIVLGVIGLKVS
FT                   SAS"
FT   gene            complement(336946..338175)
FT                   /locus_tag="BAS0314"
FT   CDS_pept        complement(336946..338175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0314"
FT                   /product="aminopeptidase AmpS"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52645"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52645.1"
FT                   /translation="MSFEQTLEKYAALAVNVGVNIQPGQTLSISAPLEAVQFVRLVTEK
FT                   AYKSGAKHVYVDWNDETLTRLKFDLAPEEAFAEFPSWKANAREELAKEGAAFMSIYAEN
FT                   PDLLKGVDSTRIATAHKVAGEAMKVYRDYVQADKVSWCVISVPTKEWAAKVFPDAAPEE
FT                   QEAKLWDAIFKATRADLENPVEAWKEHDKTLHTKVDYLNEKHYKALHYTGPGTDLTIEL
FT                   PEKHVWAGAGSLNEKNVPFMANIPTEEVFTMPLKTGVNGQVSSTKPLAFAGNIIDNFTL
FT                   TFENGRIVDYKAEVGEEALKHLVETDEGSHFLGEVALVPHDSPISNTNILFYNTLFDEN
FT                   ASCHLAIGSAYAFNLVGGKTMSKEELAENGANTSITHNDFMIGSAKLDIDGITADGRHE
FT                   PIFRKGNWAF"
FT   gene            complement(338292..339374)
FT                   /locus_tag="BAS0315"
FT   CDS_pept        complement(338292..339374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0315"
FT                   /product="polysaccharide deacetylase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52646"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52646.1"
FT                   /translation="MRKYAAIALCTSAILAGCNTSNVSQEPNKERKVQETKKQAETVQE
FT                   QGKISYNPITHESTNTTIHMTDIKDTLTEVQYKIWRTADGKETAKSLSSKEKEKQFSLP
FT                   FDTKEFEGKRGEFQIEAIGIKEDGKTIPLTKSAITFEQKVPVLMYHAIDDYHGQGIKDL
FT                   FVSPANFEAQMKYLKDNGYTLLTFERWGDINKVNKPIFVTFDDGMKNNMNAFHVLQKLK
FT                   DDTFKPVATEYMIVNNVDAEGSLSTSDIKEMVDSGIFSMQSHTATHADLPKITNYEEEL
FT                   KESKEKLEKITGKPVIAVAYPFGHVDDKVVAETKKYYQFATTTKPGKFITKGEPDELLK
FT                   MKRVRIHHTTTVEQFASSIK"
FT   gene            complement(339526..340629)
FT                   /locus_tag="BAS0316"
FT   CDS_pept        complement(339526..340629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0316"
FT                   /product="polysaccharide deacetylase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52647"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52647.1"
FT                   /translation="MKKYTYIALLSSAILVGCNTSSASDKQIQETTAKQAVEQKKAKAV
FT                   ELPLTQGVITWDPYEYNAQNTTLYTKDLRDSFKEVRYNIWRTADGPESKQTFTSQEKDR
FT                   DFALPLHLKTFHLKRGEFQIETVGIKEDNTETNLVTSKITFQQHVPVLMYHAIEKFPGP
FT                   SDGDYGLYVPPEQFEKHMQYLKDNGYTMLTFERWNDINRVNKPIFITMDDGRKNNMNAL
FT                   HILQKLKDDTFQPAATEFLTANEIDKPNRLSTDDIKQMMDSGIFSIQSHTANHTMMAHS
FT                   NNYDEELRGSKEKIEALTGKKVIALAYPVGSYNDPAVEETKKYYEFAVTTDHGNHITKG
FT                   MPNEQYLIKRHFVGPNTSMEKFISLIK"
FT   gene            complement(340869..342065)
FT                   /locus_tag="BAS0317"
FT   CDS_pept        complement(340869..342065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0317"
FT                   /product="nucleoside transporter, NupC family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52648"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52648.1"
FT                   /translation="MQYVMSIIGILVVLGLCFALSNNKSKINFRAIAIMIGFQILIGWF
FT                   MFGTKIGQQIIIFISKVFNKLIKLGTTGVDFLFNGIQRDFVFFLNVLLIIVFFSALLSI
FT                   FSYLGVLPFIVRVVGGAISKVTGLPRVESFHAVNSVFFGSSEALIVIKNDLQHFNKNRM
FT                   FIICCSAMSSVSASVTASYVMMLDAKYVLAALPLNLFSSLIVCSLLTPVDTKKEDEVVQ
FT                   KFDRTVFGDSFIGAMINGALDGLKVAGIVAALMIAFIGVMEVVNYVISAASGAMGHAVT
FT                   LQQIFGYVLAPFAFLMGIPAQDIIPAGGIMGTKIVLNEFVAILDLKGVAATLSPRTVGI
FT                   VTVFLISFASISQIGAIVGTIRALSEKQGSIVSKFGWKMLFASTLASILSATIAGLFI"
FT   gene            342491..343867
FT                   /locus_tag="BAS0318"
FT   CDS_pept        342491..343867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0318"
FT                   /product="RNA methyltransferase, TrmA family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52649"
FT                   /db_xref="GOA:Q81ZD6"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZD6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52649.1"
FT                   /translation="MSTKMTPPVEKNEFIDVVFEDLTHDGAGVAKVKGYPIFVKNGLPG
FT                   EEAQIKIVKVKKNFAFGRLMKLHTESPYRKDAECPVYNQCGGCQLQHLTYEGQLQAKEK
FT                   QVRDVMQRIGGLGDVPVHPVLGMKNPWVYRNKAQVPIGEREGGLVAGFYRQGTHDIINM
FT                   ESCLIQAEENDTLIQEVKRICEKHGISAYNEERNKGTLRHVMARYGQVTGEIMLVFITR
FT                   TAELPNKKAIIEEIAAKFPEVKSIVQNVNPKRTNVIFGDKTTVLYGSEYIYDFIGDIKF
FT                   AISARSFYQVNPEQTKVLYDKTLEYAKLDGNETVIDAYCGIGSISLFLAQKAKKVYGVE
FT                   IVPEAIEDAKRNAALNNMTNAEFGVGEAEVVIPKWYKEGVIADTMVVDPPRKGCDEALL
FT                   NTIIDMKPKRVVYVSCNPATLARDLKVLEEGGYKTQEVQLVDMFPHTTHVECVAWLKLV
FT                   "
FT   gene            343964..344953
FT                   /locus_tag="BAS0319"
FT   CDS_pept        343964..344953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0319"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52650"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52650.1"
FT                   /translation="MIDNFWRDLPRPFFVLAPMEDVTDVVFRHVVSEAGRPDVFFTEFT
FT                   NSDSYCHPEGMKSVRGRLIFTEDEQPMVAHIWGDNPEYFRQMSIGMAELGFKGIDINMG
FT                   CPVPNVASRGKGSGLILRPDVAAELIQAAKAGGLPVSVKTRLGFKELSEWEDWLTHIFK
FT                   QDIANLSIHLRTREEMSQVDAHWELIPEIKKLRDRIAPNTLLTINGDIPDRKTGLELAE
FT                   KYGIDGVMIGRGIFKNPFAFEKEPREHSSKEHLDLLRLQLDLQDQYAEVLPRSITGLHR
FT                   FFKIYVKGFPGAAELRNQLMSTKSTDEVRALLNKFEESVNVVEGSETV"
FT   gene            345214..345783
FT                   /locus_tag="BAS0320"
FT   CDS_pept        345214..345783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52651"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52651.1"
FT                   /translation="MGKVEVKKKKKLSVMKFLIYMLIAIVVINWIYKTPEEKKADLEEK
FT                   VASYEEFESHCITYEDWNVDKGGNKNLNTLYNDPQECLEKELFIWRNDGTELTRGVAKL
FT                   VFHNTDYYFTEEELKDDIQTEAENKYKLLEEIQRECKSTLLGGFSYDYYTDGYDYIIED
FT                   TSGEKSKMNEKIFNSLFEITKTYKNN"
FT   gene            346056..346574
FT                   /locus_tag="BAS0321"
FT   CDS_pept        346056..346574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0321"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52652"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52652.1"
FT                   /translation="MAMSNNDILKRVRYALDIRDIDMVEIFKLGGIEVTKEDVVDMLTK
FT                   IKRAPQYEPENPDVEEDEYVKTCDMMMLEAFFNGFITLKRGKQDPKPGQPAPVQSKESA
FT                   NNLLLKKMKIALSLTSEDVLDILDSVGVKVTKGELGALLRKKGHKNYKECGDRYARNFI
FT                   KGLAVKYRG"
FT   gene            346669..347376
FT                   /locus_tag="BAS0322"
FT   CDS_pept        346669..347376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0322"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52653"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52653.1"
FT                   /translation="MIHTYLGETINFHITYKKKKSVRLFVDSYGNVEVQAPKGTPVEYL
FT                   IQLLEEKWDWIQTTRKEMAERARGPQEKDYDQGEGFLYLGNTYPIQISQDASIEQDNAI
FT                   FEGDKLHIYVKELKDEKIQQALKRFYYKQCKSLVGKSIKAHQSNFKTKPRSIRITDSSR
FT                   TWGTCDSNLQLTFNWKLAMAPQRVIDYVVVHEMCHMVHLNHDRSFWRLVGKIMPDYKEM
FT                   ENWLALSSWKMTV"
FT   gene            complement(347576..348271)
FT                   /locus_tag="BAS0323"
FT   CDS_pept        complement(347576..348271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0323"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52654"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52654.1"
FT                   /translation="MTVLYEGRLKQNNERFHVTLLSLEYIEQILLLQNVVVEALEDKSR
FT                   LQPLSQEEFQYILEGNGMMIGAFIENELIAFRALLVPPIDDEHLGLDIGLPESELHRVI
FT                   YQEISNVHPNCRGNGMQKILATVIMDELQKEDSKYDYVCCTVAPFNIPSLKDKFAQGMK
FT                   IAALKEKYGGSMRYVFVKELREDNERDWTDIKSIPMNNAGGQQALLSEGYRGYKMEKVD
FT                   EDFVVKFGR"
FT   gene            complement(348286..349395)
FT                   /locus_tag="BAS0324"
FT   CDS_pept        complement(348286..349395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0324"
FT                   /product="mandelate racemase/muconate lactonizing enzyme
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52655"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52655.1"
FT                   /translation="MKITAIHLYAIRLPLRDPFVISYGSYSDMPSIIVKMETDEGIIGY
FT                   GEGVADDHVTGESWESTFHILKHTLAPALIGQNPMNIEKIHDMMDNTIYGVPTAKAAID
FT                   IACFDIMGKKLNQPVYQLIGGRYHEEFPITHVLSIADPEEMAEEAASMIQKGYQSFKMK
FT                   VGTNVKEDVKRIEAVRERVGNDIAIRVDVNQGWKNSANTLMALRSLGHLNIDWIEQPVI
FT                   ADDIDAMAHIRSKTDLPLMIDEGLKGSREMRQIINLDAADKVNIKLMKCGGIYPAVKLA
FT                   HQAEMAGIECQVGSMVESSVASSAGFHVAFSKKIITSVELTGPLKFTKDIGNLHYDVPF
FT                   IRLNEKPGLGIEINEDTLRELTVFQDIVR"
FT   gene            349488..350759
FT                   /locus_tag="BAS0325"
FT   CDS_pept        349488..350759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0325"
FT                   /product="transcriptional regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52656"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52656.1"
FT                   /translation="MMIKIAVVGSKEFMETLLPIAHKLEEIEIDPYVYLHPAESSELLK
FT                   RLKPCDFIFFSGALPYYMAKEIREQLRIPSTYLQQDETTVASSILSVMYHQGIQPHKIS
FT                   IDLVDRSFIINVFHDIGIKESPQVFDYENMLWSKDEINRVIDFHVAKYQSGKAHLALTS
FT                   IHAVYDELQKIGIPSERMIDLKQSIIHGLKDAKIKAELARSHSATVGACIISSLELRDG
FT                   LLEQLDVISKELRGSFKTIDEMTFILYTTRGDIESIIKTNIINNLFASIEGMIAIGFGY
FT                   GKTVKEAEQNAKIAQGFAKNNPIDHCFYILTSDKELFGPFPKEQRVQSLKNDNPELMKI
FT                   AKETKLSPANLSKIIQFSQSHPSLKFTAADLSEYLQVTRRSTERLLKKLVDYGYVHICG
FT                   EEMPYQQGRPRAIYELNLPLSLSF"
FT   gene            complement(350748..352169)
FT                   /locus_tag="BAS0326"
FT   CDS_pept        complement(350748..352169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0326"
FT                   /product="Na+/H+ antiporter NhaC"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52657"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52657.1"
FT                   /translation="MKKEIPFGVAMIPIIITVAVMMVTIVVLKQSPHVPLIIGTTVASI
FT                   VAWRYGYKWNDIEEAMYKGIHLALPAIVIIILVGLTIGAWIGGGIVATMIYYGLNLLTP
FT                   SLFLVSITIICSIVALAIGSSWSTMGTIGVAGMGIGLSMGIPAPMVAGAIISGSYFGDK
FT                   MSPLSDTTNLAAGLTNTDLFTHIRHMLFTTIPGLIITLIVYAFLGRSFGANNIDAKSIE
FT                   QTLQVLQQNFVISPFLLIIPVVVMVLVAKKVPAIPAILVGIILGFLSQVFIQGGSVSAS
FT                   VGALQAGFVIDTGNKLVDELFNRGGLDSMMNTVSMTIVAMTFGGVLEHTGILRSIVNQI
FT                   LKLAKSAKGLIASTIASCFATNLTCSEQYISIVVPSRMYANAYTEKGLHSKNLSRALED
FT                   GGTLTSVFVPWNTCGVFILATLGVGAFEYAPYAILNFIVPIISIIYGITGLTITKLSDI
FT                   EKAELLKKQNAQLEA"
FT   gene            352449..353564
FT                   /locus_tag="BAS0327"
FT   CDS_pept        352449..353564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0327"
FT                   /product="amidohydrolase amhX"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52658"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52658.1"
FT                   /translation="MKTLELQERLTEIFQHLHENPEVSWKEYETTAYITNFLKEEGISY
FT                   KTFDDCPGVIAEIGNGNPVVAIRADMDALWQEVNGEFKANHSCGHDAHMTIVMGLILQL
FT                   KNMRWKSGTVRFIFQPAEEKGNGALKMVEKGAVDDADFLFGVHLRPIEELSLKQAASSI
FT                   RHGAAGFLEGTIHGEDAHGARPHQGINAIDVISMINIGLKNIWLRPQSSYSVKMTRCQA
FT                   GGDNLNIIPGNGHFSLDVRAENNTLLEELKKRIEHVIESAASMGSKTSYEWIDLAPGAE
FT                   VSEEAERFMRKGILEVYGEDKCTGPLYTTGSDDFHYYTVKRPYLKAVMLGLGADLQPGL
FT                   HHPYMKFDHSCIMDGVEILKQTVLKVLEDRG"
FT   gene            353716..354324
FT                   /locus_tag="BAS0328"
FT   CDS_pept        353716..354324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0328"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52659"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52659.1"
FT                   /translation="MNEQYYDAVLNIKTVGEQKGFNKSMHYHRYEPTPYSGLDELLNQY
FT                   EIKRSDRVVDFGCGKGRLNFYMHHKCGASAVGIEMNEEFYKEALDNLDRYARKVRDSKD
FT                   KIRFECCLAQEYEINPCDNRFYFFNPFSVQVFMNVVNNILLSVEETGREVDIILYYPSE
FT                   DYIFFLENQTTFELKREVRLPGAYEKNGNERFLVYTLGL"
FT   gene            complement(354369..355895)
FT                   /locus_tag="BAS0329"
FT   CDS_pept        complement(354369..355895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0329"
FT                   /product="alkyl hydroperoxide reductase, F subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52660"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52660.1"
FT                   /translation="MILDADIKTQLSQYLQLMENDILLKVSAGNDDVSKDMLALVDELA
FT                   TMSSKITVEKVELERTPSFSVNRPGEDTGVVFAGIPLGHEFTSLVLALLQVSGRAPKVE
FT                   QKLIDQIKNIQGEYHFESYISLSCHNCPDVVQALNVMSVLNSGITHTMIDGAAFKEEVE
FT                   SKDIMAVPTVFLNGESFGSGRMTLEEILAKMGNGPDASELSDKDPYDVLVVGGGPAGAS
FT                   AAIYAARKGIRTGIVAERFGGQVMDTMGIENFISVKRTEGPKLVASLEEHVKEYDIDVM
FT                   NLQRAKRLEKKELIEVELENGAILKSKSVIVSTGARWRNVGVPGEAEFKNKGVAYCPHC
FT                   DGPLFTGKDVAVIGGGNSGIEAAIDLAGIVKHVTVLEFMPELKADAVLQERLNSLPNVT
FT                   VLKNVQTKEITGTDKVNGISYIDRETEEVHHVELQGVFVQIGLVPNTDWLGETVERVRG
FT                   EIVTDKHGATNVPGVFAAGDCTNNPYKQIIISMGSGANAALGAFDYLIRN"
FT   gene            complement(355910..356473)
FT                   /locus_tag="BAS0330"
FT   CDS_pept        complement(355910..356473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0330"
FT                   /product="alkyl hydroperoxide reductase, subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52661"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52661.1"
FT                   /translation="MLLIGTEVKPFKANAYHNGEFIQVTDESLKGKWSVVCFYPADFTF
FT                   VCPTELEDLQNQYATLKELGVEVYSVSTDTHFTHKAWHDSSETIGKIEYIMIGDPTRTI
FT                   TTNFNVLMEEEGLAARGTFIIDPDGVIQSMEINADGIGRDASILVNKIKAAQYVRNNPG
FT                   EVCPAKWQEGSATLKPSLDLVGKI"
FT   gene            357064..358293
FT                   /locus_tag="BAS0331"
FT   CDS_pept        357064..358293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0331"
FT                   /product="5-methylthioribose kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52662"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52662.1"
FT                   /translation="MSKFTKYFLMEANDVIVYVKEKLCKFEHAKGLQCKEIGDGNLNYV
FT                   FRVWDEQKNISVIVKQAGDTARISDEFKLSTNRIRIESDVLQLEEELAPGLVPKVYLFD
FT                   SVMNCCVMEDLSDHTILRTALINHEIFPRLADDLTTFLVNTLLLTSDVVMNHKEKKELV
FT                   KNYINPELCEITEDLVYAEPFTNHNKRNELFPLNEGWIREHIYSDKELRIEVAKLKFSF
FT                   MTNAQALIHGDLHTGSVFVKNDSTKVIDPEFAFYGPMGYDIGNVMANLMFAWVNADATM
FT                   SAGAKKDTYMDWLQSTMVEVIDLFKKKFLDAWNIHVTEIMAKEEGFNEIYLQSVLEDTA
FT                   AVTGLELIRRIVGLAKVKDITCIENEEARARAERICLQVAKKFILRANQYKTGTSFVET
FT                   LKEQSMHYAK"
FT   gene            358303..359349
FT                   /locus_tag="BAS0332"
FT   CDS_pept        358303..359349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0332"
FT                   /product="translation initiation factor, putative, aIF-2BI
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52663"
FT                   /db_xref="GOA:Q81ZC2"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZC2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52663.1"
FT                   /translation="MMEEQLIPIQWKDDALVLLDQTLLPNEVVYESFNTAEGVWDAIQV
FT                   MKVRGAPAIGVSAAYGVYLGVKEFVESTEAEFIDEVKRVCAYLATSRPTAVNLFWALER
FT                   MESVATDHTHLSITQLKDRLLEEAKEIHREDEEINRQIGEHALTLFHDGMGVLTHCNAG
FT                   ALATTKYGTATAPMYLAKEKGWDLKIYSDETRPRLQGSTLTALELQRAGIDVTVITDNM
FT                   AAMVMSQGKIDAVIVGCDRVAANGDVANKIGTLGVSILAKYYNIPFYVAAPTPTIDLKT
FT                   PTGKEIPIEERDASEVINRFGQYSAPKESKVYNPAFDVTPHENVTAIITEKGIVKAPFT
FT                   ENLKKLFQ"
FT   gene            359404..360045
FT                   /locus_tag="BAS0333"
FT   CDS_pept        359404..360045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0333"
FT                   /product="L-fuculose phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52664"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52664.1"
FT                   /translation="MLLQKEREEIVAYGKKMISSGLTKGTGGNISIFNREQGLVAISPS
FT                   GLDYYETKPEDVVILNLDGEVVEGERKPSSELDMHLIYYRNREDINALVHTHSPYAKTI
FT                   ASLGWELPAVSYLIAFAGPNVRCAPYETFGTKQLAEAAFEGMIDRRAVLLANHGLIAGA
FT                   NHIKMAFTVAEEIEFCAQIYYQTKSIGEPKLLPEDEMENLAKKFEGYGQQ"
FT   gene            complement(360086..361093)
FT                   /locus_tag="BAS0334"
FT   CDS_pept        complement(360086..361093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0334"
FT                   /product="iron compound ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52665"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52665.1"
FT                   /translation="MIPSILRKQRLIILALLILTITTIVIGMGLGSASLSYDRLLPILM
FT                   GQGTFKEEFVLYSLRLPRIIITLLAGMALALSGAILQGITRNDLAEPGILGINSGAGVA
FT                   VAIFFLYFPIDVGSFLYLLPVVGFIGAFLTAVLIYVFSYSKSSGLQPVRLTLTGIGFAF
FT                   ALSGMMIVLISSADRMKVDFISKWIAGNIWGDDWIFIFAMLPWLIVLIPFVFYKANRLN
FT                   ILALNEPVAIGVGIEIEKERRYLLVAAVALAAAAVSVTGGISFIGLMAPHIAKSLVGPR
FT                   HQIFMPIALLIGGWLLLLADTIGRNIVEPNGIPAGIVVALIGAPYFMYLLLKKA"
FT   gene            complement(361090..362106)
FT                   /locus_tag="BAS0335"
FT   CDS_pept        complement(361090..362106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0335"
FT                   /product="iron compound ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52666"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52666.1"
FT                   /translation="MTKEHDNTRSIAFTYKLILSIIAFFLIFMVAMVLGAADTSIKDVW
FT                   LALTSSAKGDKISIIREIRLPREVAAIFVGAGLAVSGAIMQGLTRNPLAEPGLLGLSGG
FT                   ANAALALTLAFNPSISYLYLTLACFIGAAVGAIMVFGIGMVKKGGLSPLRIVLAGAAVS
FT                   AFLLAISEGVGIYFKISQDVSLWTAGGVIGTTWSQLKVIIPVISISIFIAILLAKKLTV
FT                   LSFSEEVAIGLGQKIIVIKTILFIIIILLAGASVALVGNMAFIGLMVPHMVRPIVGPDY
FT                   RFVIPMSAIAGASFMLLADTIGRTINAPYETPVAAIVAIVGLPFFLFIVRKGGKTFS"
FT   gene            complement(362179..363096)
FT                   /locus_tag="BAS0336"
FT   CDS_pept        complement(362179..363096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0336"
FT                   /product="iron compound ABC transporter, iron
FT                   compound-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52667"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52667.1"
FT                   /translation="MKKLFISLTVLFVLVMSACSNGSTDKKNDAKGSKSETITYQSENG
FT                   KVEVPANPKRVVVLSSFAGNVMSLGVNLVGVDSWSKQNPRFDSKLKDVAEVSDENVEKI
FT                   AELNPDLIIGLSNIKNVDKLKKIAPTVTYTYGKVDYLTQHLEIGKLLNKEKEAKTWVDD
FT                   FKKRAQDAGKEIKAKIGEDATVSVVENFNKQLYVYGENWGRGTEILYQEMKLKMPEKVK
FT                   EKALKEGYYALSTEVLPEFAGDYLIVSKNKDTDNSFQETESYKNIPAVKNNRVYEANMM
FT                   EFYFNDPLTLDFQLDFFKKSFLGK"
FT   gene            363429..364478
FT                   /locus_tag="BAS0337"
FT   CDS_pept        363429..364478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0337"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52668"
FT                   /db_xref="GOA:Q81ZB7"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZB7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52668.1"
FT                   /translation="MNREELFDVTVIGGGPAGLYSAFYSGLREMKTKIIEFQPQLGGKI
FT                   HVYPEKMIWDIGGLLPVTGEKLIEQLVQQGLTFQPEVVLNTKIESIIRNKDGIFTLKTS
FT                   TGEEHFSKTVIVATGSGILNPQKLSIEGAERFEVSNLNYTVKSLKRFKNKTVIISGGGN
FT                   SAIDWANELEPIAKKVYLTYRKEELSGHEAQVKQLMNSSAECFFNTSITTLIAGDNHEA
FT                   IEYVELTNHETGEVSQLAIDEVIINHGYERDITLLENSELDVAIIDNYYIAGNANSESS
FT                   VDGLYAAGDILKHEGKLHLIAGAFQDAGNAVNKAKQFIQPDASEYGMVSSHNEVFKKRN
FT                   RELIKQMMK"
FT   gene            complement(364675..365043)
FT                   /locus_tag="BAS0338"
FT   CDS_pept        complement(364675..365043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52669"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52669.1"
FT                   /translation="MATRHIITMLEKTLQVETENTISHLTTSLSDRILSQSAAIQENNC
FT                   YHTIGEWYKNHFLFQQDDFLWAKYVFYDAYCEEIKKQGHLTKRVRQILESLARMHGKQY
FT                   IASILNMPFPKKRAKGTA"
FT   gene            365225..365464
FT                   /locus_tag="BAS0339"
FT   CDS_pept        365225..365464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0339"
FT                   /product="DNA binding domain, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52670"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52670.1"
FT                   /translation="MNALYITVEEAAEYLNLPKSYIEELIQQKKIRALFDGEQYLLNKE
FT                   QFNTHLEQMEKYKQLVEEILNEPIPEDMDVKDED"
FT   gene            365700..366221
FT                   /locus_tag="BAS0340"
FT   CDS_pept        365700..366221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0340"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52671"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52671.1"
FT                   /translation="MSLFHCDFLKDLIGSFVRVNRGGPESQRGTIISVCPDYFVLQNEK
FT                   GELYYYQLSHLKSITKSAKECGSSDCEWEDCACAEDFEALLESFKYRWVKINRGGPEKV
FT                   EGILQDVSCDFVTLIVKEEIILIAIKHIKSVNYNALACGESDESDDSSSKESSNNSGRA
FT                   RAQRQSSRGR"
FT   gene            366242..366691
FT                   /locus_tag="BAS0341"
FT   CDS_pept        366242..366691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0341"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52672"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52672.1"
FT                   /translation="MENVLCCDQIKCLVGETVKVNLRGPESRVGELVSLGKDYLTLQLP
FT                   HGELVYYQLKHVKSLVKKVKESKCGDCYSSCFCSDEDTFLDILKDLKYKWVKINRGGPE
FT                   CMDGLLSEVHHGCITLVNCDEVIYVINSHIKSVSQVVKCKKNEDE"
FT   gene            366854..367522
FT                   /locus_tag="BAS0342"
FT   CDS_pept        366854..367522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0342"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52673"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52673.1"
FT                   /translation="MNELNKSIGENIYVKLIGEKRFKGVLIDVGNDIVVLYNGQDYVYI
FT                   SLYHVQYYKILRTYDEEISKPDVDSVIKRESPSISLRKVLSTSKGIFTEIYVAGNAPIH
FT                   GYVTSIMNDYIVFYSPVYKTVYISLKHLKWLIPYKENQVPYALNKNELPVNPLNITLAR
FT                   TFEEQLIKMSGKIMVFDLGEESNKIGKMAKIDEGHIEILKARDAKMYVNIQHVKSVHCP
FT                   "
FT   gene            367759..369024
FT                   /locus_tag="BAS0343"
FT   CDS_pept        367759..369024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52674"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52674.1"
FT                   /translation="MEQFPNSLSITLLGSAGGAAKAVLAILNQAIVNEKDPIYEVIKSV
FT                   TFHLVDIKQKDRTYYDELFPNLKDQLFLSEIDLQDVVTFKKHLKESSTSVVIDVSGADT
FT                   IRVLSCCNELGICYINSALENEAVDQDDSLIGFQLTERYTRFEKEKEKFTNTKAIIGSG
FT                   MNPGVVQWMVVELMKERPNEKPRACYIVEHDTSFLNDTALIKPHTLYASWAVERFLDEA
FT                   IWSYPMYMSHHRPLYFYEDVYASEYKVKLGEKEFYGCLMPHEEVLILGKNFNMEVGFLY
FT                   RINEYTTNIIRQNLNKVEDLWNWNRKVFNPAEEEIAGEDLVGVLLVYENSEAYMYNVMN
FT                   SSQVFHKYKTNATYFQVGCGIYAGLCSLLFDEFKQGAYYVEELLLNTESKYGEYLNLYM
FT                   KDFVVGENDFTDGLLHDRVRWI"
FT   gene            369484..369678
FT                   /locus_tag="BAS0344"
FT   CDS_pept        369484..369678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0344"
FT                   /product="sensor histidine kinase, C-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52675"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52675.1"
FT                   /translation="MHLYIGMENEKLDKIGKAFYSTKQNGTGLRLAITYKIIEEYQGNV
FT                   AIQSSVEIGTKVEIFLMIV"
FT   gene            369902..370282
FT                   /locus_tag="BAS0345"
FT   CDS_pept        369902..370282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52676"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52676.1"
FT                   /translation="MELTLNSTVCLHTIQFRKEQKNYIVKDTITGEKYEMPPLWIDALA
FT                   MMRDGFLLGEIEEKLKEEYPAEEINMLAFTRQLLELELVEMVDGEEIACTKKKEKDYLA
FT                   WVRPRVEQFFLSLNKKYRSKGQ"
FT   gene            complement(370311..370943)
FT                   /locus_tag="BAS0346"
FT   CDS_pept        complement(370311..370943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0346"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52677"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52677.1"
FT                   /translation="MKVIDLSQTFENNMSQFPGTPKINLEAITSVEETGYQVTDFHSVV
FT                   HVGTHCDAPAHFISGATTIDQLPLDQFVGEAVLIDVTHVQERKLRKEVLHNADIKEGDI
FT                   VIFHSNLSTKWNTEAYEQEAFYLSEELAEELVQLKVKSVGLDFISPDEVTTETSPIHHI
FT                   LLGNNIYLIENLTNLDAIKTKRFFFSAAPLKIKDSDGAFARAFAVIF"
FT   gene            371292..372401
FT                   /locus_tag="BAS0347"
FT   CDS_pept        371292..372401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0347"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52678"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52678.1"
FT                   /translation="MTGNVLNYFAGGNTARGFHNLYEENLKGLNRLFILKGGPGTGKSS
FT                   LIKAIGRDWVEKGYDIEFLHCSSDNKSVDGVIIPKLKVGIVDGTSPHVIEPKMPGVVEE
FT                   YINLGGAWDSDKLREQKVEIERFVSEASKAFQAAYARFNEALIIHDEWEKIYIDNIDFN
FT                   KANELTDQLIQKLFADKGGKQSLVKHRFLGAATPKGAVDFVPNLTEGLLHRYFIKGRPG
FT                   SGKSTMLKKLAKAAEEKGFEVEVYHCGFDPNSLDMVIVRELGFAIFDSTAPHEYFPSRE
FT                   GDEIIDMYALIVTPGTDEKYAEEIRHVSIQYKTKMNEAMSFLAKAKSVRDKLERIYIAA
FT                   MDFSKVDAYKEEIQKEFERIAISVTEKNK"
FT   gene            372524..373306
FT                   /locus_tag="BAS0348"
FT   CDS_pept        372524..373306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0348"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52679"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52679.1"
FT                   /translation="MREKIKLELERIEKEKDVKILFAVESGSRAWGFPSKDSDYDVRFV
FT                   YMHPVEWYLSIHDKRDVIEYPISDDLDISGWDIKKALQLFAKSNPALLEWIRSPIFYSK
FT                   NSNFPEQLQQMSEKNFDPKATIYHYLHMASKNYREFLQGENVKLKKYFYVLRPILACKW
FT                   LEEKTTLPPVEFDRLITELLLERSVLDEIEQLLIKKKAGTELDVGLKIEVLNQFLEEQI
FT                   HYYQQYVKGIEKGSGIDIESLNTLFRDMLFEVYKKEHE"
FT   gene            complement(373321..374631)
FT                   /locus_tag="BAS0349"
FT   CDS_pept        complement(373321..374631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0349"
FT                   /product="benzoate transport protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52680"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52680.1"
FT                   /translation="MNTMQPSAPPHLESTKTIFSNSITKLVVFICWLAILADGYDLGIY
FT                   GAVLPKLLEDNSWALSPAHAGTIASYALFGMFIGAILVGTITDLIGRKWTLICCLALFS
FT                   ITMGLAALAPSPELFGLWRFIGGIGLGGVIPTASALTVEYSPKKRQSFIYALMFTGYPL
FT                   GIVLGAILSMFMLEDFGWRIMFGIGMIPLLLIPFIIRYLPESIQFLLSRNRQEEVDKIL
FT                   NRFQIEFYAKDETHQAPSNIRKKNGFLTLFSKEYIKATLLFWITYIMGMFLIYGLNTWL
FT                   PQMMRQAGYPLGSSLSFLLMLNITAAIGALFAGAIADRIGAKIVISISYLMAAICIGLL
FT                   TIKPSVSIIYLLIGLAGIGSVGITQILNAYVTQYFPSHIRATSLGWGLGLGRVGAIAGP
FT                   ILVGIIMTMQYDLAWNFYLFSFAGLLAAISVFFIPTK"
FT   gene            complement(374766..376292)
FT                   /locus_tag="BAS0350"
FT   CDS_pept        complement(374766..376292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0350"
FT                   /product="Rieske 2Fe-2S iron-sulfur protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52681"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52681.1"
FT                   /translation="MTSDTFPQFPSSYWIESTQIPTFPPLSENIKTKVAIIGAGITGIT
FT                   TAYLLAKEGIDVVLIDSGLILNGTTGHTTAKITAQHDLIYDELINHFGMEKAGLYYEAN
FT                   NHALQFINKTVQTYKIDCNFLNEDSYLYTTTDNGLRTLSKEYEAYQKLNIPCDFVQSLS
FT                   IPIPVQSALVMKNQAQFHPLLYLKTLLEKFVEMGGKVYEQTTAIDVEKGDYPQVITKGG
FT                   HRITCEYVVSCSHFPFYDATSFFFTRMYAERSYALAIKAKTDYPGGMYLSIDDPKRSLR
FT                   YTTNNGEKLILIGGESHKTGQGINTMLHYEALYSFAEATFGVDEVPYRWSAQDLITLDK
FT                   VPYIGHINESNPNIFVATGYRKWGMTTGTAAAHLLKDSILKVHSPYKELYTPSRFHANP
FT                   DIKTFLSQNIDVAKHLIEGKIETALRKPEDLEVGEGSVVHVNGKRAGAYKDKEGKLHIV
FT                   DTTCTHLGCEVEWNNGDCTWDCPCHGSRFSIEGDVIEGPADQPLKRVDNE"
FT   gene            376875..377960
FT                   /locus_tag="BAS0351"
FT   CDS_pept        376875..377960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0351"
FT                   /product="fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52682"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52682.1"
FT                   /translation="MKELHTFGWYAARVSPHLPKKAFKPVPTRLFGGLAYLLVALAGLI
FT                   SIGVFELNVWANLGIAIVLGLCFASLGFLGHEILHGTVVRKAWLRDFLGAIAFMPLSTG
FT                   PKLWRKWHNATHHVHTQHEENDPDAWPTLEKLKKSKFLSWVYRMPLHVRSFFSFLSLTI
FT                   QFTLHSTRMFFHFIKEFKSSNQKSVWLQLLLPWTVWISLLFIMGPGKWLFAYVIPLLIA
FT                   NFIVMAYIATNHRLNPIVPVNDPLANCLSVTVPRWVDVLHFNFSYHTEHHLFPAMSSKY
FT                   YPLVKEKIKEMWPERYHEMPMTKALAALWNTPRVYYQGSELVDPHREHFYGSLGNGLDP
FT                   HNISYREEHIEEEESIKKVNQ"
FT   gene            complement(378013..378888)
FT                   /locus_tag="BAS0352"
FT   CDS_pept        complement(378013..378888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0352"
FT                   /product="amino acid ABC transproter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52683"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52683.1"
FT                   /translation="MKSLKMVRMKRSVKNGLGVIFLVRRKTQSKLLASQLFHKLCPTLC
FT                   GAFHSLLKSIQYEVTHMFEIFMSTYPTLLKATIVTLQLTLTSLVLGSLIGLLFAFFRIS
FT                   NNKVLNSIAHVYIAIIRGTPLIVQIAILYFGITSVVVFTPFWAGAIALAIHNGAYITEI
FT                   FRGSIQSVDRGQMEAARSLGMPYPLAMRRIVLPQAFRQSLPPLGNQFIIGLKDSSLVAY
FT                   VGMAELWGSGLSIAAGNFQQLDTYIIVGLYYLVLVLLFTYLVNLLEKRLQRKETNSVQV
FT                   SAKKKKEVSL"
FT   gene            complement(378800..379594)
FT                   /locus_tag="BAS0353"
FT   CDS_pept        complement(378800..379594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0353"
FT                   /product="amino acid ABC transporter, solute binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52684"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52684.1"
FT                   /translation="MKRKLLTIVASITLCTSFILGACSKESATTSSNGKKEFRYAMSGL
FT                   YKPFNYKENDGKLVGFDVEIGEALAKKMNMKPTPITNPWETLIQGLKAKKYDVILGSMA
FT                   ITEERLKAVNFSNPYYRSGAQIFVAKKNTSISSPEDLKGKKIGVVKASTFKDLVAKHTD
FT                   QITEYDSDITALMDLEPGRIDAVITDQMVGLRMIKEGKSNIKEAGKPLNLDEMGIAIRK
FT                   DDKEMVEKVNKALDEIIKDGTYEKISKKWFGRNILGEEENTK"
FT   gene            complement(379716..380438)
FT                   /locus_tag="BAS0354"
FT   CDS_pept        complement(379716..380438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0354"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52685"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52685.1"
FT                   /translation="MIQVRNLVKSFGSLDVLKGIDLEVNEKEVVVLIGASGSGKSTLLR
FT                   CLNFLEMYDEGEIHLQGERIDPKHSNLNKVRENVGMVFQHFNLFPHMTSLENIIEAPIH
FT                   VKKLETANAKEIGNQLLQKVGLQDKADVTPHLLSGGQKQRIAIARALAMNPKIMLFDEP
FT                   TSALDPELVGEVLQVMKELAEEGMTMVIVTHEMNFARDVADRVIFMDDGKIVEDAPPAQ
FT                   FFSTPSHERAKQFLRNVL"
FT   gene            complement(380608..382332)
FT                   /locus_tag="BAS0355"
FT   CDS_pept        complement(380608..382332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0355"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52686"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52686.1"
FT                   /translation="MLKILYLLNVINRLILLIAVPIISILIISVVNYMNLQQMHKQLQT
FT                   VYVDRLQPIKWLGSIESSLYQEFSYVKELIITEDENRRTTILNKLNDTNKETEKLQAQY
FT                   ENTYITGEEKKLLSQYKEKLENYKKHRAQMLDFIKENKLNQAYSFYLTTVEHNLSATVG
FT                   ALKNLSDYNEKLAEGLYNDSEHSYKQVISITIILFITCLVLCILISLFTAKSIINPINS
FT                   LRSIMNTAGKGDLTIAVPKQYHHEFGHMFNSFDQMISNLQQIIKNVIQTSVQVKSSTNH
FT                   IVETATVSSSTMDNIANTMKQLSHHINDQSANIKDSSTAMDEIANGVQSIAESSTTISN
FT                   LAISTSDKANVGTEIIENSISQMTTIHTVMDEIYKVVDQLVIRTQDIDKALQTITYISE
FT                   QTNLLSLNAAIESARAGEHGKGFAVVSEEVRKLAEQSKQAATDITKLNLLVQNDTKDVV
FT                   NVMGKGQQEIQEGIHAVQNAKLAFHNIVNHINEVTDQIQDITASAEEMSASSEEINSAL
FT                   INISSISQNIVSETNHTSQSSQAQSVSIQDITNMSLQMQKLVDELEKSATQFKIKNL"
FT   gene            382540..383832
FT                   /locus_tag="BAS0356"
FT   CDS_pept        382540..383832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0356"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52687"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52687.1"
FT                   /translation="MEKERKAFSFGLRTQLMLFTTVLALITYSTSIFFIYVIYDYFQSY
FT                   VSQTAYNIIVMLLGVVWSGILAYGAAVFLIKPLRKLEEAARKAAEGDIREDVPLPKTDD
FT                   EIKSLSVAFNMMLGNLRGMVKNIDTTFSYTYNQVQQIRKQTGEATKQAQGVSETLAEIS
FT                   SGAEQSAASIQAIVSAVDTTTSIASEVEEKAKQSDELSSEMVQALGHSTRVFTSLIQGI
FT                   QTLAKENEDSMQNVQKLEERMKQVEHIVSVVSEIASQTNLLALNASIEAARAGEHGRGF
FT                   AVVAEEVRKLADESDHSARNISQLLRNMQEEVQQVAMKMTEQVKIAKEEARRGEATELI
FT                   LKEMSSSVMEVADATKQISSYMNEQVSHIHQTGAQTKAVAAIAEETSAGSQEVACVTVQ
FT                   QSKNMVVIDQLLKDLEKQAADLKQTIERFSM"
FT   gene            384069..385733
FT                   /locus_tag="BAS0357"
FT   CDS_pept        384069..385733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0357"
FT                   /product="glycosyl hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52688"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52688.1"
FT                   /translation="MNKTWWKEAVAYQIYPRSFMDSNGDGIGDLQGIIAKLDYLKDLGI
FT                   DVIWICPMYKSPNDDNGYDISDYQDIMDEFGTMEDFDALLDEVHKRDMKLIIDLVINHT
FT                   SDEHPWFIESRSSKDNPKRDWYIWHDGKDGAEPNNWESIFNGSAWEYDEVTGQYYLHLF
FT                   SRKQPDLNWENKEVREVLYDTVNWWLDKGIDGFRVDAISHIKKEDGFKDMPNPKGLKYV
FT                   PSFDKHMNVDGIQPLLEELKENTFSKYDIMTVGEANGVKIEDAELWVGEEQGKFNMVFQ
FT                   FEHLSLWDAEKKKDLDVVGLKKVLTKWQKGLENKGWNALYIENHDKPRIVSTWGDDKQY
FT                   WRESATALGAMYFFMHGTPFIYQGQEIGMTNVQFPNIEDYDDVAIKNLYREKIAEGVSH
FT                   QDMMEIIWASCRDNSRTPMHWDDEINAGFTTGTPWFGMNQNYKEINVAKQKNEENSIFN
FT                   FYKKMIALKKEHDVLNYGTYDLLLEDDPQIYAYTRTLNDEKIVVISNISKEEAVYNEDL
FT                   FALERKRLLLNNYEVAEHEQLTTITLKPYETRVYRIS"
FT   gene            385906..387543
FT                   /locus_tag="BAS0358"
FT   CDS_pept        385906..387543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0358"
FT                   /product="PTS system, IIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52689"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52689.1"
FT                   /translation="MKITSFDFWQKFGKALLVVVAVMPAVGLMISIGKLIGMSAGDINA
FT                   VHTIARVMEDIGWAIITNLHILFAVAIGGSWAKDRAGGAFAALLAFVLTNRITGAIFGV
FT                   NAEMLADSKAKVSSVLAGDLIVKDYFTSVLGAPALNMGVFVGIITGFLGATLYNKYYNY
FT                   NKLPQALAFFNGKRFVPFVVIVWSTVTAIVLSLLWPFIQSGLNEFGRWIAASKDSAPVV
FT                   APFVYGTLERLLLPFGLHHMLTIPMNYTELGGTYTMLTGSKIGQVVAGQDPLWLAWITD
FT                   LNNLLANGDTKAYNDLLNNVVPARFKAGQVIGSTAALMGIAFAMFRNVDKEKRAKYKPM
FT                   FLSAALAVFLTGVTEPIEFMFMFIAPVLYVVYAITTGLAFALADLINLRVHAFGFIELI
FT                   TRTPMMVNAGLTRDLINFVIVSLVFFGLNFTLFNFLIKKFNLPTPGRAGNYIDNEDEAS
FT                   EGTGNVQEGSLATKVIDLLGGKENIADVDACMTRLRVTVKDLDVVAPEAQWKQNGALGL
FT                   IVKDKGVQAVYGPKADVLKSDIQDMLGA"
FT   gene            387548..388339
FT                   /locus_tag="BAS0359"
FT   CDS_pept        387548..388339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0359"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52690"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52690.1"
FT                   /translation="MKLLTLNCHSWQEENQIEKIKYLAKVIQEEEYDVIALQEVSQSIG
FT                   AKNVCGNKKEDNFGLLLLEELKALHVKDYNITWDFSHIGYDVYEEGLAIITKHNVVKED
FT                   TFFISENKDTTYWKTRKIVSATIAYNGKNITFYSCHLGWWNDEEELFKGQVNRLMERVD
FT                   SNELSFLMGDFNNNARLQGEGYEYMMQEGLYDTYELAIEKDEGTTVQGEIAGWDENKHN
FT                   LRIDLILCNRSEKIRSSKVVFNGTNRKIISDHFGVEVQVDI"
FT   gene            388645..391470
FT                   /locus_tag="BAS0360"
FT   CDS_pept        388645..391470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0360"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52691"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52691.1"
FT                   /translation="MKQIWRIYKTDLRNVAKHWAAIVIVVGLMILPSLYAWFNIKASWD
FT                   PYGNTKEVPIAVSNQDAGSNLRGKDINIGNEIVDSLKKNKNLGWKFVDEKQAIYGVERG
FT                   DYYASITIPKDFSEKIATVLDENPQKPELDYYVNEKVNAIAPKITAKGASGITEEISKN
FT                   FVKTANGEIFKIFNDLGIDLETNLPSIEKVKDLVFKLEAQFPEMNTLMDKALDDATRAE
FT                   DLVKVAQKELPVVESVINDGQEALTNLDKFFANNDQTLQNAPGTIRNHLTAAKNVMDKA
FT                   NAFTDFLMHPGIDFSGMKGLPEFPARPDLSKLNDEGYKNIARNINQTVNNVLNSARAGT
FT                   TYGKSVVNGLQNGQFDPEKAKQDLNAVSENLQGRTDSIAYLINVFTELQKSATTDFGQS
FT                   FFQGRVDRLTKLKSGMENANNGIKDIVNVIGTGQEVKKDVTDVANQKLDAANGLIDQAE
FT                   KDYNETFVADYKKAVSTVDQAKADANEAYDSVKNEYDKFKNGVEDAKANISNKGVTDLE
FT                   WAKVSLNDLNGQLQATNNLIGDAIPVLESTNKVLADVNSGKNLNGGIAKLNKIQNSVQK
FT                   GIDATNKATTLINNGQKPTKEVVESINEATQNASAQLGDFLATYDSEIVPNFNTAIERT
FT                   KRMSKNTSQILKEADKKLPDVKKLLEDSSKGLVDGRKKLADIKAEMPATEKKIKELADK
FT                   IRDFESEEDLKDIIRLLKNDVEKQSDYFANPVNLKENKLFAMPNYGSAMSPFYTVLALW
FT                   VGALLMVSLLTVEVHEEGANYKSHEIYFGRLLTFLTMGLSQAFIVSMGDIFLLGTYVVD
FT                   KFWFVLFSLFIGGVFVCIVYSLVSIFGNVGKSMAIILLVLQVAGSGGTFPIQMTPAFFQ
FT                   AIYPFLPFTYAISAIRETVGGMLWDIVTRDLLVLSAFVVVMIVAALLLKTPINKSSEKF
FT                   VENAKGSKIIH"
FT   gene            complement(391511..393700)
FT                   /locus_tag="BAS0361"
FT   CDS_pept        complement(391511..393700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0361"
FT                   /product="DNA topoisomerase III"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52692"
FT                   /db_xref="GOA:Q81Z97"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81Z97"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52692.1"
FT                   /translation="MAKSVVIAEKPSVARDIARVLKCDKKGNGYLEGSKYIVTWALGHL
FT                   VTLADPESYDVKYKKWNLEDLPMLPERLKLTVIKQTGKQFNAVKSQLLRKDVNEIIVAT
FT                   DAGREGELVARWIIDKVRINKPIKRLWISSVTDKAIKDGFANLKPGKAYDNLYASAVAR
FT                   SEADWYIGLNATRALTTRFNAQLNCGRVQTPTVAMIANREDEIKNFKAQTYYGIEAQTT
FT                   NQLKLTWQDANGNSRSFNKEKIDGIVKGLDKHNATVLEIDKKQKKSFSPGLYDLTELQR
FT                   DANKKFGYSAKETLNIMQKLYEQHKVLTYPRTDSRYISSDIVGTLPERLKACGVGEYRP
FT                   LAHKVLQKPIKANKSFVDDSKVSDHHAIIPTEGYVNFSAFTDKERKIYDLVVKRFLAVL
FT                   FPAFEYEQLTLRTKVGNETFIARGKTILHAGWKEVYENRFEDDDVTDDVKEQLLPRIEK
FT                   GDTLTVKLIMQTSGQTKAPARFNEATLLSAMENPTKYMDTQNKQLADTLKSTGGLGTVA
FT                   TRADIIDKLFNSFLIEKRGKDIHITSKGRQLLDLVPEELKSPTLTGEWEQKLEAIAKGK
FT                   LKKEVFISEMKNYTKEIVSEIKSSDKKYKHDNISTKSCPDCGKPMLEVNGKKGKMLVCQ
FT                   DRECGHRKNVSRTTNARCPQCKKKLELRGEGAGQIFACKCGYREKLSTFQERRKKESGN
FT                   KADKRDVQKYMKQQKKEEEPLNNPFAEALKKLKFD"
FT   gene            394109..394915
FT                   /locus_tag="BAS0362"
FT   CDS_pept        394109..394915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0362"
FT                   /product="hydroxyethylthiazole kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52693"
FT                   /db_xref="GOA:Q81Z96"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81Z96"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52693.1"
FT                   /translation="MNTKEISKVVDLVRESNPLVHNITNVVVTNFTANGLLALGASPVM
FT                   AYAKEEVAEMASIAGALVLNMGTLRPDEVEAMLLAGKSANRNDVPVLFDPVGAGATSYR
FT                   TEVARHIPAEIELAIIRGNAAEIANVINEKWEIKGVDAGAGNGNVVSIAKQAADELNTV
FT                   AVITGKEDVVTDGERTIVIRNGHSILTKITGTGCLLTSVIGAFVAVEKDYVKAAVAALT
FT                   FYGVAAELAAAKTVEKGPGSFQIEFLNQLANTTSGDIEKYGKIEVI"
FT   gene            394932..395591
FT                   /locus_tag="BAS0363"
FT   CDS_pept        394932..395591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0363"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52694"
FT                   /db_xref="GOA:Q81Z95"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81Z95"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52694.1"
FT                   /translation="MSRISKAEMSKLLSVYFIMGSNNCTKDPLQVLREALEGFITIFQF
FT                   REKGEGALTGEERICFAKELQAICKEYGVPFIVNDDVELALELDADGVHVGQDDEGITS
FT                   VREKMGDKIVGVSTHTIEEARWVIENGADYLGVGPIFPTSTKKDTKAVQGTKGLAHFRE
FT                   QGITIPIVGIGGISIENTASVIEAGADGVSVISAISLAESAYESTKKLVEEVSRSL"
FT   gene            complement(395707..397020)
FT                   /locus_tag="BAS0364"
FT   CDS_pept        complement(395707..397020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0364"
FT                   /product="anaerobic C4-dicarboxylate membrane transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52695"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52695.1"
FT                   /translation="MFWLQFLTLLLCIFIGARLGGVGLGVMGGVGMAILVFVFHLQPTA
FT                   PPIDVMLMILAVITAAGALQAAGGMDYLVHLAEKALRKNPKRITFFAPIVTYLFTLCAG
FT                   TGHVAYSVLPVIAEVSRESGIRPERPMSIAVIASQQAITASPISAATVALLAMLADYKI
FT                   TLLDILKVSIPSTFIACMIAAFVASKMGKELNEDPEYLKRLKEGMIPKIEEKKEFVGVK
FT                   GAKLSVILFLVGTFLVVLLGSFEALRPGWIVDGKLARLSMPNTIEMVMLTIAALIIIFC
FT                   KPNVESIVSGNVFKAGATAVVAIFGIAWMGDTFFNGNLNMIQGSIQHLVTSAPWLFAIA
FT                   LFILSILLYSQAATVRALMPLGLSLGIPPALLIAMFPAVNGYFFIPNYGTIVAAINFDR
FT                   TGTTGIGKYVLNHSFMIPGLIATFTSIGIGMLLISIMF"
FT   gene            397531..399270
FT                   /locus_tag="BAS0365"
FT   CDS_pept        397531..399270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0365"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52696"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52696.1"
FT                   /translation="MKKYWHKLSFLQKNVLLTVLVILTLVGTMGALSFNMFQNSMMSIF
FT                   ERHSFETGDTVLHKLDEEIVRDVTKDPVAQREKREKLTEKLDEATEELNSVGQTYIVGA
FT                   KKNEKGELLIVDLSTDLANVVEVRPGEYYKQLDLWMEAYDKVMSTKKANMTVVYEDLLG
FT                   TWVTILEPIKDGEGNIVAIVAADVDASIVPSTKEKFIIQGLMFICISVLIATVIQFLIV
FT                   RNALAPLRDLREGLRRVGEGDLNIKLEERSDDIGIINSYFNNTIEKFKGIIDKVKQTAE
FT                   QVSSSSQELSVSTKENSMAVQEIVSSMVELRAGAQLQETSVPQYLGIVYEVEDKMEEIT
FT                   NAAKQMEKVSEGIEHHSVKGNGVTKQAINQMNIIQNAVQDLSSIIYSLEVRSKEISDIV
FT                   TVITSISNQTNSLALHATIEASRAEETGEGFAVVADEVRKLAEQMEASAKDIANLIRET
FT                   QAGTEEAVVSIRKASKEVESGMKLVEMNGAFFEEISKSAQSVTNQVRVVSSNSSDILQN
FT                   SQNIVRVVNELSLIANTYTNSSSNVEESMKEQEMSVQDIAELASSLSWLSQELQELIGE
FT                   FKS"
FT   gene            399534..399854
FT                   /locus_tag="BAS0366"
FT   CDS_pept        399534..399854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0366"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52697"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52697.1"
FT                   /translation="MSQQVTMSFSVVPQAKTKDVYSVVDKAIEVVQQSGVRYEVGAMET
FT                   TLEGELDVLLDVVKRAQQACVDAGAEEVITSIKIHYRPSTGVTIDEKVWKYRDEYAKPE
FT                   AI"
FT   gene            399802..400599
FT                   /locus_tag="BAS0367"
FT   CDS_pept        399802..400599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0367"
FT                   /product="ABC transporter, permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52698"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52698.1"
FT                   /translation="MKKFGSTVMNMQNQKQSKIITTIWLILLIAIWEGSVSLFKIEPWI
FT                   LPKPSAIVQELIGMKDLLLPNTMQTLQEVIIGLFFAILIGTSIAILMDVIPLFRILINP
FT                   LLVISQTIPIVVLAPLFIIWFGYGMLPKVMVVILVCFFPIALSILEGFQTVDKNMLKLL
FT                   QTMKATKWQVYQKVKFPAVLPYFFSGLKIAVTYSVMGAIIGEWLGASEGLGVMLTRATK
FT                   SFLTARVFGVAAIIVMVTLCLYFIVEFMARITAPWIYRKDGRK"
FT   gene            400596..401594
FT                   /locus_tag="BAS0368"
FT   CDS_pept        400596..401594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0368"
FT                   /product="ABC transporter, substrate-binding protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52699"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52699.1"
FT                   /translation="MKKGLKVMLAALLAVGVAGCNPAKKEESASKDQKVKVVLDWFPNT
FT                   NHTGLYVAQAKDYYKKQGLDVEIIQPGDNVTAEQMIASGKADFAISAQENVTLARVEGI
FT                   PVVSVGAIIQHNTSAFASLKKDNMTSPKDFEGKRYGGWGGPAEEATLKTIMDKHQADFN
FT                   KVEKIILGQTDFFKSIGRDADFEWIYYGWDGIEAKRQGKELNTIMVKDLDPALDFYSPV
FT                   MITSEKHTKQDKDFVKKFMSATTEGYNFAIKEPKEAADILIKAVPDVNKDLVQESQKWL
FT                   STKYQDDAKAWGVQKEEVWTNYMNFLYDNKVIKKKIDVKDAFTNEFLPSEK"
FT   gene            401591..402340
FT                   /locus_tag="BAS0369"
FT   CDS_pept        401591..402340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0369"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52700"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52700.1"
FT                   /translation="MRGLQIKDIVKSFDGNNVLANISASIREGEFVSFVGPSGCGKSTL
FT                   LNMIANVENPTSGSVTYNDKHIQEQDVVSYMPQQDLLLPWRSALQNIVLPLEIEGKPKK
FT                   QRLTEGMEALKQFELDEYADHYPDELSGGMRQRISFLRTYLCEKPIMLLDEPFGKLDAF
FT                   TKMEVHSWLLNSWHQEKQTIVMVTHDLDEAILLSDRVFILSQRPASIVGEVQVKLPRPR
FT                   TMDMLTSIELKKDKEEILRVLAPYMKK"
FT   gene            402632..404176
FT                   /locus_tag="BAS0370"
FT   CDS_pept        402632..404176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0370"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52701"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52701.1"
FT                   /translation="MSILTVENLSHSYGEKTILYNACFRLLKGEHVGVVGGNGIGKSTL
FT                   LRILTGELIHDDGNIEWFPHVKIGFLQQHMDLQEGMTIEGYLQSAFADLYAIECEMLKI
FT                   AEEMNGAGEVEKLLVKYGELQTILESSNFYHIHAEVEEVAIGLGLFEIGLKKDVSKLSG
FT                   GQRTKLLLGKLLLEKADVLLLDEPTNYLDTAHIEWLQSYLRLYEKAYVIISHDELFLNS
FT                   ITNVIFHLEGGKVKRYVGNYEKFVQSYQVQKKQLQSAYVKQQKEISQLETFIQKNKIRK
FT                   AKQAKSREKVLEKMQRIEKIHPVPRSRFDFNVYEEPVSRILQAEKLRIGYSDPLCPELN
FT                   LQVKKGEKIAIIGHNGIGKTTMLKTLLGQIKPLSGSISVGERVNPAYFAQEEFASETTP
FT                   LEKVWAERPDMTKKEVRQALAKCGLKEEHVLKPIRLLSGGEQTKVRLCELIVTRSNVLI
FT                   LDEPTNHLDIETKKSLQEALQQYKGTVLLVSHEPSFYEAWITKVWNIEEWNAEQYE"
FT   gene            complement(404637..406661)
FT                   /locus_tag="BAS0371"
FT   CDS_pept        complement(404637..406661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0371"
FT                   /product="chitinase B"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52702"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52702.1"
FT                   /translation="MKSKKFTLLLLSLLLFLPLFLTNFITPNVVLADSQKQDQKIVGYF
FT                   PSWGIYGRNYQVADIDASKLTHLNYAFADICWNGKHGNPSTHPDNPNKQTWNCKESGVP
FT                   LQNKEVPNGTLVLGEPWADVTKSYPGSGTTWEDCDKYARCGNFGELKRLKAKYPHLKTI
FT                   ISVGGWTWSNRFSDMAADEKTRKVFADSTVDFLREYGFDGVDLDWEYPGVETIPGGSYR
FT                   PEDKQNFTLLLQDVRNALTKAGAEDGKQYLLTIASGASQRYADHTELKKISQILDWINI
FT                   MTYDFHGGWEATSNHNAALYKDPNDPAADTKFYVDGAIDIYTNEGVPADKLVLGVPFYG
FT                   RGWKSCGKENNGQYQPCKPGSDGKLASKGTWDDYSTGDTGVYDYGDLAANYVNKNGFVR
FT                   GWNDVAKVPYLYNATTGTFISYDDNESMKYKTDYIKTKGLSGAMFWELSGDCRTSPKYS
FT                   CSGPKLLDTLVKELLGGPITQKDIEPPTNVKNIAVTNKNSNSVQLNWTASTDNVGVTEY
FT                   EITAGEEKWSTTTNSIAIKNLKPNTEYTFSILAKDAAGNKSQPTSILVKTDDANTTPPG
FT                   GNSNATFSVTSNWGSGYNFSIVIKNSGTTPIKNWKLEFDYNGNLTQVWDSKISSKINNH
FT                   YVITNAGWNGEIPPGGSITIGGAGTGTPAELVNASISEN"
FT   gene            407033..407404
FT                   /locus_tag="BAS0372"
FT   CDS_pept        407033..407404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0372"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52703"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52703.1"
FT                   /translation="MDVFLNIAEEKIRQAIRNGDLDNIPGKGKPLQLEDLSMVPPELRM
FT                   SYKILKNAGMIPPEMELQKDILKIEDLIACCYDEEERKKLQQELTAKTLRFQQVMEKRK
FT                   IKDSSAFRMYQDKVFHKLR"
FT   gene            407415..407729
FT                   /locus_tag="BAS0373"
FT   CDS_pept        407415..407729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0373"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52704"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52704.1"
FT                   /translation="MKKFETIEELATYIEEQQLVLLFIKTENCGVCDVMLRNVNYVLEN
FT                   YDYVEKIEILLQDMQEVAGRYAVFTGPTILLFHNGKEILRESRFISLENLERTIQLFEE
FT                   "
FT   gene            407743..407994
FT                   /locus_tag="BAS0374"
FT   CDS_pept        407743..407994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52705"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52705.1"
FT                   /translation="MEFIIFILLFVVIGIIVTAVRSNKKKVNLMKQNNIHNSSNSSSPL
FT                   FFFAGSDNDSSHGGSHDCGGSFGGDSGGSCDGGGGGGD"
FT   gene            408277..408858
FT                   /locus_tag="BAS0375"
FT   CDS_pept        408277..408858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0375"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52706"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52706.1"
FT                   /translation="MRRSAEEIKKEIAYKAEILFSQKGYAATSMEEICEITERSKGSIY
FT                   YHFKSKEELFLFVVKQHTYDWLEKWNEKEKLYSTSTEKLYALAEYHVEDIQQPISNAIE
FT                   EFSMSQVVSKEILDEMLALTRESYVMFETLIEAGIQSGEFREDNTRDLMYIVNGLLSGL
FT                   GVLYYELDYKELKRIYKKAIDVLLKGMAAE"
FT   gene            408925..410157
FT                   /locus_tag="BAS0376"
FT   CDS_pept        408925..410157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0376"
FT                   /product="major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52707"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52707.1"
FT                   /translation="MNALFKNRAFMLVMASDILQQFAIWIRNMALLYFIMERTNNDPVS
FT                   VSLLSVMEYAPIFIFSFIGGALADRWNPKRTMVAGDVLSVLSIIGIVLLLKLDYWQAIF
FT                   FATLISAIVGQFSQPSSSRIFKRYVKEEQVANAIAFNQTLQSLFMIFGPVVGSLVYTQL
FT                   GLFTSLYSLIILFLLSAIALSFLPKWVEQEQVARDSLKNDIKEGWKYVLHTKNLRMITI
FT                   TFTIMGLAVGLTNPLEVFLVIERLGMEKEAVQYLAAADGIGMLIGGIVAAVFASKVNPK
FT                   KMFVFGMSILAMSFLVEGLSTSFWITSFMRFGTGICLACVNIVVGTLMIQLVPENMVGR
FT                   VNGTILPLFMGAMLIGTALAGGLKEMTSLVIVFCIAMALILLAIGPVLRMQIKKEDVTT
FT                   KEELTNSLASK"
FT   gene            410214..410465
FT                   /locus_tag="BAS0377"
FT   CDS_pept        410214..410465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0377"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52708"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52708.1"
FT                   /translation="MSQLYTDDVKTILQVRRNGVKNQIYELRTENNISQGALADKCKVS
FT                   RQTINAIENNKYDPSLALAFRLAEVLGTTVDKLFLYKQ"
FT   gene            410517..410870
FT                   /locus_tag="BAS0378"
FT   CDS_pept        410517..410870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0378"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52709"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52709.1"
FT                   /translation="MAIGTLLYALYYWLTELQVNWYALFICSIALHYLFKSSASHSVEG
FT                   ETEENQDLEKHVLKTSANVTYYVLVVFIFGLFFASVGFNRWIDFHNIPLLFALCAAIVV
FT                   KPAVEFLIVRRYR"
FT   gene            complement(410897..412180)
FT                   /locus_tag="BAS0379"
FT   CDS_pept        complement(410897..412180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0379"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52710"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52710.1"
FT                   /translation="MKKMSRQEKSWILYDWANSVYSLVITTALFPIYFKAAAKEAGLSG
FT                   ATSTAYWGYANSFATLLISILAPILGTVADYKGFKKRFFTFFFGLGIVFTSMLAVVPTS
FT                   QWYLLLGCYMLALVGFAGANIFYDAFLVDVTSEDRMDRISTRGFALGYIGSTIPFIGCI
FT                   ALIILAQKGTIPLSVGIASQISFAITALWWGLFTIPMLKNVEQTHYIERHPKPIAMSFK
FT                   RLADTFKNIKEYKTVFMFLIAYFFYIDGVDTIITMSTAYGTDLGISATNLLIILFVTQI
FT                   VACPFALLYGKLSTTFTGKKMLYVGIIIYIIICIYAYFLKTTLDFWILAMLVATSQGGI
FT                   QALSRSYFAKLVPKESANEFFGFYNIFGKFAAIMGPVLVGVTTQLTGKTNAGVLSIIVL
FT                   FIIGGFLLTRVPENNTSVTPPNPKTKTL"
FT   gene            complement(412289..413602)
FT                   /locus_tag="BAS0380"
FT   CDS_pept        complement(412289..413602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0380"
FT                   /product="type I phosphodiesterase/nucleotide
FT                   pyrophosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52711"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52711.1"
FT                   /translation="MDKALTNRVIILSFDCLSALDFPILQKLPHFQSLIKKGTVVEKVE
FT                   PIYPSVTYPSHSTIVTGNYPNKHGVVSNTLLQPGRESPDWHWYRKSIKGTTLYDEAHKA
FT                   NLTTAALLWPVTGRANIDYNLPEIFPNRPWQNQVLVSLFSGSPLYQLDLNRRFGHIRNG
FT                   LSQPELDDFVLASAVHTIQTKKPNVMFVHFTDLDTQRHYHGFESKETIAAIHRHDERLG
FT                   QIIQALKDSDLYEESTIIALGDHSALSENKAIQLNVLFHQKGLISVNSKGNLVDWKVYC
FT                   QSCDGSAYVYVKDKNDTDTIREVQLLLEELLQHKQNGIEFILHDEDAKECGADGNCLFM
FT                   LEAREGYYFTENYTGDFIKEITEKDVTPSKKYTFGTHGYSPTKPNYETIFIAAGKGIKS
FT                   GVTIPYMRLIDESPTIARLLGLHLGETDGSIVEDLLQL"
FT   gene            413738..414049
FT                   /locus_tag="BAS0381"
FT   CDS_pept        413738..414049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0381"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52712"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52712.1"
FT                   /translation="MEGGNSMDWLDGFGIFYIIGGITIILVFAISYLLKKRFPDKQFDI
FT                   IFALSLILLCLASFPVTMMVIGGWEGMGYGFIGFFVLLGTLIGMIAHQLVKISRKSYV"
FT   gene            414397..415923
FT                   /locus_tag="BAS0382"
FT   CDS_pept        414397..415923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0382"
FT                   /product="prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52713"
FT                   /db_xref="GOA:Q81Z76"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81Z76"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52713.1"
FT                   /translation="MAKEQVQAITKMEEDFAQWYTDIVKKAELVDYSSVKGCMILRPYG
FT                   YALWENMQKVMDEKLKATGHENVYMPMFIPESLLQKEKDHVEGFAPEVAWVTHGGDEKL
FT                   AERLCVRPTSETLFCEHFSKIVQSYNDLPKLYNQWCSVVRWEKTTRPFLRTTEFLWQEG
FT                   HTIHETAEESQAETLNILNLYASFCEDYLAIPVIKGQKTEKEKFAGAKATYTIESLMHD
FT                   GKALQTGTSHNFGTNFSEAFDIKFLDRNGKWQYVHQTSWGVSTRMIGGLIMVHSDNNGL
FT                   VMPPKVAPVQVVIVPIAQHKEGVLAKATELQGHIQKVARVKIDASNKTPGWKFNEYEMK
FT                   GIPIRLEVGPKDIEKNQVVLVRRDTKEKEFISMDQLEERIPALLEEIHNSLFNKAKVFR
FT                   DENTYSVTNFEEMKKLADEKQGFIKAMWCGELACEEKLKEEVASRCMPFEQEHLAEECV
FT                   CCVNKWCIGEKRINALLDRKDEKDFGLHNKCNPKSFLVLQFVSCIFKMEG"
FT   gene            complement(415928..416731)
FT                   /locus_tag="BAS0383"
FT   CDS_pept        complement(415928..416731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0383"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52714"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52714.1"
FT                   /translation="MTKIFILASTLSLSFFSGLNIGNAATENFSPITNAIVQNNDYFVE
FT                   GNSKDNNKPPGNGGSQDDSGSDGNGSDGSGSGDNGSGDNGSGGNGSGGNGSGENGSGGN
FT                   GSGSSGSGDNGSGGNGSGGNGSGSSGSGENGSGGNGSGSSGSGENGSGGNGSGSSGSGE
FT                   NGSGGNGSGGNGSGGNSSGGSGSGGSGSGDNGSGGSGSQGGNRVKGDSSSQGGNGSQGG
FT                   NVKDNAKKQGDKLPNTATHYPASILMGLSTFLIGMLLFIRRKNAK"
FT   gene            416934..417812
FT                   /locus_tag="BAS0384"
FT   CDS_pept        416934..417812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0384"
FT                   /product="ROK family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52715"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52715.1"
FT                   /translation="MKEYIAFDIGGTQIKYGIVSETGIVLKHKTVPTEIHLGGEQIIQK
FT                   LILLSKKLMSEHTISGIGISTAGIVDVNRGVVTGGADHIPGYSTIPIINRLQEVLKVPV
FT                   SIENDVNCAALGEKWNGIGREKENFIMLTLGTGIGGAIFIDRELYRGHSYSAGEWGNML
FT                   IEGKTFEEVASISGLIHLVRNYKGKGNWNGKTIFELYDKGDREVTQAVEVFFKHLAIGI
FT                   SNLAYIFNPETIIIGGGITDRGNQFLKEVKEEVGRYLNKEIYSDCEIELAQNGNRAGMI
FT                   GAIYHFLHHHK"
FT   gene            417941..418537
FT                   /locus_tag="BAS0385"
FT   CDS_pept        417941..418537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0385"
FT                   /product="tellurium resistance protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52716"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52716.1"
FT                   /translation="MPIILEKGQKIDLTKGQPKVAKLQVGLGWDPIGQSGGFLSSLFGS
FT                   KPNVDCDASVVMLEGDRFLNKNDLVYFGNKLSTCGSIIHSGDNLTGEGAGDDETIFVEL
FT                   HKVPSRINRLVFVVNIYDCVNRRQDFGMIRNAYIRIQNPQTGEELARYNLSDNYAGKTT
FT                   LIAGEMYRHGSEWKFSAVGEGTQDKNLSEIVSRYQ"
FT   gene            418555..419145
FT                   /locus_tag="BAS0386"
FT   CDS_pept        418555..419145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0386"
FT                   /product="tellurium resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52717"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52717.1"
FT                   /translation="MYMASISLKKGQKVDLTKTNPGLSKVLVGLGWDTNRYDGQNDFDL
FT                   DVSIFLVGANGKVSGAEDFVFYNNPKGANGAVEHLGDNRTGEGEGDDESIKVDLKNVPA
FT                   HIERICFTITIYDGEGRSQNFGQVSNSFVRILDEEKNAELIRYDLGEDFSIETAVVVGE
FT                   LYRHAGEWKFNAIGSGFQGGLASLCNNFGLDVE"
FT   gene            419226..419810
FT                   /locus_tag="BAS0387"
FT   CDS_pept        419226..419810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0387"
FT                   /product="tellurium resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52718"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52718.1"
FT                   /translation="MVIQLQKGQKIDLGKTSPGLTKAVIGLGWDIKSYDGGSDFDLDAS
FT                   AFLLDANGKCTKETDFIFYNNLQSPCGSVLHTGDNRTGEGEGEGDDEQLVVDLKKVPAD
FT                   VHRIAITVTIYDAEGRSQNFGQVGNAFVRLANEETNEEVLRFDLGEDFSIETAVVFCEL
FT                   YRHNGQWKFNAVGSGFQGGLGALVRAYGLDA"
FT   gene            419884..420675
FT                   /locus_tag="BAS0388"
FT   CDS_pept        419884..420675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0388"
FT                   /product="tellurium resistance protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52719"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52719.1"
FT                   /translation="MSILQGILDTYAQFFDLDMWIKVLQDPVSWGLIGTLVVLEGLLSA
FT                   DNALVLAVMVKHLPEEKRKKALFYGLIGAYVFRFIAIGIGMFLIKLAWVKVLGALYLAW
FT                   LSVKYFIDKRKGNAEEEEAHGMNQNSILFRMFGVFWGTVAMVELMDIAFSVDSVLAAFG
FT                   VSNEVWILLLGGMLGILMMRGIAGVFLKLLERIPELETTAYILILIIAAKMLLSVIHIE
FT                   VSHTLFFIILVVAFGATFILHYVKNSGQAKEEVAATKNNHK"
FT   gene            420785..422416
FT                   /locus_tag="BAS0389"
FT   CDS_pept        420785..422416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0389"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52720"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52720.1"
FT                   /translation="MFSRFTLQPYALKDESDLKHFETLLEKRPQYELTENEMKFSYIAC
FT                   RILGVPNDVDEYFNELFDYSEAKGIEVLHEQNLNKVIDSEKLRHIQEVFGLHQEAPNGL
FT                   TVNRLVAHLSGKQLLPKVDNPDLQHYIHTTFISVLKLYEKQHNQSLKTEGFRRFLIDMI
FT                   KLSENYVAKWFSTINYKKQMPRIIWYGDAQESRIYFLYFLIMLGCDVLYYHPEGKDGFE
FT                   NIDEEARTFVVSHSSRISLEPFPDRRRERVATVAYQASKEIEQVLHHDNSLLYKPWQFR
FT                   SYTPVARTLKTTYDELFLITKEKAFVRPTFFVENKHIYIPSLFAKISGVSKNDKEYFQR
FT                   LKAVTSFDNSLLINTFPFTKEQKANFQYHYRDALDRGGKLHPDLIMNSHWWPHKRLPEG
FT                   LQHGIAEAIIHTCESEMCKPIAKETKQDVALYVFAQLSQIPPNILEQLEKFDYSQDVPK
FT                   IVIFNNEKSGELTRSDAVLLLFLNQIGVDVFHFNPTGRNDIEPYIEAGAFDSHWLEEVN
FT                   FDFEFHGSSAYKNLSQTIKGLFRPFL"
FT   gene            422435..423517
FT                   /locus_tag="BAS0390"
FT   CDS_pept        422435..423517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0390"
FT                   /product="tellurite resistance protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52721"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52721.1"
FT                   /translation="MNNPVVLDSKTELNEQTAQDVRLQLRQDADVQRIYNAVDIKDQLE
FT                   LIELGKEPSMEISRFADQILHTMSLSKIEDSGELLKQLGKIMDRFDSKDFAEEKSGFFS
FT                   RMFKKADKMIEQIFSKYQTMGREIDKVYVEITKYQDEMKKSIGTLDGLYEQNLKYYLDL
FT                   EKYVVAGEMLLERLNTELVPMYEERVRNNDQLAGIELESLKNSVEILEQRIDDLEKARM
FT                   VALLTAPQIRMIQRGNNKLIGKINTAFITTIPIFKNGIIQAVNAKRQKLVADSMAELDR
FT                   RTNELLKKNAQNIATQSVEVARLSGSSSIKMETLEETWNIISRGMQETQQIEEQNKRER
FT                   EESRKRMATLTENIKKELQG"
FT   gene            complement(423553..426219)
FT                   /locus_tag="BAS0391"
FT   CDS_pept        complement(423553..426219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0391"
FT                   /product="cation-transporting ATPase, E1-E2 family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52722"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52722.1"
FT                   /translation="MSNWYSKTKDQTLIDLETNEQHGLTEEIVNERLTQYGANELATKQ
FT                   KRSLWQRIFAQINDVLVYVLIIAALISAFVGEWADASIIALVVVLNAVIGVVQESKAEQ
FT                   ALEALKKMATPKAIVKRDGELKEIPSEHVVPGDIVMLDAGRYIPCDLRLIETANLKVEE
FT                   SALTGESVPVDKDAIYHPSMQSDEQVPLGDQKNMAFMSTLVTYGRGVGVAVETGMNSQI
FT                   GKIATLLHEADDDMTPLQKSLAQVGKYLGFVAVAICIVMFLIGFLQGRDTLEMFMTAIS
FT                   LAVAAIPEGLPAIVSIVLAIGVQRMIKQNVIIRKLPAVEALGSVTIICSDKTGTLTQNK
FT                   MTVTHFYSDNTYDQLERLNVNNDTQRLLLENMVLCNDASYNNESQTGDPTEIALLVAGS
FT                   TFNMQKDHLEKIHERVNELPFDSDRKMMSTVHTYDESYYSMTKGAIDKLLPLCTHIFKN
FT                   GKIEGLTEDDKNQILEAAEVMSQEALRVLSFAFKQYNSSDVDIDHLEENLIFIGLVGMI
FT                   DPPRTEVKDSISECKKAGIRTVMITGDHKDTAFAIAKELGIAEEISEIMIGTELDNISD
FT                   TELANKINHLHVFARVSPEHKVKIVKALRAKGNIVSMTGDGVNDAPSLKQADVGVAMGI
FT                   TGTDVAKGAADVVLTDDNFSSIVKAVEEGRNIYRNIKKSILFLLSCNFGEIIALFLAIL
FT                   LGWATPLRPIHILWVNLITDTLPALSLGVDPEDPDVMKEKPRHAKESLFSGSVPFLIFN
FT                   GFVIGLLTLIAFIAGAKFYTGDTNLFPLFPERIDEDALLHAQTMAFVVLSFSQLVHSFN
FT                   LRSRTKSIFSIGIFTNKYLVFSLLIGVLMQVCIISIPPLANIFGVHALTMRDWGFVLLL
FT                   SIIPLVVNEFIKLVKRN"
FT   gene            complement(426411..426635)
FT                   /locus_tag="BAS0392"
FT   CDS_pept        complement(426411..426635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0392"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52723"
FT                   /db_xref="GOA:Q81Z66"
FT                   /db_xref="InterPro:IPR009507"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81Z66"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52723.1"
FT                   /translation="MDLSVKSEENVEYMVEAIKEKLRMVNAGAMRAASFNEEMYEDLRD
FT                   IYEHVMKRETFSISEMQAITEELGTLIKK"
FT   gene            426810..427274
FT                   /locus_tag="BAS0393"
FT   CDS_pept        426810..427274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0393"
FT                   /product="low molecular weight phosphotyrosine protein
FT                   phosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52724"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52724.1"
FT                   /translation="MVQVLFVCLGNICRSPMAEAIFRDLVVKEGLEEKIVIDSAGTGDW
FT                   HVGHPPHKGTQKILKENAVTFEGIKARQVEKEDLTKFDYIIAMDNKNIADLKSLGKTGG
FT                   YIGRLSDFVPDGGWTDVPDPYYTGNFQEVYDLVTEGCAKLLAFIRNEQGI"
FT   gene            427328..427810
FT                   /locus_tag="BAS0394"
FT   CDS_pept        427328..427810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0394"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52725"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52725.1"
FT                   /translation="MAKKNNIARNIAIGVAAGVAVSMLKKENREKVKNTAEKAKTKMIE
FT                   IGENAKIKEKVQTVTDKGRELADLNVVKAKVAEIKKLTPSVVETLKETKEIFSKKKVEP
FT                   AEKPETIEIQAVSPKVDELKVEEEPVVAEDGGMKESRELFMKDSNVEEKKLKRTLS"
FT   gene            427849..428718
FT                   /locus_tag="BAS0395"
FT   CDS_pept        427849..428718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0395"
FT                   /product="ribonuclease BN, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52726"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52726.1"
FT                   /translation="MRKILEKVRRNRTYSFGKDLYDRTMRDDVAGLAAQLAYFFLLAIF
FT                   PGLVFLITLLGFIDLQTESVLNLLEPYVPEDAMSLIEVNVDKVVNEQNGGLLSFGLLSM
FT                   LWFASNGVNAVMNAFNRAYDVTETRSFIKTRALSIVFTLAIIFMIVFALIVPVFGQVIG
FT                   AAVFKAIGLSDSFSYVWSITRLVASFFVLFALFSFLYTFAPDRKLKRREVISGATFATV
FT                   GWIVVSYSFAYYVDKFANYANTYGGLGGIIILMLWFYLTGWVILLGGEINGLLHHYRTG
FT                   DNNSRNEK"
FT   gene            complement(428660..428869)
FT                   /locus_tag="BAS0396"
FT   CDS_pept        complement(428660..428869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0396"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52727"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52727.1"
FT                   /translation="MVAIMSVRTTTRFMLWMRTALLFIVIFIVVILFIITHEISPLFLI
FT                   IMEQEVIFHYGNYCHPSYNDGVNH"
FT   gene            complement(428903..430828)
FT                   /locus_tag="BAS0397"
FT   CDS_pept        complement(428903..430828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0397"
FT                   /product="heavy metal-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52728"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52728.1"
FT                   /translation="MNSEVKTLQVQKSISHPSLWDTLKKHYELIFAITSGIFILAGWLF
FT                   TKNDVMNVGITCYILAYIVGGYAKAKEGIEDTIEEKELNVEMLMLIAAIGAAMIGYWAE
FT                   GAILIFIFALSGAMESYTLSKSQKEISALLDLQPEEALRISNGTEERVPVGRLQINDII
FT                   LIKPGERVPADGTIHSGETNIDEAAITGEPIPNEKKHGDEVFAGTVNLRGAIEVKITKP
FT                   SDQTLFQKIIRLVQSAQSEKSPSQLFIEKFEGTYVKGVLLVVTLMMFVPHFLLDWSWNE
FT                   TFYRAMILLVVASPCALVAAITPATLSAISNGARNGILFKGGIHLERLASVKAIAFDKT
FT                   GTLTEGKPTVTDVYVRENMTEKEVLSITAAIESHSTHPLAESIVKYAQHTYDITLKKPE
FT                   NVEDVTGFGLKGIFESKAYKIGKADFIGEETKTFHNGVSASLEKEGKTVVYISDEEGIL
FT                   GLIALKDTLRQETIAAIRELQSIGVEAIMITGDNEETAKAIASESNIKEYYASCLPETK
FT                   VETIKKLKEKYGTVAMVGDGINDAPALATASIGVAMGEGTDVALETADVVLMKNELSRL
FT                   SQAIRLSKRMNRIVKQNVIFSLAVIAMLICSNFLQFLALPFGVIGHEGSTILVILNGLR
FT                   LLKGNN"
FT   gene            431099..432049
FT                   /locus_tag="BAS0398"
FT   CDS_pept        431099..432049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0398"
FT                   /product="transporter, EamA family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52729"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52729.1"
FT                   /translation="MKTEKFFTHPIGVFIAAIVATFLWGSAFPFIKLSYAELGIQPKEV
FT                   GEQILFAGYRFFLSGVMLLFFFKLLGKDMNFKKGTGKQLVQIGLFQTFLQYICFYIGMS
FT                   YSSGIEGAIISGTSSFFQIILAHFLYKDDALNMRKIIGVSIGFCGVVLVNVPSDGSLSF
FT                   HFGIGSLLLLSAAMLYSYGNILAKEGSKTLDVGYMTAYQMIFGSIGLLCIGALQVGIMP
FT                   FTFSVHAILMLIYLSFLSAAGFCIWNTIMKYNKVGKVSMYMFFIPVFGVLLSSMILGEA
FT                   IHSFVLFGLACVAAGIIVVNRTPAKQKIEQEKQVA"
FT   gene            432172..432852
FT                   /locus_tag="BAS0399"
FT   CDS_pept        432172..432852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0399"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52730"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52730.1"
FT                   /translation="MNLLYMVLIGQIILFLIGAIYAIGQTKKTTNNIPLPLAVRLILSF
FT                   SLTASAIWIWLQDPSVEYSTWVALGMTLSTVGDLFMAGLIPIGHRLIGGMITFALAHCF
FT                   YVKAFLQTGISWNGFWIGLLVYGLFLIIGWFFFIRNEKQDKLFTIGALIYGLWVGGMAC
FT                   FAFALYYENTGIWWIPAFGGLLFVISDFIIGVTDIGGRKLKYEPLWIWFTYVAAQMCIV
FT                   YVGL"
FT   gene            433082..433438
FT                   /locus_tag="BAS0400"
FT   CDS_pept        433082..433438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0400"
FT                   /product="type I signal peptidase, N-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52731"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52731.1"
FT                   /translation="MMQKKKRWREFFGTIAIACLLVFLAKIFVFFPTTVKGASMKPTLQ
FT                   DGDKVIVNKLAKQFESYGREDIIVVKTDNFYVKRVIGLPGDVIEVRNDQLYVNHEVIEE
FT                   AYLQSNKKQAEKNL"
FT   gene            433435..433617
FT                   /locus_tag="BAS0401"
FT   CDS_pept        433435..433617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0401"
FT                   /product="type I singal peptidase, C-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52732"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52732.1"
FT                   /translation="MNLTEDFGPITVPKNKIFVMGDNRLISRDSRNGLGLIDKADVLGE
FT                   LAAIYYPFEHMKIIN"
FT   gene            complement(433661..436423)
FT                   /locus_tag="BAS0402"
FT   CDS_pept        complement(433661..436423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52733"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52733.1"
FT                   /translation="MTIENQFIQKVYYKTFLTEETSTPVSDVLGEAYINESTNEFSNIS
FT                   NIRFAQGELYYQNKDFEAAIFKWEKVNNELALWATKNIADAYFELGFLPKAEEMYQSIQ
FT                   TEDTTLTMEVSLQLLSLYIEQDRLGLAFKTISEAVAFQPDYPNITSIARSFYEKQEDWN
FT                   NAIELAVQEGIRTKSLHWFDTLINYVNQGFTKQIKPEYFYESLKALYAIDQVQFKELVI
FT                   TLWNSYQNEKLHLPWIETINHLFLHIETDNNDDWHEIVERYQDTYFELITGEHFMHEMQ
FT                   GLVPDLLTNWFSLTRAKDALFVSAAVLAWNEVSPTTLESLLVKSAGALLSNSTAETNVN
FT                   METVSHLFETIAVWAEKNDVDLSHQFTLLVHELCDLNVTQLLIAGTSDHDKLSFVNSIL
FT                   GENILTETITTPILFKDDSQTEITEFTALDVHNIPNFDEFHQIMATSDQSELENKCIEI
FT                   KLPSRFLRKNKFAFLVTPSVQGQVDKNSSYFEYLQAADSLIYVLNSASPLHGKELDTLL
FT                   YLREQVPNLQIHFVLHTNSADKNEKLMSKIKVHFPNAQFFPYSPSQESSQQLGDVTESI
FT                   LSNLATRDIEQERIEKLIWFTQKTIAYLVNERVELENTLVKSVRWNKHISVKLNGFINN
FT                   LTALEKDKIRSITESYLLTKEEITRDIHSQIPELLQSCSDLVQEDSDFKLVHEELNTAM
FT                   NERIQKHVQQVLLPKFTGFIQEWIETAHNEFIQAQSYLDEMSETFNKLYKEERMKLPCD
FT                   FKLLDDWHRDVVRMTNRITVSNINILLRFTPTQFFLKSAGKLFGNMQKNQSMLANKYKQ
FT                   YIETEDYTEIAQTISKQFFLQFEVFEGALERDIMMFFKDPLSILKQNVEAAQLEIQEDE
FT                   QTLATLRSNPETYHDPLAFFKLQLLQHKFILSTHKNNEDIYEFNESPTI"
FT   gene            436898..437488
FT                   /locus_tag="BAS0403"
FT   CDS_pept        436898..437488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0403"
FT                   /product="dedA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52734"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52734.1"
FT                   /translation="MEQHIGELIAHYGYFGIIIALAGGIVGLPIPDEFLLTFVGYNVSK
FT                   GVMSGTAAFLSGMAGAMLGITLSYILGLKLGLPVLKKYGPKIRIKEHHIEKTHILFEKY
FT                   GPFLLMIGYFIPGVRHLTAYFAGMSNLTIWRFCLYAYGGALIWISVFIGLGWKLGEKWR
FT                   FVEYSLHHYGIWILSISVVVTCVVWFYIKKNRE"
FT   gene            complement(437497..437925)
FT                   /locus_tag="BAS0404"
FT   CDS_pept        complement(437497..437925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0404"
FT                   /product="transporter, EamA family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52735"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52735.1"
FT                   /translation="MSSWLLFALLSAIAAALVSIFGKIGLDGIDANVATTVRSIIMALF
FT                   MVGVIIIQGKFQNIGDVLLNKKALLFITLSGVAGASSWLFYFLALKTGKVSQVAPVDKL
FT                   SVVFSIILAMIILGEKLNFMTGIGVVFITAGVLFIAFS"
FT   gene            complement(438332..438748)
FT                   /locus_tag="BAS0405"
FT   CDS_pept        complement(438332..438748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0405"
FT                   /product="general stress protein 26"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52736"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52736.1"
FT                   /translation="MHLKEKITTIIQGQRTGVLSTVRNDKPHSAFMMFFHEDFVLYVAT
FT                   DRQSKKITDIENNPNVHVLLGREGKKLDEDYIEVEGLASIEEDSTLKNKFWNNSLKRWL
FT                   LRPEDPNYVLIKINPDTIYYIDGAGTTEPEFLRL"
FT   gene            438919..439983
FT                   /locus_tag="BAS0406"
FT   CDS_pept        438919..439983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0406"
FT                   /product="calcium/proton exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52737"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52737.1"
FT                   /translation="MESMFNKIFLIVALIGVPLSVLGKTLHWPQTIMFAVYCITIIALA
FT                   GFMGRATESLAIVSGPRIGGLLNATFGNAVELIISIFALQAGLIEVVLASLTGSVLGNL
FT                   LLVGGLSFFIGGLKYKRQSFNVYDARHNSALLIFAVVVAFVIPEIFSMKMDAGKTYQLS
FT                   IGVSIIMIIMYLAALLFKLVTHRGVYQHKSDEVAHEEEPEWSKGKALLILAIATIAVAY
FT                   VSEALVHTFETVAKSFGWSELFIGVIIVAIVGNAAEHASAIIMAYKNKVNIAVEIAVGS
FT                   TLQIAMFVAPVLVLLSMFFAQRMPLVFTIPELVSMITAVFLTIAISNDGDTNWFEGGTL
FT                   LAAYVIMGIGFYLL"
FT   gene            440065..440862
FT                   /locus_tag="BAS0407"
FT   CDS_pept        440065..440862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0407"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52738"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52738.1"
FT                   /translation="MKRVYSICLSTMVSFILLFPNMSFAKTTVETKMPSSVLNISKDNT
FT                   FPNDAQDLPRLQPSKFAQELLKTANIKIENPDLIRMFNETTISNAPLAVGYRAKIYLGQ
FT                   WALHYESIDTSINWEYKQVNRNVYDNRGGDRLYPLRYKQETQKTVEGDLTADMKDATDV
FT                   KKMMLLKALEKVQLPLSFKTTIGYGTGHERVYNISPSQLGYLYAYTPAVNEKGKVTFGE
FT                   VYLVLKGNQKRLVVKNITSQGIGAAIPIHDHLYFKFISSSHSQ"
FT   gene            complement(440897..442024)
FT                   /locus_tag="BAS0408"
FT   CDS_pept        complement(440897..442024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0408"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52739"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52739.1"
FT                   /translation="MTISQKMKPITPSYDPWEAYMDLEEYGKLLLTNVEFTTTTLCNMR
FT                   CEHCAVGYTLQPKDPNPLPMDLLLKRLDEIPHLRSLSITGGEPMLSKKSVDNYVTPLLK
FT                   YAHERGVPTQINSNLTIDLARYEQIIPYLDVLHISHNWGTIDDFVEGGFAMMERKPTYE
FT                   QRAKLFERMITNSKALSDAGVLVSAETMLNKRTLPHIEHIHRQIVDEMGCKRHEVHPMY
FT                   PSDFASNLEILTKAEIRDAIEHLLEIRDENVWMLFGTLPFYACSDDERDIATFRKLQES
FT                   KNVTVRNDPDGRSRLNVNIFDGNIIVTDFGDVPLLGNIQTNTLQEAYEKWSASKTAKSL
FT                   SCHCPTVKCLGPNVLVKNSYYPTEDFLSKTANITL"
FT   gene            442238..442420
FT                   /locus_tag="BAS0409"
FT   CDS_pept        442238..442420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0409"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52740"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52740.1"
FT                   /translation="MGKAIQDKDTQLVYLKERLNMFIEVIDTIEPEEVELEDVDRLLAM
FT                   LDELELKCEQFKKDE"
FT   gene            442627..444147
FT                   /locus_tag="BAS0410"
FT   CDS_pept        442627..444147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0410"
FT                   /product="fumarate hydratase, class I"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52741"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52741.1"
FT                   /translation="MEKLQESMYQLIVETSTNLPKDVRRAIQQAKERENAGTRSAMALG
FT                   TITNNIKMADDNISPICQDTGMPTFKIYTPVGVNQLKLKEAIYHALERATKDGKLRPNS
FT                   VDSLFGDNSGNNLGPGTPVIKFEQWEKDYIDARLILKGGGCENKNIQYSLPCELEGLGR
FT                   AGRDLEGIRKCLLHAVYQAQGQGCSAGVIGVGIGGDRTSGYELAKNQLFRTLDDVNPIP
FT                   ELQQLEEYVLENANKLGIGTMGFGGETTLLGCKIGVYNRLPASFYVSVAYNCWAYRRLG
FT                   VTIHPETGEIMDWLYQEGDDTLQQEAQEKTEQREIVLQAPITEEQIRKLRVGDVVTING
FT                   MMYTGRDAIHKHLMDNDCPVDLNGQVIYHCGPVVVKDENDNWQIKAAGPTTSIREEPYQ
FT                   GDIMKKFGIRAVIGKGGMGAKTLAALEEHGGVYLNAIGGAAQYYAECIKEVKDVDFLQF
FT                   GIPEAMWHLRIEGFKAVVTMDSHGNSLHADVDKTSLEKLASFKEPVFK"
FT   gene            444274..445056
FT                   /locus_tag="BAS0411"
FT   CDS_pept        444274..445056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0411"
FT                   /product="polysaccharide deacetylase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52742"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52742.1"
FT                   /translation="MKHKWLYIGLIFSIMMALVPVSALAYTNTPHNWGIPRPKNETVPD
FT                   AGKLYTDLLQKNGGFYLGDTKKKDIYLTFDNGYENGYTGKILDVLKEKKVPATFFVTGH
FT                   YIKTQKDLLLRMKDEGHIIGNHSWSHPDFTAVNDEKLREELTSVTEEIKKVTGQKEVKY
FT                   VRPPRGVFSERTLALTKEMGYYNVFWSLAFLDWKVDEQRGWQYAHNNVMTMIHPGSILL
FT                   LHAISKDNAEALAKIIDDLREKGYHFKSLDDLVKSNQP"
FT   gene            445116..445304
FT                   /locus_tag="BAS0412"
FT   CDS_pept        445116..445304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0412"
FT                   /product="DNA-3-methyladenine glycosylase II, N-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52743"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52743.1"
FT                   /translation="MWSEHVTLEYPYHFEEVLKRLSFDPLNVIQLDEKVIYVPLCIDEE
FT                   QIVVRLQGIGTVQNPQF"
FT   gene            445338..445979
FT                   /locus_tag="BAS0413"
FT   CDS_pept        445338..445979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0413"
FT                   /product="DNA-3-methyladenine glycosylase II, C-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52744"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52744.1"
FT                   /translation="MKRMGAIFHWNEPFQDIQNHFLNTSLRPLFETYAYTPIILEFDYF
FT                   ACLLRCIIHQQINLKFATVLTEQFVKRYGTEKNGVFFFPTPEIVANISIEELREQKFSQ
FT                   RKAEYIVGLGQSIASGTLNLASIETRAEEEVSARLLPIRGIGTWTVQNFLMFGLGRKNM
FT                   FPKADIGIQRAVQGVFQLDDKPDDAFLEKVKQECEPYCSYAALYLWKSIE"
FT   gene            445990..447369
FT                   /locus_tag="BAS0414"
FT   CDS_pept        445990..447369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0414"
FT                   /product="RNA methyltransferase, TrmA family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52745"
FT                   /db_xref="GOA:Q81Z48"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81Z48"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52745.1"
FT                   /translation="MIQKQHESKLEVGQTFPVTIKRLGINGEGVGYFKRQVVFIPGALP
FT                   GEEVVAETTKIQRGFAEAKVKKVRKASPHRVKAPCPVYEECGGCQLQHLDYKEQLNQKR
FT                   DIVVQAFEKYMKNSMEEKIRPTLGMENPWHYRNKSQLQVGRKDEKVITGLYKQNSHQLI
FT                   DIAHCMIQHKATNEATKVVRRILEKLNVSIYNEKKQKGLVRTIVTRTAVQTGEVQVTLI
FT                   TTKEELPNKEQFIAEVQKQMPAVKSIMQNVNWRKTSVIFGDKTFKLAGKEVIQETLGDL
FT                   SFELSARAFFQLNPEQTVVLYNEAKKAAALTGNEKIVDAYCGVGTIGLWLANDAAEVRG
FT                   MDVIPEAIADARKNAKRHGFTNTKYEAGKAEQWLPKWVKEGWRPDVIVVDPPRTGCDDK
FT                   LLETILKVKPKQVVYVSCNPSSLARDVQALMKSYEVEYVQPVDMFPHTAHVENVVKLTL
FT                   K"
FT   gene            complement(447430..448554)
FT                   /locus_tag="BAS0415"
FT   CDS_pept        complement(447430..448554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0415"
FT                   /product="prophage LambdaBa04, site-specific recombinase,
FT                   phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52746"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52746.1"
FT                   /translation="MKGYFRKRGEKWSFTIDIGKDPITGKRKQKTASGFKTKKEAERAC
FT                   NELIHQFNTGSLVDDKNFTLSEYLQEWLENTAKQRVRETTFTNYKRAINSRIIPVLGSH
FT                   KLKDLKPLHGQRFVKSLIDEGLSPAYIEYIFIVLKGSLEDAVRWELLFKNPFQHVEIPR
FT                   PRKVVNSTWSIEETKKFLNRTKFENVIYYHLFLLALNTGMRRGEILGLKWKNFDLNEGK
FT                   ISVTETLIYDENGFRFTEPKTHGSKRLISIDQNLCKEFKSYKAKQNEFKLLFGQSYEDN
FT                   DLVFAKETGQPILPRTMTTTFNQFIKKADVPQIRFHDLRHTHATILLKLGINPKIVSER
FT                   LGHSSIKTTLDTYSHVTIDMQESAVLKLSEALKS"
FT   gene            complement(449270..449614)
FT                   /locus_tag="BAS0416"
FT   CDS_pept        complement(449270..449614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0416"
FT                   /product="prophage LambdaBa04, DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52747"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52747.1"
FT                   /translation="MRHFGQILKKLRKSRGLTQEQLSHKLNLSRSQIKNWETDRYQPDI
FT                   DTLVIIASFFNVSVDALIGFTNEFDEEPLTELLSNVQTTYAALNEQQRERFCKQVSVLI
FT                   NMLEDNQDIF"
FT   gene            450149..451324
FT                   /locus_tag="BAS0417"
FT   CDS_pept        450149..451324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0417"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52748"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52748.1"
FT                   /translation="MWKVLNVLEGELYVAGIKKNKLADYWGVKPATVTKVFKGANDISF
FT                   GYLSKTLILLKKSLISQAKIVNDYVTNTDPKPENLREAMEDLAIRGKFELLKAIIDQEI
FT                   HSDVAENREFAEVYEIIFRRYHDGLNASAYFKLLRQKNKNVKTIEMEVLTEILLCQAQY
FT                   QSGNYKTLYERLKSVSEKINEITNKFIKECLLLRYKEAIAVTSLQGGEVVESRSICRDI
FT                   LDELEWDDFFSLPKLNAYLKIGESLIFEPDNYDSAKFYLEKTLELLGNPSCKGLEKKWK
FT                   LVQQTLSFLKIHQQRDLNTLEFVHPSEKAYSMILEGDVLGAKKILLDLKEKNGEWTDIQ
FT                   TAYYALTCEGEERESLLKKSLLMCQKSGNIHYSQLPKNILGFNLKKWYNYL"
FT   gene            complement(451818..452159)
FT                   /locus_tag="BAS0418"
FT   CDS_pept        complement(451818..452159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0418"
FT                   /product="prophage LambdaBa04, DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52749"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52749.1"
FT                   /translation="MTFGEKLKQLRGKRTQGDVANLLNISRATYSHLENNRIEPSMTVL
FT                   NSIADLFCVSTDYLLGRSSDPRLTEEQDKTADEMARRFMELVADLPKEEQENAWKQAAM
FT                   YVNFTKNQK"
FT   gene            452334..452555
FT                   /locus_tag="BAS0419"
FT   CDS_pept        452334..452555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0419"
FT                   /product="prophage LambdaBa04, DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52750"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52750.1"
FT                   /translation="MNNILKNERKKMKFTQKQLAEKLGISTIYVRKIESGYIPRPDIMV
FT                   KYQEVFDISVKELFPDYFSAFNDKKFII"
FT   gene            452552..453304
FT                   /locus_tag="BAS0420"
FT   CDS_pept        452552..453304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0420"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52751"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52751.1"
FT                   /translation="MNRGGMEMNQLQDLRHPVSEFVFTERNQVVTDSLTMAQMFGKEHK
FT                   NVIRDIEVQLEKLIEANETEWGQLNFEPTQYQHYQNKQWYPKFNLTEDAFAIVAMSYIT
FT                   PEAMKMKIKFLQEFKRMKEHIQKVQQQPKSVEDAIIYSMTELKQIKSRQDHTEEEMNKM
FT                   KLLVDNELWLTEQHKGSVQRKVKQRVFELKKEGYDNASYQGIYGALKRHFGVAKYDKIP
FT                   RKYYQNAMRFIAGWYPPERPNTLDDYVS"
FT   gene            453349..453699
FT                   /locus_tag="BAS0421"
FT   CDS_pept        453349..453699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0421"
FT                   /product="prophage LambdaBa04, DNA binding protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52752"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52752.1"
FT                   /translation="MKNSTVQIALAVTKFSAQKGWSDEEFWEAIELLRFNKEDARQTAI
FT                   EKLDTIPVTYDNTNDYPIMLKVDHVAEVLGISQRKAYDIMDQKGFPLVKIGRKKVVPRD
FT                   AFFNWLERGVSA"
FT   gene            453696..453863
FT                   /locus_tag="BAS0422"
FT   CDS_pept        453696..453863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52753"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52753.1"
FT                   /translation="MMEDTTSLVAFAMFIAFSILLLYITYEPIKRWAWSNVEQNKKTHG
FT                   SGSFKKKQLS"
FT   gene            453893..454078
FT                   /locus_tag="BAS0423"
FT   CDS_pept        453893..454078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52754"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52754.1"
FT                   /translation="MDLIKYQVLLPNKFWDLAESKDELKKMIEQYFKNSYPHYKIKEII
FT                   RSGESHIAICERKWLI"
FT   gene            454075..454947
FT                   /locus_tag="BAS0424"
FT   CDS_pept        454075..454947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0424"
FT                   /product="prophage LambdaBa04, DnaD replication protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52755"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52755.1"
FT                   /translation="MNNVVLQIGQMNFRGNVIDHGWFKTLTLDNGKPNMVAISILGEVV
FT                   YWYKPTEVRDEHSNNVRYKQKFKADTLQKSYQQFADSFGFTKRQVKDACDYLKDRRLVH
FT                   IEFRTIFVNGTRCNNVMFIEPIPEEIQKISILYWENGTPPTLERKRVLQQNEPPSYDKK
FT                   EEPPTFKRKTNTENTTKNTTENVSSSSIFSFYENNFGILNSFIAENISQWVNDTSEELV
FT                   QAAMERALKQQKKWNYAEGILKQWVNNNVKTLKDVDALETEYQRNKGVKKRVGINRKSD
FT                   DSDSEYIGL"
FT   gene            454916..455719
FT                   /locus_tag="BAS0425"
FT   CDS_pept        454916..455719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0425"
FT                   /product="prophage LambdaBa04, DNA replication protein
FT                   DnaC, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52756"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52756.1"
FT                   /translation="MTRIVNTSACSEETEGYTCEHCNKYIAAITVEVPQLRIKNKILPT
FT                   CECVVEREEAKIREAQNFAKKREIEKLFSISNLGERFSKSTFESFLDRNGSETAYKVAV
FT                   KYVKTFKEWNGESLMLWGEPGNGKTHLAAAIVNELSKKGYIVVFQSVPELLQRIRSTFN
FT                   SENKENETQIMRALLECDLLILDDIGAEKTTEWVEEKLFNIIDGRYRKELPTLYTSNLE
FT                   PKELKNQVGKRSYDRMVETSLTVKNEAASYRREIAKQRLQRFIEA"
FT   gene            455735..455929
FT                   /locus_tag="BAS0426"
FT   CDS_pept        455735..455929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52757"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52757.1"
FT                   /translation="MCVLCHDTGIIRKETYPGVIETNGCNCEVAKRQQAENDKRWQAWL
FT                   IKFESMKQELERSKQQKAS"
FT   gene            456142..456396
FT                   /locus_tag="BAS0427"
FT   CDS_pept        456142..456396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0427"
FT                   /product="conserved hypothetical protein, phage-like"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52758"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52758.1"
FT                   /translation="MKQLTIDDVMGSFNYDAISTSEKFLNPSYEVHFYDKEERQKMDCF
FT                   DAKTETEAWNATIKEHGKGIQKIRITHSNRTRAEFLALD"
FT   gene            456405..456824
FT                   /locus_tag="BAS0428"
FT   CDS_pept        456405..456824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0428"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52759"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52759.1"
FT                   /translation="MMFNRWLTDEEYQQAESNGISRRVLYMRMYRYGWELQEALTTPPR
FT                   TYWHMGEGKHNKWLKLAEKNGVNSSTFYSRVNNGWDPKDAASIPTRKQMDRKELVKIAE
FT                   SNGISVSTFRSRLSYGWDPMKAATTPAKSKNKNIS"
FT   gene            456840..457304
FT                   /locus_tag="BAS0429"
FT   CDS_pept        456840..457304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0429"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52760"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52760.1"
FT                   /translation="MNIMENGVLEATKLISEARKEATVLQIASILSIGELNDYQEATLR
FT                   TWNNKTDFGGRVSNAALGLTGEAGEVADIVKKAIYHGHGFQPSHCPGEEDGNTYKLALE
FT                   LGDILYYLSIMAHELGYTLQDIAEMNIAKLAKRYPDGFSREASQARVDVK"
FT   gene            457564..457854
FT                   /locus_tag="BAS0430"
FT   CDS_pept        457564..457854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0430"
FT                   /product="prophage LambdaBa04, transactivating regulatory
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52761"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52761.1"
FT                   /translation="MVMNIKVDELKENEDGIKGGKITITNEAHTITIHSQHVDDAYYLA
FT                   GNLEDCANKIEVKQNCEKCCHCDGKGVGLDWGAMKFWECDVCDGTGELDSK"
FT   gene            458054..458653
FT                   /locus_tag="BAS0431"
FT   CDS_pept        458054..458653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0431"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52762"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52762.1"
FT                   /translation="MEYIEKATKEIRENWFGDHVAEIQGEEGLQVIYWGKPGTGSYRAK
FT                   FVLSGYNVFVSGDIGEAVYNLTCPATLENIKGCNLGYFTGKLTAFCEERWNFDQDKAKE
FT                   ELNEFWEEYEMNETKDGKEIYDDIVSAIDESSSMESYHFWVGNVYHNSSLESDTMECIW
FT                   DFGKRLPRRLIGYWLGLQMAIEQLEKNKPAAEAVTL"
FT   gene            459251..459670
FT                   /locus_tag="BAS0432"
FT   CDS_pept        459251..459670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52763"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52763.1"
FT                   /translation="MRKIAMKTYEELVEKCKELVEKGWTPESVRECFEAYSEFGIDAIQ
FT                   SAMNEALLNNGCSDNVLDYRPNLENLKALGLEEDYVFQALAYMGNASQFMSWANTVLAL
FT                   VDDVPEQLKQDIKKVHSGIYEMQEKLREYKKEDDE"
FT   gene            459670..460116
FT                   /locus_tag="BAS0433"
FT   CDS_pept        459670..460116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52764"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52764.1"
FT                   /translation="MEEILVQGNITEDLKRLGVKANRTYGDETTSYQVYEVSEEDFRKL
FT                   SDDAENMDTDDSHWKNGGWRWDTGSNQPIPTDKAEVNNQELVCWVETINDDEETYRNDW
FT                   YVDLLEYLDVGVGCTAFRNVCAVTKDLAKYNNMSMAELFKKYQG"
FT   gene            460151..460339
FT                   /locus_tag="BAS0434"
FT   CDS_pept        460151..460339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52765"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52765.1"
FT                   /translation="MNMGTLVVNCGEYEFTRFESAVRTLEQEYGYEGEAWEMVVASGDL
FT                   EILSDFLNSDGLNAEIE"
FT   gene            460371..460745
FT                   /locus_tag="BAS0435"
FT   CDS_pept        460371..460745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52766"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52766.1"
FT                   /translation="MTVVSRSHRALKRKYRPIRKEFKKDILEATKNNRAFAMMIIETYT
FT                   ASQHRTHIMKVWELLGIHHREAYKDYCDKLMGKHLTGRDEIMRSIYFADKVLYDKYHRK
FT                   LPECYAMGDALGIAYKVLKQ"
FT   gene            460851..461207
FT                   /locus_tag="BAS0436"
FT   CDS_pept        460851..461207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0436"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52767"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52767.1"
FT                   /translation="MSKVIEGQEVYVSTSGGWVGKSEPNLRKYIVVRANKTSFYANPEG
FT                   VEDKSPYRFNQKDLSHNTGWGYHYQAYRTEKEYWDMIERGKEKAQLRKELKDTVDKMSL
FT                   IELRKLKEVLFVTK"
FT   gene            461864..462346
FT                   /locus_tag="BAS0437"
FT   CDS_pept        461864..462346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0437"
FT                   /product="phage transcriptional regulator, ArpU family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52768"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52768.1"
FT                   /translation="MTKQLSFLPKIDRTATQEELEGVLESVRIHRQFGMMRKEMKVTPS
FT                   YEIREHGPTHTVGKPLEDVAIANIQQSKREEWLERMSVRIDQFLNRLGNGRAGSIQRDI
FT                   IYKRYLEEEDVCDYMVYNEIGMSERTYRRWKSKAFYKLAFALGLEVYETEETGGNE"
FT   gene            462346..462639
FT                   /locus_tag="BAS0438"
FT   CDS_pept        462346..462639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0438"
FT                   /product="phage integrase, N-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52769"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52769.1"
FT                   /translation="MNFVQPIRDPEQIQQLKEYFKEKSLRNYILFIMGINTGLRISDIL
FT                   KLKVGDVKGSHISMREKKTGKQKRIQITASLKRELKWFIEEREDNEYLLQSR"
FT   gene            462667..462888
FT                   /locus_tag="BAS0439"
FT   CDS_pept        462667..462888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0439"
FT                   /product="phage integrase, C-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52770"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52770.1"
FT                   /translation="MAYKILSGAAAEFGLDEIGTHTLRKTYGYHMYMQTKNIALLMEIF
FT                   NHSSEKVTLRYIGVNQDAMDKAMTRFKI"
FT   gene            463477..463779
FT                   /locus_tag="BAS0440"
FT   CDS_pept        463477..463779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0440"
FT                   /product="prophage LambdaBa04, Gp54"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52771"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52771.1"
FT                   /translation="MAKEYAKKFYKSTVWKKCRDSYFKFRHGLCERCTDPGKIVHHKNY
FT                   ITPENINDPEITLSFNNLELLCQDCHNREHHEKNSPVVEGVMFDENGDLIRREDI"
FT   gene            463776..463943
FT                   /locus_tag="BAS0441"
FT   CDS_pept        463776..463943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0441"
FT                   /product="prophage LambdaBa04, DNA binding protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52772"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52772.1"
FT                   /translation="MNTFFHNTIGVNDAAILLKVSPGHIKNMCAEGKIIAKKIGKTWVI
FT                   DRSKLKGVRK"
FT   gene            464187..464558
FT                   /locus_tag="BAS0442"
FT   CDS_pept        464187..464558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0442"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52773"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52773.1"
FT                   /translation="MASKKELTKEERVNKEIRRLKRIYKELPKDTLMVVEGLIVEAADL
FT                   RVRLEDIRKDLDENGYDEMFSQSENQEPYERERPAARRYIAMNKSYQTIMKQLGDYIPK
FT                   KPIENKEKDDGFDDFVTNR"
FT   gene            464555..466243
FT                   /locus_tag="BAS0443"
FT   CDS_pept        464555..466243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0443"
FT                   /product="prophage LambdaBa04, terminase, large subunit,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52774"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52774.1"
FT                   /translation="MRVQYPLSYNPIIEYYNKIESGEEIVGYKVKRIYKKLVDDIYDQD
FT                   SIYEYNPKRANHAMEFIENFCKHSKGKWAGKPIDLELWQKAFIGSLFGFIHKIDGTRKY
FT                   REALLIVARKNGKSTLSSGICLYLQIADGEGGAEVYAVATKEKQAKIVWSEAKRMVKKS
FT                   PVLSKRIKALVKELNADFNDSTFQPVGSDSDTLDGLNVHGASLDEIHAWKDKNLYDVIV
FT                   DGTSAREQPLILMITTAGTVRESVYDMKYEEAERLLLSLDDEKEYTDPTFLPIIYELDS
FT                   RKEWTDPKCWKKANPGLGTIKKIDNLQTKVNKAQANPLLVKNLLTKDFNVRETSSEAWL
FT                   TFEQLNNKQTFDVMELKPNYGIGGTDLSETTDLTAAKVIFMLPNDINVYVLQMYWLPEE
FT                   LLEQRSKEDKIPYDLWHEAGYLRTTPGNSIHPKFVTEWFLEIRDEYGIYLPWIGYDRWS
FT                   AKYWVEEMQGYFGKEAMVPVAQGKQTLSMPMKLLGADLEAKRIIYNNNPIDKWCLSNTA
FT                   IDIDKNLNIQPDKTNNQRRRIDGTAALLDAYVVLQEKKNDYLNMI"
FT   gene            466481..467479
FT                   /locus_tag="BAS0444"
FT   CDS_pept        466481..467479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0444"
FT                   /product="conserved hypothetical protein, phage-like"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52775"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52775.1"
FT                   /translation="MRFILEEPNPLMTSQMFQEKMTVQLELNHNAFAYIKRDELGFATE
FT                   LYPIPCITVEVVEGIQGDIFLTFYFKNGKRMTVPYVDVIHLRKDFNEDDFFGEHPGQAL
FT                   SSLMDIVTTTDQGIVKAIKNSAIIKWILKFKSVLKQEDIDMQVGNFVKNYLNIDNVNGG
FT                   AAATDPRYDLEQVKNEAFVPDSKQMQETTQRIYNFFNTNEKIIQSKYTEDEWNAYYESE
FT                   IEPLAMQLAGEFTRKLFSRRERGFGNKIIFEAASLQYASMSTKMNLVQMVDRGAMTPNE
FT                   WRSILSLGPIEGGDKPIRRLDTALVKDGNVIDKGGGKIGQDGNKGNSNTED"
FT   gene            467427..468017
FT                   /locus_tag="BAS0445"
FT   CDS_pept        467427..468017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0445"
FT                   /product="prophage LambdaBa04, prohead protease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52776"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52776.1"
FT                   /translation="MGKLDKTETREIVTQKIEIREDDNGNRTLIGYAVKWEKKSVVMGY
FT                   YRKFREQFKNGAFTETLQNDDQRFLWSHDTSKVLGRTKNNTLRLNEDAVGLRFELDLPD
FT                   TTLGNDTYKSIKRGDVDGVSFGFSMISEEIQEPDDDLMLRTVTKAKLLEVSAVAFPAYP
FT                   DSEVSARGYDPYKHFTEEKKRSEKRRRLYLQTL"
FT   gene            468024..469226
FT                   /locus_tag="BAS0446"
FT   CDS_pept        468024..469226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0446"
FT                   /product="prophage LambdaBa04, major capsid protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52777"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52777.1"
FT                   /translation="MDFNMNKEQLLKRKSEIGELLSDETRSIDNLDTIETELRDINEQL
FT                   AAIEKREQLLNEARSINEGNAAGANKIETFNANLNLSNEKREIGTNTVEYRNAFMNYVL
FT                   RGEAIPAELRANAVTKTSDIGSVIPQTVLDKIIEKIEAVGMILPLITRTAIKGGVTVPT
FT                   SAVKPVATWVAESSGSDKQKKTTGSITFNYHKLRCAVAVSLEVETMSLAVFETTLINNI
FT                   VEAMTKAIEQAIVSGDGSGKPKGILAETPFEGQALDVAKINYKTLTDAEAALPLEYEAS
FT                   AIWTMTKKTFMEFSAMTDADGQPIARTNYGISGKPERILLGRPVVLCNYVDSFATATEG
FT                   TAFAFLFNYKDYILNTNYQMGVKKYEDNETDDQVTKAIMIVDGKVVDKNSLVVLKKAPS
FT                   A"
FT   gene            469242..469499
FT                   /locus_tag="BAS0447"
FT   CDS_pept        469242..469499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52778"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52778.1"
FT                   /translation="MNHFVLNTFIDKETKVGYSKGDMYESNDSERIAFLIEKGFLKGNK
FT                   EIPTFPKHTGGGWYELSNGEKVQGKEEAMSAEQSLKDKES"
FT   gene            469496..469768
FT                   /locus_tag="BAS0448"
FT   CDS_pept        469496..469768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0448"
FT                   /product="prophage LambdaBa04, DNA packaging protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52779"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52779.1"
FT                   /translation="MILKDVKKTLRISHDALDDEINDSIEAARHDLMLSGVSSVKANND
FT                   DDPLIKRAIKVYCKAEFVTEAKEAERFQASYNMLKNHLTLAGDYK"
FT   gene            469765..470064
FT                   /locus_tag="BAS0449"
FT   CDS_pept        469765..470064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0449"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52780"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52780.1"
FT                   /translation="MNDILFFPVVTTTKDDLGQIEVSEDFTRQVFCEKKSISQNEFFQA
FT                   GQNGFKPKCVLIVYSLDYQEEQKVNYNNKTYSIYRTYERDDERIELYCEVKAGG"
FT   gene            470057..470413
FT                   /locus_tag="BAS0450"
FT   CDS_pept        470057..470413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52781"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52781.1"
FT                   /translation="MASIDSLANDIARELQRYGKEVEEKLEVEKEEVANNLVSDLKENS
FT                   PKNTGKYAKGWRKKKEGNGFIVHNALKPQLTHLLEKGHAQVNGGRVPAKVHIAPAEEKA
FT                   ENEFLERVERAIQQ"
FT   gene            470410..470739
FT                   /locus_tag="BAS0451"
FT   CDS_pept        470410..470739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0451"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52782"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52782.1"
FT                   /translation="MTLSELKKILDATGYPVAYSHFTATIGNPVPKPPFICYLVTGSPN
FT                   MIADSKVHFKISDVNIELYTAKKDLVAEAKLEKVLDDNEIPYESSEIYIDSEKLFQKIY
FT                   ETRLI"
FT   gene            470740..471309
FT                   /locus_tag="BAS0452"
FT   CDS_pept        470740..471309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0452"
FT                   /product="prophage LambdaBa04, major tail protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52783"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52783.1"
FT                   /translation="MENKVVFGLKKVHYSVITEDSSGKITYGTPAKLPGAVKMKLDPKG
FT                   EQSDFWADDSNYYTDSSNQGYEGTLNIANITEAFRTDVLGEILDEDDQVLTEVSNAKIK
FT                   RIALMFEFDGDVKATRHLLYNVSVSRPGFGSSTKSDKTEPNTTELKFVASQHPETLNVK
FT                   TSTKVTTPAGIYDAWYTKVYEKVVGA"
FT   gene            471314..471676
FT                   /locus_tag="BAS0453"
FT   CDS_pept        471314..471676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0453"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52784"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52784.1"
FT                   /translation="MKKTIIIDEKAVLLKSTAGTAIRYKSQFRRDMFADILSLGVLSSY
FT                   ISTDGDQSNIDLSQVDLSKLDFEVIYNLVWAFAKTANKEVPDPLTWLDTFGEFPIAEII
FT                   TEIQDLIKSTVQSKKK"
FT   gene            471918..475853
FT                   /locus_tag="BAS0454"
FT   CDS_pept        471918..475853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0454"
FT                   /product="prophage LambdaBa04, tape measure protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52785"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52785.1"
FT                   /translation="MVGRIKGITIEIGGETTGLQSALKDVNKRSSELSKELKDIERLLK
FT                   FNPGNVEALAQKQQLLTQQIENTTKKLDSLKSAQQQVQAQFESGAISEEQYRAFRREIE
FT                   FTEGQLNGFKNSLAGLKAEQEKAASSTRQLETLFSATGKSVDDFADALGNRLVNAIKNG
FT                   TASSRQLEQAIEIVGREALGAEADIGKLQQALRSVDDGNSIQNIRNDLNQLSQEAEEAS
FT                   ESVKGLGVELENVLGGIVAGGGIQEVIGQALDMSELKTKIDITFDVPESSKRSVEDAIR
FT                   TVVAYGGDAEEALEGVRRQWSLNKDASDAANTEIIKGAANIASSYSQIDFTELIQETNE
FT                   IGSELNISNKEALGLVNSLLKIGFPPEQLDIIAEYGAQLRRVGYTAQEVQSIMASAAKE
FT                   KSWNIDNLLDGLKEGRIRSVEMARGLSNSMKDAVRDAVDDTEKMSDAQISAMQKGFAKQ
FT                   ESALANSFSNQEKALSKSHSRRQNELAKSLDAEYNAVSKSYENQQKNLEKKLSAEYDAA
FT                   SKNYDRQQKALEKSLDAEVKAFEKSSEQKIKLIDKEYMERMKLIDEEKYNRLKAVDDQI
FT                   NSLDAKTAAEDKYFKDRENAEKRADLKVKISKAKNEEERQAAIKALRDLEEKMRLDKIR
FT                   EERKSQIDRLKEEKDSIKEASDAKKEALKSEFDSRKERVKEQINNEKEALKERQQEQKE
FT                   AFQQNKQENLKAISESNKAQLDSLREVNQANLSALKENHNERKQALSERLSDEMDAVRE
FT                   SHRAELESFKEMNAEKLELAKNPPDSAAVQEIFAQLEGWGKAIAKGGEEGKQAFVDMVK
FT                   WLDQIEDADLKEAIGVELFGTMWEDQGQKIINTILQTEQKQADLKQGIDDLQQSVSKTD
FT                   ASPMVKLKEAMNDLKQALEPILLIIADVVSAFAGFISAHPVLAAAITAITVAIGILVGI
FT                   CAALAPVIFLATSGAITFAGVMAALTSPIALVVAAIAGLIAIWVLFGDKIMAIYNEYFK
FT                   PTIDQIVSIIVSTLKPVFEQGFAIIKDVVQDAFIIIQRVWNEILSPVFSVITSIIKTVL
FT                   LPAFKFVFSAIGSVVSDAFSGIKDMWNNVLKPILNGIIDFISGIFSGNWEKAWGGIVKI
FT                   FSGVFEGIKSAAKAPINAVVSMLNGLIEGINSIEMPDWVPFVGGSKPSIPRIPMLATGG
FT                   HVLGDGSFIAGEAGPELFTKRGNRVSVTPLSSTEKSLGITGTMSRLIGDMSYSMASSMK
FT                   ELSGLKSVMSNVYGSMASSSQAMSRNASQRTAEGNSSSNANKSDSYNFADMFRGSTFVV
FT                   REEADVQKLAVELGKYIKASGRRVGQL"
FT   gene            475850..476659
FT                   /locus_tag="BAS0455"
FT   CDS_pept        475850..476659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0455"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52786"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52786.1"
FT                   /translation="MSLTLDGKPLKQLGLALLPGYQHPAAPPVRDYTVSIPGRPGAYYF
FT                   GSDIDPMEFNLPLIIKPQENRYELAAAIRKMVDTFIDPYGKPKEVKLIYDYEPDKYYLA
FT                   RYSGSMSIERYFRMGKFELPMIAYDPYAYSIIDSTNGIKWGDPIPWMSDIPISAGDNSY
FT                   TINSPQNISLNNYGTLVVRPVINISGSAENLTLTLKGERFSLGTFTNSTFLLDAKHYTA
FT                   IKNGQNYLFQLKGDLEKLELIPGANVIKISGVNLNINITFEYRAKYI"
FT   gene            476674..480252
FT                   /locus_tag="BAS0456"
FT   CDS_pept        476674..480252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52787"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52787.1"
FT                   /translation="MADAPKLTGEETIKQSYYKINMAIDNSNDALKTAKDSLTSPVSNA
FT                   RIDPKAVTKDKLGDDVDYQTTALGGAIIGDNVMWEKVAIFGPKSNMTEEFTDNNELEFG
FT                   KKLLKLTVTSTSNYKQLLNPGTSEHANAGVEIPVYAKRYKKISGALNYKINKATGETLI
FT                   RAGITVRYTDGTIQKSTMFKLKADGKEYADVFEQDIDNTKTISSMYLYISGGDVNDVIK
FT                   ISYVSFWMGKTNDNIFDKSLLLSKIGDVDSSVTIIKENNRINWFTDAKNIIQNKPMIKQ
FT                   GNELESSGSFLQKGIKNLNVNNIMGTPFWFEFECNSDSATPYFRFELPELMKKLHEIRQ
FT                   SGLKLSKVNATVELYFPYNLKHNVTYRLLSKKITGEWHFFPLKTITKNTGAQTITIQLN
FT                   EDIDSVIDTLGDYLTVYVTFQSALNTQKVYLGWMDIWMDDDKQVLFSENFDGRAILPGT
FT                   VVEQSLEKSLQEKINGTTVSNNPKKQLRVAMTGSSITWGKGLLDDGFVREIDYYLRDYL
FT                   SNTYLHSDPSLLFKGANSIITNEKFYKRTARKMTGTESSVSFSLVGDELSIVHGLERSN
FT                   KGAAIIELYVDGQLYDTFSNYNTEPYGNTVVNAIGDGTTVKFDLGRAFTYNHVVKVNGI
FT                   TLVGKINDAESGATFPNGHDYMIIRKYGQNPDTQETEVHHFLYLKNAPAARANIEVTMS
FT                   YGENIIYTKSTIGEITESIEGALESRYGDDEISFDPANPAALSSGLDFRETDERSVKTW
FT                   NFAEYKEREFMFKIKGYDPRANKTVSPYFILNFITNRMHYIMNAGIGGWTAEKLYNDNG
FT                   LRNYHYLMRFDPDILFVESGTNDDWDSANQFVATKTITDVTEAALRRYPTLWLKSSKYV
FT                   AVDNYTIETAALTIEEVTRNSVKINGTNTDLSSVKKGDYLIIGDYHFDEREVVTRIIDT
FT                   WDIATRTATFKKPLKPQEILNIRKLSDLTGRTVMVKRIDGFISWLDKVVDGVRQYNEDV
FT                   QIGLVSTGLCAFTTRLLLGYPDKIKELALQKECTFANAFDFIKRFQYNQTRVGSAFLNS
FT                   ANNTTSSGSNEYNLVNASGVDINVAQKLRGIRNYSIKVDGIERYGDGCYIDNAYGYYFK
FT                   PATTSSNLTIDNWNNKVTTKIAADYVTTKLVFTKDIPPNGAKIEVSFSTEKWSSDDCHM
FT                   GSLGGIHMYKNSLIDAMQIMICKSIG"
FT   gene            480548..482182
FT                   /locus_tag="BAS0457"
FT   CDS_pept        480548..482182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0457"
FT                   /product="phage minor structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52788"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52788.1"
FT                   /translation="MKHIKLYDKQLQLKAYLENAFKIKYSPPLNELWTAGFSLPFTDPK
FT                   REEIETFDYVEIFDNGKRIGLFRIMDSEEEREVSQKIITYDCEHVLSTLMDSVLFGYHE
FT                   RINLTTRENIEYLLSKQRIKHWKLGQCDFVKYFQYSWENEDTILGPIYSIAKPFDEKFQ
FT                   WTWDDTSYPWTLNLVKYSDEITGELRYRKNMKGIKRKVEAKDVMTRIYPLGYGEGVNQL
FT                   NIKSVNNGLPYIDAPDFVRELQDGFDYIWVDRRFEDPKTLYASAKAMLLKACMPKVTYE
FT                   IDAIDYELIDPYKIEKYETGKLVRLYDEDFNISVDLRVMDRSKDDVTGNPLDVKLVLEN
FT                   KVTDIGTIQADIEKRQKVNEVYSQGTTNIDSQPFQDNCDPDHPAIIRFQIPNDVKNVNQ
FT                   LILTFETLRFRAYERAIKGGGAVVASTSAGGANVSSTSSGGGTVGSTSSGGSSVQASSS
FT                   GGGTVKASSSGGDHVHKMFHGGGIVPAEPSTIGLYTAFSDPGRNTSASFYAKGTGSSFY
FT                   TYGSSGNHTHDISIPNHTHSININHKI"
FT   gene            482200..482679
FT                   /locus_tag="BAS0458"
FT   CDS_pept        482200..482679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0458"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52789"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52789.1"
FT                   /translation="MQTIEIHTQGGLKHKVQTEVYNAEALNTKLNDNDLITVLIGDFII
FT                   QRIDVKRIIPLNMIDAEGAKRVEVHTNAGKVIEITTNDYDPIYLNEQLNNNNTITVVIG
FT                   DYIFSRIDVKQVVPVKEEPKEPEQPPVTEPEKPTEPVTPPGEGTEDDSITTTEQL"
FT   gene            482774..483013
FT                   /locus_tag="BAS0459"
FT   CDS_pept        482774..483013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0459"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52790"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52790.1"
FT                   /translation="MAELKHDDMKELLVGLTRVETKLDTLGNVKEVAIEAQQSAKSAHL
FT                   RVDRLDKLVFWLGTTVIGAVIVGAITALFKFAGK"
FT   gene            483229..484026
FT                   /locus_tag="BAS0460"
FT   CDS_pept        483229..484026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0460"
FT                   /product="prophage LambdaBa04, glycosyl hydrolase, family
FT                   25, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52791"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52791.1"
FT                   /translation="MGHIIDISKWNGDINWSIAKQHIDFIIARVQDGSNYVDPLYKGYV
FT                   QAMKQHGIPFGNYAFCRFVSIADAKKEAQDFWNRGDKSATVWVADVEVKTMNDMRAGTQ
FT                   AFIDELYRLGAKKVGLYVGHHMYTPFGMANVKSDFVWIPRYGGNKPAYPCDIWQYTETG
FT                   NVPGIGKCDLNSLIGNKSLSWFTESATQESVQAPTQNIIQSGAFSPYETPDVTGALTSL
FT                   KMTAKFILKPDGLTYFISDPTSDAQLNAMKEYLDRKGWWYEVK"
FT   gene            complement(484080..484415)
FT                   /locus_tag="BAS0461"
FT   CDS_pept        complement(484080..484415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52792"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52792.1"
FT                   /translation="MSLDTVAALQRMQQLKQSEAASGEKLILKREDSKSEKTVLILCII
FT                   LALPTIGISLLFLVLYGLIKERNRKTYLVKNVATGERFHVDKEDFKQYEKEFKAKEKEV
FT                   KKISDLQ"
FT   gene            484795..485532
FT                   /locus_tag="BAS0462"
FT   CDS_pept        484795..485532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0462"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52793"
FT                   /db_xref="GOA:Q6I3T8"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6I3T8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52793.1"
FT                   /translation="MNNYKLTIQYDGARFKGWQRLGNNDNTIQGKIESVISEMVGKETE
FT                   IIGCSRTDAGVHALNQVANFQSDEKLVEHKVKKYLNQYLPNDISITNVEEVHDRFHARY
FT                   NSKAKTYLYKIWNEEHTNPFMRKYSMHVNKKLNVKSMKEAAKHLVGSHDFTAFSNAKSK
FT                   KKSMVREVYSLEVMEEAGFVQIRVSGNGFLHNMVRKIVGALIEVGLGQLAAEAIPQILE
FT                   AKQRNQINCLAEASGLYLENVEF"
FT   gene            complement(485583..485786)
FT                   /locus_tag="BAS0463"
FT   CDS_pept        complement(485583..485786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52794"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52794.1"
FT                   /translation="MSNDNKLNLLQYLYFFPAILCMMLFINTDTSSFPYAKLLATISGS
FT                   FAAIMLAAFWNLKIRMKREKSS"
FT   gene            complement(485870..487273)
FT                   /locus_tag="BAS0464"
FT   CDS_pept        complement(485870..487273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0464"
FT                   /product="arginine utilization regulatory protein RocR"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52795"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52795.1"
FT                   /translation="MRTEEINLKQIIEMNMLYETLLNELDIGIHIINEESKTIIYNRKM
FT                   MEIESMERSDVLYKSPLEVFAFEENKNSTLIEALKLGKTNKNIKQTYFNNKGQEITTIN
FT                   DTFPIIENGKIKGAIEISKEMNHLKQTIKMDSFRKQNTKFTFDHIIGDSEAIQSTIAEG
FT                   KRVIRTSSSILLVGETGTGKELFAQSIHNESQRSTKPFISQNCAAIPDTLMESLLFGTN
FT                   RGAFTGAIDKAGLFEEANGGTLLLDEINSLSPALQAKLLRAIQEKTIRRIGGTQEKEID
FT                   VRIIATINEDPLEAITHNRLREDLYYRLSVVTLCLPPLRERKEDIPALVQHFIEKYNIQ
FT                   FGLSVTDVDIHVREFLYAYDWPGNVRELEHIIEGSMNLVEDENIITAFHLPTRFREQIK
FT                   KEFNTQPFLTNNATDAPKTLKHTIAEMEKNYITQILKEYHGNISQAAKFLGLSRQNLQY
FT                   RIKKLHLHI"
FT   gene            487547..487801
FT                   /locus_tag="BAS0465"
FT   CDS_pept        487547..487801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0465"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52796"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52796.1"
FT                   /translation="MKTVIEGVYSPCYGKVEKLFVKESSYVYEWEKLALIETIDKQKVE
FT                   IKVGISGYIESLEVVEGQAIADQKLLITMRDDLLITGSD"
FT   gene            487906..489327
FT                   /locus_tag="BAS0466"
FT   CDS_pept        487906..489327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0466"
FT                   /product="amino acid permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52797"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52797.1"
FT                   /translation="MMNQNQGLKRELKSRHIFMIALGGVIGTGLFLGSGYTIHEAGPGG
FT                   AIVAYLVGGFVMYLTMLCLGELAVAMPDAGSYQTYATKHISPAAGYVVGWMSWLNWSAT
FT                   IGIELIAVSILMKRWFPDVPSWIWCVVFAVLLFAINALSSRSFAEVEFWFASIKVITII
FT                   AFIILGGAAMFGFLDMKGNEPAPMFSSFTDYGGLFPNGLSAILITMIAVNFSFQGTELV
FT                   GIAAGESENPEKTIPKAINNTVWRILVFFVLSIFILAGLFPWQQAGVIESPFVVVFDKI
FT                   GIPYAADIINFVIITAVLSVANSGLYATSRMLWSMSNQGMISPIFGKLSKNGVPIYALI
FT                   VSTIVGCLSLLSGIYAEDTVYLWLLSIAGFGAILVWASIALSNLLARRSYIKQGGDVKD
FT                   LKFKTPLYPFVPLLALVLNVTVIVGMAFIPEQRMALYCGIPFMIVCLLFYRATRNKAHK
FT                   VEHIEKTDTTEVDSL"
FT   gene            489423..490703
FT                   /locus_tag="BAS0467"
FT   CDS_pept        489423..490703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0467"
FT                   /product="acetylornitine deacetylase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52798"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52798.1"
FT                   /translation="MNEEVSQLLEQIDLRKDELLELTKTLIRFETPAPPARNTNEAQEF
FT                   VAEFLRKRNFSVDKWDVYPNDPNVVGVKKGTESDTHKSLIINGHMDVAEVSADEAWETN
FT                   PFEPFIKDGWLVGRGAADMKGGLAGALFAIQLLQEAGIELPGDVIFQSVIGEEVGEAGT
FT                   LQCCKRGYDADFAVVVDTSDLHMQGQGGVITGWITVKSPQTFHDATRRQMIHAGGRLFG
FT                   ASAIEKMMKIVQSLQELERHWAVMKTYEGYPSGTTTINPAVIEGGRHAAFIADECRLWI
FT                   TVHFYPNETHEQIIKEIEEYIGKVAAADPWLSENPPQFKWGGESMIVDRGEIFPSLEID
FT                   SEHAAVKTLSSVHESILSKNAILDMSATVTDGGWFSEFHIPAVIYGPGTLEEAHSINEK
FT                   VEIEQLIEFTKVITAFIYEWCHTKKID"
FT   gene            complement(490798..491451)
FT                   /locus_tag="BAS0468"
FT   CDS_pept        complement(490798..491451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0468"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52799"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52799.1"
FT                   /translation="MPKDNPNERLSKLIKKLLKERALSMRQLGMLTSIDPATISRIMNG
FT                   KQPPKQKHLQKFAECLQVPPQLLFDEMYPDSPHINKEKTDMYTSLDTIQQTLQSSNLFD
FT                   FDYTTTRVKQELENYERYAQTTEGEKRIHESFASKLEQIDSAGPFIEQLTDMYQQFCNE
FT                   TISKEERAVLGGALLYFILSTDIIPDYLFPIGYLDDAIAVELAKEKLIELKRKT"
FT   gene            491581..492192
FT                   /locus_tag="BAS0469"
FT   CDS_pept        491581..492192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0469"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52800"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52800.1"
FT                   /translation="MSTAGLFSIFLIGIASNLDNAGVGIAYGIRKIRISWFNNFIIAFL
FT                   GFLFTLLAGFFGNWIALFISEFTANLIGAIVLGIIGVFILCQPFLGQKNTVGSKDGNVL
FT                   MGILRDPEKADFDGSKTISFSEAVVLGVALSINNIAGGFDAGVTNLNLWLTATISGVFS
FT                   FICISGFAYVGKRFLAEYLGKWATVIAGLLLIFIGIDQLL"
FT   gene            complement(492488..492829)
FT                   /locus_tag="BAS0470"
FT   CDS_pept        complement(492488..492829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0470"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52801"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52801.1"
FT                   /translation="MKLIFQMGKQPVLEKTILLFILSIVESLKLKVVSLDEAHRYIFNL
FT                   EVLELLMDRNIDDQVLELIHFGMGLEDIHHVLPEELEHTIEELKWLCIQVLSEYSMHEE
FT                   SEQLIEDIR"
FT   gene            complement(493005..493934)
FT                   /locus_tag="BAS0471"
FT   CDS_pept        complement(493005..493934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0471"
FT                   /product="glutaminase A"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52802"
FT                   /db_xref="GOA:Q81YY0"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81YY0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52802.1"
FT                   /translation="MQCIETNNLQQLLEQVKPYTKKGKLATYIPELGNANPDDLGIAIF
FT                   HKETEYIHAGNSQTLFTLQSISKVITLALALLDRGEEYVFSKVGMEPTGDPFNSIIKLE
FT                   TTSPSKPLNPMINAGALAITSMLAGKDNEEKMERILHFVREITDNPTINYSSKVANSEL
FT                   ETAYLNRSLCYYMKQNGIIDCDIEELMDLYTRQCAVEVNCIDLARIGLIFAMDGYDPYK
FT                   KKQIIPKHITKICKTFMVTCGMYNESGEFAIRVGIPAKSGVAGGIFGCVKGEMGIGIFG
FT                   PALDANGNSIAGFKILELLSAQEGWSIF"
FT   gene            494259..495752
FT                   /locus_tag="BAS0472"
FT   CDS_pept        494259..495752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0472"
FT                   /product="PTS system, N-acetylglucosamine-specific IIBC
FT                   component, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52803"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52803.1"
FT                   /translation="MLQFLQRIGKALMLPIAVLPAAGLLLRLGQEDVFNIPVMAQAGAA
FT                   IFDNLALIFAIGVAIGLSVDGSGAAGLAGAIGYLVLQNTTNALSKTYSAAELNDKLKSV
FT                   QDLVGSVDPTKLADTMTKVSKAAALTPKINMAILGGIIAGVVAGLLYNKFHKIKLPEWL
FT                   GFFAGKRFVPIITSIVMLLLGLVFGQIWPTIQSGIDAVAHGIVNLGSIGAGLFGLLNRL
FT                   LIPIGLHHVMNTYFWFVLGDFTNAAGDIVHGDIARFFAKDPSAGMFMTGFFPVMMFGLP
FT                   AACFAMIAAAKPEKRKMVTGMLGGLALTSFLTGITEPIEFSFMFLSPVLYGIHAVLTGL
FT                   SLFITTTLGIHDGFSFSAGAIDYVLNFGIATKPLLLAGIGLIYAAIYFVVFYFLIKKFD
FT                   LKTPGREDEEEMAEGEEAPVAGSIGETYVAALGGKENLTVIDNCATRLRLQVKDAGQVN
FT                   EAALKRAGAKGVMKLSNTSVQVIVGTNVESVADDMKKHV"
FT   gene            495980..497245
FT                   /locus_tag="BAS0473"
FT   CDS_pept        495980..497245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0473"
FT                   /product="penicillin-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52804"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52804.1"
FT                   /translation="MVNKGKKAIMDQEKNNANGKSRRPIVYIKRTIILVLLFSLVYFMY
FT                   TKIVTHNKKEEILKAAEMKKQEELKKKEEKKKQEAQKQKEQEEQVKQAQAAEQPAEGPP
FT                   QEINENAQLDQYLQNIGFSGTAVIVKNGKVLVNKGYGMANKEKQVPNNSETTFYIGSIS
FT                   KAFVATAIMQLKDQHKLNVEDTIAKYIPDFPQGNSIQLKHLLTHTSGIPEYEQGAEDIS
FT                   HEELIKRIGKQKRIGSPGEKWKYSDSNYSILAYIAEKVSGQPLEEYIKQHIFAPAGMKH
FT                   SGFGRELEQTRFPSTGYKIVNNNMTTPNIPSMSQLYGCGDIYTSAHDLYLFNEALFSGK
FT                   LISKESYDQMFTGGKKDYGFGWYVDPGSYSNHGVMPGWNCLNGFSKNGSVYVVLLSNIQ
FT                   NNIKSFGKVNNDIYTMLRNIEV"
FT   gene            497399..497800
FT                   /locus_tag="BAS0474"
FT   CDS_pept        497399..497800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52805"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52805.1"
FT                   /translation="MCLFGKYWKKLSRLFNRQLDYFLDNKLLPAVERLLFSQNFARFIQ
FT                   RNSKQATEEFIESSKFQSIICNILKECNTSPFKEIAEQYLGKNVEITVTVGQLTGVIVA
FT                   VGDDFLILQEGIGTEVLLPFASIISIKEA"
FT   gene            497769..498011
FT                   /locus_tag="BAS0475"
FT   CDS_pept        497769..498011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0475"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52806"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52806.1"
FT                   /translation="MQVLYQLKKRKKGDLYMLFTDELRNHVGELVQVVTAVEIVSGVLL
FT                   SVTDGAVSVRTSPSYGPPEDVIVRIPVIAYVRLEG"
FT   gene            497968..499572
FT                   /locus_tag="BAS0476"
FT   CDS_pept        497968..499572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0476"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52807"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52807.1"
FT                   /translation="MYVFLLLPMFAWKGKRDKSMKVSVVIPVHNEASTLSKVLAEVKKL
FT                   EPYEIIIVDNGSTDGTKEIALQHHCRVIYYNHSLGNDVGRAIGAREAKGEIVLFLDGDI
FT                   VMKSEELYPFIKGIQQGHQIVLNNLTWSVYLKVRPHYTTVGKYMLNRYLNKKEFVVGSL
FT                   IAIPHAISREVIEKLGWWNLADPALFQAMAMSRGVDISDMASVDVIYTNKVRPVHTGTS
FT                   PDSPYPKATSRIMGDHLRALQYITETYGKRGGFSEGNRDREFIGKYKPVVLKKEKAKYS
FT                   AIIPVSEEKTTIRSVIQEVKKAGVDEIIIVANGADIETIKQVNLENVIVVEVTKTLGNN
FT                   VARAIGAMHATAEICLFVDGDYAIPAKKLVPFLRAIEDGSDMALNDLQCLLDIFHPADP
FT                   ISMGKYFVNLVAKRPDLWNNSLTAVPHAIRKKVIEKIGYDSLIIPPLAQMKAILEGFSI
FT                   TTVEFVDVIKTNRVRPEQHEFVNGRISAFDRIFGDQLEAIAYLLQHTDERGGFTDGDRD
FT                   REIIQQLRREEENTNEY"
FT   gene            499562..499762
FT                   /locus_tag="BAS0477"
FT   CDS_pept        499562..499762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0477"
FT                   /product="UDP-N-acetyl-D-mannosamine 6-dehydrogenase,
FT                   N-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52808"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52808.1"
FT                   /translation="MNTSRKVAIIGLGYVGLPLAVHLAERGHTVLGLDKDTRKIESIIK
FT                   GESYIPDVSSKALQSLLTKKN"
FT   gene            500128..500805
FT                   /locus_tag="BAS0478"
FT   CDS_pept        500128..500805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0478"
FT                   /product="UDP-N-acetyl-D-mannosamine 6-dehydrogenase,
FT                   C-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52809"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52809.1"
FT                   /translation="MYSTIFDVVVPVSSPKVAEMCKLFENIQRLVNISLVNELNTLCES
FT                   LGIDFYEALEAASTKPFGFTPYWPGPGIGGHCIPVDPLYFQWRIKKNGAMSQLIEAAHV
FT                   INEEMPEKMVQKVKGVVQPPATVLIVGIAYKKDVNDLRESPALPIIELLIKEGYEIEYH
FT                   DPYISSAKFGDKVYQSVSLNEQAVNQASCILILTDHSNIDWKLFKGIKRVVDTRGIVKK
FT                   VSK"
FT   gene            500802..501767
FT                   /locus_tag="BAS0479"
FT   CDS_pept        500802..501767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0479"
FT                   /product="NAD-dependent epimerase/dehydratase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52810"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52810.1"
FT                   /translation="MSKKCLITGGAGFIGSHLAEELVGRGYNVTIVDNFYKGKNKYHDE
FT                   LMKEIRVIPISVLDKNSIYELVNQHDVVFHLAAILGVKTTMEKSIELIETNFDGTRNIL
FT                   QAALKGKKKVVFASTSEVYGKAKPPFSEEGDRLYGATSKIRWSYAICKTLEETLCLGYA
FT                   LEGLPVTIVRYFNIYGPRAKDGPYAGVIPRFISAALQGEDILVYGDGEQTRCFTYVSDA
FT                   VEATIRAMDEKVNGEIINIGSENEKSIKEVAEVIKKLTDSSSKIVQVPFEEVYPHGFEE
FT                   IPNRRPDVTKLKDLVQFQAKVTWEDGLKETIKWFREEDNG"
FT   gene            501748..503304
FT                   /locus_tag="BAS0480"
FT   CDS_pept        501748..503304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0480"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52811"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52811.1"
FT                   /translation="MKKTMAKSLSVIIPAWNEIDTISDVIQSVKGLNPLEIIVVANGCT
FT                   DGTETVAEHLGCKVLRYTEKLGNDVGRAAGAKESIGDVLLFIDGDFAIQTSKLQLFLNP
FT                   ILYNQADVVLNNLDALFLKRQKPNSITVWRQILNSILEREELKIDSLLAVPHALTKEVV
FT                   QSIGYECFVNPILAHLRLVQGKWRISRHCAIDVITPNKFRPTEHAAYGTDLSPSEKRMI
FT                   GDHIEAVAERIVGSDERGGYCDGNRKRDSVYHTLDFEDFYQGWGVTSNLYKGKQLSVII
FT                   PVQDEEKTIGNVIEELRKIEPFEIIVVVNGSSDQTATIAKDKGATTIVYKEALGNDVGR
FT                   SLGTYFAKGEIVLFIDGDFVIPASELYPFAKAIADGTDVALNDLNHYLDLRVPLHLVTA
FT                   FKYALNLACDRKDLGVGSLIAVPNAFSRKCLKQIGYRSLLAPCVAQVKAILSGFEVACV
FT                   SRVEVDKMNRIRPSEHFAKIGHPPAVLRIIGDHIEGLEQLIGLTGSRGGFHDGNRKRDI
FT                   L"
FT   gene            503644..505893
FT                   /locus_tag="BAS0481"
FT   CDS_pept        503644..505893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0481"
FT                   /product="formate acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52812"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52812.1"
FT                   /translation="MTQVLENVKNAWENFKGEKWKAEIDVRDFILNNVNVYEGDESFLA
FT                   GATEATKQLWDQVMDLTTKERENGGVLDMDTKIVSSITSHEPGYLNKETEKVVGFQTDK
FT                   PFKRSLQPYGGIRMAEQACESYGYEMDKELSRIFRDWRKTHNQGVFDAYTPEMRAARKS
FT                   GVITGLPDAYGRGRIIGDYRRVALYGVDHLIEAKKADLNLTGGVMSEDTMRLREELSEQ
FT                   IRALQELKQMAASHGFDISKPATNAQEAFQWLYFAYLAAIKEQNGAAMSLGRTSTFLDI
FT                   YIERDLANGTLTEEDVQEIVDHFIMKLRLVKFARTPDYNELFSGDPTWVTESIGGMALD
FT                   GRPLVTKNSFRFLHTLDNLGPAPEPNLTVLWSKQLPQNFKNYCAKMSIKTSAIQYENDD
FT                   IMRADYGDDYGIACCVSAMRIGKQMQFFGARANLAKALLYAINGGKDEKSKAQVGPEYA
FT                   PITSEVLDYEEVMHKFDMTMEWLAGLYLNTLNVIHYMHDKYSYERIEMALHDTNVLRTM
FT                   ATGIAGLSVVADSLSAIKYAKVKPIRDENGIAVDFEIEGDFPKYGNNDDRVDEIAVNLV
FT                   KTFMNKLRKHKTYRNSVHTMSILTITSNVVYGKKTGNTPDGRRTGEPFAPGANPMHGRD
FT                   TKGALASLLSVAKLPYEDAQDGISNTFSIIPKALGKEDEVQVRNLVSMLDGYAVKEGHH
FT                   LNINVFNRETLMDAMEHPEKYPQLTIRVSGYAVNFIKLTREQQIDVINRTMHESM"
FT   gene            505963..506694
FT                   /locus_tag="BAS0482"
FT   CDS_pept        505963..506694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0482"
FT                   /product="pyruvate formate-lyase-activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52813"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52813.1"
FT                   /translation="MVKGRIHSVESCGTVDGPGIRYVIFTQGCLLRCQYCHNADTWEIG
FT                   KGKEITVEEVMQDVTCYLPFIEASGGGITVSGGEPLLQLDFLIELFKKCKEIGIHTTID
FT                   SSGGCYSEETEFQNKLDILMEYTDLVLLDLKHIDSKKHRKLTGKPNEHILQFARYLSDK
FT                   NKPIWVRHVLVPGVTDNEEDLQKLSSFIQSLSNVQKIEVLPYHKLGVYKWEALGHKYPL
FT                   ANVEPPTEKNVEQARHILQAV"
FT   gene            507107..508273
FT                   /locus_tag="BAS0483"
FT   CDS_pept        507107..508273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0483"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52814"
FT                   /db_xref="GOA:Q81YW9"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="InterPro:IPR009695"
FT                   /db_xref="InterPro:IPR023589"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81YW9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52814.1"
FT                   /translation="MIKNPKVLILTAHYGNGHVQVAKTLEQTFRQKGIKDVIVCDLFGE
FT                   SHPVITDITKYLYLKSYTIGKELYRLFYYGVEKIYDKKIASWYANFGRKRLKLLLQAEK
FT                   PDIVINTFPIIAVPELKKQTGISIPVYNVLTDFCVHKIWIHREVDRYFVATDHVKKVMV
FT                   DIGVPAEQIVETGIPIRSSFELKINPDIIYNKYQLCKNKKILLIVAGAHGVLGSVKELC
FT                   QSFMSVPDLQVVVVCGKNEALKQDLVGVQETNPDALKVFGYVENIDELFRVTSCMITKP
FT                   GGITLSEAAALQVPVILYKPVPGQENENAMYFERKGAAVVIRDDSEVFAKTEALLQDDM
FT                   KLLQMKEAMKSIYRPEPADHIVDTILAENHVEPNHIPIKSPALAQSFT"
FT   gene            complement(508868..509425)
FT                   /locus_tag="BAS0484"
FT   CDS_pept        complement(508868..509425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0484"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52815"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52815.1"
FT                   /translation="MLKKRDLHDSHVLYELMVDPAVFPFVRQKAYSYEEYLFLTKQTIE
FT                   AEERGELISRTILDEWGNPIGTITLFDVQEKAGFLGTWLGKPYHGKGYNKLAKDSFFSE
FT                   LFYELDIETIFMRIRKINIRSIKAAEKLQYVNLANETRKAVYDEINANEEVYNLYEIPK
FT                   DQYTLATMRDTTFQDAHHLKEA"
FT   gene            complement(509667..510797)
FT                   /locus_tag="BAS0485"
FT   CDS_pept        complement(509667..510797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0485"
FT                   /product="chlorohydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52816"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52816.1"
FT                   /translation="MKILLKQAMVYPITSQKFQGDVLVIGEKIAEVKPFIQPTQDMTVI
FT                   DARALHLLPGFIDVHTHLGLYDEGTGWAGNDANETSEVSTPHIRSLDGIHPLDIAFQDA
FT                   VQNGITTVHVMPGSQNIIGGTTCVIKTAGTCIDHMIIQEPAGLKIAFGENPKKVHSNGT
FT                   KESITRMGIMGLLRESFYEAQHYGHEADFRMLPILKALRREIPVRIHAHRADDISSALR
FT                   FATEFNLDLRIEHCTEGHFIIEELSKHNLKVSVGPTLTRRSKIELKNKTWDTYHILSKN
FT                   GVEVSITTDHPYTPIQYLNLCAAVAVREGLDEKTALEGITIFPARNLRLEDRIGSIEVG
FT                   KDADLVLWTHHPFHYLAKPVLTMIDGKIIYKKNKKN"
FT   gene            complement(510938..511843)
FT                   /locus_tag="BAS0486"
FT   CDS_pept        complement(510938..511843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0486"
FT                   /product="cell division inhibitor-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52817"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52817.1"
FT                   /translation="MKIAISGGTGFIGTYLSTFFIQKGYTVYILTRKKTTETSHPNLQY
FT                   VQWTPDLQTFPLSSIDVVINLAGESINSRWTKKQKKIILNSRIQTTKGLIKQLQALPAK
FT                   PHTFINASAIGYYGTSETESFTEQHVTPGNDFLANTVYSWEQEASKARSLGIRTIYARF
FT                   GVILGPDGGALPKMLLPYQFYIGGTVGSGKQWLSWIHIDDVASMIDFIIHKKEIDGPLN
FT                   ITAPEPIRMKGFGETIATIMKKPHWLPVPSFMLHALLGEMSILVLEGQHVLPSKAIEHG
FT                   YQYTFPTIDHALQNILSHTM"
FT   gene            511925..512737
FT                   /locus_tag="BAS0487"
FT   CDS_pept        511925..512737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0487"
FT                   /product="recX domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52818"
FT                   /db_xref="GOA:Q81YW4"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81YW4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52818.1"
FT                   /translation="MAVITKIEVQKRSKERFNIYIDKGQGEEYGFSVNEVILIKHGLQK
FT                   GLEIDEIALGNILYNEEVQKAYLQAISYLSYQMRTKLEIEDFLRKKEVGQAIISEVVSK
FT                   LLHDRYINDKEYAILYTRTQSNVNRKGPTVIKRELLNKGVQDLIIMHSLQEYTKEKQIE
FT                   NALILIEKKKKSYQKHSFLQMKLKLDEMLVRKGYSRDVIQICLEELKDEKDDEKQQEAL
FT                   HYHGNKYYEKYKKYDGWTFENKMKQALYRKGFSIDEIEIFLQMKREEG"
FT   gene            512747..513064
FT                   /locus_tag="BAS0488"
FT   CDS_pept        512747..513064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0488"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52819"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52819.1"
FT                   /translation="MNMPKRYSEMTPYELREEIGVLKEQAIKAEQLGIVNEFDVLMRKI
FT                   AMARAYMTDINKFHIGETYELVEEPGILFEITYFNGVFAWGHKQNDNEEIGIPISLLQE
FT                   K"
FT   gene            513605..513871
FT                   /locus_tag="BAS0489"
FT   CDS_pept        513605..513871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0489"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52820"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52820.1"
FT                   /translation="MNDIYEALTKELLEKNDKLSYAQARAWVELLWEDFQTTYAKSGRY
FT                   QGEEMTEQVVRSWINNHGGRLHEMRTNNPKYSHLINQEDHLKH"
FT   gene            complement(513896..514876)
FT                   /locus_tag="BAS0490"
FT   CDS_pept        complement(513896..514876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0490"
FT                   /product="yfhP protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52821"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52821.1"
FT                   /translation="MDTATHLVMGVTLGSLATLDPAIAQSDIGPQAVMLATIAGSNIPD
FT                   IDTVLKLRNNAKYIRNHRGITHSIPAVILWSFLISGISFAFFSDAPYLHLLLWSFIAVF
FT                   LHVFVDIFNAYGTQALRPFTKKWVALGIINTFDTVIFFIHILAIACMLVGSHKGYTALA
FT                   AYILMIIYYIGRIIMHRNIRSVVHKRFKNVEKIIISPSYRFYHYHLAVVTADYYYVARW
FT                   HRGNIMIYDKFDRVPFPDNAIMRAAKQDENISAFLSFSPVYRWDIFDYDHYYEVRFIDL
FT                   RYRSKDYYPFVAIVQLDHNLNIISSYTGWIFSEEKLRKKLELLPH"
FT   gene            515026..516123
FT                   /locus_tag="BAS0491"
FT   CDS_pept        515026..516123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0491"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52822"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52822.1"
FT                   /translation="MTLEILNNFNIEQFQNDLIGWFEKEQRDLPWRKNKDPYRVWVSEI
FT                   MLQQTRVEAVKPYYANFMGKFPTLEALANADDEEVLKAWEGLGYYSRARNLHAAVKEVK
FT                   EVYGGIVPSDVKKIEKLKGVGPYTKGAILSIAYGIPEPAVDGNVVRVLSRILSVWDDIA
FT                   KPKTRKVFEEIVREIISAENPSYFNQGLMELGALICIPKNPACLLCPVREHCRGYAEGV
FT                   QKELPVKSKAKAPTMVPIVAGVLQTEDGRYVINKRPSTGLLANMWEFPNVELGEGIRNQ
FT                   KEQLIDYMKEKFELSISIEEYAMNVQHTFTHRTWDIFVFYGKVTGDIVETDTLKFVSKE
FT                   AFEQLPFSKSHRTIYENCVEKITMQ"
FT   gene            complement(516158..516445)
FT                   /locus_tag="BAS0492"
FT   CDS_pept        complement(516158..516445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0492"
FT                   /product="yfhS protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52823"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52823.1"
FT                   /translation="MKKFRIYLLLLIQTIENGGGNMYIGRDMTELTMVSKNEWKEDELA
FT                   YFHHSLQQILPYLNAEGQSIYKEIVIEIESRGGLQEGEASWTHGTKISYD"
FT   gene            516508..516795
FT                   /locus_tag="BAS0493"
FT   CDS_pept        516508..516795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0493"
FT                   /product="small acid-soluble spore protein, gamma-type"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52824"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52824.1"
FT                   /translation="MSKKQQGYNKATSGASIQSTNASYGTEFATETNVQAVKQANAQSE
FT                   AKKAQASGASIQSTNASYGTEFATETDVHAVKKQNAQSAAKQSQSSSSNQ"
FT   gene            516984..517244
FT                   /locus_tag="BAS0494"
FT   CDS_pept        516984..517244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0494"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52825"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52825.1"
FT                   /translation="MNDFDKLVGEQLETMDELLKLQAHLEKYQQIEMSEKDTCDKKELH
FT                   FIRQEIYRTELALKLLHEKFEEQTNSVIQSFETEKMISNLG"
FT   gene            517477..518007
FT                   /locus_tag="BAS0495"
FT   CDS_pept        517477..518007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0495"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52826"
FT                   /db_xref="GOA:Q81YV4"
FT                   /db_xref="InterPro:IPR007295"
FT                   /db_xref="InterPro:IPR016882"
FT                   /db_xref="InterPro:IPR035930"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81YV4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52826.1"
FT                   /translation="MGFPKEGEKVQIHSYKHNGSIHRMWKETTILKGTQSLVIGANDRT
FT                   VVTESDGRTWITREPAICYFHENYWFNVIGMLREEGVYYYCNLSSPFAYDSEALKYIDY
FT                   DLDIKVYPDMTYTLLDEDEYEKHSQIMQYPPVIDTILKRNVAQLTQWIHQRKGPFAPDF
FT                   VDMWYERYLMYRN"
FT   gene            518062..519822
FT                   /locus_tag="BAS0496"
FT   CDS_pept        518062..519822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0496"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52827"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52827.1"
FT                   /translation="MQGIKRYLQFVKPYRWLIAITIMIGLVKFGIPLIMPWLLKYIIDD
FT                   VIQGAGSLQDKTSQLVTAIGIAFFIFAVLRPPIEYYRQYFAQRIANTILYDLRKHIFGH
FT                   LQKLSLRYYSNTKTGEIISRVIHDVEQTKDFVITGLMNVWLDTATIAIAIIVMFSMNIK
FT                   LTFVALLILPIYVVAVKYFFGRLRKLTKERSQALATMQGYLHERIQGMQVTRSFALEEY
FT                   EGKQFEKRNNEFLTKALTHTSWTARTFSAVNTLTDLGPLLVIGFAAYEVIQGQLTLGTM
FT                   VAFVGYMDSLYSPLRRLVNSSTTLTQSFASMDRVFELLDEKYDIVNVPSAVQTKKLNGE
FT                   VIFDNVSFRYNADEKEILHNLSLTMLPGEKVALVGASGGGKSSLASLIPRFYDVSSGAV
FT                   YVDGIDVRKYDMRNLRSHIGIVLQDNLLFSDTIGANILYGNPKATEEEVIAAAKAAQIH
FT                   DFIIELPDGYDTVVGERGVKLSGGQRQRVAIARVFLKNPSLLILDEATPALDLENERYI
FT                   QEALQTLAADRTTIIIAHRLATITHVDTIIYIEDGEIKETGSHEELMKKRGYYYNLYQL
FT                   QHITETAPLA"
FT   gene            complement(519836..520924)
FT                   /locus_tag="BAS0497"
FT   CDS_pept        complement(519836..520924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0497"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52828"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52828.1"
FT                   /translation="MKLGARILKTGIAITLALFACILLNLPSPVFAGISAIFAVQPSVY
FT                   RSYLTALEQIQANVIGAVFAIAFATAFGHNPFIIGLTCILVIALTLQLRLENTISIALV
FT                   TVIAIMEYQGEDFFSFALLRFATIMVGIIAASLVNLVFMPPKYETKLYHRIVDNTEEIV
FT                   KWIRMNSRQASDFTTLKTDIDRMKEKMIKLNHYYLLYKEERSYTKKVQFAKIRKLVLFR
FT                   QMLATTSRALSTLKSLHRTENELRYMPEEFQESIQNELDSLTHYHEQVLLKFIGKAKKQ
FT                   QSVEMLDEVETGKQELIDIFMEYQNKDDEEAYKTWLHLFPLISAIINYSEEVEHLDLLV
FT                   DSFYTYHKPEAELKIDDKKEDE"
FT   gene            complement(521185..525621)
FT                   /locus_tag="BAS0498"
FT   CDS_pept        complement(521185..525621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0498"
FT                   /product="glutamate synthase, large subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52829"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52829.1"
FT                   /translation="MLNKTNTWTPSLFRDYKNAEHDACGIVSVMEKRKIPTKENIDLCI
FT                   QSLVKMNHRAGFINGEGDGIGIHIDVPKALWNEKLKSSGYNPTIVDHPHFIVGHFFLNK
FT                   NENIVDLKNHIRTQLNNENFAILFESDNVINSDALGPLGKQEEPLFWQVALIAENEVVN
FT                   IEQTLFSVTIKIEENEAIHVASLSRDHVVYKVLGAGDTLVAYYNDLQHPLIASTMTLGH
FT                   NRYSTNTLSNFFRVQPFSILGHNGEINTIAKLRDQAEMIHVPLTAGGSDSQDLNRTLET
FT                   LLVQYGYSLFEAMDILFPPIINEIKLYETHLQDLYTYIREAWGHFAQGPAGIISRYKDE
FT                   AVFSVDSLGLRPVWKVEIESSYIFSSEPGVVSPTEYVAEPKPLAPGEKVGLKWNEQDEL
FT                   VLYEHDDYQTQVYNRFKKKVDVTNYHLHLSIPKTKEIPDACDSMQVETKQYVAFGWDRE
FT                   HIQLLEQMATKGVEPIRSLGHDSPLAALDTDRRNIADFIKESVAVVTNPAIDRDREVEH
FT                   FSTRTILGERPSLLSDAKKPFVVEMLSPIILEGSVAQSIAQELHTITYEQLIELFNTHS
FT                   SIATISATFSQAETLQCALSRISSEAITAVNDGASLLLIDDADAHLNERLWIDPHLVTA
FT                   KVHQVLSENKLRRNCSLVIRSGALRSLHDIVTLHGLGADSINPYLLFATVNDGTKTPIT
FT                   NLYNALNKGLEKVISTIGIHELRGYGRLYSSIGLHEEIANILQITNFLGSNDLAFSLES
FT                   LAEDAQMRADDYNDPKVRIRKSFHIFPRIWKAIGDVAKGNSYDDYRDKLSELEENNPIA
FT                   IRHLIQTKETKHVIPTEEVSISIQNHDLPFIISSMSFGSQNEIAFRAYAEAADQLNMIS
FT                   LNGEGGEIKDMIGKYPHTRGQQVASGRFGVNAELLNSSNLIEIKIGQGAKPGEGGHLPG
FT                   SKVTAKIAEARNATIGSDLISPSNNHDIYSIEDLAQMITEIKTANQLAKVAVKVPVVPN
FT                   IGTIAVGIAKAGADFINISGFDGGTGAARIHALQHVGLPVEIGVKAAHNALLEANMRHN
FT                   VEIWADGGIRSVNDALKIMLLGANRIGFGTLSMIAIGCTTCRGCHLDTCHVGIATQIES
FT                   EAQAKEHGLRRFVPRELESAVAGLLHLFTTFGEELKRLTGNLGYTNLQEIVGRSDLLEQ
FT                   VRGKNLLNLCNLLQTIEHPSVIKTEHVLEKQFEPIHSPHPKELVGVGVEQRVMGGLESC
FT                   YRVRSKLYEDTKLEPLTLKYTNGSIPGNGLGAYNSENLFIHVNGGAQDGIGKTSFGGGI
FT                   YITKAKGKDGLYYNGSVGKGFGYGAQKGALYVQGNADARAGIRLSGADMIIGGRMTKPL
FT                   REKEQGNIGAYSNIKGFAFEYMTNGRALVLGDPGPWICAGMTGGVVYLRHDSSLGLTEQ
FT                   ALKRRIAKGANVTLQPISKNGVRDVNELLLDYIRVLNEHEQYEEVALLTPLLDDMQQQF
FT                   FEIIPKKEQADPSISTE"
FT   gene            complement(525821..527125)
FT                   /locus_tag="BAS0499"
FT   CDS_pept        complement(525821..527125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0499"
FT                   /product="glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52830"
FT                   /db_xref="GOA:Q81YV0"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="PDB:3L44"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81YV0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52830.1"
FT                   /translation="MVVKFTKSEALHKEALEHIVGGVNSPSRSFKAVGGGAPIAMERGK
FT                   GAYFWDVDGNKYIDYLAAYGPIITGHAHPHITKAITTAAENGVLYGTPTALEVKFAKML
FT                   KEAMPALDKVRFVNSGTEAVMTTIRVARAYTGRTKIMKFAGCYHGHSDLVLVAAGSGPS
FT                   TLGTPDSAGVPQSIAQEVITVPFNNVETLKEALDKWGHEVAAILVEPIVGNFGIVEPKP
FT                   GFLEKVNELVHEAGALVIYDEVITAFRFMYGGAQDLLGVTPDLTALGKVIGGGLPIGAY
FT                   GGKKEIMEQVAPLGPAYQAGTMAGNPASMASGIACLEVLQQEGLYEKLDELGAMLEKGI
FT                   LEQAAKHNIDITLNRLKGALTVYFTTNTIEDYDAAQDTDGEMFGKFFKLMLQEGVNLAP
FT                   SKYEAWFLTTEHTKEDIEYTIEAVGRAFAALADNK"
FT   gene            527247..528260
FT                   /locus_tag="BAS0500"
FT   CDS_pept        527247..528260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0500"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52831"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52831.1"
FT                   /translation="MKSVIEVQGLRKEFTAYSSRPGLKGAFRDLLNRNYKIVPAVNDVS
FT                   FTVKQGEMVGYIGENGAGKSTTIKMLTGILTPTSGDILVNGMNPHKQREEFVRTIGVVF
FT                   GQRSQLWWDIAVQESFRLLKKVYGVSDAQYKEHMEHVIETLDIGPLLDKPVRKLSLGQR
FT                   MRCELAAALIHNPPLLFLDEPTIGLDVLVKLKIREFLKEMNERYKTTILLTTHDITDIE
FT                   ALCERVIMLDEGNIMYDGSLNNLRTQWGAEKEIHFQFVAPVSYQALSMVMPDSHVVWSK
FT                   AKEENAWIAKIPNEEVIISMLISKVVQAFQIKDLKINEVSTEEIIRNIYEEGIKHG"
FT   gene            528253..529044
FT                   /locus_tag="BAS0501"
FT   CDS_pept        528253..529044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0501"
FT                   /product="ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52832"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52832.1"
FT                   /translation="MGKYIEMIRIRFLMMLAYRTNYYSGILIYTINIGAYYFLWQAIYS
FT                   GKENIESLSISQMTTYIAIAWMARAFYFNNIDREIAMEIQEGRVAVELIRPYNYLGMKV
FT                   MQGLGEGIFRFAFFSIPGMVIVTLLFSLQITTNFQTWLYFFLSLIFSFIINTQINLMTG
FT                   MLTFFLFNNSGIMYAKRVVIDLFSGLLLPISFYPLWAQKAMVFLPFQAISYIPSMIFSE
FT                   GIQGSKLYEALLFQVIWAIVLIIPIVLMWRTARKRLIVQGG"
FT   gene            529049..529834
FT                   /locus_tag="BAS0502"
FT   CDS_pept        529049..529834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0502"
FT                   /product="ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52833"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52833.1"
FT                   /translation="MIYIKLFLQYASQYIKTKLEYRGDFIVGLLSDLSLQAVNLIFILV
FT                   VFGHTQALKGWSREEVIFIYGFFLVPFAIFSAFFNIWDFNDRYIIKGEMDRILTRPIHS
FT                   LFQIILERMELESLIGAITGMIVMGYAAVELQLSFYWYDFFLFLLMVGGGALVYGGIFV
FT                   TLASLGFWSDAKSSIMPLMYNIGNYGRYPVNIYNRVIRFILTFVLPFAFVGVYPAAYFL
FT                   RKTEWNSYAFATPLVGVICFTIAITLWNQGVKRYRGAGN"
FT   gene            529907..530311
FT                   /locus_tag="BAS0503"
FT   CDS_pept        529907..530311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0503"
FT                   /product="potassium channel protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52834"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52834.1"
FT                   /translation="MLWGFILLIVAIAILRSVQLLWSSYSDSTRFFSLYNLATLFLIYT
FT                   TVLIAFGLSYVVLEEMGFAVLKEEGESLNAHSFQLVEICLYFSAVTLLSVGYGDISPIG
FT                   IGRWIAIGEALIGYTLPFAFVMRSVIDNEK"
FT   gene            530347..530811
FT                   /locus_tag="BAS0504"
FT   CDS_pept        530347..530811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0504"
FT                   /product="bacterioferritin comigratory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52835"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52835.1"
FT                   /translation="MITMVTVGEMAPEFTLEGSNGEQVRLADFRGKNVVLYFYPKDMTP
FT                   GCTTEACDFRDSYGLFQEKDTVILGVSPDPANRHLKFIEKHELPFTLLVDEDHKVAELY
FT                   DVWKLKKNFGKEYMGIERSTFLINKDGELVKEWRKVKVKGHIEDVLSYIN"
FT   gene            531103..531537
FT                   /locus_tag="BAS0505"
FT   CDS_pept        531103..531537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0505"
FT                   /product="transcriptional regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52836"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52836.1"
FT                   /translation="MTVVKEELKEALEMLKNTGVRITPQRHAILEYLVESMTHPTADDI
FT                   YKALEGKFPNMSVATVYNNLRVFKEVGLVKELTYGDASSRFDYVTSQHYHVICEKCGKI
FT                   VDFPYGGLEKLEEEAAKTTGFVINSHRLEIYGVCPECHKA"
FT   gene            complement(531736..532092)
FT                   /locus_tag="BAS0506"
FT   CDS_pept        complement(531736..532092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0506"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52837"
FT                   /db_xref="GOA:Q81YU3"
FT                   /db_xref="InterPro:IPR020912"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81YU3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52837.1"
FT                   /translation="MSIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMM
FT                   VGFLAVIASTVVYFWIGMLSTKTVQIICPSCDKPTKMLGRVDACMHCNQPLTMDRDLEG
FT                   KEFDEKYNKKSYKS"
FT   gene            532506..534014
FT                   /locus_tag="rRNA-16s-9"
FT   rRNA            532506..534014
FT                   /locus_tag="rRNA-16s-9"
FT                   /product="16S ribosomal RNA"
FT   gene            534183..537093
FT                   /locus_tag="rRNA-23s-9"
FT   rRNA            534183..537093
FT                   /locus_tag="rRNA-23s-9"
FT                   /product="23S ribosomal RNA"
FT   gene            537191..537309
FT                   /locus_tag="rRNA-5s-9"
FT   rRNA            537191..537309
FT                   /locus_tag="rRNA-5s-9"
FT                   /product="5S ribosomal RNA"
FT   gene            537315..537392
FT                   /locus_tag="tRNA-Asn-5"
FT   tRNA            537315..537392
FT                   /locus_tag="tRNA-Asn-5"
FT                   /product="tRNA-Asn"
FT   gene            537392..537486
FT                   /locus_tag="tRNA-Ser-6"
FT   tRNA            537392..537486
FT                   /locus_tag="tRNA-Ser-6"
FT                   /product="tRNA-Ser"
FT   gene            537501..537578
FT                   /locus_tag="tRNA-Glu-2"
FT   tRNA            537501..537578
FT                   /locus_tag="tRNA-Glu-2"
FT                   /product="tRNA-Glu"
FT   gene            537581..537659
FT                   /locus_tag="tRNA-Val-6"
FT   tRNA            537581..537659
FT                   /locus_tag="tRNA-Val-6"
FT                   /product="tRNA-Val"
FT   gene            537681..537760
FT                   /locus_tag="tRNA-Met-3"
FT   tRNA            537681..537760
FT                   /locus_tag="tRNA-Met-3"
FT                   /product="tRNA-Met"
FT   gene            537761..537839
FT                   /locus_tag="tRNA-Asp-6"
FT   tRNA            537761..537839
FT                   /locus_tag="tRNA-Asp-6"
FT                   /product="tRNA-Asp"
FT   gene            537846..537924
FT                   /locus_tag="tRNA-Phe-4"
FT   tRNA            537846..537924
FT                   /locus_tag="tRNA-Phe-4"
FT                   /product="tRNA-Phe"
FT   gene            537940..538018
FT                   /locus_tag="tRNA-Thr-4"
FT   tRNA            537940..538018
FT                   /locus_tag="tRNA-Thr-4"
FT                   /product="tRNA-Thr"
FT   gene            538026..538112
FT                   /locus_tag="tRNA-Tyr-1"
FT   tRNA            538026..538112
FT                   /locus_tag="tRNA-Tyr-1"
FT                   /product="tRNA-Tyr"
FT   gene            538117..538193
FT                   /locus_tag="tRNA-Trp-2"
FT   tRNA            538117..538193
FT                   /locus_tag="tRNA-Trp-2"
FT                   /product="tRNA-Trp"
FT   gene            538210..538288
FT                   /locus_tag="tRNA-His-2"
FT   tRNA            538210..538288
FT                   /locus_tag="tRNA-His-2"
FT                   /product="tRNA-His"
FT   gene            538349..538426
FT                   /locus_tag="tRNA-Gln-1"
FT   tRNA            538349..538426
FT                   /locus_tag="tRNA-Gln-1"
FT                   /product="tRNA-Gln"
FT   gene            538429..538506
FT                   /locus_tag="tRNA-Gly-8"
FT   tRNA            538429..538506
FT                   /locus_tag="tRNA-Gly-8"
FT                   /product="tRNA-Gly"
FT   gene            538518..538591
FT                   /locus_tag="tRNA-Cys-1"
FT   tRNA            538518..538591
FT                   /locus_tag="tRNA-Cys-1"
FT                   /product="tRNA-Cys"
FT   gene            538599..538686
FT                   /locus_tag="tRNA-Leu-5"
FT   tRNA            538599..538686
FT                   /locus_tag="tRNA-Leu-5"
FT                   /product="tRNA-Leu"
FT   gene            complement(538891..539211)
FT                   /locus_tag="BAS0509"
FT   CDS_pept        complement(538891..539211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0509"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52838"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52838.1"
FT                   /translation="MTHSNEKKPHGLKGIGEKLNPTIYQVRFMKLDEPIQFESFPELKK
FT                   LGDWLSTSTHMWACHSTMYKYNKEEFKKRFLEITNLTVDHVLISTGGVGFNFMSPGWRD
FT                   SL"
FT   gene            539564..540283
FT                   /locus_tag="BAS0510"
FT   CDS_pept        539564..540283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0510"
FT                   /product="conserved hypothetical protein TIGR01033"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52839"
FT                   /db_xref="GOA:Q81YU1"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026562"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81YU1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52839.1"
FT                   /translation="MGRKWNNIKDKKASKDANTSRIYAKFGREIYVAAKQGEPDPESNQ
FT                   ALRVVLERAKTYNVPRTIIDRAVEKAKGGSEENYDELRYEGFGPNGAMVIVDTLTNNVN
FT                   RTAADVRAAFSKNSGNMGVNGSVAYMFDATAVIGLEGKTSDEVLEILMEADVDARDILE
FT                   EEDAVIVYAEPDQFHAVQSALKDAGVEEFTVAELTMLAQNDVTLPEDAQAQFEKMVDAL
FT                   EDLEDVQQVYHNVDLGE"
FT   gene            540401..540895
FT                   /locus_tag="BAS0511"
FT   CDS_pept        540401..540895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0511"
FT                   /product="mutT/nudix family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52840"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52840.1"
FT                   /translation="MEYSLLLGGLHVEHKTPKHIVAVAGYLTNEKDEVLLAKVHWRADT
FT                   WELPGGQVEEGEALDQAVCREIKEETGLTVKPIGITGVYYNASMNILAVVFKVAYVSGE
FT                   IKIQHEEIQEAKFVALNEENIDEYITRPHMKSRTLDAMRSSHFIPYETWEVQPYNLIGR
FT                   L"
FT   gene            541382..542158
FT                   /locus_tag="BAS0512"
FT   CDS_pept        541382..542158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0512"
FT                   /product="penicillin-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52841"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52841.1"
FT                   /translation="MKERVLSRVNYHQKVALNPMTKFFYKAIILLLLLSFTLLFIGNVM
FT                   IEQSDISKLHVPAKLEVPESLTHAFIATEDKRFYHHNGLDYIAIIRASVENIKAGGVVQ
FT                   GGSTITQQLSKNAFLTNERTFSRKWKEIFYTKKIERTFTKDEILKLYVSNIYYGEGAWG
FT                   IEKAANLYFGKKVSQLTLAESAMMAAVVKAPAYYSPAQNYDKAVERRNVVLRLMEKEGY
FT                   INHDEYMQAVSEKLVIRHDIKTERSMLNHAREKAVS"
FT   gene            542340..542999
FT                   /locus_tag="BAS0513"
FT   CDS_pept        542340..542999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0513"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52842"
FT                   /db_xref="GOA:Q81YT8"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81YT8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52842.1"
FT                   /translation="MYMKSSNKLMALGIVFSIAVLIVIGTIVYSIINDKKDKGNEMFAY
FT                   STQQSLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGK
FT                   DSDLGAAAGEAIYKQDQDSFWIFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKIDVEQ
FT                   FKKDLHSKEIKEKVRKDSDRAQKLKVQGAPSVYVNGNLANPDFDSLKKAIDKELKK"
FT   gene            543114..543190
FT                   /locus_tag="tRNA-Gly-1"
FT   tRNA            543114..543190
FT                   /locus_tag="tRNA-Gly-1"
FT                   /product="tRNA-Gly"
FT   gene            543386..544528
FT                   /locus_tag="BAS0514"
FT   CDS_pept        543386..544528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0514"
FT                   /product="iron-sulfur cluster-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52843"
FT                   /db_xref="GOA:Q81YT7"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81YT7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52843.1"
FT                   /translation="MDFEQLKQDVIAYSKTIGIDKIGFASASPFEELKQRLIQQQQLNY
FT                   QSGFEEPDIEKRTNPQLLLSGAKSIIAIALAYPSKLKNAPLSKRGERRGIFCRASWGQD
FT                   YHLVLRDRLQKLEAYLIEKLPDIEVKSMVDTGELSDRAVSERAGIGWSGKNCSIITPEF
FT                   GSYVYLGEMITNVPFPPDQPIEDQCGSCTKCIDICPTGALIQGGQLDSKKCIAFLTQTK
FT                   GFLPEEYRDKIGNRIYGCDTCQTVCPKNKGMDFHNHPEMEPDPELVKPLLTPLLTISNR
FT                   DFKEKYGIMSGSWRGKKPLQRNAILALAHFKEASAIPDLIGVMKDDPRPVLRGTAAWAL
FT                   GKIGGDGVGEAIEKAMQREKDEEVLHEMNRGLELLAQKKE"
FT   gene            544573..545460
FT                   /locus_tag="BAS0515"
FT   CDS_pept        544573..545460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0515"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52844"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52844.1"
FT                   /translation="MVVKINIEKQVQQFLAYVTEKRTNVDGIAEDLLQIAKRKRLLFQK
FT                   RNADIVKATADVSFMRQLNNSNHQEIDYQIHFKYLIKHKELFYIEEEQLKRRVCLNNSQ
FT                   VIGDYAIEAPEAVGMSETLEREVTKEKYGSYQYNRLEAVKYAERWWDDRNPVYRNFPDN
FT                   CTNFISQCLHTGEVPMNGYPNIRKGWWQRENQWSWSWAVAHSFYWYLSGATTGLRAEAV
FT                   ERPEDLILGDVIAYDFEDDGRWNHTTIVVAKDADGMPLVNAHSANSRRRYWNYEDSSKY
FT                   TPQMKYKFFHIING"
FT   gene            545519..546007
FT                   /locus_tag="BAS0516"
FT   CDS_pept        545519..546007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0516"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52845"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52845.1"
FT                   /translation="MGVHVVLYQPEIPANTGNIARTCAATGTELHLIRPLGFSTDDKML
FT                   KRAGLDYWQHVKITYYDSIEEFYEKNKDGEFFYLTKYGEKAHTAFDYSKREKDYYFVFG
FT                   RETNGLPANVIEENFDHCLRIPMTDKVRSLNLSNTAAILIYEAFRQQNYPGLDLEIVY"
FT   gene            546135..548204
FT                   /locus_tag="BAS0517"
FT   CDS_pept        546135..548204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0517"
FT                   /product="sensory box/GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52846"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52846.1"
FT                   /translation="MKEQYSNQNTFLSMIDMDLIRRGLLHAIQDLVFIVKVIDDETFKY
FT                   IYVNKLGMDYAKLSEECYGKTFAEVLPEDTAEILQVQYAKVASEAKAHTFCDVVSLPKG
FT                   ELHYESSLNPVFDEEGVCQFIICITRDITAQIEEKMEIEEKQMLFKSLLEYNNDSIISI
FT                   DSIGRITYANPATYEIFGYRFEELNNKFIFEFINKEYEKDFQIIFKEAMQGRAKQIVSK
FT                   KYVHKEGYELYISLRTIPIIVNGEIVGVYIVTRDVTKQVLNEMRTEYLAYYDQLTGLMN
FT                   RISCTNKLNDFLNEKVAFAFIFIDLDEFHLINDTFGHKEGDKVLQKVTECLSSFQIPDM
FT                   HLFREHDDQFVMLIENITKERVEVFAKSIQKKISEHFVIEEEDVYLSASIGIVMAPTDG
FT                   EDEKILFQRVDAALEKAKEKGKGHYHFYGNGLDCEREKRFIIENQLHRAIEKNEFFLYY
FT                   QPQMNIETKKIASMEALIRWENKELGFVSPNQFIPLAERTGFIIKLDEWVINEVCRQIR
FT                   EWLNKGYEVVPIAVNISARHFRSITLIEMITRALHKYNVSAHLLAIEVTEGALIHKDIS
FT                   KRVLLQLKEQNLKIHLDDFGTGYSSLSYLKTYPIDTLKIDRSFMEGIHVDERDTNITAA
FT                   IIHLAHTLELDVIAEGVEKAEQIQFLKEKNVKFVQGYYYSRPLSKYDVENVYYK"
FT   gene            548596..550491
FT                   /locus_tag="BAS0518"
FT   CDS_pept        548596..550491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0518"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52847"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52847.1"
FT                   /translation="MDILKKIEQHREAEERLQWEGTFAEYLELVKERPWVAQTAHSRIY
FT                   NMIKDAGIEEVDGRRKYNFFSNQLFGLEDALERLVEEYFHPSAKRLDVRKRILLLMGPV
FT                   SGGKSTLVTMLKRGLETYSRTDRGAIFAIKGCPMHEDPLHLIPHHLRDDFFDEYGVRIE
FT                   GNLSPLNVMRLEQEYGSRIEDVVVERIFFSEDRRTGIGTFSPSDPKSQDIADLTGSLDF
FT                   STIAEYGSESDPRAYRFDGELNKANRGMMEFQEMLKCDEKFLWHLLSLTQEGNFKAGRF
FT                   ALISADELIVAHTNETEYRSFIANKKNEALHSRIIVMPVPYNLRVSEEEHIYEKMIRES
FT                   DVSDVHIAPHTLRVAAMFTILTRLKDPKRPDIDLIKKMRLYDGETVEGYNAIDVEELQR
FT                   EYQDEGMKGIDPRYVINRISSTIIRKEVPSINALDVLRSLKDGLDQHPSISNEDRERYM
FT                   NFISLARKEYDEIAKKEVQKAFVYSYEESAKTLMDNYLDNVEAYCNKSKLRDPLTGEEM
FT                   SPDEKLMRSIEEQIGISENAKKAFREEILIRISAYARKGKRFDYNSHERLREAIQKKLF
FT                   ADLKDIVKITTSTKTPDENQLKKINDVVARLIDEHGYNSSSANELLRYVGSLLNR"
FT   gene            550937..552112
FT                   /locus_tag="BAS0519"
FT   CDS_pept        550937..552112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0519"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52848"
FT                   /db_xref="GOA:Q81YT1"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="InterPro:IPR014230"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81YT1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52848.1"
FT                   /translation="MGEENQPNYTISQENWSLHRKGYDDQQRHQEKVQEAIKNNLPDLV
FT                   TEESIVMSNGKDVVKIPIRSLDEYKIRYNYDKNKHVGQGNGDSKVGDVVARDGSGGQKQ
FT                   KGPGKGQGAGDAAGEDYYEAEVSILELEQAFFKELELPNLKRKEMDENRIEHVEFNDIR
FT                   KTGLWGNIDKKRTMISAYKRNAMRGKASFHPIHQEDLKFRTWNEVLKPDSKAVVLAMMD
FT                   TSGSMGIWEKYMARSFFFWMTRFLRTKYETVDIEFIAHHTEAKVVPEEEFFSKGESGGT
FT                   ICSSVYKKALELIDNKYSPDRYNIYPFHFSDGDNLTSDNARCVKLVEELMKKCNMFGYG
FT                   EVNQYNRHSTLMSAYKNIKDENFRYYILKQKADVFHAMKSFFREESGEKMA"
FT   gene            552274..555486
FT                   /locus_tag="BAS0520"
FT   CDS_pept        552274..555486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0520"
FT                   /product="internalin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52849"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52849.1"
FT                   /translation="MLVAATLSLPFAVYATPILAATAATENMAVQSPKKHVFDAVIKAY
FT                   KDNSDEESYATVYIKDPKLTIENGKRIITATLKDSDFFDYLKVEDSKEPGVFHDVKVLS
FT                   EDKRKHGTKVIQFEVGELGKRYNMQMHILIPTLGYDKEFKIQFEVNMRTFVESDIEEDE
FT                   EEQIEDTQNIIRDKRLQQAINKNVLNRKDVNEPIFEEDLKEIKELNIYAGQGIESLKGL
FT                   EYMENLERITIQGSDVRNIAPISQLKRLKVVDLSFNKIENVEPLVNLEKLDILELQNNR
FT                   IADVTPLSQLKKVRTINLSGNKISDIKPLYNVSSLRKLYVSNNKITDFTGIEQLNKLGT
FT                   LGVGSNGLVNIEPISQMSGIVELNLEKNDIKDITSLSKLTGLQSLNLEENYVSDVSSLS
FT                   NLINLYELKLATNEIRDIRPIQELGKRIKIDAQRQKVFLDEAYMNEEVKIPVYDVNGTA
FT                   LQNIEWKSEGGSITNGVIKWNSLGEKMYEFKMDAGESKIRFQGRVIQNIVEKREESSNV
FT                   IQDMKLRQYMNKHNFERKNVNTPITKEDLLTVKALKITDGKKEGITDFSGLEFMTNVEE
FT                   LTLQNVNMKNAEFISSLRNLKSVDLSYNQIEDIKPLHSLEDLEKLNVSDNGIKNVPELF
FT                   KMQKLKTLDLSNNKLDNAALDGIHQLENLDALLVNNNEINNLDEISKVSKLNKLEMMSN
FT                   KVRDISPLASLKNLQWLNLSDNKIQDISTLSSMLDLLSLKLAGNEIRDVRPVIQLAQWI
FT                   TVDIKNQKIVLEDGQMNQEIQIPIYDLEGEIFEDIELKSTDGIVTDRGTVVWKTPGAKI
FT                   YSFSLNGNYHGLSLLFSGTVTQNIVAKEEPKEPVEEVEGSKEEPIKEAEGSKEEPKEPA
FT                   KEVEGSKEEPKEPAKEVEGSKEEVKEPAKEVEGPKEEVKEPTKEVEGPKEEVKEPTKEV
FT                   EGPKEEVKEPMKEVEGSKEEVKGPTKEAEGSKEEVKEPTTEVEGSKEVKEPGKEVEGSK
FT                   DAINQSAVAQETNVNNQVGKEKVVENQNMKENKPAVTKQEESKKSLGATGGQENTSTLL
FT                   SGLALVLSALSMFVFRKRLFKK"
FT   gene            555641..556507
FT                   /locus_tag="BAS0521"
FT   CDS_pept        555641..556507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0521"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52850"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52850.1"
FT                   /translation="MHVSSILKIEEVASFIASMNKDATQYVGYCGDEKEELLQTIIQDF
FT                   SHIGWEKSFVVTYENNKIIGVLGFDVDEVKKCADIWGPFIKAENWEEVALHMWKELIEK
FT                   VPFHIEKFYGFYHVENNNCARLMKKLHVKEQGRHSIFSLSHNTVEERSICNVEEALPKV
FT                   FGQFVALHNYVFPNTYYEGNEIIGRLSDTNKLFVSMKNEKLEGYVYVEVNPEFQEANIE
FT                   FIATAENSRRKGVGERLLQAAIQYIFSFQGMREIELCLNTNNDRAVKLYKKVGFEEKAC
FT                   LQHYIIE"
FT   gene            complement(556611..558161)
FT                   /locus_tag="BAS0522"
FT   CDS_pept        complement(556611..558161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0522"
FT                   /product="glycine betaine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52851"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52851.1"
FT                   /translation="MIKKENSVFYISILLTTLFIIWGITPASWIQGYDLQSVTSSLNSF
FT                   ILNKFGWFYSLLMTAMIILATYLAFSKYGSIRLGKDGEKPKYSYPSWLSMLFGAGMGIG
FT                   LLFYGIAEPISHFTDPLTGKAGTEESAKLAMQYSFFHWGLFPWALYAMVALTIAYFTFR
FT                   KQKGSTIGATVTPLFNRSKNSPIGKTVDILAVLATVFGIVPSVGIGAQQIAGGLSYLFP
FT                   SIHNTLLTQLVLIAIFAVLYLTSAQTGLDRGIKYLSNLNFSLTGILLVSFLLLGPTVFI
FT                   MKYFTSTLGSYIGALPSMGLNLGAFNEKSSSWIENWTIFYWGWWISWSPFVGTFIARIS
FT                   KGRTIKEFIFGVVLVPTLICTFWFAVFGGTAIHMEMFQSLGVADEIAKNGTEIGLFAVI
FT                   SHLPFSTFLTIIGLILVATFFVTSADSATFVVSMQTSNGSLSPKNSLKLIWGLTIAIIA
FT                   AILLQAGGLNALQIAAIIAALPFSIVVVLMVTSLFKELRKEDINSQTKEVPKKIKKVM"
FT   gene            558430..561327
FT                   /locus_tag="BAS0523"
FT   CDS_pept        558430..561327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0523"
FT                   /product="microbial collagenase,putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52852"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52852.1"
FT                   /translation="MNKKSKINKVMLSISTMALSLGAIQTHVSAEEKVPYNVLHSKPVG
FT                   IEKPVDEIGHVSKAEETLSFQERLKVGDFSQRPASITNKVTVKQVKESYSMADLNKMNN
FT                   QELVETLGSIKWHQITDLFQFNEDAKAFYKDKGKMQVVIDELAHRGSTFTKDDSKGIQT
FT                   FTEVLRSAFYLAFYNNELSELNERSFQDKCLPALKAIAKNPNFKLGTTEQDTVVSAYGK
FT                   LISNASSDVETVQYASNILKQYNDNFTTYVNDRMKGQAIYDIMQGIDYDIQSYLIEARK
FT                   EANETMWYGKVDGFINEINRIALLNEVTQENKWLVNNGIYFASRLGKFHSNPNKGLEVV
FT                   TQAMHMYPRLSEPYFVAVEQITTNYNGKDYSGNTVDLEKIRKEGKEQYLPKTYTFDDGS
FT                   IVFKTGDKVSEEKIKRLYWAAKEVKAQYHRVIGNDKALEPGNADDILTIVIYNSPEEYQ
FT                   LNRQLYGYETNNGGIYIEETGTFFTYERTPEQSIYSLEELFRHEFTHYLQGRYEVPGLF
FT                   GRGDMYQNERLTWFQEGNAEFFAGSTRTNNVVPRKSIISGLSSDPASRYTAERTLFAKY
FT                   GSWDFYNYSFALQSYLYTHQFETFDKIQDLIRANDVKNYDAYRENLSKDLKLNEEYQEY
FT                   MQHLIDNQDKYNVPEVADDYLAEHTPKSLTAVEKEITETLPMKDAKMTKHSSQFFNTFT
FT                   LEGTYTGSVTKGDSEDWNAMSKKVNEALEQLAQKEWSGYKTVTAYFVNYGVNSSNQFEY
FT                   DVVFHGIAKDDEENKAPTVNINGPYNGLVKEGIQFKSDGSKDEDGKIVSYLWDFGDGST
FT                   SAEVNPVHVYESEGSYKVALIVKDDKGKESKSEITVTVKGGSLTESEPNNRPEEANRIG
FT                   LNTTIKGSLIGGDHTDVYTFNVASAKNIDISVLNEYGIGMTWVLHHESDMQNYAAYGQA
FT                   NGNHIEANFNAKPGKYYLYVYKYDNGDGTYELSVK"
FT   gene            561574..562122
FT                   /locus_tag="BAS0524"
FT   CDS_pept        561574..562122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0524"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52853"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52853.1"
FT                   /translation="MVLFGYPLETIYLYGFIIATILTVIYIFFGDIFESIFSFGGGSVS
FT                   IVTLLLSFFAMLCGLSYIGEYLFSFNSILIFVAAFAISFIGVFIMKILILKPIAEAEQN
FT                   TVQRMDEFIGCKGEVITTIPTEGFGEVLISSQFGSNAIPAKTIGKKDISQGTEVIIEGV
FT                   QDGVLLVQNIAYSLKKPKL"
FT   gene            562135..563715
FT                   /locus_tag="BAS0525"
FT   CDS_pept        562135..563715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0525"
FT                   /product="SPFH domain/band 7 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52854"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52854.1"
FT                   /translation="MTIPLIIGGVLLAILILLILVFITKYRTVGPDEALIVTGNWLGGG
FT                   KNVVTTDDGKKIKIIRGGGTFVVPIMQRAEPLSLLNYKLEVGTRDTYTKQGVPVTVNGV
FT                   SIIKVGSTIEEVSTAAEQYLGKETEELKVEAKEVLEGHLRAILSSMTVEDAYSNREQFA
FT                   QKVHEVASTDLKKMGLRIVSFTIKEIMDKNGYLDALGQPQIATVKRDATIANAEREKEA
FT                   RIEKARAEKEAKEAEYQRDAQIAEAEKHKELKVQSYKREQEQARADADLSYELQQAKAQ
FT                   QGVTEEQMRVKIIEREKQIELEEKEIARREKQYDAEVKKKADADRYAVEQSAEAEKVKQ
FT                   IKKADADQYKIEAEARARAEEVRVEGLAKAEIEKAQGQAKAEVQKAQGTAEADVIRLKG
FT                   LAEAEAKQKIAEAFELYGQAAIMDMVLKMLPSYAKEVASPLSNIDKITVVDTGGGGKNS
FT                   GAGKIAGYATDLMATMQETLKASSGIDLKELLEGFAGKGAVQQLSSDKPVVSVVEDEKK
FT                   EVEKDKDKE"
FT   gene            563952..565928
FT                   /locus_tag="BAS0526"
FT   CDS_pept        563952..565928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0526"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52855"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52855.1"
FT                   /translation="MLQGKLRRSSLKAKLLVSFVIVLILPSIVIGWTSYQQAKTNFNET
FT                   ILQSAEDNVKILNNVINKEIDSKKVDAVYFTKLFNGVSYGTDQLQNVQNKLEEYNKLHP
FT                   EIEAIYTGSSTGQFIQSPSIQMPDGYNPTERDWYKEAAKKSGEVVITAPYKSSTTGNIV
FT                   ITIAKQNEDKSGVLGIDLIINDIVNTSKMVNIGKTGFVAIFDQSKHVIAHPTIKPGDKI
FT                   EEKVEKELYKQETGDFKFKLDGDDRNITFITNKQTGWKIAGIMPSKEIIEAANPIFYKT
FT                   LTVIGISLIIGGVLIYFIIASIISPLKQLVISSKKISEGDLTETITVHSKDEIGQLGES
FT                   FNEMAASLHHVISNINTSASHVAASSEELTASMKQTSEATEQITQAIEQVSSGAEIQTK
FT                   EVEEGATLLEEVTEGIQRVADSSSLVSTASMYTKKKAEDGGKLVEQTVNQMQLIHESVS
FT                   QSDKVIVLLDDKSKQIGAILEVIQHIAEQTNLLALNAAIEAARAGEQGRGFAIVADEVR
FT                   KLAEQSGQSSTEIGKLVKEIQFDIKETVSSMKLVGTEVQSGLVVANETKQSFAEILKST
FT                   DDTVVQIDNMVDVAKQMTVDARQVSASINEIAATIEENAASVQNIAGSSEEQLASVDEI
FT                   NAAAVHLSQMAEELQEMIGKFKV"
FT   gene            566080..567690
FT                   /locus_tag="BAS0527"
FT   CDS_pept        566080..567690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0527"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52856"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52856.1"
FT                   /translation="MVLKFKKLKLQPRITLTISALILVVLMLTSYLFYYILSETVEEQI
FT                   GKRALHVAKTVAAIPEIKEAFQTENPASIIQPIAERIRMDTEADFIVVGNKEGIRYAHP
FT                   ERDKIGEAMIGGDNKGVLLEGKSYVSKATGSLGPSLRGKVPIRNQENEIIGVVSVGFSM
FT                   DDIHGAVEVYGKRVFWITIIGLLIGVIGSIYLAGSIKRMMFGMEPEEISSLYEEHSTVI
FT                   QSVREGIIVIDQNGMISLVNQAAYDILALDEQRNIIGEFILDIIPNSTILDVLQTGEEQ
FT                   FDRQLNIKGQAVIANRLPIKVKNKVTGVVSSLRLKSEMDQLTAELSQTKQYTEALRAQT
FT                   HEYNNLLYTLSGLIQLELYEDALELIHKETAVYQDFVQFIMKRIQNPWLGGILIGFYNR
FT                   ARELKIEFMLDRESSLDKLSPPIESNYVVSILGNLITNAFEAIERNEEHDKKVRMFVTD
FT                   IGEEIVIEVEDSGQGIHDEVITSIFYKGFSTKEGEKRGYGLAKVKELVEDLNGSIAIEK
FT                   GDLGGALFIIALPKERGDL"
FT   gene            567690..568073
FT                   /locus_tag="BAS0528"
FT   CDS_pept        567690..568073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0528"
FT                   /product="two-component response regulator, citrate/malate,
FT                   N-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52857"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52857.1"
FT                   /translation="MGEEIEVLIVEDDIRIADIHRRFTEKIEGFKVIGTATTGEQAKEW
FT                   LDLVKPQLVLLDVYLPDMQGTELVTYIRHHLHDIDIIMITAASETDVVRHALRGGVTDY
FT                   IVKPLMFDRFKASLENYQKSLCS"
FT   gene            568064..568381
FT                   /locus_tag="BAS0529"
FT   CDS_pept        568064..568381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0529"
FT                   /product="two-component response regulator, citrate/malate,
FT                   C-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52858"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52858.1"
FT                   /translation="MQLKKNNKLSIEQIEHLWSQRGVKGNEIEYAPKGIDPLTLAKIKK
FT                   HMLTVNEEGITAEVLSSMVGVSRSTARRYLEYLISGKKVHAELIYGSVGRPERRYFLIP
FT                   S"
FT   gene            complement(568425..569729)
FT                   /locus_tag="BAS0530"
FT   CDS_pept        complement(568425..569729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0530"
FT                   /product="citrate transporter, CitM family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52859"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52859.1"
FT                   /translation="MLALLGFAMVFVFMFLIMKKRMSALVALILIPITFALIGGFYADM
FT                   GPMMLEGIQKLAPTGIMLMFAILYFGIMIDSGLFDPVISRILKFVKGDPLKIVVGTAIL
FT                   TIIVSLDGDGTTTYMITVSAMYPLYKRLGMNPLILAGVVMLGAGVTNLTPWGGPTARVM
FT                   SALGLDASELFTPLIPGMIAGALWVVFVAYYLGKKERKRLGIMDVQYLKQMQTTDEQAA
FT                   TVEAAVHKRPKLLWINFLLTATLLVCLILEVMPLPVLFTIAFAIAVMLNYPNLEQQKER
FT                   IASHAGNVLAVVSLVFAAGIFTGILSGTKMVDAMAKSVVTLIPDALGPQLPIITALLSM
FT                   PFTFFMSNDAFYFGVLPILTKAAATYGISAAEMGRASLLRQPVHLLSPLVASTYLLVGM
FT                   AKVDFGEHQRFTLLWAVGTTMVMLITGILIGVIPI"
FT   gene            569981..570235
FT                   /locus_tag="BAS0531"
FT   CDS_pept        569981..570235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0531"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52860"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52860.1"
FT                   /translation="MKTRMEEICSSYEGKVEEIFVNESSYVYEWEKLMMIRKNNGELEK
FT                   VAVGISGNIRLVNVVVGQQIHTDTLLVRLEDDLLITGCE"
FT   gene            570370..570873
FT                   /locus_tag="BAS0532"
FT   CDS_pept        570370..570873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0532"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52861"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52861.1"
FT                   /translation="MRTKYVMFAICLFFVFTIVGCGKKQAEAVAIDEKHDKCDICQIGV
FT                   MDNQFATEIILENGKALKFDDIGCMYKWMEINPGEKTKEKFVRDYDSKDWISLEDATYV
FT                   YDKTITTPMAYNVISFKNKKDAENFVSNYKGKVLSYKELAEHKWEMNKEMMGNQKKGNH
FT                   GGHH"
FT   gene            571337..572032
FT                   /locus_tag="BAS0533"
FT   CDS_pept        571337..572032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0533"
FT                   /product="ankyrin repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52862"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52862.1"
FT                   /translation="MKNEKKQEKHKEKEESKEEKSINLMDKQLLLSATLGDTETAMKLI
FT                   QDGANINVEGDNGETPVLAATYQNHVETVKALIGAGANIEIKDEKQSNPLLYASREGYT
FT                   DIVKVLINAGVNTKETTKLGGTALISASERGHVEVVKELLEHTDIDVNYKNARGGTALV
FT                   EAIVLGNGSENHKKVIQMLIDHGADVSMANKENITPLQFAEKRGFKDIANMLRAAGANE
FT                   VVEPQQPVE"
FT   gene            572591..573157
FT                   /locus_tag="BAS0534"
FT   CDS_pept        572591..573157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0534"
FT                   /product="glycerol uptake operon antiterminator regulatory
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52863"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52863.1"
FT                   /translation="MFKEPYIAMIKDWKGYNTYKKLPKTVFLMTGSMLELPERVYELQK
FT                   HGHDVFLHCDFIQGLNTNTEEALSYIQDVIGAQGIISTKGSTIRNANKIGLKTIQRISI
FT                   VDTLSLTKSIENCKTTKPNAVEIMPGIMPSIIKQLAEEIEFPIIAGGLIQTREDAEIAI
FT                   RSGASAISTSHYEVWIQEEKRSAIL"
FT   gene            573121..574251
FT                   /locus_tag="BAS0535"
FT   CDS_pept        573121..574251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0535"
FT                   /product="glycerol-3-phosphate ABC transporter, ATP-binding
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52864"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52864.1"
FT                   /translation="MDTRRKKECNLVIELKNVSKVYQNAEETAVKGVSVHIKKGEFFVL
FT                   VGPSGCGKSTLLRMIAGLEEISSGDLIINERVANDLEPKDRNLSMVFQNYALYPHLSVE
FT                   ENILFGLKVRKVQKEERQKRLMEAVEMVGLKEYVKMKPGQLSGGQRQRVALARAIVSQA
FT                   PICLMDEPLSNLDAKLRAQMRIEIREIQQRLGITMIYVTHDQIEAMTMGDRIMVLNKGS
FT                   VQQVGTPLDIYNKPANEFVASFIGSPSMNMNDGEVDEEKGVLHIGQLQIPLSIGQLKQL
FT                   PAGTVRVGMRPEHIALSEEGQEVTLQSVEVLGNESILNFVINGTTWSAKVIGQLLLNKG
FT                   DKVKLLFSEEKLCFFHQNTNERLKVVAEEELKVVAK"
FT   gene            574251..575183
FT                   /locus_tag="BAS0536"
FT   CDS_pept        574251..575183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0536"
FT                   /product="glycerol-3-phosphate ABC transporter, permease
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52865"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52865.1"
FT                   /translation="MIEVSKLPVQTKVSKKKNLWGRTKDLRIGLLFLAPSILLFSIFLF
FT                   YPLFRTIYYSFYLTDIHGEANLFVGLENYQYLFSNPAFYKSIKSTLLFVLYTVPTSIIF
FT                   ALFLALIANGKVRGIGLFRVLFSSTMGISVAASAVIWLFLFHPSVGLFNNILASMNLPA
FT                   IAWLTSPDWALFSVSVTTVWVNTGFAFLVILGGLQNIDTSLYESASIDGASYLYKLRRV
FT                   TLPMLSPTLFFIVTVTLISAFQSFGQIDILTHGGPNDATNLIVYSIYKEAFVNHQFGTA
FT                   SAQAMVLFVFIFIATLLQFKFAERKVHYK"
FT   gene            575180..576001
FT                   /locus_tag="BAS0537"
FT   CDS_pept        575180..576001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0537"
FT                   /product="glycerol-3-phosphate ABC transporter, permease
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52866"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52866.1"
FT                   /translation="MIVKQWKQNFLLYMLLIISAVMVFFPVLYAFLISFMTPDDIQMRR
FT                   IFPTQFTFDNFINIFQKVPLFAYLYNSLVVSTVVMIGQLIVSSLAAYAFVFLQFKGRNL
FT                   IFFLFISTMLIPWEATMVPNFLTIQNFGWINSFAGMTVPFFATAFGIFLLRQHFMTLPN
FT                   ELKEAAFIEGIGNVRFLFSVVIPYCKTSFITLGVYSFLTTWNMYLWPLLVTTDETVRTV
FT                   QIGVKQLQSQEVATDWGSVMAGVTVIVIPTLILLFLGQKQLQQGLTKGAIK"
FT   gene            576023..577399
FT                   /locus_tag="BAS0538"
FT   CDS_pept        576023..577399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0538"
FT                   /product="glycerol-3-phosphate ABC transporter,
FT                   glycerol-3-phosphate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52867"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52867.1"
FT                   /translation="MSLVKKGAALLMVATMALSSAACSNSKTEGKPEAQAKVAPVEKNG
FT                   DKTVIRFWHAMGGKTQGVLDGLVADYNKSQNKYEIKAEFQGTYEESLTKFKTMSATKEA
FT                   PALVQSSEITTKYMIDSKKITPIDSWIKKDKYDTSKLEKAITNYYSVDGKMYSMPFNSS
FT                   TPVLIYNKDAFAKAGLDPEKAPKTYAELQEAAKKLTIKEGGNVKQYGFSMLNYGWFFEE
FT                   LLATQGALYVDNENGRKDAAKKAVFNGKEGQKVFGMLDELNKAGALGKYGASWDDIRAA
FT                   FQSGQVAMYLDSSAGVRDLIDASKFNVGVSYIPYPEDSKQNGVVIGGASLWMTNMVSEE
FT                   TQQGAWDFMKYLTKPDVQAKWHTATGYFSINPDAYNEPLVKEQYEKYPQLKVTVDQLQA
FT                   TKQSPATQGALISVFPESRDAVVKALEAMYDGENSKEALDEAAKATDRAISISARTSQK
FT                   "
FT   gene            577815..578519
FT                   /locus_tag="BAS0539"
FT   CDS_pept        577815..578519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0539"
FT                   /product="serine/threonine phosphatase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52868"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52868.1"
FT                   /translation="MKRILVISDIHGEIEKFEQLLEEAQYDAKQDQLILLGDYVDRGPN
FT                   ARAVIEKVKELKEDGALVLKGNHEDMMIKALTTDEERSWNHWVKRNGGDKTLYSYGFVE
FT                   EDIMVNEKDFRKPILQSLVLEEHVKFIQKLDHYIETEEYIFVHAGVEPLKRVSECEPYT
FT                   LMWIRNEFHSEYSGEKVVVFGHTETKTLHGNDNCNVYFGNNRIIGIDGGAVYGGQLNCL
FT                   ELPSKKVYVVKS"
FT   gene            578669..579340
FT                   /locus_tag="BAS0540"
FT   CDS_pept        578669..579340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0540"
FT                   /product="DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52869"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52869.1"
FT                   /translation="MRLLVVEDNASLLESIVQILCDEFEVDTALNGEDGLFLALQNIYD
FT                   AILLDVMMPEMDGFEVIQKIRDEKIETPVLFLTARDSLEDRVKGLDFGGDDYIVKPFQA
FT                   PELKARIRALLRRSGSLTTKQTIRYKGIELFGKDKDVQVDGQSMKLTLKQYELLEYLVQ
FT                   NSGKILMREQIFDRVWGFDSDTTVAIVEVYVHHLRKKLEPFGYQKDIQTVRGIGYILKE
FT                   Q"
FT   gene            579337..580587
FT                   /locus_tag="BAS0541"
FT   CDS_pept        579337..580587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0541"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52870"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52870.1"
FT                   /translation="MKKGSMFQKTRIRLTILNSLVFIILIGVLGSIIYSYTYKRIYSGV
FT                   NESIEKAVQHRKNADDKKLPKKIRGYPPIGDPRIMELTWLGNTVEIDIENGKRRFIFED
FT                   NLEKFSPKKLGTLQDIEVQGRYFRIFAFQKDAKIVQIARDITAEKEMLHTLFLILVIGC
FT                   SIGSLCAIGIGFFLAGRALVPIQNSWEKQQQFVSDASHELRTPLAVIQSKTDILFQSPS
FT                   ATIEEKAMDISTISKECRRLSKLVANLLLLARSDSNQIEMDKKIFELDKLLEEIVEPYK
FT                   EIASYQEKEMILKVEYDISFMGDRERIHQMMVILLDNAMKYTNEGGHIQIDCTQTNSSI
FT                   RIRVKDDGIGVKGEDIPKLFDRFYQGDKARSASEGAGLGLSIANWIVEKHYGKISVESQ
FT                   WGEGTCFEVILPKNQRI"
FT   gene            580794..581615
FT                   /locus_tag="BAS0542"
FT   CDS_pept        580794..581615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52871"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52871.1"
FT                   /translation="MKKKMMMVFTIGVMSLSILGGASPSETSKGKTDYKQRSKEQLNNG
FT                   KIHAVHTEEKAEKLGIETTGKEQITLEKEIHETEVGREAKQLGISIEGKDVGTLSEEIY
FT                   ETKVEQEALKLGISIENTSIVNLINQINTIKINDEADKLGISTNGKEIEDIAEEIYGTK
FT                   VREEAGKLGISPKGKEIEVLAQEVYEQKVQEEAKEYHIDLYGKDIYQVLSEINEQKVLQ
FT                   MADELNMDKTNMNVQELAEKIKKDQPEKGKELNFVPVIRTDADAFYSYLTN"
FT   gene            581623..582375
FT                   /locus_tag="BAS0543"
FT   CDS_pept        581623..582375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0543"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52872"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52872.1"
FT                   /translation="MKVIRKFKWYICMALLGIAVWGIYTNGITKYVEKLTFFNIQSGKQ
FT                   VEFNRDEKVILSNVPFIQQLPELDRGCEVTSLAMMLQYAGITVDKMKLANEIKKVDFMN
FT                   DGVRGNPNEGFVGNIYTFSESGYGVYHGPLFQLAKKYLPNKAVDLTGKSIEELYKSVKA
FT                   GQPVVIITNATFAPLDEDEFTTWETNNGDVSITYNEHCVVLIGYDQESVYIRDPLKDSL
FT                   DVKVPREKFEQAWVQMGSQAISYVKRSK"
FT   gene            582629..584611
FT                   /locus_tag="BAS0544"
FT   CDS_pept        582629..584611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0544"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52873"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52873.1"
FT                   /translation="MQKIFNWVKCMSIKKKLIISFFLILTIPGLIIGGVSYQTAKTNFE
FT                   QQITGKAKENISILNTVISQNIEEKFVDAAYFADILTEDTYPNGQEEIVRTKLAQYIKL
FT                   HPEVEGIYIGTQTGKFIREPFIQMSDGYNPTDRDWYKEAHENKGKVIVTAPYQSASTKN
FT                   MVVTIAKEVKDGKGVIGINLNLDNILKISKMINIGEKGYAVILDQNKQIVSHPSRKPGA
FT                   KVTDPWIKPIYEDKQRNVAYTEKDDKKNLIFATNEKTGWKVVGVMFDEEITQAANPVFY
FT                   KTFIVIAIAIVFGSVLIYFITKSITRPLRKIADSAYKISKGDLTEKITIHSKDDIGKLG
FT                   NSFNEMSASLQDVITQISFSAEHVAASAEELTASVQQANDATDQITIAMEQVSGGAESQ
FT                   SQGVEEGAATLQQVNTAIQDVNGSAESISISSLHARERAKEGEDLVEQTATQMQSISRS
FT                   VSESDAIIKLLDEKSKQVGAISEAIQNIATQTNLLALNAAIEAARAGEQGRGFAIVADE
FT                   VRKLAEQSGESSGEIANLIAEIKADIEHTVKAMDNVNGEVQQGLDVVTKTKVSFTEILS
FT                   STTHIVSQVNEMVETTKRIAGDANEVTNAIDEIAAAAEENTASMQSVAASTEEQVNSME
FT                   EISSASQNLAEMAEELQAMTSKFKV"
FT   gene            584690..586294
FT                   /locus_tag="BAS0545"
FT   CDS_pept        584690..586294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0545"
FT                   /product="sensory box histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52874"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52874.1"
FT                   /translation="MKKRKRLWNLWKTITLLVCTVVIFSLLVTDILISHNVERTTEDSQ
FT                   AEKAKTIAHIVANDSIVIDGLIGKADTSAIQTYTNRILKNTGVQFIVVMDMNGIRKSHP
FT                   NPQKIGHHFIGGDEGPALKGKEHVSLAEGTLGISMRVFVPIFSETGEQLGAVAVGISAD
FT                   NVKERVKESRHIIYIGVGVGVLVGIIGAILLARHIKKSLFGLEPHRIAKILEERNTMLQ
FT                   SVKEGIIAVDKEARVTLINNEAKRLFKKSGLEEDFIGKDVELYMPNSRIKEVLQTGEVQ
FT                   LNEEQNIYGITIVTNRVPLYVKEEIVGAIATFRDKTEIRKLAEELTGIRLYAEALRAQS
FT                   HEFMNKMHVVLGLTHMKQYEELQKYISGMVSEHQYEIGGVMKRIKSPVFAGFLLGKLSY
FT                   AREKNIKLIISEDSYMPEIDDESITHELITIVGNLIDNALEAVTNCEKKRVEVKIQHED
FT                   ILTITVQDTGKGIQEKEIEELFTKGYSTKGDNRGYGLYLVKESIQRINGEIHMHSLVGK
FT                   GTTITIEIPKGRDERQI"
FT   gene            586291..586998
FT                   /locus_tag="BAS0546"
FT   CDS_pept        586291..586998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0546"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52875"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52875.1"
FT                   /translation="MIKVLIVEDDPMVAMLNTHYLEQVGGFELVQAVNSIKSAIEVLEE
FT                   SRIDLVLLDIFMPEETGFELLMYIRNQEKEIDIMMISAVHDMGSIKKALQYGVVDYLIK
FT                   PFTFERFKEALTIYREKLTFMKEQQKISQSELDSLILQKEKREPTVTKELPKGLTKQTL
FT                   QLIWQKIESLNGRVFTTDEMAQLVGISRVSIRKYVMFLTDIGVLENEMMYQHVGRPVSK
FT                   LRCVDQKKIEFYV"
FT   gene            587121..588467
FT                   /locus_tag="BAS0547"
FT   CDS_pept        587121..588467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0547"
FT                   /product="citrate cation symporter family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52876"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52876.1"
FT                   /translation="MGIQKNVEAVSFSEGNEVQRESFASKIMNVKIGVIPLPLYVVLAA
FT                   IIYGASVYNKLPADMIGGFAVIMIMGIFLGDIGMRIPILKNIGGPAILSLFIPSLLVFF
FT                   NWMNPASMEAATMLMKKSNFLYLYISCLVVGSILGMNRKVLVQGFVRMFIPLVVGTLAS
FT                   VAVGLLVGSLFGFEMKHTFFFIIVPIVSGGIGEGILPLSLAYSDILNESSATFVSQLIP
FT                   AAIIGNMFAIVSAGYMKRLGEKKPELSGNGVLVKTDNQAELLKEQNTEKPIDFSLMGAG
FT                   LLIACTFFIFGGFASKFIGIPGAIIMIFSAALVKYFKLMPAKMEQGAFHLYKFISKNLT
FT                   WPLMVGLGLLYIPLKDVAAVLSVGYVVVCASVVLTMVASGFLVGKVMKMYPVESAIVTG
FT                   CHSGLGGTGDVAILSASNRMELMPFAQISTRLGGAAMVVTATILLKMFS"
FT   gene            588527..589726
FT                   /locus_tag="BAS0548"
FT   CDS_pept        588527..589726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0548"
FT                   /product="malate dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52877"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52877.1"
FT                   /translation="MLANQINERSLLLHKELVGKIEITSKVEVNSADDLSLTYTPGVAE
FT                   SCKAIAADEETVYDYTARGNMVAVVSDGTAVLGLGNIGPKAAMPVMEGKSILFKKFANV
FT                   DAFPLCLGTTDVDEIVTLVKNLEPTFAGINLEDIAAPRCFEIEKRLKEETNIPVFHDDQ
FT                   HGTAIVVLAAVINALKVVSKQMDHVKIVINGAGSAGIAIGKLLLKAGAQHITLVSLEGI
FT                   VCEGEAWMNEAQIEVSKKTNREHVRGTLKEAIHQADIFIGVSAPNVLTKELVQMMNEKA
FT                   IVFAMANPIPEIFPEDALEAGAAVVGTGRSDYANQVNNVLAFPGIFRGALDVRATDITE
FT                   EMKLAAAYGIANIITDEERNANYVIPNPLDKRVVPSVAEAVAKAAIDSGVAQIMKIPSY
FT                   "
FT   gene            complement(590022..590546)
FT                   /locus_tag="BAS0549"
FT   CDS_pept        complement(590022..590546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0549"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52878"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52878.1"
FT                   /translation="MKKIGTMLLFSILIAGCTQAQPDLKKPKKEAIATSSTQVNAPSFF
FT                   HLSVLKDVNWEETPSFIQEKIPLKGIEEKIAMADSPIIANEKNEIMWYFLDPEMPTGKL
FT                   SIIALKQGSVTPTPLLFQQESSEPTWTTSNTIDSTTNELPLTMSLPSSGLWVLNIYVNE
FT                   KYYDQFVITAE"
FT   gene            complement(590662..591588)
FT                   /locus_tag="BAS0550"
FT   CDS_pept        complement(590662..591588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0550"
FT                   /product="transporter, EamA family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52879"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52879.1"
FT                   /translation="MNNSRRIGLIMIITGATLWGLSGPMIQWLFQHTNVSSVDFLTIRL
FT                   LLAGIFILSFLLIKKQNIFQIWKHPRYSIQLIIFSILGMLGAQYAFIETVHISNAVTAT
FT                   LFQFLGPVLITMYVAFEQRKSPAPIQLLAIITALTGTYFIITNGSIENIVLSKEAIIFG
FT                   LLTAIGFAFYTLHPASLIKECGTIVVIGWGMLIGGIALLICNRSFEWTQLSQTFTLKTF
FT                   SMLILIIISGTLSFLLYIGSLKYLAATETSILSSIEPLVAAIVSIAWLNESFGAYQLLG
FT                   GLCIVLSVIFLTMPQKENEATFSTEQI"
FT   gene            591709..593109
FT                   /locus_tag="BAS0551"
FT   CDS_pept        591709..593109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0551"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52880"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52880.1"
FT                   /translation="MLELTPNLNMNSKKALYVQLYEYIKKEIKDGTISAFTKLPAKRKL
FT                   AGYLQVSKNTIEAAYEQLLAEGYIESISRKGYFVCEFEQMMDVEGSEAEVEEIPFREGN
FT                   YTFDFTQTGVDTNTFPFTTYRKLINDVWQPHNNDLLFLGHPQGELSLREEIANYLYESR
FT                   GVRCSASQIVLGAGTQILVKLLFQLLKGSNYAVENPGYHRKMVVFEQGEKKVQMLSLDR
FT                   DGICMADLENSDANVVFVTPSHQFPYGMIMPITRRTQLLQWAKKEEDRYIIEDDYDSEF
FT                   RYSGRPIPALQGLDTDGKVIYMGTLSKALLPSLRMSYIVLPKNLIKKYQKEYLFYTQSV
FT                   SRMDQEVIRKFLNEGYWEKHIHKMRVVYRKKRDRLVFEIEKYFSNRVEVIGEDSGLHIL
FT                   LKVHNGMREEELIKAAAKYSIKIYPFSTYYKDDTAPENVVLLGFAILSEEEIAKAIQLL
FT                   HKAWFTRK"
FT   gene            complement(593143..593655)
FT                   /locus_tag="BAS0552"
FT   CDS_pept        complement(593143..593655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0552"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52881"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52881.1"
FT                   /translation="MDIHVLTKDEAEIYLELRVEGLKQNPEAFSSSYEDIINKECAIEY
FT                   KAQKLAQDENYTLGAFKDGKLIGVATLETKPYVKQEHKAKIGSVYVSPKARGLGAGKAL
FT                   IKECLELAKSLEVEQVMLDVVVGNDGAKKLYESLGFKTFGVQERSLKYNGQYWDEEHMV
FT                   LFLDENK"
FT   gene            complement(593802..595265)
FT                   /locus_tag="BAS0553"
FT   CDS_pept        complement(593802..595265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0553"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52882"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52882.1"
FT                   /translation="MSKLSLKIGTYFLILALCIETIAFVSFYKSISKMRIEEETLALLE
FT                   KGNRYSNKITRRAKWSAHAQEKKNIERTEYNKNPNRPIYPDFDIADEAEHLVESESISN
FT                   SDIAIIITDNNGKIISTSEPVTKAMQKQLTCKTEPIPKDGLIVEKNWKKSKFITTVSPI
FT                   HTTEFQGKLYMLLKTSFLENMLLKLMKQFLIISVLTIILTTISVFIFSRVITEPLIKMK
FT                   RATEKMSKLNKPIQLGIKRNDELGSLAKTIEDLSSELTYMKKERGEFLASVAHELLTPL
FT                   TYMKGYAKVAKRDSLTKEEREEYLQIIEDETDSVTDLVQDLFMLVQLEQHQFVIKKQKV
FT                   LLRPFLERMVEKTKTTLTNKQMQLHVYCKDDLEVCIDERRMEQVMLNLLHNAYQHSLEN
FT                   TTITIRVLAETNSFTISVQDEGEGIPEGDIPHIFDRFYRVDKSRTRATGGKGIGLAVAK
FT                   EIVELHNGSILVTSKLDVGTNFIIELPFE"
FT   gene            complement(595331..596002)
FT                   /locus_tag="BAS0554"
FT   CDS_pept        complement(595331..596002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0554"
FT                   /product="DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52883"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52883.1"
FT                   /translation="MVKILLVDDEERMLRLLDLFLSPRGYFCMKATSGLEALKLIEQKD
FT                   FDIILLDVMMPNMDGWDTCYQIRQISNVPIIMLTARNQNYDMVKGLTMGADDYITKPFD
FT                   EHVLVARIEAILRRTKKDGFVSFNGIEWDKTKHTVTVYDEKISLTPIEFSLLRLFLQNT
FT                   NRAYSRDDLIEKIWGYETDIEYRTIDSHIRNIRDKLRKKGFPVENYLETVYKVGYKWKS
FT                   E"
FT   gene            complement(596836..597342)
FT                   /locus_tag="BAS0555"
FT   CDS_pept        complement(596836..597342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0555"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52884"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52884.1"
FT                   /translation="MEIRLLTTEDAEIYLKVCMEGLTKNPEAFSSSYEDVLKHEDPVAA
FT                   MAKRLSNPDKYTLGVFKDKDLIGIATLETKPFIKQEHKAKIGSVFVSPKARGLGAGRAL
FT                   IKAIIENADKLHVEQLMLDVVVGNDAAKKLYESLGFQTYGVQERSLKHNGQYWDEEHMV
FT                   LFLND"
FT   gene            complement(597571..598377)
FT                   /locus_tag="BAS0556"
FT   CDS_pept        complement(597571..598377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0556"
FT                   /product="formate dehydrogenase accessory protein FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52885"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52885.1"
FT                   /translation="MGPTQETYTIVRYHSGTFSKQIDEIVTESPITIKLNGEEYVTVVC
FT                   TPNYIEDMVIGFLISEGIISSYKDVGELWVQKDNGIVHVTSSKVNPLYQNLYNKRYITS
FT                   CCGKGRQGFIFANDAAKAKNLHNIHVTITPEECFHLMNTLQQSSTTFRQTGGVHNTALC
FT                   DRNNILLSRMDIGRHNALDKIYGHCLRNDISVKGKIIAFSGRISSEILLKVSKIGCEIV
FT                   LSKSAPTKLALQLAHDLGITVVGFIRNESCNIYTHPHRIDGYQSNN"
FT   gene            598681..601617
FT                   /locus_tag="BAS0557"
FT   CDS_pept        598681..601617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0557"
FT                   /product="molybdopterin oxidoreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52886"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52886.1"
FT                   /translation="MAEQTVRVTVDGKEFSASGEKTILQLFNESNLEHPQICHVPEVDP
FT                   IQTCDTCIVEVDGKLMRACSTQIENGMHIERQSQRAKEAQTEAMDRILENHLLYCTVCD
FT                   NNNGNCKVHNTVHMMGIEEQKYPYEPKVSACEVDMSHPFYRYDPNQCIACGQCVEVCQN
FT                   LQVNETISIDWSLDRPRVIWDHGVSINDSSCVSCGQCVTVCPCNALMEKSMLGEAGFMT
FT                   GLKPDVLDPMIDFVKDVEPGYSSILAVSEVEAAMRKTKVNKTKTVCTFCGVGCSFEVWT
FT                   KDRHILKVQPVSDAPVNGISTCVKGKFGWDFVNSEDRITKPLIRQGDMFVEASWEEALE
FT                   VVASNMQHIKSAYGSDAFGFISSSKVTNEENYLMQKLARQIYGTNNVDNCSRYCQSPAT
FT                   DGLFKTVGMGGDAGTVKDIAEAGLVIIVGANPTEGHPVLATRVKRAHKLHEQKLIVADL
FT                   RKHEMAERADLFIHPRQGTDYVWLAGITKYIIDQDWHDKKFIAENVKNFDEYSKMVEKY
FT                   TLDYTEKITGISKENLKEMARMVYEADGTCVLWGMGVTQNTGGSTTSAAISNLLLVTGN
FT                   YRRPGAGAYPLRGHNNVQGACDMATLPNWLPGYQAVSDDTLRAKFEKAYGTTIPKAPGL
FT                   NNIAMLLAAEEGKLRGMYVMGEEMALVDSNANHVQHILANLDFLVVQDMFLSKTARFAD
FT                   VILPAAPSLEKEGTFTNTERRIQRLYEVLKPLGDSKPDWWILQKVARALGGDWNYESPS
FT                   EIMDEIASLAPLYSQATYDRLEGWNSLCWGSHDGSDTPLLYVDGFNFPDKLARLSLDEW
FT                   IPPVVAPDEYDLLLNNGRMLEHFHEGNMTNKSAGILSKVSEVFVEISPELAIERNVKDG
FT                   GLVELASPFGKIKVQALITDRVTGKELYLPMHATINEEAINILTGTATDLYTCTPAYKQ
FT                   TMVKMRVLREKGNRPLPPSNPRDKNRNPQNGVEIEQKWQRKQYVSLVD"
FT   gene            601768..602112
FT                   /locus_tag="BAS0558"
FT   CDS_pept        601768..602112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0558"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52887"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52887.1"
FT                   /translation="MQKAGILDAAISLLAAKEDVSKIAVEQLNREPVKNALNNMMGAGE
FT                   ALSSVDPEVTKQITSSLVTGLQFATDELNSGKKTKVMDFFKVLKDPDINRAITFGFSFL
FT                   KAFGQGLEKK"
FT   gene            602269..604140
FT                   /locus_tag="BAS0560"
FT   CDS_pept        602269..604140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0560"
FT                   /product="glycerophosphoryl diester phosphodiesterase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52888"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52888.1"
FT                   /translation="MQHRKRLSIPGVMGHSFQTVKFAFWNVLTFQLAYKLLAAIVFVPL
FT                   FGIIFNKLLYFGGYANATNDELLAFLKTPYGILAIVILSLLALFLIFTEFAVLIIISYF
FT                   AHKRQKVRLRPILYKTVTYLPTLFTYCLPGFILYAVVLLPLLNMGYETALIPQIQIPNF
FT                   ITGELFKTTMGQVGYYTFFAVVAYLNLRWIFVLPIVVLEQKPFRVAARKSAKLVKESFF
FT                   KVLFFLVGFFISIGIVYVLFLGIYLLCLWGVYEFTNPKGTFALLAESTMSVFLTSTLYL
FT                   FSFIVTPFYIMAITRLYLQKVPVEDVLLEEGLDYSKTKADKCFFQKHRWKFIGVYIVGI
FT                   ITAGMVVAFIVTFITNTYKEPIIMAHRGYISKGVENTKEALQGAIDAKADYAEIDVLQT
FT                   KDGELAVIHDLKLKRLANANVHVSDLTMDELRQLTLSQDGFSGQISTLDEIIKLAKGKI
FT                   KLNIEVKLHGGEKDFVNKVLKTIKDNEFEKQCVIQTLHYPLIKEFKRANPNIKVGYILY
FT                   ASRAHLKNVKADFYVAEEYMLNKKLVKEARKLNKPIYVWTVNDMESLKGYYKLNVDGII
FT                   TDYPEDARETIKMLKEQEEEESDLFDKITETTDDLFSKLFISYPAAS"
FT   gene            604508..605641
FT                   /locus_tag="BAS0561"
FT   CDS_pept        604508..605641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0561"
FT                   /product="alanine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52889"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52889.1"
FT                   /translation="MRIGVPAEIKNNENRVAMTPAGVVHLIRNNHEVFIQKGAGLGSGF
FT                   TDAQYVEAGAKIVDTAEEAWNMEMVMKVKEPIESEYKHFSEGLILFTYLHLAPEPELTK
FT                   ALIEKKVVSIAYETVQLENRSLPLLAPMSEVAGRMAAQIGAQFLEKNKGGKGILLAGVP
FT                   GVKRGKVTIIGGGQAGTNAAKIAVGLGADVTIIDLSAERLRQLDDIFGNQVKTLMSNPY
FT                   NIAEAVKESDLVIGAVLIPGAKAPKLVTEEMIKSMEPGSVVVDIAIDQGGIFETTDRIT
FT                   THDNPTYEKHGVVHYAVANMPGAVPRTSTLALTNVTVPYAVQIANKGYKEACLGNSALL
FT                   KGINTLDGYVTFEAVAEAHGVEYKGAKELLEAETVSC"
FT   gene            605745..607160
FT                   /locus_tag="BAS0562"
FT   CDS_pept        605745..607160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0562"
FT                   /product="amino acid permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52890"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52890.1"
FT                   /translation="MANLFKKKSVTQLLGESKSKTLTKTLGAFDLTMLGIGAIIGTGVL
FT                   VLTGLVAARDAGPAVIFSFMIAAIVCGFAALCYAEVASTLPVSGSVYTYSYATIGEFIA
FT                   HLMGWTLLSVYVVTTAAVAGGWTGYFNNLVSGFGLEIPTELLKIPSQGGIVNLPAVVIT
FT                   LVLTWLLSRGTKESKRVNNIMVLIKIGIVILFIAVGAFYVQPENWTPFAPYGISGIFAG
FT                   GAAVFFAFLGFDALATSAEEVKNPQRDLPIGIIASLVICTIIYVVVCLVMTGMVSYKEL
FT                   DVPEAMAYVLEVVGQDKVAGVIAVGAVIGIMAVIFAYIYATTRVFFAMSRDGLLPKSFA
FT                   KINKKTEAPVFSTWLTGIGSALIAGFIDLKELSNLANIGALLTFAMVGVSVIILRKTHP
FT                   NLKRGFMVPLVPTLPLISIACCLFLMFNLPLTTWIYFGIWLAIGVVVYFVYSKKHSHLK
FT                   DDGSSQDNLEQAN"
FT   gene            607427..607804
FT                   /locus_tag="BAS0563"
FT   CDS_pept        607427..607804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0563"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52891"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52891.1"
FT                   /translation="MAGNKVETPQETCSQTIIHEEVVDQVKQTIPTDESLSKVAELFKV
FT                   LGDRTRTRILHALFEAEMCVCDLAYLLGMTQSSISHQLRVLKQAKLVKNRKEGKVVYYS
FT                   LADQHVIHIFEQAFEHVNEEE"
FT   gene            607829..610195
FT                   /locus_tag="BAS0564"
FT   CDS_pept        607829..610195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0564"
FT                   /product="heavy metal-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52892"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52892.1"
FT                   /translation="MAEALVKKKLMLEGLDCANCAMKIEKGVGNIEGVNSCSVNFATKT
FT                   MVLETAQNKESEVVTEAKKLVTKLEPHIKVQEEKNTKVAKEVFILEGLDCANCAMKIEN
FT                   KVKEMPTVSAATVDFVSKKLRVEVANKRELEATVANITNVVQKLEPDVKVVREEKGGHD
FT                   HGHSHDHGEANVKKMVGRLVVGGILTAIAALAGLPQMITIPLFVLAYLLIGGDIVWRAV
FT                   RNITRGQVFDENFLMAIATLGAFAIQQYPEAVAVMLFYQVGELFQSIAVNRSRKSITSL
FT                   MDIRPDYANVKIGNETKQVSPEDVQIGDYIIVKPGEKVPLDGKVVEGTSMVDTSALTGE
FT                   SVPREVEVGNDVLSGFVNQNGVLTIEVTKEFGESTVSKILDLVQNASSKKAPTENFITK
FT                   FARYYTPVVVITAAIMAFIPPLILEGATFSDWIYRALVFLVISCPCALVVSIPLGFFGG
FT                   IGGASKSGVLVKGSNYLEALNDVKYIVFDKTGTLTKGVFKVTKMEPSEGITNEELLEYA
FT                   AFAEVYSNHPIAQSIRNAYRKSIDEKIIDDYNEISGHGTVVKVQGKEIFAGNAKLMRKE
FT                   NITFKQPETVGTLVHVAVDGKYAGYIVISDEVKEDSKQAIQKLKELGIKKTVMLTGDAK
FT                   LVGEAVGKELGLDEVHAELLPQQKVEEIEKIDAAKHGKEKVAFVGDGINDTPVLARADV
FT                   GIAMGGLGSDAAIEAADIVIMTDEPSKIATAVNIAKRTRRIVWQNIIFALGVKGLVLLL
FT                   GAFGIATMWEAVFSDVGVTLLAVLNAMRVLRVKDL"
FT   gene            complement(610399..611862)
FT                   /locus_tag="BAS0565"
FT   CDS_pept        complement(610399..611862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0565"
FT                   /product="nicotinate phosphoribosyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52893"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52893.1"
FT                   /translation="MTYYKDDSYALHTDLYQINMAYTYWKDGIHNRRSVFDLYFRKLPF
FT                   ENGYAVFAGLEKIVEYIENFSFTESDIAYLAELQFEEEFLHYLQNMKFTGTVRSMQEGE
FT                   VVFNNEPLLRVDAPLGEAQIIETALLNIVNYQTLIATKAARMKHAANNDELLEFGTRRA
FT                   HEFDAALWGTRAAFIGGFSSTSNVRAGKRFGIPVAGTHAHSFVQAYRDEYVAFKKYAET
FT                   HKKCVFLVDTYDTLKSGVPNAIRVAKEFGDRIDFYGIRLDSGDMAYLSKKARKLLDEAG
FT                   FTNTKIIASSDLDEYTIMHLKSQGAKINVWGVGTKLITSFEQPALGAVYKLVAIEDTDG
FT                   KLNDTIKISSNPEKITTPGLKRIYRIINRVNDHAEGDYIALDYEEPGKEERLKMFHPVH
FT                   TYISKFVTNFEARELHKDIFVNGERTYELPSILDIQKYNEQSLSLFWEEYMRTLNPEEY
FT                   PVDLSQECWDHKMNYIQTVREQVEKNIQK"
FT   gene            612063..613331
FT                   /locus_tag="BAS0566"
FT   CDS_pept        612063..613331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0566"
FT                   /product="transcriptional regulator/TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52894"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52894.1"
FT                   /translation="MQQTLEKIGKQVFYKRLQQKMTQEELCQGICSVSYLSKIENGKIE
FT                   ASEEILQLLCTRLEIAVTDLRDVEEDVKGKLDEWLNALVHLDKPQVERIYEELQSEMKH
FT                   VLDFEIINYYKLLYTRYLIMKRDIATLEEELDRLKKVYKKYSPFQKLLYMYSRGLLCCL
FT                   QYRWKEGLDYLLKTEVMAKEQGYHETGLYYNIALVYTHLDIHHLAIHFVNIALEGFRSE
FT                   YKFRNIINCQILIAVSYTEKGQYEEALKMYESILRESASFADKDVLLAITLSNMGSIYY
FT                   KKGKYQQAKKYYLDSLQLQKQIDLNYLDTIYEMAVVCIKLEELEEAKALIDKGIDAAKQ
FT                   EERFNAKLYLLLMLRYKYFEEAKDYKAFLENEAIPLYKSAGNKIELKKVYIELAEHFSS
FT                   LSRFEESNRYYRLVIDLMNDKEE"
FT   gene            613632..615332
FT                   /locus_tag="BAS0567"
FT   CDS_pept        613632..615332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0567"
FT                   /product="neutral protease"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52895"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52895.1"
FT                   /translation="MKKKSLALVLATGMAVTTFGGTGSAFADSKNVLSTKKYNETVQSP
FT                   EFISGDLTEATGKKAESVVFDYLNAAKGDYKLGEKSAQDSFKVKQAKKDAVTDSTVLRL
FT                   QQVYEGVPVWGSTQVAHVSKDGSLKVLSGTVAPDLDKKEKLKNKNKIEGAKAIEIAQKD
FT                   LGVTPKYEVEPKADLYVYQNGEETTYAYVVNLNFLEPSPGNYYYFIEADSGKVLNKYNK
FT                   LDHVANEDKSPVKQEAPKQEAKPAVKPVTGTNAVGTGKGVLGDTKSLNTTLSASSYYLQ
FT                   DNTRGATIFTYDAKNRSTLPGTLWVDADNVFNAAYDAAAVDAHYYAGRTYDYYKATFNR
FT                   NSINDAGAPLKSTVHYGSRYNNAFWNGSQMVYGDGDGVTFTSLSGGIDVIGHELTHAVT
FT                   EYSSDLIYQNESGALNEAISDVFGTLVEYYDNRNPDWEIGEDIYTPGKAGDALRSMSDP
FT                   TKYGDPDHYSKRYTGTGDNGGVHTNSGIINKAAYLLANGGTHYGVTVNGIGKDKVGAIY
FT                   YRANTQYFTQSTTFSQARAGLVQAAADLYGASSAEVAAVKQSYSAVGVN"
FT   gene            complement(615395..615943)
FT                   /locus_tag="BAS0568"
FT   CDS_pept        complement(615395..615943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0568"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52896"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52896.1"
FT                   /translation="MAETIQNFLTDYYSIAIPLSILINIIISLLGFIPSIFLTAINIQL
FT                   FGVTNGTIISIAGEALGAIISFYIYRIGLQKFTHSKVNKYPKVERLLYVKGKEAFLLVL
FT                   SFRLIPFIPSSIVTLFAALGKMSLLSFSIASTIGKIPALLIEVYSAYHVINGTNEAKWI
FT                   VTIAGAIGLFYLWKKWRKK"
FT   gene            616319..616840
FT                   /locus_tag="BAS0569"
FT   CDS_pept        616319..616840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0569"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52897"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52897.1"
FT                   /translation="MMKRISSLFLSSLLALMLILSGCAGKEQKTEKQTGNQSTSVEKIS
FT                   DNILDEMEGPPKNGHTIERHVGKSEEDLKNRLKTDKVSAASTYYDKETATKAVKDSLKQ
FT                   HDKEIQDWLKNSKEARLVLNTTHSFPVGKTVIKKNMNVKDKLVKTVTVLARDKSGDLGY
FT                   KIITSYPSDK"
FT   gene            616856..617128
FT                   /locus_tag="BAS0570"
FT   CDS_pept        616856..617128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52898"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52898.1"
FT                   /translation="MYTTLQYFLKSYCTLSIHEDEIVGVMEEFIEQEDEEIVLKLRDEL
FT                   LYMKKKDAWEEACVLAARQGNRMWSLEETKDHLTTFLVLLQKKKA"
FT   gene            complement(617177..618439)
FT                   /locus_tag="BAS0571"
FT   CDS_pept        complement(617177..618439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0571"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52899"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52899.1"
FT                   /translation="MKLSKILIGSAIAGGILLCVGGVSGYQYVSKLNNQLDTTALPNTT
FT                   FEGISLDGKNKKDIQAIINQKITELDQKSLTYIFQNDKQTYTWKDLGINYKEKDIIDKI
FT                   FKEQEGNAINRYKMRKQAENGELKRDYKLTPQLNTTAYESFMKDKYNKTLKNPVNAELS
FT                   IEGTTVNISQSQNGEKIDKGKLTDLTKQAITSGTSDITLPVTLLKPERSTEDIQKMGIK
FT                   EVIAEYSTPMAGRNGNQSFNVNKSANTLSGVIVAPDETFSFNGRVGVTDAAHGYKSAAV
FT                   YSQGKVIQSAGGGVCQVSSTLYSAALRADLGIVSRSNHSMPVNYLPLGQDAAVADYGPD
FT                   LKFKNNTGNHIYIQAFSNGGSITTRIFGTNTGKNVEVSSQVISRTNDKITAVTYKKVTQ
FT                   NGEVISNGQISKSVYKSAPKQ"
FT   gene            complement(618674..619687)
FT                   /locus_tag="BAS0572"
FT   CDS_pept        complement(618674..619687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0572"
FT                   /product="transcription antiterminator, LytR family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52900"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52900.1"
FT                   /translation="MKSDMNKDTRAKKGRSKKKRLLWFLLIPLLIIALGAGGYSFHIYS
FT                   KAKSILSNAYSELGRGDKSSKREKAVKPMTDNISILIMGVDESDIRDKNYGKATRTDAL
FT                   LLATINKNDKSVKLVSIPRDSRVYIKSREKYDKITHAHVFGGVDSTIDTVENFLDVPVD
FT                   YYVKFNFKSFIKIVDSLGGITVDVPVEFTEQNSKDEADAIHLKKGRQHLNGEEALALAR
FT                   TRHIDSDYMRGQRQQLVLEAIAEKALSLNSINKIGGLLDAVDKDLKTNLTFDDMMTIAK
FT                   NSMGSNLKMDKLQVEGTDKYIGGIYYYVPNEKSVNNISTTLQEHLGVTNKNEHKKL"
FT   gene            complement(619951..621129)
FT                   /locus_tag="BAS0573"
FT   CDS_pept        complement(619951..621129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0573"
FT                   /product="nucleoside transporter, NupC family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52901"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52901.1"
FT                   /translation="MKFITFFLGLIVVFFLAYIASNNKKHIKFKPIFIMLLIQLILTYL
FT                   LLNTEIGLILIRVISSLFTKLLEYAADGINFVFGGLANKGEMPFFLTVLLPIVFISVLI
FT                   GILQHFKILPFFIHWIGYFLSKINGLGKLESYNAIASAIVGQSEVFITVKKQLAQIPKH
FT                   RLYTLCASAMSTVSMSIVGAYMTMIEPKYVVTALVLNLFSGFIIVLIINPYDVKDDEDI
FT                   LEIKGEKQSFFEMLGEYILDGFRVAIVVGAMLIGFVALISCINDLFLIIFGITFQQLIG
FT                   YVFAPIAFLIGVPSSEIVAAGSIMATKLVTNEFVAMMDLSKISNSLSPRTVGIISVFLV
FT                   SFANFSSIGIISGAVKGLNEEQGNVVARFGLKLLYGATLVSILSAIIVSIML"
FT   gene            621221..621607
FT                   /locus_tag="BAS0574"
FT   CDS_pept        621221..621607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0574"
FT                   /product="glyoxylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52902"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52902.1"
FT                   /translation="MNISRVHHVAIICSNYEVSKDFYTRILGFKAINEVYRKERDSYKL
FT                   DLCVGKEYQIELFSFPNPPKRPSFPEAAGLRHLAFAVTNIEEAVQDLSQCGVETEAIRI
FT                   DEITGKKFVFFQDPDGLPLELYEV"
FT   gene            621715..622800
FT                   /locus_tag="BAS0575"
FT   CDS_pept        621715..622800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0575"
FT                   /product="CBS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52903"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52903.1"
FT                   /translation="MDILKLLMVAILIGLTAFFVAVEFAIIKVRSSRIDQLVSEKRRGA
FT                   LAAKKVTSNLDEYLSACQLGITITALGLGWLGEPTIKHLLEPLFLKLNLSPAIASTVSF
FT                   IIAFAVITFLHVVIGELAPKTFAIQRAEQVSLLLSKPLIYFYRIMYPFIWALNGSARLV
FT                   TGLFGLHPASEHEVAHSEEELRLILSESYESGEINQREFKYVNNIFEFDNRVAKEIMVP
FT                   RTEVIGLYEDEPFETHIKIIAQEKYTRYPVFGEDKDEIIGMVNVKDLFIRYMDGNRDEE
FT                   CSITPYTRPVIEVLENIPIHDLLLQMQRKHIPLAVLYDEYGGTAGIVTLEDILEEIVGE
FT                   IRDEYDEDEHPPIEHISEGGH"
FT   gene            622884..624317
FT                   /locus_tag="BAS0576"
FT   CDS_pept        622884..624317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0576"
FT                   /product="aspartate ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52904"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52904.1"
FT                   /translation="MIATKDIRIEKDFLGEKEVPSIAYYGVQTLRAVENFPITGYRIHP
FT                   SLITAMAIVKKAAALANMDTGYLAKDIGHEIAEAAQEIVDGKFHDQFIVDPIQGGAGTS
FT                   INMNTNEVIANRALERMGYEKGEYAKISPNTHVNMAQSTNDAFPTGIHIATLMRLEELL
FT                   ITMEELHAAFRAKAKEFDHVIKMGRTHLQDAVPIRLGQEFEAYSRVLARDIKRIKQSRQ
FT                   HLYEVNMGATAVGTGLNANPTYIEQVVKHLRTFSGFPLVGAEHLVDATQNTDAYTEVSA
FT                   ALKVCMMNMSKIANDLRIMASGPRVGLAEIQLPARQPGSSIMPGKVNPVMAEVINQVAF
FT                   QVIGNDHTICLASEAGQLELNVMEPVLVFNLIQSISIMNNGFRVFREYCIKGITANEEL
FT                   LKQYVEKSVGIITAVNPHIGYEAASRIAREAIETGKSVRELCLEHGVLTEEELDIILDP
FT                   FEMTHPEIAGASLLKDKKM"
FT   gene            complement(624357..625976)
FT                   /locus_tag="BAS0577"
FT   CDS_pept        complement(624357..625976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0577"
FT                   /product="L-lactate permease"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52905"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52905.1"
FT                   /translation="MSTWTQIYDPLNNIWLSALIAALPIFCFIICLVGFKMKGYMAGLY
FT                   SVIVAIILAIFVYKMPTTAAVASAGFGVLSGFYPICTIVIAAIFLYKLTVKTEQFNVIR
FT                   DSISSITNDQRLQVLLIAYSFGAFLEGAAGFGVPVAITAALLVGMGFNPLKAAGICLVA
FT                   NIAGGAMGAMGIPVTVPAQLTGIDALTVGRQAVYILPFISIVLPFLLVSMVDGFKGIKE
FT                   TWQGILVSGVSFAITQFVVTYFLGAELTNIFAAVVSMVALALFLRVWQPKSSAKEEKQE
FT                   EKESHTFNQILYAWSPFVFLTAFVTIFNLKPIKALFAPDGPLANLVFNIQFPGLHNQVI
FT                   KTAPITKADTPFAAIFKLDVFSSTTTAIVLAIIVSLIVYRVNGKMIKELMIETIKELKV
FT                   PVYTICSVIALAYVENYSGMSSTLGLAFSSTGNAFPILSPILGWIGVFITGSVVSSGSL
FT                   FAPLQAVTADQLNIVPSTLVSLNVVGGTIAKMVSPQSVAVACAAVGLVGKESALFKTVM
FT                   KYSLIFLAIISLLQLNAVFNIF"
FT   gene            626813..627100
FT                   /locus_tag="BAS0578"
FT   CDS_pept        626813..627100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0578"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52906"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52906.1"
FT                   /translation="MSQNQFECRISEEDVQMLRALAHPLRLRLVMELMQRGTCNVTQLQ
FT                   EVLEIPQSTVSQHLTKLKQNKVVRFERRGLEVYYQIHNDKVSEVVKTLFS"
FT   gene            627146..627394
FT                   /locus_tag="BAS0579"
FT   CDS_pept        627146..627394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0579"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52907"
FT                   /db_xref="GOA:Q81V87"
FT                   /db_xref="InterPro:IPR012610"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81V87"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52907.1"
FT                   /translation="MEYILKGKEKIERSVISKRRDSRMDVKRVKQILSSSSRIDVTYEG
FT                   VPVWIESCDEQSGVAQVYDVSNPGESVHVHVNALEEK"
FT   gene            complement(627435..628793)
FT                   /locus_tag="BAS0580"
FT   CDS_pept        complement(627435..628793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0580"
FT                   /product="proton/peptide symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52908"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52908.1"
FT                   /translation="MDAALKLDKAGEQQSPKKHPPGLYLLFLTEMWERFSYYGMRGLLV
FT                   LYLTTAAVSGGLGFDKAFAVQLYGTFTAAVYFMPIIGGWLTDHYITRRHAITLGGIIMA
FT                   IGNFVLFSMNTKTGLFLGLVLLVIGNGFFKPNISTLLGELYEENDSRRDSAFTIFYMGI
FT                   NVGAFFAPLICGFLAEDFFKTSVDGVMVMGYKYGFLAACIGMIIGQIVFNLLAPRYLGT
FT                   AGTTVIGKKTKNQPAVEKKPLTKQEKNRTWAIVILTCFVVFFWAGFEQAGSSLTLYTDK
FT                   FVDRTIFGWEIPTSWFQSVNPAFIVLLAPFVSMLWLKLSKSKRGDLKIPTKMAFGMILL
FT                   GIGYLVLTLAVLKTGSSEADITVKANLLFIVITYMFHTIGELFLSPIGLSMVSAIAPVK
FT                   LASLLMGVWLAGKLASFTQSLGYLEVFASIGIIVIVLGLVLLLFSKKVASMME"
FT   gene            complement(629175..630140)
FT                   /locus_tag="BAS0581"
FT   CDS_pept        complement(629175..630140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0581"
FT                   /product="iron compound ABC transporter, iron
FT                   compound-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52909"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52909.1"
FT                   /translation="MNFMRKKSFTVFVFSLAFSLLLSACGKSNTKEESKEDTKKEMIPV
FT                   EHAMGKTEVPANPKRVVILTNEGTEALLELGVKPVGAVKSWTGDPWYPHIKDKMKDVKV
FT                   VGDEGQVNVETIASLKPDLIIGNKMRHEKVYEQLKAIAPTVFSETLRGEWKDNFKFYAK
FT                   ALNKEKDGQKVLAAYDKRMKDLKAKLGDKVNQEISMVRFMPGDVRIYHGDTFSGVILKE
FT                   LGFKRPGDQNKNDFAERNVSKERISAMDGDVLFYFTFDKGNEKKGSELEKEYINDPLFK
FT                   NLNAVKNGKAYKVDDVIWNTAGGVMAANLLLDDIEKRFVK"
FT   gene            630295..631317
FT                   /locus_tag="BAS0582"
FT   CDS_pept        630295..631317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0582"
FT                   /product="iron compound ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52910"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52910.1"
FT                   /translation="MKGKRCMLLKTNRAKWIGLFVGIIAVITCIWGSIIFGYTNTSWKL
FT                   ALDAFFHFNGSNEHIIIQNVRLPRALIAASVGASLAIAGCLMQTLTKNPLASPDFIGLN
FT                   SGAAFFIVVAIVIFSVTSLSAFTWIAFLGAAIAAVLVFASSSLGKEGTTPLKLTLAGVA
FT                   ISALFSSLTQGLLVLNEKALEEVLFWLAGSVQGRKLEILQSVFPYLLIGWIASIMMTGK
FT                   VNTLMMGEDVAKGLGQRTILMKSFVLLIIVLLSGGSVAVAGPIGFIGIVTPHFARFLVG
FT                   VDHRWRVPYSGLLGAILLILADIAARYVIMPQEVPVGVMTAFIGAPFFIYIARKRGLSK
FT                   "
FT   gene            631314..632372
FT                   /locus_tag="BAS0583"
FT   CDS_pept        631314..632372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0583"
FT                   /product="iron compound ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52911"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52911.1"
FT                   /translation="MKKYIPFRIGKGELSFLMYKRACLVLFSLLVVLIGLFFASAGMGD
FT                   MKIAPYDVWQAITGNGDAMSNMVVNKFRMPRILIAILVGIALAVAGCILQGLVRNPLAS
FT                   PDIIGITGGASVAVVLFLAIFSDKNNALTVSIHYMPLAAFIGATIVALFVYLFAWRNDG
FT                   LSPISLVLIGVGFWALTKAATTLFMLLAPIYQASQANVWITGTVYGSSWQNVMVLAPWV
FT                   LILTVISFIAARHLNAQELGDDIAVGLGVPLTKSRIFMLLLSTALIGGAVAFAGGIGFV
FT                   GLMAPHISRRLVGSLYGALLPVAAIVGAILVLAADLIGRTVFTPLEIPAGVFTSAIGAP
FT                   YFIYLLYKSRNS"
FT   gene            632385..633206
FT                   /locus_tag="BAS0584"
FT   CDS_pept        632385..633206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0584"
FT                   /product="iron compound ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52912"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52912.1"
FT                   /translation="MQKALETKRLTLSYGETIIIDELNLEIPKGEITIFIGSNGCGKST
FT                   LLRSLARLLKPTTGDILLDNQAIQSMQTKQIARQMAILPQGPQAPEGLTVLQLVKQGRY
FT                   PYQTWLKQWSEKDEEMVQNALAATGMTEFAERDVHALSGGQRQRAWIAMTLAQDTDIIL
FT                   LDEPTTYLDMTHQIEVLDLLFELNETEQRTIVMVLHDLNLACRYADNIVAIQDKQIYAQ
FT                   GKPEEVVDEKLVRDVFRMECQISTDPLFGTPLCIPHGKGRRVRKEVAHAMR"
FT   gene            complement(633238..633969)
FT                   /locus_tag="BAS0585"
FT   CDS_pept        complement(633238..633969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0585"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52913"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52913.1"
FT                   /translation="MAFTESDVYNNEAFFKQYMKRRYRENSPNELLEKPAFFQLIGDVK
FT                   GKKILDLGCGDAKFGKELLEKDCHSYTGIEGSQLMYEKAKKQLENKNGIVHFLNLKDYT
FT                   YPPATFDLVTSRLALHYIEHLPIIFQNVYETLKTNGTFTFSVQHPVITSSFESLQTSGK
FT                   RTSWLVDDYFKTGKRVEPWIDQEVIKYHRTTEEYFTLLQQAGFTITNLKEATPNQTYFQ
FT                   SAEEYERRLRIPLFLLFSCRK"
FT   gene            634182..635372
FT                   /locus_tag="BAS0586"
FT   CDS_pept        634182..635372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0586"
FT                   /product="8-amino-7-oxononanoate synthase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0586"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52914"
FT                   /db_xref="GOA:Q81V80"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR010962"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81V80"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52914.1"
FT                   /translation="MSSKTLAKFLEENLEDLKSKGLYNVIDPLESSNGPIITIGGKEYI
FT                   NLSSNNYLGLATDSRLQEAAIGAIHKYGVGAGAVRTINGTLDLHIKLEETIAKFKHTEA
FT                   AIAYQSGFNCNMAAISAVMDKNDAILSDELNHASIIDGSRLSKAKIIVYKHSDMEDLRQ
FT                   KAIAAKESGLYNKLMVITDGVFSMDGDVAKLPEIVEIAEELDLMTYVDDAHGSGVLGKG
FT                   AGTVKHFGLSDKVDFQIGTLSKAIGVIGGYVAGKQNLIDWLKVRSRPFLFSTAVTPADA
FT                   AACMRSIEILMESTELHDRLWENGRYLKQGLKELGFNIGESETPITPCIIGDEVLTQEF
FT                   SKRLNEEGVYAKSIVFPTVAKGTGRVRNMPTAAHTKEMLDEAIRKYEKVGKEMGII"
FT   gene            635417..635692
FT                   /locus_tag="BAS0587"
FT   CDS_pept        635417..635692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0587"
FT                   /product="NAD dependent epimerase/dehydratase, N-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52915"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52915.1"
FT                   /translation="MKKILVTGSLGQIGSELVMKLRDVYGASNVIATDIRETDSEVVTS
FT                   GPFETLDVTDGQKLHDIAKRNEVDTIIHLAALLSATAEKIRYLHGI"
FT   gene            635695..636369
FT                   /locus_tag="BAS0588"
FT   CDS_pept        635695..636369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0588"
FT                   /product="NAD dependent epimerase/dehydratase, C-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0588"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52916"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52916.1"
FT                   /translation="MGGLVNALEAARELNCKFFTPSSIGAFGPSTPKDNTPQDTIQRPT
FT                   TMYGVNKVAGELLCDYYHQKFGVDTRGVRFPGLISYVAPPGGGTTDYAVEIYYEAIKKG
FT                   TYTSYIAEGTYMDMMYMPDALQAIISLMEADPSKLVHRNAFNITAMSFEPEQIAASIRK
FT                   HIPTFTMDYAVDPARQTIADSWPNSIDATAAMKEWGFKAEYDLDKMTTDMLVKLKKSSQ
FT                   LS"
FT   gene            636435..636857
FT                   /locus_tag="BAS0589"
FT   CDS_pept        636435..636857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0589"
FT                   /product="mutT/nudix family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52917"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52917.1"
FT                   /translation="MQRVDVVYALIHDEETDKILMVHNVEQNVWSLPGGAVEKGETLEE
FT                   ALVREVKEETGLTAVAGGLVAINEKFFEEPGNHALLFTFRAHVVKGELVAADEGEISAI
FT                   EWVDRAIANERFPFYDGGFDSLLEVAIPYKFQPETK"
FT   gene            complement(636897..638777)
FT                   /locus_tag="BAS0590"
FT   CDS_pept        complement(636897..638777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0590"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0590"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52918"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52918.1"
FT                   /translation="MRQIFSDKKIDASLFLQMENLMYALLKEDDAYLEYGYKAYYDEIE
FT                   KKVVISHFWDDRKEEDTVIGLKSEVFLKALGNKHYSDMTLIRSYAIELQESPLKKFLTQ
FT                   LFVLLEDLRVEEIVKNLRPGTKHVFKRRKEMYRNYFSSQNEINRVRNYHGDRLFCLCYL
FT                   SLTSDKYEMFNNEYFEQIEAILHETFQARNTEDIMYIVEKIRYRLEELLESDMLNNYFG
FT                   HAPLYLSVIADEKDSRPEKLTNDDTQIVDDENKNKMNESFSTWHRENKNNENENFLRFE
FT                   LESGTKTNMMGDTARESEDGDQALGSVQGTSQKSTQSNFDGADTEEARASHASSQNDGA
FT                   YGKYNVGASHTFKEARKSTPDEKKDYQAIKSVVNKDVKELKKIIEKTIENKTNANSDKY
FT                   YGRLRKKFLRIYTEKQPRMFYKKGQESQELDVAFQLLVDCSGSMYNKMEETKKSVVLFH
FT                   EALKSLKIPHAISGFWEDASSAKPEDKPNVIHEVVTYKNSTLPNVGPEIMQLREEEDNR
FT                   DGYIIRIVSEKLAKRPEKHKFLLVFTDGEPSALDYQQDGILDTHEAVKLARKSGMEVIG
FT                   IFIEEGEAKEATYQLMKNIYNHHFLVANHAEDLRLKIKPLLKKLLLKTIE"
FT   gene            complement(638781..639674)
FT                   /locus_tag="BAS0591"
FT   CDS_pept        complement(638781..639674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0591"
FT                   /product="NorQ protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0591"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52919"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52919.1"
FT                   /translation="MLEQFHIHADLKQQLSTIHEKNKQEAGENAHLIGTKIYKASDNSI
FT                   IEDAITALLLGKNILLKGPTGSGKTVLAETLSSLFQKPMHSINCSVDLDVEGILGYNTL
FT                   QTKDGASEVTFVNGPLMKAMKNGHFLYIDEINMAKPETLPLLHGALDYRKMITNPFTQE
FT                   VVYGDDEYRVIAAINEGYVGTSELNEALKNRFVIIEVPYIQGDTLKELLLAESKLKDVA
FT                   TIEKFVAFASDLMPLARDGRVSEEAASIRGIIDACDLGVYIPVMRAIERSIIAKLNDET
FT                   EQMTVRELAESYFFEG"
FT   gene            complement(639802..641331)
FT                   /locus_tag="BAS0592"
FT   CDS_pept        complement(639802..641331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0592"
FT                   /product="cardiolipin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52920"
FT                   /db_xref="GOA:Q81V75"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="InterPro:IPR030874"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81V75"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52920.1"
FT                   /translation="MKKPIIQLLLIFTIVSIVPFLLNTSYISLYTFVGVLWSITIVGIS
FT                   FVIFIENRSPQSTLAWFLVLALLPVVGVLLYSIFGRSRWRRKKHLHRSEEQRKLFREIL
FT                   EGRRLELSLKVPLSERSVHLTEVVQKFGGGPAADRTTTKLLTNGDQTFSEILQAIEQAK
FT                   HHIHIQYYIYKSDEIGTKVRDALIKKAKDGVIVRFLYDGLGSNTLRRRFLQPMKEAGIE
FT                   IVEFDPIFSAWLLETVNYRNHRKIVIVDGEIGFTGGLNVGDEYLGRSKKFPVWRDSHLK
FT                   VEGKALYKLQAIFLEDWLYASSGLNTYSWDPFMNRQYFPGKEISNAEGAVQIVASGPSS
FT                   DDKSIRNTLLAVMGSAKKSIWIATPYFIPDQETLTLLRLSAISGIDVRILYPGKSDSII
FT                   SDQASQSYFTPLLKAGASIYSYKDGFMHAKILLVDDKIATIGTANMDVRSFELNYEIIS
FT                   VLYESETVHDIKRDFEDDFKHSTEIKWNAFQKRSIKKRILESFMRLISPLL"
FT   gene            641383..641751
FT                   /locus_tag="BAS0593"
FT   CDS_pept        641383..641751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0593"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52921"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52921.1"
FT                   /translation="MYCDIFIIKCFLFFTKCRYLPILSAFVLHTVYCYVFKEKRKVNIM
FT                   YGRPIGGFGHGGGFGHGGFHGGFGHSPFFGGGFFPGFVAGALLSPGFGYGGYGYPYYSD
FT                   YSYYTGYQQDPYYSYNTY"
FT   gene            641782..642120
FT                   /locus_tag="BAS0594"
FT   CDS_pept        641782..642120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0594"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52922"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52922.1"
FT                   /translation="MNYIENNGLYYRNHHHGGHHHNGGHHHHGGHNHHDHHHHHGGGWG
FT                   WGGGSWGGGFFPGSFAGGVLGGLTAGALTGAAGGGYYPAPYPVTYPAPYPVPYPTPYPG
FT                   YQQTPYPY"
FT   gene            642479..644182
FT                   /locus_tag="BAS0595"
FT   CDS_pept        642479..644182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0595"
FT                   /product="sensory box/GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0595"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52923"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52923.1"
FT                   /translation="MLEQRGHALYESSLRDLKLALDESSIVAITDRKGLITYVNDKFCE
FT                   ISKYTREELIGKDHRILNSGYHPKTFFQMLWKRILSGKVWRGEIRNQAKDGTYYWVKTT
FT                   IVLFLNEKGEPYQFIAIRNDISSRKEAEQRLRLSESRYRELAYHDALTSLPNRLQLITT
FT                   VNELIADKNEFGMIYFDLDRFKLVNDTLGHMIGDLLLSEVASRLHYVLGEKDVLARLGG
FT                   DEFVLLTKNHKQDEMRQLATSVLSCFQAPFMLEGHEVYISASLGLCSYPQDGQDVETLL
FT                   KNSDLAMYSAKEQGRNAACFFTDELRAKINRRMKIEFALQKAIRDEELDVVLQPIIDLK
FT                   TKKYTGIEALVRCTTEEGPISPSEFIPIAEESGLIIKLGDWVLEKSCRLFKTLPEYEEG
FT                   LKLSVNLSIQQLMQKRFIISVRSILRRTGFPANRLILEITESIAVRHFDYIIATLQELR
FT                   NMGILIALDDFGTGYSSLYYLKQLPLDIVKIDRNFIREFHYDHAQPERTIVKSVIEIAH
FT                   SLNLAVVAEGVETVEQESLLKSMGCDYVQGFYYAKPLSVAELKEKLIIDF"
FT   gene            complement(644213..645610)
FT                   /locus_tag="BAS0596"
FT   CDS_pept        complement(644213..645610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0596"
FT                   /product="amino acid permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52924"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52924.1"
FT                   /translation="METKKWGLWVLTAFVIGNMVGGGVFMLPANLAQVSGPMGSTLAWS
FT                   ITGLGVFMIALVFGNLAIRKPELKAGPQSYAQAMFPSKKAGKVAGYSMAWGYWAANWAA
FT                   TASVIISFAGYLSTFFPVLQSKQILFSTNGFSLELGKGLTFLVCSLMLWGIQYILSQNI
FT                   DRAGNMNLLATIAKIIGFTMFIVITLFIFNASNFGDGQTFMNEAGQSISLGGQINSAAI
FT                   ATLWAFIGIESAVMLSNRAKSQRDVKKATIFGLIIALLIYMSITLLTMGALSQDALKDS
FT                   QKPLVDALNLAIGNKGAYIMALLALVSLFGSTVGWIVVSSEVPYQAAKNGLFPKFFAKT
FT                   NKKGSPSKSLFITNVMTQIFLFSTISGTVSEAYNFAIVVATLAYLIPYLVSTLYQFKLV
FT                   ITGETYDILPGSRIKDGIITTLAFVYSIWVIKTGTADLKTFFLGIGLFVLGLILYPVLM
FT                   KDSQKMN"
FT   gene            646062..646772
FT                   /locus_tag="BAS0597"
FT   CDS_pept        646062..646772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0597"
FT                   /product="trehalose operon transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0597"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52925"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52925.1"
FT                   /translation="MMSKYEQIYTAISKSIDNKQLKEGCKIPSETELMKQYEASRGTVR
FT                   KAVDLLQERGYVQKIHGKGVFVLKRKNIEFNFGGIVSFQEENERLGRHCITEVVEIEKI
FT                   KATKEIAKLLNVKEKTEIDHIKRVRNIDGEKVILDINHFVSEHIPGLTSEIAAGSIYKY
FT                   IEKELGLHISYSQRVIEVQSCTEDDRKYLDLNGTDYVVVVKNFTHFYDGSQFEYTESRH
FT                   RLDIFHFSDVARRK"
FT   gene            646910..648337
FT                   /locus_tag="BAS0598"
FT   CDS_pept        646910..648337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0598"
FT                   /product="PTS system, trehalose-specific IIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52926"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52926.1"
FT                   /translation="MGKDYRKTAEEVLQYIGGKDNIEQAAHCVTRLRIALKDESKIDND
FT                   KLQSVSLVKGAFHNAGVFQIVIGPGDVDRVYAELITLAGMKEATVADVKDSGNQKLNPA
FT                   QKFVKVFSDVFMPILPAIVTAGLLMGINNLLGAKDLFFDGKNLLDVYPNLSGLWDLINM
FT                   MANTAFVFLPALVGWSATKRFGGSPILGIVMGLMLVHPALLNAWDYGKAATGLDGQKIE
FT                   YFNILGLFQIEKVGYQGQILPVLVAAFVLSKVEIFLKKHVPNAIQLLVVPITTIVVTGV
FT                   LALGIIGPVTRHIGDLLTAGLVGVYETVPVVGAVLFGALYAPLVITGMHHMFIAIDLQL
FT                   IAQHGGTFIWPMIALSNIAQGSAALAMFWISKNQNDKSMASTSAISAYFGITEPAMFGV
FT                   NLRNKFPFYAAIIGSAVAAIFITLNGVLAPAIGIGGLPAFISIIPKSIPMFIVGMVIAV
FT                   VIPFTLTWLFAKRVKQK"
FT   gene            648351..650012
FT                   /locus_tag="BAS0599"
FT   CDS_pept        648351..650012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0599"
FT                   /product="trehalose-6-phosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52927"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52927.1"
FT                   /translation="MKDWHKSVVYQIYPKSFNSYYNKETGDIKGVTEKLDYLKELGVDY
FT                   IWLTPIYQSPQNDNGYDVSDYYSIDPSYGTMEEFEELLEEAKARNIEIMLDIVVNHSST
FT                   EHKWFKEAKKDKNSPYRNYYIWRDEKNNWQSKFGGSAWKYDEKTKQYFLHLFDETQADL
FT                   NWENEKLREEVYDMMRFWLDKGVTGFRLDVINLISKDQQFLNDDGSTATSDGRKYYTDG
FT                   PRVHEYLQEMNRNVFEGKDVLTVGEMSSTTIDNCIKYSNPDRNELSMTFSFHHLKVDYP
FT                   NGDKWTKADFDFIKLKEIMSNWQIEMQKGGGWNALFWCNHDQPRIVSRFGNDEKYRNES
FT                   AKMLATAMHMLQGTPYIYQGEEIGMTNPNFESIEQYRDVESLNIYDIKLEEGLSKEEII
FT                   GILKQKSRDNSRTPMQWNEDVNSGFTTSTPWISVAENFKEINVEKALEDKESVFYYYKK
FT                   LIELRKTYDVITEGEYAILDENDSEIWAYTRTTESEVLLVINNFYGEEITYSVPAHVQL
FT                   DGMKQEVLLSNYKDSSKDIAKLNLRPYESIVYRYTK"
FT   gene            complement(650044..651168)
FT                   /locus_tag="BAS0600"
FT   CDS_pept        complement(650044..651168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0600"
FT                   /product="spore germination protein GerKC"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52928"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52928.1"
FT                   /translation="MFKKRVKLLFILCTSAFLSGCWDQEPLREARLAYSIGSDITEENK
FT                   LQQTIELVKSSSGEQASFENEIHSATGHNIRDTSDALKKNVTGNIRYFKYGVQLLGTKI
FT                   LKKGVLPYLDVSFRDPTNPTALVKLIAVDGETSEILEKKKVGNLLIGDFLKKKVKSLED
FT                   MSVFPKETLETAATKMLDPGKDFTLPSIKIKGREVITNGLALFNNDKLTGHLPLKQSVL
FT                   FVLLTGKMGTSARITQKLTSDESEKTSDYLTMEVSNRKLKRDLKITTDKKGNVYAHIKL
FT                   QLKVIALEAPRDNLYKMDERKKLNKELSKQLTKEAKKITNKLQKANCDAFGIGRHLIAY
FT                   HPDLWKKKKWNKDYAKVKFKPEVDVNILYSGVLK"
FT   gene            complement(651149..652255)
FT                   /locus_tag="BAS0601"
FT   CDS_pept        complement(651149..652255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0601"
FT                   /product="spore germination protein GerKB"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52929"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52929.1"
FT                   /translation="MTNTQSKISLVQFTFFVIQCQIGVGILSLPNRLHPIAKGGGWISA
FT                   LIAGLAIQLIILLMWLFLKRFPDADMYESVCMLFGNKFGKLLGFAYVFYFTLIGMTVML
FT                   NACNVIKVWVLQATPWYAILLLFTIACCYIAYNTFKVIVRFYVMASILILPMALLIALG
FT                   FSRADFSYIFPITEAGWWNIIQASKETITAMYGFEIILIAFPKVNGSSVAKLKAISIAN
FT                   GFVTLFYTFTVWICFIVFSPKQIELIPEPVAYLLRSLHIGIIDRTDLLFIPIWMITVVA
FT                   SIASYYCAASIGIGHIFNLANHKKAVPIVGIIAFSVALFIDTPEELKVIATFTDKFTYI
FT                   FIVVLPLLFLLYSVIRNKKGEQYVQKKS"
FT   gene            complement(652236..653738)
FT                   /locus_tag="BAS0602"
FT   CDS_pept        complement(652236..653738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0602"
FT                   /product="spore germination protein GerKA"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0602"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52930"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52930.1"
FT                   /translation="MTEQKEQQESTGQKHMFPSLPENINYIENKLCHSDDIKKLDLPFQ
FT                   NGKGTILYIESLADPNLIHQLALEPLLTRSDLSLDKAFATLNMKKETNLNYGVQLLLQG
FT                   KSLYFHEHVDSFCIFETAISLKRDIAEPDNEGIVRGPHTGFVEDLATNLTSIRKLIKSP
FT                   NIVVKYFTLGEEMHTKVAIAYMQNIANDDLVTEVKRRLETIKTDALMPPGYIQEFIEDT
FT                   SFSPFPQQLNTERPDRVAANLMEGRVAIFSDGDPTALIVPVTLFAFYQSPDDYNNRWIV
FT                   GSFVRMIRLVSFLIAFLLPAIYIATVAFHPDVLPLELVYTIKASLEKVPLPPIFEALLM
FT                   ELIFELLREAGIRLPSRVGQTIGIVGGLVIGDAIVKAGLVSYTMIIVVALTAISSFLVP
FT                   SNDMSSAVRILRFPLMLLAALFGYVGISFGLIITFVHLCQLHSFHTPYLSPVAPMRIKD
FT                   MKDSFVRLPIWSFWERPHDPKPKKMQRQHVTREEEDGDKHAK"
FT   gene            653888..654574
FT                   /locus_tag="BAS0603"
FT   CDS_pept        653888..654574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0603"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0603"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52931"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52931.1"
FT                   /translation="MTLRHMWGWKEVLYLFMFVFVIVPVTVESLFYKYILEVIGNSLYA
FT                   GVLMGFIMAVIFTTVVYLFCIKRYKLSWKDIGIRKLSWKDILWTVGAVIFLIVASIAVL
FT                   VIMEKMGISFENSKTETVQNDKSIYSFCIAVIGAAIISPIYEEILYRGVFYTFFRNRYG
FT                   IWSGMFISSIIFTVVHIPTYNTLPVNFLSGVVFAWLYEKTNSILSAMIAHALFNFIAVL
FT                   LTFMSN"
FT   gene            654598..655569
FT                   /locus_tag="BAS0604"
FT   CDS_pept        654598..655569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0604"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52932"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52932.1"
FT                   /translation="MEIAVERVFTKEIVKRAASLFHVTVDEKPLGDFENYIFKAKGDRG
FT                   EDYVLRLTHSSHRSKQGVEAELDFLRYVAENGAKVAGPLYSTSRNLVEEIVAEDGTFFF
FT                   ASLFTYAKGEQVKGEESPYWGDAYFEAWGKAIGQLHRLTMNYPKTNHRDTWEEDESGIV
FT                   NELEDDQVKKIATVLMDEIKALPVERETFGLMHGDIHPGNFHYDGKELTIFDFDDAAYN
FT                   YFIHDLAMVLYYSVLFTPWTAEEKTDFARKQLQVLRKGYEYEHRLADSWYESLPLFLRL
FT                   RDIGLYGTLQKKFKGKDMPDNFQKLSEELYERIISEEPIVNI"
FT   gene            655727..657187
FT                   /locus_tag="BAS0605"
FT   CDS_pept        655727..657187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0605"
FT                   /product="sodium/alanine symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0605"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52933"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52933.1"
FT                   /translation="MEAFVNWLNNIVWSPALVYLCLGVGLYFSIRTRFLQVRHVGEMVK
FT                   LTFQGEKSEAGVSSFQALALSLSGRVGTGNIAGVATAVAFGGPGAVFWMWAVAFLGAGS
FT                   AYVESTLAQIYKTKHQGQFRGGPAYYIEKGLGVKWYALVFVAATILATGLLLPGVQANS
FT                   IAVSLETAFGINTTLSGALLVVVLALIIFGGVKRIVNVAQVVVPFMAVGYILVACVIVA
FT                   MNIEKLPEAFMLIIRSAFALEAAFGGIIGLAISWGVKRGIYSNEAGQGTGPHAAAAAEV
FT                   SHPAKQGLVQAFSVYIDTLFVCSATAFMMIITGMYNVFDASGKNFIVNKLNGAQPGPGY
FT                   TQAAVESVFPGFGNGFVAISLLFFAFTTIMAYYYIAETNIAYLNRDKDRPWLSMVLKFV
FT                   FLGAVFYGCIKTAATAWALGDIGVEIMAWVNIIAILLLQKPALVALKDYEKQKKEGKDP
FT                   VFDPGPLGIKNADFWEHEYGKGKKEEVS"
FT   gene            657321..658052
FT                   /locus_tag="BAS0606"
FT   CDS_pept        657321..658052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0606"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52934"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52934.1"
FT                   /translation="MLIEFRNVNKYYGNFQVLKDINVQVKKGEVVVVVGPSGSGKSTLL
FT                   RCINQLESITDGELIVQNTEVHNAKTDMNELRRNIGMVFQHFYLYPHKTVLQNITLAPI
FT                   KVNKISKEEAEKTAMFYLEKVGIPEKANVYPHQLSGGQQQRVAIARGLAMQPEIMLFDE
FT                   PTSALDPEMIGEVLDVMKTLAKEGMTMVVVTHEMGFAREVADRILFMDDGKIIEDTTPA
FT                   QFFASPEQERARLFLSRVLNH"
FT   gene            658065..658895
FT                   /locus_tag="BAS0607"
FT   CDS_pept        658065..658895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0607"
FT                   /product="amino acid ABC transporter, amino acid-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0607"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52935"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52935.1"
FT                   /translation="MLKMKKLFTLIVFSCLFVLVVAGCGSKKDEAKETNTKQGGAVEQI
FT                   KKRGKLVVGVKNDTNLFGLKNPSTGQVEGFDVDVAKALAKKILGDEKKLELKEVTSKTR
FT                   IPLLKNGDIDAIIATMTITEERKKEVDFSDVYFKAGQSLLVKKGSDIKSIDDVKKGVKV
FT                   LAVKGSTSTNNIRQKSPEATVLEFENYSEAFTALKAGKGDVLTTDNAILYGMAKQDSNY
FT                   EVVGKIFTDEPYGIAVQKGADDLTKEINSLIKDMKANGEYDKLYEKWIGQKPEK"
FT   gene            658958..659614
FT                   /locus_tag="BAS0608"
FT   CDS_pept        658958..659614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0608"
FT                   /product="amino acid ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52936"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52936.1"
FT                   /translation="MPDFSILTNNIDMYLEGFKYTVMSSVIALIGSFILGVVLAIMRIA
FT                   PIRILNWLGTAFVEFVRNIPLVLIAFIFYFALPVVGITLNGFVAGTVTLTVYTAAFIAE
FT                   VIRAGILSVAKGQMEAARSSGLTYTQAMYHVVLPQAMKIVIPPLGNQFLNLVKNSSILG
FT                   IIAGADLMYQGDLISTKTFVTFDVYIFVGMFYLILTIPLSMLVRYLEKRLAKEAV"
FT   gene            659615..660259
FT                   /locus_tag="BAS0609"
FT   CDS_pept        659615..660259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0609"
FT                   /product="amino acid ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0609"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52937"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52937.1"
FT                   /translation="MDFKGALTGDHILFLLKGLLITLEVALVAIVLSFIIGSVIGILRY
FT                   MKIPVVSQVLGIIVEVIRNLPLLLIIFFTYFALPEAGLKLEIITAVIVALTIFEAAMIS
FT                   EIVRSGLLSIEKGQIEAARSSGLTYVQALWHIILPQALRRMVPPLVSQFISLLKDTSLA
FT                   VAISLPELMHNAQIISGQNVNYMIPTFIVVACMYFIVNYSLSILSRRLELR"
FT   gene            660464..661891
FT                   /locus_tag="BAS0610"
FT   CDS_pept        660464..661891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0610"
FT                   /product="amino acid ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0610"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52938"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52938.1"
FT                   /translation="MQQTTNEKLHRTMKSRHLFMIALGGVIGTGFFLGSGYTINQAGPG
FT                   GAILSYLVGGFIMYLTMLCLGELTVAMPVSGSFQKYATKFIGPGTGFMIGWLYWLGWAV
FT                   TVGLELTSIGLMMKRWFPNVDVWVWCLVFGVILYASNAISAKSYAELEFWFSSIKVITI
FT                   LAFVVLGGSALLGFISYDGKEAAPLFSNFVSEGGLFPNGLAAVLLTMITVNFSFQGTEL
FT                   IGIAAGESENPEKTIPRAIRNTVWRIMLFFILTMTILVGLISWKEAGVIESPFVVVFDK
FT                   IGIPYAADIMNFVIITALLSVANSGLYAATRILWSLANEGMAPTSFQKVNKRGIPITAL
FT                   VVTIAVAGLSLFTSFLAEDTVYMYLLSIAGLSAVSSWIIIALSQLRFRSQYIKGGGKLE
FT                   DLKYRTPLYPIVPILALITNSIVVISLAFIPEQRMALYCGIPFIIFCYIYYYINKKRQK
FT                   PMKVEMEKANETNNQTR"
FT   gene            661866..662243
FT                   /locus_tag="BAS0611"
FT   CDS_pept        661866..662243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0611"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0611"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52939"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52939.1"
FT                   /translation="MKLTIKHDDIEADLSYGPLAIGKENGYSPLQLLVSSIAGCSAIVF
FT                   RTILEKKRIPYDTFTIETEIGRSEALSKPVESVHLHYKIKAQNITEEQLDKALQLAVKN
FT                   CTIVQSVKDSIKITETIELIK"
FT   gene            662302..662739
FT                   /locus_tag="BAS0612"
FT   CDS_pept        662302..662739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0612"
FT                   /product="HIT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0612"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52940"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52940.1"
FT                   /translation="MMECLGCRLAGGEEKIYKVYEDDYVTCFLDHEPFYTGHTLIVPKQ
FT                   HVVEVDELDDVVAKSIMDASKLITKAIKLLYKPDGVTVCQNGGIFNELTHYHMHVVPRY
FT                   KERSFAEFYMVQQGENKNYNFEETKNLLKEAIERILCTEKV"
FT   gene            662916..663473
FT                   /locus_tag="BAS0613"
FT   CDS_pept        662916..663473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0613"
FT                   /product="RNA polymerase sigma-70 factor, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0613"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52941"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52941.1"
FT                   /translation="MKVTDNDYEKMEELYELYEQKVYYVAYSILNNIQQAEDAVQETFI
FT                   TLYKNLEKLHNLNIQEFKRYILRVAKNKAIDSYRKNKRHETFLEEYERESIEAVDENIE
FT                   EWEKRKMSEVQIDTLLKELNESNRQVFKYKVFYNLTYQEISSVMGIKEANVRKQFERAR
FT                   KRVQNMIGGIQHDEFKELQRNI"
FT   gene            663439..664872
FT                   /locus_tag="BAS0614"
FT   CDS_pept        663439..664872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0614"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0614"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52942"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52942.1"
FT                   /translation="MTNSKNSKEIYEFAEKIALDDFDKIEEKHEFSHTYTRKKKLFMEE
FT                   MKLKNRQPQKKRKRHRMLIAAACLLIGMPTTVFGAVKVYNMIVQKQNYEVNVSLTNKDS
FT                   KKSDQWYKLKVGKLPENMEAIDDSAMKYSFKDNYAKGGFSFILWRVGKDSNFKTLYSKS
FT                   YEEKEINGKKAVIVNKENGNNNLAFNREVFLFFEKEGIMLQSYIGNDVNEEQMVDVLGN
FT                   ISLEPTSKEKASDITDYDKKYFSEESKPKKTKVIPLKKDSKRLFHIGQKVPVTISMDNS
FT                   KIEYMIEKVEVFDSIKDFKQENFSELGLGILSENQALDQTGQLIPYRRDEYKFGNGKDS
FT                   IDKLVDSKLVHPKFVYLTTTVKNIGKKSTEEIYMHPSIKLLKSEGNAWNYAERDGIAEK
FT                   NIMTGEVDYLEPHGDGKSFYNIGSIRPGETVKVNLGYFVDEDKLDSIFLDAFRYSGSSG
FT                   TENMNEKNRWWFDIRQQSK"
FT   gene            complement(664906..665859)
FT                   /locus_tag="BAS0615"
FT   CDS_pept        complement(664906..665859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0615"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52943"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52943.1"
FT                   /translation="MSKAKRLLDILIFASAKKTFTAQEIADEFNISVRTVHRYIVDLSD
FT                   MGLPIYAEQGRNGGYKVLTNRVIPPILFTEEEAVSIFFAFQSLSYYRDLPFNTEINSVT
FT                   HKLYSSLQHDAKTKVDKIRSYIAFWNPKRTVNTPLLNEVLTAAIENKNLHFQYESKSGI
FT                   KTKHVHPIGVYAHDGLWYLPSYDFSRKKVLLYRVDRILSILSAEENESTFMNLEEWFDS
FT                   NSNVVHSPTQLHVLLTTEGVRQCKSVPYLEEFVVVNEDGTGYIHSTIDKGEINFITPLF
FT                   YRLGKDTRVLEPKELIDGLRIRAKEILHMYEDEKSC"
FT   gene            665966..666487
FT                   /locus_tag="BAS0616"
FT   CDS_pept        665966..666487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0616"
FT                   /product="dihydrofolate reductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0616"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52944"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52944.1"
FT                   /translation="MSREIVLFIAASLDGYIAKEDDDLEWLMETEGEGDNGYTEMYETI
FT                   DTIIMGKRTYDYVVEHMDIFPYVDKKCYVFSNSEKGSNEHAEFVNEDVVEFTKGLKAQE
FT                   GSKIWMVGGGSLLREFFKNNLIDEYVVTITPHILGSGVPLFQDKNPEIHLTLTDTKRFG
FT                   QFVNLYYKVK"
FT   gene            complement(666501..667892)
FT                   /locus_tag="BAS0617"
FT   CDS_pept        complement(666501..667892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0617"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0617"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52945"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52945.1"
FT                   /translation="MKRISIQFGFYFLIVTLLIESVLFVLLYYSLVNTRVNEEMTALLK
FT                   RGNSHRDVLEKYYDEQTISHVALMESEAETTVVITNTNKEVLAKSNKINTTIKNHISSM
FT                   QTRTNHDGAIIENHWKTSNYICTVSPIIVAGKHEGYVYMFLGTESIEKLVNGLTKQFII
FT                   AGAITFLLTVITIFLLSRLLTKPLLHMKHATEKMSKGDLSVSLTTTRNDEIGELSSSIQ
FT                   TLANDLHYMKTERSEFLASVAHELRTPLTYVRGYADIALKETTSPEQRLRYLSIIKDES
FT                   DYITNLVQDLFSLAQMEQHNFSIQVKEVHLHTFLTRISEKVNAMYKERYITVSFSCPPT
FT                   LLVNLDEQRFEQVVVNILNNAYRHSKEHSQIHISVIEENKRISITMEDEGEGIPPEDLP
FT                   HIFERFYRVDKARSRATGGTGLGLSIVKEIVELHGGNITVTSEVDHGSCFTISLPSIKK
FT                   HDYHQ"
FT   gene            complement(667904..668581)
FT                   /locus_tag="BAS0618"
FT   CDS_pept        complement(667904..668581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0618"
FT                   /product="DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0618"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52946"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52946.1"
FT                   /translation="MIDILLVDDEPRMLELLTLYLTPIGYNCICARSGEEAISHIENQN
FT                   FKFILLDIMMPKMDGWETCKKIRSFSNVPIIMVTARDQTIDVVQGLKLGADDYVTKPFH
FT                   EEELFARIEAVLRRTNQHAQIQYHGILWNEAKHSASVHNEELLLTPIEFSLLGLFLRHV
FT                   NYVLSRDQLIERIWGLNTNTEDRTVDSHIRNLRDKLRKVNFPIDNHLKTVYGVGYRWID
FT                   IEH"
FT   gene            668755..668994
FT                   /locus_tag="BAS0619"
FT   CDS_pept        668755..668994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0619"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0619"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52947"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52947.1"
FT                   /translation="MKKATRILGVTIITAVGLAACGQTNNMDHTKHEPKKEKETEQKEM
FT                   KMNQEVTAPKEMNQGASNDLLTTSLKKCNEIKYK"
FT   gene            669005..670006
FT                   /locus_tag="BAS0620"
FT   CDS_pept        669005..670006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0620"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52948"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52948.1"
FT                   /translation="MAVLTSQTIWPATHKENQPGAVILVPVNEWQLGIASADLIHHPNN
FT                   GPILFIEKEKVPEMTLKEIKRLNPLGTKDGTQIMVMGDVGASILEQLKEYKVKQIKETD
FT                   PATFAKDVDKEYADITGSYPNSVIIGSSEEEGRLYTTPAVNWISHMPEPLLYTEKDKVP
FT                   KATIEALKMRKDKANIYVLGPEKIISKEVEKELSKYGKVTRISGETPVENSIAFAKFKD
FT                   EKTKFGWGFKKPGHGMSFVSNKTPDLAVAGAPFSHMGKHAPVILLEEGKASQPVYDFLA
FT                   TIQPKFKDDPTLGPYNHGFLLGSTSDISFETQGILDERLEIVQESGQGHGGH"
FT   gene            670164..671615
FT                   /locus_tag="BAS0621"
FT   CDS_pept        670164..671615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0621"
FT                   /product="sulfate permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0621"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52949"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52949.1"
FT                   /translation="MFQTIKNDWFSNVKGDVLSGIVVALALIPEAIAFSVIAGVDPTVG
FT                   LYAAFCIAVTISFVGGRTGMISAATGAMALLMVTLVKDHGLQYLFATTILTGIVQIIFG
FT                   VFKLSSFMKFVPKSVMSGFLNALGILVFTAQLPQLKNATWQMYALVALGLAIIYVFPRI
FT                   TTAVPSTLIAIIIVTSIALMSGLQLKTVGDMGSLPKELPFFSIPDVPFTLETLGIILPY
FT                   AVMLAIIGLLESLLTASVLDDMTHTESNKHKEARGQGIANIVAGFFGGMAGCAMIGQSV
FT                   INIKSGGRGRLSTFVAGGFLIVLLFVLGDYVVHIPMAALVAVMIMVSIGTFDWNSVATI
FT                   HKVPKGNAFVMIVTVVVVLITHNLGLGVVIGTVISAVLFAFNMAKIHVKHLYIENKKIY
FT                   EIHGQLFFASTADFINNFSFNEDVKEIEMNFTHAHVWDDSAVASIDKVIMKYEQSGVKV
FT                   SITGLNERSAKLVTNLATYNKRIAS"
FT   gene            671681..672103
FT                   /locus_tag="BAS0622"
FT   CDS_pept        671681..672103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0622"
FT                   /product="universal stress protein family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0622"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52950"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52950.1"
FT                   /translation="MYKQIILACDGSEHALRAAEHATHIAKFNEETNVEVVYVVDNRTA
FT                   KSDIIQGQTDLETVSASRKDKLKEIEGLLKKENISYKITILHGDPGDTIVQYVNTGDID
FT                   LVIAGSRGLNTLQEMVLGSVSHKIAKRVKCPVMIIK"
FT   gene            complement(672541..674322)
FT                   /locus_tag="BAS0623"
FT   CDS_pept        complement(672541..674322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0623"
FT                   /product="oligopeptide ABC transporter,
FT                   oligopeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0623"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52951"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52951.1"
FT                   /translation="MNKPKLYKVLSTLAASTLLLSACGGADSGSKKTNTKKVETNKFSA
FT                   AVKNDGKEIKDGSLTYGLVSNSPFAGVLSRVLYEVAPDSEIMDFFDEGLLASDKNWEIT
FT                   NDGAATYTISEDKKTITIKIKDNVKWHDGNPVTAEDLEYSYLIIGNSKYTGIRYDTQMQ
FT                   MIEGMEEYHAGKADKISGIKVVDPKTISITYKEVNPSLKTGIWTYPTPKKYLGDVPIEK
FT                   LAESDKIRQNPIGFGPFKVKKIVPGESVEYERFDDYWAGKPKLKNVTLKVVNPSIVSAS
FT                   LKKGDIDIASITADQYPNVSKLKNTQLVGKTALAYTYIGFKFGHMDKAKNEAVMDNDKF
FT                   KDVRLRQAMAYAIDREKLGEKVYHGLRVPANSPIPPSMPKYHNNNAGAYNLDVDKAKKL
FT                   LDEAGYKDKNGDGFREDPKGNEFKINFLASNGSETSEPLAKFYIQSWKDIGLKVELVDG
FT                   RLHEFNAMREMIKKDDPKVDIFSGAWNTGSDPDLSGLWGKNAGFNYQRWVNDENTKLLD
FT                   AGLSEKATDEKYRKEVYDKWQKLIHDEAPMIPIHYTFDLTGVNKRVKDFDVNAEVNQIT
FT                   SHWKDVTVTSEKPEVEK"
FT   gene            complement(674337..675242)
FT                   /locus_tag="BAS0624"
FT   CDS_pept        complement(674337..675242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0624"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0624"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52952"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52952.1"
FT                   /translation="MLANPEKQTEVIHYEKIPSGFSIMWREFRKDKLAMFSLFFLALIL
FT                   IAVYTTSFIMKQEDIVRVDLFAIYDPPSAEHWLGTDYGGRDIFGQLIIGTRNSFTVGLA
FT                   ITLLSTLIGLTMGLIAGYFGGVVDNIIMRFIDFMMILPFLMIVIVFISLVPTFNITTFI
FT                   LIMTAFLWVGKARLIRSKVLTEKELDYVSASKTLGTPNWKIIFQQILPNLSSIIIVNIT
FT                   LNLAGNIGIESSLTYLGFGLPESTPSLGTLVSYATNPDVLQEKWWIWLPASIMILVLML
FT                   CINFIGQALKRAADARQRKG"
FT   gene            complement(675261..676229)
FT                   /locus_tag="BAS0625"
FT   CDS_pept        complement(675261..676229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0625"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0625"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52953"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52953.1"
FT                   /translation="MWKFILRRILVMIPQLFVLSVLVFTLAKAMPGDALSGAELANPKA
FT                   DPKVIEEQREKLGLNDPIPTQYVRWISNAVQGDFGISYAHKIQVTDIIGERLGNTVLLA
FT                   LLILILTYLIAIPLGVISGRWNDTWADRLITLYNFLGFGTPLFIFGLVMLFLFGFLYPI
FT                   FPTSGSVDPQVAAGSFDYYLSKLNHMILPALSGALIGTVGTVQYLRSEIIDTKHKDFVR
FT                   TVKAKGVPESKVYSRHILRNSFLPIAAFLGYEITGLVGGSIILENIFGYPGIGQLFFQS
FT                   ITQRDFSVVTALVLFTGFATLLGTLLSDIILSIVDPRIRID"
FT   gene            complement(676244..677170)
FT                   /locus_tag="BAS0626"
FT   CDS_pept        complement(676244..677170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0626"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0626"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52954"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52954.1"
FT                   /translation="MALLKVEDLKVHFPIKGGVFGRTLDYVRAVDGVSFELQPGETYGI
FT                   VGESGSGKSTTGKAIMHLTKATGGSIHFNNRDLTKLSRSELREQRKDIQMIFQDPYSSL
FT                   NPKKRVMDIIAEPLRNFEKLSPDEERRAVQDYLDKVGLNPESIYKYPHEFSGGQRQRIG
FT                   IARALTLKPKLIIADEPVSALDVSVQAQVLNFLQDLQSELGLTYLFISHDLGVIRHMCD
FT                   RIGVMYRGRIVEEATSAEIYNNPQHIYTKRLISAIPDIRPENREQQRKLRREVSAEYEK
FT                   SYENYFNENGRAYDLKPISPTHRVALP"
FT   gene            complement(677157..678104)
FT                   /locus_tag="BAS0627"
FT   CDS_pept        complement(677157..678104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0627"
FT                   /product="ABC transporter, nucleotide binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0627"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52955"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52955.1"
FT                   /translation="MNIFSTYTCQTLSIYIKITTTYKIFSLFRKDGGIAMKNPLLRIEN
FT                   LQTSFRIQDQYHAAEMNKVRGSNIGMIFQEPLTALDPLMTVGKQIEENLDYHTSLSKVE
FT                   KKERTLELLHQVGIPKPELTYKQYPHELSGGMRQRIVIAIAIACNPALIIADEPTTALD
FT                   VTIQAQILDLLKSIQEQTKMGIILITHDLSVVAETADRIVVMYAGQVVETGKVEEIFNN
FT                   PLHPYTRSLLNSIPSAYAEKEKLHVIQGVVPTLAKLPRTGCRFQARIPWIRPDQHEENP
FT                   ILHEVKPNHWVRCTCYKHFNFQDKKGDDVTHGTA"
FT   gene            complement(678284..679633)
FT                   /locus_tag="BAS0628"
FT   CDS_pept        complement(678284..679633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0628"
FT                   /product="glycerol-3-phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0628"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52956"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52956.1"
FT                   /translation="MFFTQFFKPAPHAERLPADRVDSEYRKLRLQVFLGIFIGYAGYYF
FT                   VRKNFSLAMPYLIEQGFSKGELGVILSAVSIAYGLSKFLMGIVSDRCNPRYFLAAGLFL
FT                   SGIINIIFGSFSFITTSIILMFVLQFLNGWVQGMGWPPCGRTMVHWFSISERGTKMSIW
FT                   NVAHNVGGALMPSLVTLGLYFFANDWKSIFYFPGILSILVGVYVLITMKDTPQSCGLPS
FT                   IEEHTGEYPPDEKIKDRERELSAKEILFKYVLNNKFLWYIAIANVFVYFVRYGVVDWAP
FT                   TYLVEEKSFTHSSSRTAYALYEWAGIPGTLLCGWMSDKLFKGRRAPAGILFMVGVFIAV
FT                   LVYWLNPPGNPMVDSIALVAIGFLIYGPVMLIGLHALDLAPKKAAGTAAGLTGFFGYLG
FT                   GAAFASAAMGFIVDAFGWDGGFILLLASCVLAMFFLALTLKTGSVKQKQA"
FT   gene            679906..680364
FT                   /locus_tag="BAS0629"
FT   CDS_pept        679906..680364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0629"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0629"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52957"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52957.1"
FT                   /translation="MPNDMTHIDKIQALAFSIGKKMQTELLEQMQATGLTPPQFYILKI
FT                   LDHYGASRATKLAKKMYVKPSAITVMIDRLIDQELVERYHDKDDRRVVIIELTKKGKAR
FT                   VEEAMVARNEHIAKYFSHLELQEREDLLRLFEKLETIICGTQEKKENN"
FT   gene            680384..681814
FT                   /locus_tag="BAS0630"
FT   CDS_pept        680384..681814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0630"
FT                   /product="multidrug-efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0630"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52958"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52958.1"
FT                   /translation="MEQQENINRKLLLIGLIIAMLFAALDGTIVGTAMPRIVGELGGLS
FT                   LMTWLTTAYMLTSTTVVPIAGKLADLLGRRNVYITGLVIFMVGSALCGMANGMTELIIF
FT                   RGIQGLGGGIMMPMAMIIIGDMFTGKERAKWQGIFGALYGLASVIGPQVGGWIVDAVNW
FT                   RWVFYINLPVGILATIFIAMGLKSHKQTGPIKIDIAGIFTMILGVVSLLLALTFGGKDY
FT                   AWDSWQIIGLFALALIGIVSFVIVETKAEEPILPMHFFKNRTFTLLNAIGFFMSIGMFG
FT                   AIMFVPFFMQGIVGVSAAESGTIMTPMMITMIVMSIIGGQLVLKVGVKPQIITGMLIMA
FT                   GGFWLLTTMDMHTTKLTATSYMMVIGLGMGLVMPTLTLALQESFPKKDLGVVTSSSQFF
FT                   RQIGGTFGITILGSIMNNTSGTTLTKNLVPVLDTFPKEAGQMVTKFKDMIHTDPQGLYS
FT                   MLFSPEALKQMPEALYQF"
FT   gene            682122..683093
FT                   /locus_tag="BAS0631"
FT   CDS_pept        682122..683093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0631"
FT                   /product="ribose operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0631"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52959"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52959.1"
FT                   /translation="MSTIKDVAKLAGVSVSTVSRVLNKNGYVHEDTLKKVERAIEMLDY
FT                   KPSTVARSLYNKKSRLIGLVVPNIVNPFFPEVARAVEDVAHKQGYTVVLCNSDESLEKE
FT                   KQYIDVLRQNNVDGFIVATNPQNSVNYMNLSVPVVAIDRMFNERIPAVYADNYAGSQAA
FT                   TKLLIDKGCKRIAHIRGPRDVSTANERFEGFVDVITQNNLSYMIAESTFDPANSERVAV
FT                   ELLEEYPHIDGIVAGNDLIAIGIVKAALQKGISIPDDLQIIGFDGISLTEMMYPSITTV
FT                   AQPIYEMGKVATELLLEQMEGNVLEEKHYRLPIEIIERNTTK"
FT   gene            683107..684003
FT                   /locus_tag="BAS0632"
FT   CDS_pept        683107..684003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0632"
FT                   /product="ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0632"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52960"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52960.1"
FT                   /translation="MPNIAVVGSISMDLVAVSKKRPKAGETVIGEAFHTIPGGKGANQA
FT                   VAAARLGANVAMVGAVGDDNYGTVVKRNLENERVFIDYVVPVTDAATGIAHIVLAEEDN
FT                   SIVVVQGANALVNESVVNRSKDLLIKADMVVLQLEIPLETVKYVLAICQEHKIPVMLNP
FT                   APAQVLSEDILEKATYITPNEHECRIVLDDFTSPIEDLLAKYPNKLLMTEGSNGVRFHN
FT                   GTEIVHVPSIAVDVVDTTGAGDTFNGALAVALSEGETLQKAIRFANIAGGLSVTKLGAQ
FT                   GGMPTRDRVREVQVIVG"
FT   gene            684000..684395
FT                   /locus_tag="BAS0633"
FT   CDS_pept        684000..684395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0633"
FT                   /product="ribose ABC transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0633"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52961"
FT                   /db_xref="GOA:Q81V37"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81V37"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52961.1"
FT                   /translation="MKKHGVLNSEIAAVLASLGHTDTIVIADCGLPIPDGVKRIDLAVE
FT                   IGKPSFLDVLQVVADDMAIEKVTLAEEVINNNAEVNKEIELKLIEPAFEYVCHEQFKEH
FT                   TKKAKAIIRTGEATPYANVILHAGVIF"
FT   gene            684414..685898
FT                   /locus_tag="BAS0634"
FT   CDS_pept        684414..685898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0634"
FT                   /product="ribose ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0634"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52962"
FT                   /db_xref="GOA:Q81V36"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81V36"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52962.1"
FT                   /translation="MRIEMKNISKAFNGNPVLKNAQFMIETGEVHALMGENGAGKSTLM
FT                   KILTGVYKRDGGTITIDGQERTFKNAKEAEEYGIAFIHQELNILPNLTVAENMFLGKEL
FT                   MYGKTGILRTRQMNAIAQQQLAELGLHVKGAMLAGELSVGQQQIIEIAKALMTNASVII
FT                   MDEPTAALTDREIETLFTVINKLRKEGVSFVYISHRMEEIFSICDAITILRDGEYVGKR
FT                   SIPETSFDEVVSMMVGRSIGERYPERNSQIGDVIFEMRNGTKKGKFENVSFQVRKGEIL
FT                   GVAGLMGAGRTDIMKAIFGYEPLDSGQIFINGQEVKIDSPIDAIRQRIAFITEDRKSEG
FT                   LVLDFSIRENLALPNLESLSKGSVLSNELEQQFTADMMKLLNVKASSGEQAVKSLSGGN
FT                   QQKVVIAKWLGIHPQLLILDEPTRGVDVGAKKEIYSIMNKLTEEGDAVIMVSSELPEVL
FT                   GMSDRVLVIHEGKVGGILEKDEASQESIMALATGGE"
FT   gene            685901..686836
FT                   /locus_tag="BAS0635"
FT   CDS_pept        685901..686836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0635"
FT                   /product="ribose ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0635"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52963"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52963.1"
FT                   /translation="MAKKGNVLQQLGSLIGLALIIVVITALNPAFIEIPNLFNILRQVS
FT                   INALIAFGMTFVILTGGIDLSVGSILALSSALVAGMMASGMDPFLAMAVGLLAGLVMGI
FT                   VNGIIIAKGKVAPFIATLATMTIFRGLTLVYMDGRPITGLGDHLMFQMFGRGYFLGIPV
FT                   PAVTMMIAFAVLYFILKKTTFGRRTFAIGGNEEAAALSGINVTKIKVMIYGLSGILAAF
FT                   AGIVLTSRLDSAQPTAGTSYELDAIAAVVLGGTSLSGGRGWIVGTFIGVLIIGVLNNGL
FT                   NLLGVSSFFQQVVKGLVILLAVLIDRRKEA"
FT   gene            686851..687777
FT                   /locus_tag="BAS0636"
FT   CDS_pept        686851..687777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0636"
FT                   /product="ribose ABC transporter, ribose-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0636"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52964"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52964.1"
FT                   /translation="MKKWLLILVACMMVITAGCSMEPPEWAKDSSDKGRNKTIKVGFSV
FT                   STLNNPFFVTLKKGAEKKAKESGIELIAVDAQNDAAKQTNDVEDLIQKGVDVVVINPTD
FT                   SDAVASAVSAANAANVPVITVDRVANSGKVVSHIASNNIEGGQMASDYIRELVGEGANV
FT                   AELEGIPGSSAARERGKGFHNVADKSLKVVAKQAADFDRAKGLSVMENILQANGDIKAV
FT                   FAHNDEMALGALEALKSAGKTDVVVVGFDATEDAVKAVNDGRMAATVAQKPELIGEKAM
FT                   QTAKEITQGKKVDKSIPIELELIKKNK"
FT   gene            687812..688459
FT                   /locus_tag="BAS0637"
FT   CDS_pept        687812..688459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0637"
FT                   /product="transaldolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0637"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52965"
FT                   /db_xref="GOA:Q81V33"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81V33"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52965.1"
FT                   /translation="MKFFIDTANINEIKEANALGVLAGVTTNPSLVAKEGVDFHERIRE
FT                   ICNVVEGPVSAEVISLEADKMIEEGKELAKIAPNVVVKVPMTTEGLKAVKAFSDLGIRT
FT                   NVTLVFSAVQALLAARAGATYVSPFLGRLDDIGHNGMDLIRQIAEIFAIHGIETEIIAA
FT                   SVRHSVHVTDAALNGAHIATIPANVIASLVKHPLTDQGIEKFLADWEKTQEK"
FT   gene            688776..691175
FT                   /locus_tag="BAS0638"
FT   CDS_pept        688776..691175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0638"
FT                   /product="immune inhibitor A metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0638"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52966"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52966.1"
FT                   /translation="MRRKAPLKVLSSLAIAAIIGCTSVMSAPLAYAETPAKEKENVSTT
FT                   PIDYNLIQEDRLAEALKERGTINPASSKEETKKAVEKYIEKKQGDQANKEILPADTAKE
FT                   ASDFVKKVKEKKMEEKEKVKKPEKNVSPEQKPEPNKKQLNGQVPTSKAKQAPYKGSVRT
FT                   DKVLVLLVEFSDYKHNNIDQTPGYMYSNDFSREHYQKMLFGNEPYTLFDGSKVKTFKQY
FT                   YEEQSGGSYTTDGYVTEWLTVPGKASDYGADGSSGHDNKGPKGARDLVKEALHAAAEKG
FT                   LDLSQFDQFDRYDTNSDGNQNEPDGVIDHLMVIHAGVGQEAGGGKLGDDAIWSHRSKLA
FT                   IDPVAIEGTKSKVDYFGGKVAAHDYTIEPEDGAVGVFAHEFGHDLGLPDEYDTKYTGTG
FT                   SPVEAWSLMSGGSWTGKIAGTEPTSFSPQNKDFLQKNMGGNWAKILEVDYDKIKRGVGV
FT                   PTYIDQSVTKSNRPGVVRVNLPGKSVETIKPEFGKHAYYSTRGDDMHTTLETPFFDLTK
FT                   GTNAKFDYKANYELEAECDFVEVHAVTEDGTKTLIDRLGEKVVQGDKDTTDGKWIDKSY
FT                   DLSQFKGKKVKLQFDYITDPAVTYKGFAMDHVNVTVDGQVVFSDDAEGQSKMNLNGFVV
FT                   SDGTEKKAHYYYLEWRNYAGSDNGLKAGKGPVYNTGLVVWYADDSFKDNWVGVHPGEGF
FT                   LGVVDSHPEAFVGNLNGKPTYGNTGMQIADAAFSFDQTPAWSVNSLTRGQFNYSGLQGV
FT                   TTFDDSKVYSNNQIADAGRKVPKLGLKFQVVGQADDKSAGAVWIKR"
FT   gene            691494..691835
FT                   /locus_tag="BAS0639"
FT   CDS_pept        691494..691835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0639"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0639"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52967"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52967.1"
FT                   /translation="MKEVIECPQCEGNITAQHIMDLPHSFSFRCPHCKVKLKEMRITPC
FT                   LILVAICIIPLFIMIGESIKELLVKYFSIIDGVPTVLIFFLFCYPLYYLYEKYNAILFI
FT                   KYGLLKVKS"
FT   gene            complement(691873..693045)
FT                   /locus_tag="BAS0640"
FT   CDS_pept        complement(691873..693045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0640"
FT                   /product="multidrug resistance protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0640"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52968"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52968.1"
FT                   /translation="MKYFIYFIVIVAFLDTFSQLPIMSTFAQSLGGSPLIIGLVVGMYS
FT                   FANMIGNIIAGAAVDKFGAKKILYISMGLTSFIVLLYTVVQSGEQLLVVRFMHGFSDGF
FT                   LIPAAFTFLSKQTNAARQGKAMALSGAAVGTAAIVGPAFSGIMKATAGIEWVFITISIL
FT                   MVLGTIVSLFFLPNNVSRKDTSRTQMMNKEDMFELLKSEPLLQAYIGAFTLMFSQGIVT
FT                   YMLPVKVEALALKASTTGMMLSAFGITAILFFLLPTNRIYDRFNRSKLMLIGIAVMALA
FT                   LSLLGLFATKGMLFIVMMIYGIGFAILFPSINALLVENTTNDKRGKAFGLFYAFFSLGV
FT                   VAGSFTVGAIGASPSVSFVIGTAFLLTFAGMIYVRSKVKGRDKVKKTMIG"
FT   gene            693271..694323
FT                   /locus_tag="BAS0641"
FT   CDS_pept        693271..694323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0641"
FT                   /product="alcohol dehydrogenase, zinc-containing"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0641"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52969"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52969.1"
FT                   /translation="MKALLWHNQRDVRVEEVPEPTVKPGAVKIKVKWCGICGTDLHEYL
FT                   AGPIFIPTEEHPLTHVKAPVILGHEFSGEVVEIGEGVTSHKVGDRVVVEPIYSCGKCEA
FT                   CKHGHYNVCEQLVFHGLGGEGGGFSEYTVVPEDMVHHIPDEMTYEQGALVEPAAVAVHA
FT                   VRQSKLKEGEAVAVFGCGPIGLLVIQAAKAAGATPVIAVELSKERQELAKLAGADYVLN
FT                   PATQDVLAEIRNLTNSLGVNVSFEVTGVEVVLRQAIESTSFEGQTVIVSVWEKDATITP
FT                   NNLVLKEKEVVGILGYRHIFPAVIKLISSGQIQAEKLITKKITVDQVVEEGFEALVKDK
FT                   TQVKILVSPK"
FT   gene            694442..694786
FT                   /locus_tag="BAS0642"
FT   CDS_pept        694442..694786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0642"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0642"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52970"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52970.1"
FT                   /translation="MLSFMLTLKRMLKACLRAWKDKEFQVLFVLTFLTLTSGTIFYSTV
FT                   EGLRPLDALYFSVVTLTTVGDANFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQL
FT                   PSILSNRKKE"
FT   gene            695040..695891
FT                   /locus_tag="BAS0643"
FT   CDS_pept        695040..695891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0643"
FT                   /product="phospholipase C"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0643"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52971"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52971.1"
FT                   /translation="MKKKVLALAAAITLVAPLQNVAFAHENDGGSKIKIVHRWSAEDKH
FT                   KEGVNSHLWIVNRAIDIMSRNTTLVKQDRVAQLNEWRTELENGIYAADYENPYYDNSTF
FT                   ASHFYDPDNGKTYIPFAKQAKETGAKYFKLAGESYKNKDMKQAFFYLGLSLHYLGDVNQ
FT                   PMHAANFTNLSYPQGFHSKYENFVDTIKDNHKVTDGNGYWNWKGTNPEDWIHGAAVVAK
FT                   QDYSGIVNDNTKDWFVKAAVSQEYADKWRAEVTPMTGKRLMDAQRVTAGYIQLWFDTYG
FT                   DR"
FT   gene            695830..696966
FT                   /locus_tag="BAS0644"
FT   CDS_pept        695830..696966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0644"
FT                   /product="sphingomyelinase C"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0644"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52972"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52972.1"
FT                   /translation="MHNVLLLDTFSFGLIRTEIVKDLKKVKSHNRVFDLFITIHMEVWN
FT                   VKGKLLKGVLSFGIGLGVLYGGSSAQADTSTDQNNTLKVMTHNVYMLSTNLYPNWGQSE
FT                   RADLIGAADYIKNQDVVILNEVFDNSASDRLLGNLKKEYPNQTAVLGRSNGNEWDKTLG
FT                   SYSSATPEDGGVAIVSKWPIVEKVQYVFANGCGPDNLSNKGFVYTKIKKNDRFVHVIGT
FT                   HLQAEDSMCGKTSPASVRTNQLKEIQDFIKNKNIPNDEYVLFGGDMNVNKINAENNSDS
FT                   EYASMFKTLHASIPSYTGHTATWDATTNSIAKYNFPDSPAEYLDYIIASKDHANPSFIE
FT                   NKVLQPKSPQWTVTSWLKKYTYNDYSDHYPVEATISMK"
FT   gene            697074..698246
FT                   /locus_tag="BAS0645"
FT   CDS_pept        697074..698246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0645"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0645"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52973"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52973.1"
FT                   /translation="MDRGIFKEVPLPCAFLDEVALDRNIQSIIELSGNKKIRIASKSLR
FT                   SVPVMQRILAASDRFQGIMCFSPREALFLIEQGFNDLLLGYPAYDERALHEISLLTKQG
FT                   LIITCMVDCEDHIVYLEKIAEKSKGCFRVCLDIDMSSRFFKFHFGVKRSPVKDGQGALK
FT                   IVKRLKESSFLILDGVMGYEAQIAGVGDHIPNQRVKSKVISYLKKKSVLEVKERRGHIV
FT                   KEIQNLGIELRFVNGGGTGSIKTTEQDHSVSEITIGSAFYAPKLFDYYKEVQFHPAVGF
FT                   ALPVVRKPAPTIYTCLGGGYIASGAIGKDKEPEIWRPGGAKLLALEGAGEVQTPIFYNG
FT                   EERVEIGDSILFRHSKAGELCERFPFLYRVKEGEIVGEYSTYRGDGQCFL"
FT   gene            698234..699547
FT                   /locus_tag="BAS0646"
FT   CDS_pept        698234..699547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0646"
FT                   /product="oxidoreductase, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0646"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52974"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52974.1"
FT                   /translation="MLSIKGQKWRNWTGNVEGTPHYTMYPESIQDVVEVIELARKKGKK
FT                   IRVVGSGHSFTPLVQTEEILVSLDEMKGIVNIDTEKMIAEVWAGTKLHELGKLLEEKGY
FT                   AQENLGDIDSQSIAGAISTGTHGTGITFGSLSTQVIEITAVLSTGETIVCSEMENVEYW
FT                   RAFQLSLGMLGIIVRIKLNIIRAYSLVYESEKQSLATVMNKLEEYKKNRHFEFFVFPYS
FT                   DEVQVKVTNETTGKKSDLKWHKLKVELLENKMFSLLSKGCKWFPSISKGVSRLSAKAVP
FT                   NTKIIGPSYEVFATSRAVPFYEMEYSVPSKYMQAVVEEISNLIEKKKYKVHFPIECRYV
FT                   KRDDIWLSPAYGRDSAYIAVHMYKGMKYAAYFGEVEKIFLKYEGRPHWGKMHTLTYEKL
FT                   QNIYPELHSFLKVRKLLDEAEMFSNPYTEKLFTIMKKS"
FT   gene            complement(699555..700706)
FT                   /locus_tag="BAS0647"
FT   CDS_pept        complement(699555..700706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0647"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0647"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52975"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52975.1"
FT                   /translation="MTAYLFPVKTAFILFPFLAMFLLIPFLIFNYRKYGYLNKWRSFIL
FT                   YSLLLYLLNAYFLVILPLPQTYDTCSLQPANTQHMQLSPFYFIQEISNHTSAILTKPAT
FT                   YFYLLKESAFLQVAFNVLLTVPFGIYLRYYFRRSFLQTICISFCLSLFFELTQVTGLYG
FT                   IYNCAYRLFDIDDLFLNTLGGVIGFIIAPIFMYFLPKANELDSHVDLETKPVGFVRRFI
FT                   AMQIDWIFLSIVVPVIKNKGNSFFVSNIQAYTNIYELIFITCSILIYFIIIPYFTNGKT
FT                   IGKALLRIYVKGKSDRITMKELFIRYGIFYFILGGINYILSSSSILNLKEPLVLIVIVL
FT                   FQLVINGLFIIHVLLHVFSRDKLLFYERISQTRNAIILKKADK"
FT   gene            700879..701082
FT                   /locus_tag="BAS0648"
FT   CDS_pept        700879..701082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0648"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0648"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52976"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52976.1"
FT                   /translation="MRYELFSVSGNHITTFESAWCFQEGEQIFVHDDQTKRNFIIIRLT
FT                   HDVFQQNKHVIRLYCQEKKVYA"
FT   gene            complement(701140..701952)
FT                   /locus_tag="BAS0649"
FT   CDS_pept        complement(701140..701952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0649"
FT                   /product="undecaprenol kinase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0649"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52977"
FT                   /db_xref="GOA:Q81V21"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81V21"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52977.1"
FT                   /translation="MEQFYYILKYLILGLFQGLTEPIPISSSGHLVLAQHLLGLKIEGF
FT                   SFELLVNSASLLAVLLIYRNDLIRLTKNGLSYIFTRAEDAKSDFFFIIYLVIATIPAGV
FT                   IGVLFKDYIDQYLKGVKMVGISLLITAVGLWIIRNLRGRRNDGDLSMKDAIIVGLAQAC
FT                   ALIPGISRSGATIVAAMLLGMKQETALRFSFLLYIPVSLGGLLLSITDIAKDPNLDTLF
FT                   VPYIVAFIATFIMTYISLKWFMNIMAKGNLKYFSFYCIIVGVLTLIFL"
FT   gene            complement(702085..703029)
FT                   /locus_tag="BAS0650"
FT   CDS_pept        complement(702085..703029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0650"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0650"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52978"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52978.1"
FT                   /translation="MFTQKKSLQHKIDQLENRIQELKAELKQKDIEQQETISSIHDRVQ
FT                   NIVQEHKLVNNQHHTLQNLVQQLNSCFENVSTRTTHSNELNNEMLQKEQSLIQSIEEII
FT                   DCSNEGKESVHRLLIVINKLGEQSQRTSNSMNHLSERSKEIEQIVEVIQNIAAQTNLLA
FT                   LNASIEAARAGEHGKGFAVVANEVRKLAESTAESTKNIGNLTKKIQEEIEKAYDNTKDN
FT                   LHLVDEGVEMSADTNARIENILIMIQTLQNGATNVIKAIENQKSCNDDILREFANTQQM
FT                   FQKLNTTIMNHIHDAEKVDVQLTKSLEETVVSH"
FT   gene            703250..704512
FT                   /locus_tag="BAS0651"
FT   CDS_pept        703250..704512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0651"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0651"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52979"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52979.1"
FT                   /translation="MNYFKRISSLVLAGIIGLSSTVAVKAESNDEKLNNMQQQLQQNDA
FT                   EMQKKEQEKQAVSKEIQGIENELHNLNNTIAKNKEDQAAIQRKIDETHKQIEQKKNEIV
FT                   VLEDKVLARKDIMRKRMVSVQNSSNTSLVVEVVVESKNFADFLQRMNAVSTILEADKEI
FT                   LRLQEQDLRQIEEDKKTIDEKEASLVVDKQKLAKAQAELQDNLKKRQANLQTVQAKYNQ
FT                   VASQLNLAAEEKAKIESNMKAVQETIAREQEAARIAAEERAKAEAAAKAEQEALAKAQA
FT                   EVAEKKKQEQASKPAEPVANNNSKVEPVQPSKPTAGGREIYVHATAYTADPAENGYGPG
FT                   QQVYSAWGGYNLTANPGMKLIAVDPSVIPLGSRVYVEGYGEAIAADTGGAIKGHKIDVL
FT                   MPDKASSSKWGRKNVKLTILS"
FT   gene            704616..704843
FT                   /locus_tag="BAS0652"
FT   CDS_pept        704616..704843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0652"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0652"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52980"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52980.1"
FT                   /translation="MVNLTILNRVKELRARFNFSQSVLAEKVGVTRQTIAAIEKGDYVP
FT                   SLLLALMICDVFQLKMEDVFVLNKEGEEDE"
FT   gene            704836..705309
FT                   /locus_tag="BAS0653"
FT   CDS_pept        704836..705309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0653"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0653"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52981"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52981.1"
FT                   /translation="MNRLVFSYMLNVLLMVLAGWAFIELYYFTIEVANFIQTKRVPFEV
FT                   SVSLMPLGLLLIFGIVSTVLYKVQKKKYKELSYWMFPLLFPQEDEREKAITEKACRTTF
FT                   MSLWYVLPCAVGFLTLSPIVNLYVPAYPIYIAFSIFFIQMTIFHVSLYRNKIA"
FT   gene            705426..706058
FT                   /locus_tag="BAS0654"
FT   CDS_pept        705426..706058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0654"
FT                   /product="LPXTG-site transpeptidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0654"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52982"
FT                   /db_xref="GOA:P0DPQ5"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042007"
FT                   /db_xref="PDB:2KW8"
FT                   /db_xref="PDB:2RUI"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DPQ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52982.1"
FT                   /translation="MNKQRIYSIVAILLFVVGGVLIGKPFYDGYQAEKKQTENVQAVQK
FT                   MDYEKHETEFVDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLL
FT                   SGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDNENEYEYAVTGV
FT                   SEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK"
FT   gene            complement(706087..707472)
FT                   /locus_tag="BAS0655"
FT   CDS_pept        complement(706087..707472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0655"
FT                   /product="proton/peptide symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0655"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52983"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52983.1"
FT                   /translation="MESAIQLEKEQQRKKKHPPGLYLLFFTEMWERFSYYGLRGLLTLY
FT                   LTTALVSGGLGFSPAWALSIYGFYTGACYFTPMIGGYLTDRFLGRRKAITIGGITMAIG
FT                   NLTLFAMQNQVGLYLGLALIIIGNGFFKPNISTLVGELYEENDPKRDSAFTIFYMGINV
FT                   GSFLAPLVCGFLSENLFKTTVDGVVHYGFRYGFLAASIGMIIGQILFTTLSNRFLGDIG
FT                   KKPTRDLQTTDGQPSVGDTPLTKKEKQRTAVIVILTCFVVFFWAGFEQAGSSLTLYTNK
FT                   FVDRSVFGWEVPTSWFQSVNPLFIILLAPVISALWAKLATRKRGDLKIPTKMGLGMILL
FT                   GIGYIILVIATLKTGSDEHNITEKANLLFIVFTYLFHTLGELFLSPVGLSMVSALAPVK
FT                   LASLLMGVWLASSGIANILGGQLASFTTSLGYAEVFTVIGAVAIVLGCVLLLISKKLVK
FT                   WMD"
FT   gene            707725..709026
FT                   /locus_tag="BAS0656"
FT   CDS_pept        707725..709026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0656"
FT                   /product="branched-chain amino acid transport system II
FT                   carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0656"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52984"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52984.1"
FT                   /translation="MKLLQKKEILLISLMLFSMFFGAGNLIFPPFLGYEAGEHVWISLV
FT                   GFIISATGLPILGVIAIAKAGSFQALAGRVHSSFAIIFPCIVYLFIGPGLGIPRAGSLA
FT                   FEMGPGQFFPEAGSIVLLCYTVIFFSIVYWLSLSPSKLMGLFGKVLTPLLLGMIALIFI
FT                   KSMFTSVGSVKEAAGNYGQAPMFQGFLDGYLTMDALAALIFGIVIANALRAKGIEDDKG
FT                   LAKYMSIAGIGAGLLLSIIYVILGYVGSMSGSLGTFDNGAQVLAQVMTTLFGQGGVVLL
FT                   GLIFTIACLCVSIGLVTSCSQFFASAFPKVAYKFWAFILSFVSMILANLGLTQILKVSV
FT                   PILGFIYPVALTLIILGLFQKYIGKYAYVYAVTVGIVAVFSAIDIFNKNVMLNQWTSVL
FT                   KYIPFYTEGVGWIVPAIIGACIGVIVSFVFNKKK"
FT   gene            709162..710883
FT                   /locus_tag="BAS0657"
FT   CDS_pept        709162..710883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0657"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0657"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52985"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52985.1"
FT                   /translation="MKEDLNKKIEALETTIETMQEALFELKAKQREIEVENAQQHVSKE
FT                   KKEYIETVIEEKQKEEVVTIKEPVQEREVKQVDISAFKPEPFNIIKFCQTWLPRIFVGI
FT                   MLLGVIWLFKAGVDAGLLTPAIRIVFGIVLSMGFYYIGDIQIKRERQALGLVLAGGSIT
FT                   GIVLTTFAAHYLYGFIPASIAFVCNIAWVILGIYIAKRYQSEYLTIFVAVGAFFVPFLL
FT                   NSTTPNPYIFFGYETILTLSLLWYALKNRYQYLYMISYAVAAIVLFVFFAVMSMLVEDL
FT                   QVQLTVVYGLIHLLLFWHMFTERSFIVEPRLAIFSANAVFFILAISKILEFTTWGLMIS
FT                   ALVHANMFVFEYRKNRHSTFTNLLFGFAMGAFSLAILYEYSLVNAAIVLLLQGFLGMVT
FT                   SIKGKQQIKLYVSATVYAIGMIQTIFSPFDQFISAGFVAHLILIGTFYYCMRQAKDVLA
FT                   SFGKYVYSIALYWFMVIVFITITRIGEVLSTDGSIISVSVSLLWMVYALFAVWLGRNKH
FT                   MNEILYAGLIVLVVTIGKLFLLDLPEVSMMIRAVLFLIVGSIGIVISRMFFSKEEK"
FT   gene            complement(710919..712466)
FT                   /locus_tag="BAS0658"
FT   CDS_pept        complement(710919..712466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0658"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0658"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52986"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52986.1"
FT                   /translation="MKNKKWITFSLATAITLSIGASFIPSTYAESSVDPAPEIAAKVVN
FT                   QNNGKKVLFDNTHGQTAGTADWVIDGGFSDFGNGIAQNGYHVKELRKSTPITYEDLKDY
FT                   NVFIVPEANIPYKKSEQDAMLQYVKNGGSIFFIADHYNADRNKNRWDSSEVFNGYRRGA
FT                   WDNPAKGMSNEEANSQAMQGVESSDWLSDNFGIRFRYNAIGDVAAKNIVSPEQSFGITE
FT                   GVSSVAMHAGSTLAITNPKLAKGLVYLPENPSKWNNAVDSGVYNGGGVAEGPYAAIAKV
FT                   GLGKAAFIGDSSPVEDATPKYVREDSGQTKKTYDGYKEENDAILLENIVNWLSNKETFT
FT                   SLDQVNGLQLDLPTTLQTFEQPSLSTEPQPEPWSAPNAGYQWFNTNTFKPGSYGYNGAV
FT                   TANDYVVTHPSILPNNEVFQMKIQVNNLLPNTTYDNYSLGIFTTGGTQVAKVQNTNGTW
FT                   PSTFGYSSAFSFTTNSLGSAEKIVNVQINPNTTGQATLRLRQNTTAKYSETVTINKK"
FT   gene            complement(712648..714039)
FT                   /locus_tag="BAS0659"
FT   CDS_pept        complement(712648..714039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0659"
FT                   /product="amino acid permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0659"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52987"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52987.1"
FT                   /translation="MQHSNKSGTLNRGLKERHITLMSLGSAIGVGLFLGSASAIKLAGP
FT                   SILLGYMIAGLVIFFIMRALGEMAIEQPVAGSFSKYAYDYLGPLAGYITGWNYWFLWVV
FT                   TCMAEITAAGIYMQYWFPDIPRWTWALLALLLMSAFNFLSVKVFGELEFWFALIKIVTI
FT                   ICMIVVGAGIILFGFGNGGIATGISNLWSHGGWFPNGFSGLLLSMQMVLFAYLGVELIG
FT                   VTAGEAQNPKKTLAKAIDNVFWRILLFYVGALFVMMAIYPWNELGEKGSPFVLTFQQIG
FT                   IAKAAGIINFVVLTAALSSCNGGLFSTGRMLYTLAQQKKAPERFGRLNKNGIPSQGIVA
FT                   TAIVLLIGVILNYLVPAKVFTWLTSISTFGAIWTWGIILVAQIKFRKSLPTQNRQKLSY
FT                   KMPLYPLSSYFSLAFLVLVLGIMAYSEDTRIALIVGPIWLIGLAIVYYMKGFHKIDETP
FT                   NSKIS"
FT   gene            714320..715612
FT                   /locus_tag="BAS0660"
FT   CDS_pept        714320..715612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0660"
FT                   /product="xanthine/uracil permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0660"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52988"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52988.1"
FT                   /translation="MFQLQKYNTSVKQEFLAGITTFFTFAYILVINPKILSDAGVPFDQ
FT                   AFTATIIATVVGTIGMAIFANYPIVIAPAMGMNAYFAYSVVQKAEGITYVIAFSAVFVT
FT                   GIIFLLLSFTSFRQKLILAIPDSLKHAIAGGIGLFIAFIGLRLFGIIVDHPSNLVTIGD
FT                   FHSPAVILTLIGLILAAVLMALRVSGALFISMIVTGVIAFFTGQLKFTDKIVAMPHLPE
FT                   GIIVSNPINAFSDVIEYGLYGVVFSFLLVLLFDTTGALLGLIKQAGLITDNTEKRFGKA
FT                   FIADAIGGTTGSIFGTSPTAATIESSAGIAAGGKTGLTGIVVVGLTIITAFFSPVIASL
FT                   SSVAAITAPSLIIVGSLMAQSIRDINWNEFEDALPAFLIFVGIPLTSSIANGIAIGFLV
FT                   YPVLKIVKGKGMEVHPLLYLFTILFGCHLFL"
FT   gene            715744..715944
FT                   /locus_tag="BAS0661"
FT   CDS_pept        715744..715944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0661"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0661"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52989"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52989.1"
FT                   /translation="MAVSKIKVARVQLDLTQQQLAEKVGVTRQTISLIEKGKYNPSLDL
FT                   CLKICYAVDKTLNDLFWEEKE"
FT   gene            715949..716377
FT                   /locus_tag="BAS0662"
FT   CDS_pept        715949..716377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0662"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0662"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52990"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52990.1"
FT                   /translation="MKIVKDERLMIEGLKHIRLVFILQNIFILGIVFYRYVLQDAGYES
FT                   VSDLLMVFMGGIVVINFLNLKNSVEVYEHTGGVSRSYFMKLLLVPVSIVIGILAICIVV
FT                   TPDISIKEISMTGLIMFACFLVPSLFIYIYMKKIKSED"
FT   gene            complement(716415..716852)
FT                   /locus_tag="BAS0663"
FT   CDS_pept        complement(716415..716852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0663"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0663"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52991"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52991.1"
FT                   /translation="MITVKNIDGSETYVLRQKILRSSQTLADCKYSSDYETDTFHLGAF
FT                   INDKLISIASFSKEMHPDLQAGMHYRLRGMATLPEFRNNHAGSSLIQKAEQILQERQAN
FT                   ILWCNGRVTVANYYKRLGFQEHGEIFEIEPIGLHKVLYKRI"
FT   gene            complement(716867..717106)
FT                   /locus_tag="BAS0664"
FT   CDS_pept        complement(716867..717106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0664"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0664"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52992"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52992.1"
FT                   /translation="MRMDYIMSIITLALLLLAEILVAIILIGVSIEICSYGWKKSNGIK
FT                   YSCLLLSLLLGTASILGLFAAPAYFFIQLTEKAL"
FT   gene            complement(717178..719007)
FT                   /locus_tag="BAS0665"
FT   CDS_pept        complement(717178..719007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0665"
FT                   /product="sodium/hydrogen exchanger family protein/TrkA
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0665"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52993"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52993.1"
FT                   /translation="MEHHTSVLSLMVVVAIAFFVPLLLQRFKLKALPVVVAEIIAGIFV
FT                   GKSGFNIIEPDMWLQVLSTLGFIFLMFLSGLEIDFSIFKQKGKKNTTNEPNTFQAASVI
FT                   FLFIFILSYALSLLFVWLGFVDNAMFMTLIISTISLGVVVPTLKENNLGKTAIGQIILL
FT                   VAVIADLVTMILLAVFVGLNSESGQSMWLLLLLFGAGIVIYFVAKRFKNIPYLDSLKAG
FT                   SVQIDTRAVFALILILVGLSESVGAENILGAFLAGVLVSLLSPNEDMVEKLDSIGYGFF
FT                   IPIFFVMVGVNLEVWSIFKEPSSMLMIPILIVGLFISKLIPSLVLRKWYPRNIVLGSAI
FT                   LLTSTLSLVIAAAQIGEKLGIISPSLSASLILSAVITCIFAPILFKKMFPKVETPKPKV
FT                   SIIGASRITLPLSLDLKREDYDVTLYMMRQNKINDEEAKSHDFPIVKLDDITIASLTEQ
FT                   TAFHADRVVVATSDDEQNLLLAEHAKELGVEHVIASVEDPLLQEKATQEHIAVFSTINS
FT                   TRILLRALIDKPSLVRLITTANETVREVELRSNKYNGVALRRLPFLGDVLVIQIYRGNK
FT                   ALIPHGDTRLQHGDTLLVTGSKEHIDTLKSILE"
FT   gene            complement(719229..719540)
FT                   /locus_tag="BAS0666"
FT   CDS_pept        complement(719229..719540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0666"
FT                   /product="quinol oxidase, subunit IV"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0666"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52994"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52994.1"
FT                   /translation="MGQNNNQANGHAHSGFPWSHVFGFILSLALTFLALYVALYTNLPL
FT                   STILTTIIAMAVAQALLQLIMFMHLKEGEGRVQILTMIYSFFVATATVGLTVWIFFSM"
FT   gene            complement(719541..720143)
FT                   /locus_tag="BAS0667"
FT   CDS_pept        complement(719541..720143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0667"
FT                   /product="quinol oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0667"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52995"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52995.1"
FT                   /translation="MAALDKSLPLEYQSEQSRLNILGFWIFLGAEIMLFATLFASYLVL
FT                   AGRTADGPTPAQLFELKTLLIQTLLLLTSSFTCGIVIHEMRKHNQKAMLGWFVLTLLLG
FT                   AGFLFFEIEEFIMYIGEGATIQTSAFLSGFFVLLGTHGAHVTGGIIWAICVIIQILKRG
FT                   LTPVTARKVFIISLYWHFLDLVWVFIYTLVYLNGMVA"
FT   gene            complement(720157..722100)
FT                   /locus_tag="BAS0668"
FT   CDS_pept        complement(720157..722100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0668"
FT                   /product="quinol oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0668"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52996"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52996.1"
FT                   /translation="MNTVKLDEFFVTGDPIIYGADASIVLVTLAIIFVLTKYKKWKWLW
FT                   DEWLTTVDHKKIGAMYIISAVIMLFRGGMDGLMIRAQLTFPETTYLNAEHYNGIFTTHG
FT                   TVMILFMAMPFVMGLMNLVVPLQIGARDVAYPFLNALSFWLFFVGAMLFNIAFVIGGSP
FT                   DAGWTSYFPMAGTEFTSGVGNNYYAIALQISGLGTLMTGINFLVTILKMRTPGMTLMRM
FT                   PMFTWSILITTIIIIFAFPVLTVALALMTFDRLFDAHFFTMASGGMPMLWANLFWVWGH
FT                   PEVYIVILPAFGIFSEIISTFSRKRLFGYSAMVYSMVAISLLSFVVWLHHFFTMGAGPA
FT                   VNSFFSISTMAISIPTGVKIFNWLFTLYKGRIRFTVPMLWSLAFIPNFVVGGVTGVMLG
FT                   MAAADYQYHNSYFLIAHFHYVLIAGTVFAMLAGFTFWYPKMTGHMLNERLGKWTFWIFM
FT                   SGFNICFFPMYFLGLDGMTRRMYTYSESLGWGWLNQIASVGAVMMGIGFLLLCYNVIWS
FT                   ARHGERDTTGDPWDGRTLEWATQSPVQHYNFAKLPEIKEADAFWYMKKRGETVTPAAED
FT                   IKPIHMPSNSGVPIIASGFFGLAGFALVFSWFWLAAIGGIGILACLIYRSFDYDEGYYI
FT                   SVDEIKKSEHVA"
FT   gene            complement(722125..723000)
FT                   /locus_tag="BAS0669"
FT   CDS_pept        complement(722125..723000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0669"
FT                   /product="quinol oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0669"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52997"
FT                   /db_xref="GOA:Q81V01"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006332"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR034227"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81V01"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52997.1"
FT                   /translation="MQLKKAFWKLASLLPLSLLLFLGGCDKKLAVLNPQGPVAKAQYDL
FT                   IVWSFLLMSLIIAIVFILFTVILIRYREKPENMDYEPPEQHGNTLLEIIWTLVPVIIVI
FT                   ALSIPTVKATYASEEVPKESKHIKPVEIYVTSANWKWLFSYPEEKIETVNYLNIPAGVP
FT                   IQFKLTSVGPMNAFWVPELGGMKYTMDGMIMDLYLQADKPGSYLGRSANFSGEGFTHME
FT                   FEVEAKTKEKYDKWVKEVQQTAPKLTEDKYNEIVKPGVVGRMTFSSHHLSYVDPKSLEY
FT                   CDYNYYKNKK"
FT   gene            complement(723282..723479)
FT                   /locus_tag="BAS0670"
FT   CDS_pept        complement(723282..723479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0670"
FT                   /product="amino acid permease domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0670"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52998"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52998.1"
FT                   /translation="MLLTSLLERFCELLFTFVSLVFIPDQRIALYCGIPFMVICCILYQ
FT                   MKYKKIVTFEQQRTISKRIN"
FT   gene            723536..724246
FT                   /locus_tag="BAS0671"
FT   CDS_pept        723536..724246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0671"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0671"
FT                   /db_xref="EnsemblGenomes-Tr:AAT52999"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT52999.1"
FT                   /translation="MKKLKYLFVFGIIFAAVFFIGKDKIIQKAQVLRLDFLSEMKEAAM
FT                   IENVPFIKQLPELPRGCEVTSLAMLLQYKGVQVDKMQLASEIHRVPFEQDGLRGNPYEG
FT                   FVGNIYTKAEPGYGVYNKPIFNLAEKYVSEKVINLTDRDVNDLYKVISSGSPVWVIINT
FT                   TFKPLAESSFETWNTSSGEVKITYFEHSVVVVGYDQNFVYVNDPLKNNPRFAVPRAEFE
FT                   KAWEQMGKQAITIL"
FT   gene            724379..725554
FT                   /locus_tag="BAS0672"
FT   CDS_pept        724379..725554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0672"
FT                   /product="N-acyl-L-amino acid amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0672"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53000"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53000.1"
FT                   /translation="MDVAKELVLSKDQLVEWRRHFHKYPELSFQEEKTSQFVFDILRKI
FT                   PCLEVSRPTKYSVMARLIGKQSGKTIAVRADMDALPIHEENEFDFISAYPGVMHACGHD
FT                   GHIAILLGVVHKLVEAREKIKGEVRFLFQHAEENFPGGAEEMVAAGVMEGVDYIVGAHL
FT                   WASLEVGKVGVIYGPAMAAPDVFKITIEGKGGHAGIPHETVDSIAIGTQVVSQLQQIVS
FT                   RLTNPLDSLVVSVTQFHAGTTHNVIPAQTEIEGTVRSLRHELREETEKRIEQIVKHVTE
FT                   AYGAKYTFSYEYGYRPVVNDYEVTEIIEQTALQLYGRERVTRLQPTMAGEDFSAFLQKV
FT                   PGTFFFIGAGSKEKGIIYPHHHPRFTIDEDALPIGVQVFVSSIMNFISKGE"
FT   gene            725556..725753
FT                   /locus_tag="BAS0673"
FT   CDS_pept        725556..725753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0673"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0673"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53001"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53001.1"
FT                   /translation="MKKIHVLALIPVFCLVVGPVFANSVTPYILGMPFLLFWILLSVLI
FT                   TSLCMGIVYVFDPANKGDVK"
FT   gene            725750..727222
FT                   /locus_tag="BAS0674"
FT   CDS_pept        725750..727222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0674"
FT                   /product="sodium/solute symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0674"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53002"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53002.1"
FT                   /translation="MTALLIIILFLFLALFLGIRAQHGKDMNLEQWSVGGRGFGTIFVF
FT                   LLMAGEIYTTFTFLGGSGWAYSKGAPTFYILGYGALAYILSYFLLPPVWKYAKEHNLVS
FT                   QPDFFVKKYKSQALGLIVSIIGVISIIPYLVLQLKGLGIIVSEASYGRVSPVIAVWIGA
FT                   IVITIYVMVSGIHGSAWTAALKDIMILFIVMFLGIYLPYHYYGGFQPMFEAVEAAKPGF
FT                   LSLPDEGMSISWFVSTIILTALGFYMWPHTFASAFSAKNEKVFRKNAAIMPLYSLVLLF
FT                   VFFAGFAAILQVPGLKGGDVDLSLFRLALQTFDPWFIGIIGSAGVLTALVPGSMLVMAA
FT                   STLLAKNIYRTMVPSASDRQVAKVAKLFVPVVTLVAVLFTFKGGETIGALLLMGYSIVT
FT                   QLFPALVCSLFPRQTITKQGAIAGMGIGLLVVAYITLSGSTIATMFPGFPQYIKDLNVG
FT                   IVALLMNMIVMFIVSGFTKNVSIKKDNIIVEK"
FT   gene            727367..728803
FT                   /locus_tag="BAS0675"
FT   CDS_pept        727367..728803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0675"
FT                   /product="spore germination protein GerLA"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0675"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53003"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53003.1"
FT                   /translation="MKKIRDELGSPNDLTIREVALAGSFTRCAVVFLCGLTDKDNVYKY
FT                   VVRTLQYEEIQKDEAVVQTLLDRFISIAEVGKKTTFPDIINAILAGDTVILIDNIQTAI
FT                   VINSRAWEKRSLESPVTEDLIRGPRIGLNEDINVNKMLIRRSLRDPKLRFQSYIMGKRS
FT                   QKEVTLVYIEDIINPYIVKELDRRLQSIVTDVVFETGTIEQLIQDNNLSPFPQFLNTER
FT                   PDNIVASLAKGKAAILVDGSPFALIAPLVFVDIFQSVEDHYERWVIGTLLRILRMGSGI
FT                   VAILMPAMYVALVSYHQGLIPSKLAYSIAGAREGVPFPAYIETLMMALTMELIREAGIR
FT                   LPKPMGQTIGIVGGLVIGEAAVNAGIVNPFLVIIIAVTAIATFSLPVYSITITFRILLF
FT                   VFVLAATAFGLYGIILALIALAVHITNLTSVGVPYTTPIAPAFYKDWKEEFIRMPKSML
FT                   KERPEYLQTKDSTVRPKERE"
FT   gene            728804..729928
FT                   /locus_tag="BAS0676"
FT   CDS_pept        728804..729928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0676"
FT                   /product="spore germination protein GerLB"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0676"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53004"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53004.1"
FT                   /translation="MKPFEYGDEEIGSREIGFAVSSTIIGIGALSMPRDIANQTLFSDG
FT                   WIILLLGGLICAVLGWFVTRVAILFPKQNFVQYTSAHLTKPVAYTISMVLVLTFAALTA
FT                   YESRMIAIISQTYLFSETPVQLLSFFFLLVVIYGIAGSRAALLRLNVMFLPIVLIAIVL
FT                   LSLLNINLMEINNLFPAFQTEVSQYAVGVKNSIFTFIGFEVALFYAVLLNDKTAKKAPM
FT                   AVAKAVIVNVLSYILIYVTCISVFTYMTTRGLTYPTIELGKEIEIGGGFLERFDAIFFT
FT                   TWIITIYNTTAMYYDVASLLFCAMFPKVKKHIFIFGSAPLIFMLNMLPGNLDTLSSYGT
FT                   YLAWIDMGFVVLAPLLVFIVYKIKRRNGRNETPS"
FT   gene            729903..731078
FT                   /locus_tag="BAS0677"
FT   CDS_pept        729903..731078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0677"
FT                   /product="spore germination protein GerLC"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0677"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53005"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53005.1"
FT                   /translation="MVEMKHLLKIIMVIVLAGSISGCSELEEIEERGFVVGAAYDIVKK
FT                   KKSNPIMKGTYQMVLPSKLAQQGGQGDGDSENYINVSAKADSVFEQIRIIAKKISRTLF
FT                   FPHIQVIIFSDKLLANPYVLQNTLDVYFRDHEMRRNIRLFVSKKNAESILKQSAKPENL
FT                   PAQYIDMLAEHPPKNAQMIEAARIGEVQGKMIADRSFALPLLGLTKQGVQMEGAALIRG
FT                   KDNKCVGTLSGEQTLGMNYVIGKKIGGFFTVRKKNQLITYEIHKLRRKIQVSTENATKP
FT                   KFDIHLSTEGILAELHFNEPKQVMNEKFLKKEISKEMKKRIEKSIQLVQKKYKVDVLEL
FT                   GEVYKRHNYKEWKKISKNWDQGQNYFSNAEINVHVDPTIEHSGSALPKKVK"
FT   gene            complement(731289..732689)
FT                   /locus_tag="BAS0678"
FT   CDS_pept        complement(731289..732689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0678"
FT                   /product="Ferrous iron transport protein B"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0678"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53006"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53006.1"
FT                   /translation="MESHSASKALPLDYIIQHAQTLSKEDIRDDIVGDIYRTSASICKE
FT                   SVQYTNTDKLYRSEKLDKIFTSPIWGFPIMLGILSIIFYLTIAGANVPSDMIAEFFGWA
FT                   EGYLTSWFHAAHAPEWLHGILILGLFRGIGAVISVMLPPMAIFFPMFALLENYGYLPRV
FT                   AFNMDRLFKRSGAHGKQSLTMAMGFGCNAAAIMSTRIIESPRERMLAILTNNFVPCNGR
FT                   WPMLILMASLFMAAGYTGSMQTLVTAGVVVGMVVIGIIMTLTVSWVLSKTALKGVPTHY
FT                   TLELPPYRKPKVWNTIVRATLDKSVYVLKRAVVVAAPAAALTWLLANIFIGDTSLLMYF
FT                   VNFLDPFAKMLGLDGFILAAFILGLPANEIVIPILLMSYLSTGALTEIDDFNQIKNLFL
FT                   ENGWTWLTALNTMLFSLLHFPCGTTLVNIYKETKSAKWTFLSFAIPTVIAIVVTFLSTQ
FT                   LVHWLGLV"
FT   gene            complement(732667..733389)
FT                   /locus_tag="BAS0679"
FT   CDS_pept        complement(732667..733389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0679"
FT                   /product="Ferrous iron transport protein B"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0679"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53007"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53007.1"
FT                   /translation="MSKHRIALAGNPNTGKSTLFNTLTGLKQHTGNWTGKTVLKAEGEY
FT                   EHNGSKYTLIDLPGTYSLYSNSADEEVARDYIIFEKPEVTVVVIDATAMERNLNLALQV
FT                   MEMTSNVVICINLIDEAEKKGIVIDEKKLAKSLGVPVVKISARNRVGIGHLLNVIAKVA
FT                   NKKLIPTPIKVTYSEKIENMIRELEPQIYKVFGDTYPARWIALRILDGDKNFLTALQKH
FT                   HNEPLVREVVINGISLSQ"
FT   gene            complement(733386..733643)
FT                   /locus_tag="BAS0680"
FT   CDS_pept        complement(733386..733643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0680"
FT                   /product="ferrous iron transport protein A, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0680"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53008"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53008.1"
FT                   /translation="MVSANTKPLSEFKTGEFVQIEKIQLEGTMKRRLLDLGFIPGATIK
FT                   VLQRSPLGDPVAYQVSNTTIALRKEESSLIFGVLIGDDFR"
FT   gene            734129..735055
FT                   /locus_tag="BAS0681"
FT   CDS_pept        734129..735055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0681"
FT                   /product="phosphate ABC transporter, phosphate-binding
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0681"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53009"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53009.1"
FT                   /translation="MIIQMGVQDMVMKKGIKFSLAALVVAGSLVGCGKAEETSGKDAKG
FT                   SDNAKQELSGTIAAAGSTALQPLAEEAGKKFMEKNSNVSIQVQGGGSGTGINQVASGAV
FT                   QIGNSDVPSADKIKDADKAKELVDNKVAGIAFALVVNKDVKVDNLTVQQVQDIFTGKVT
FT                   NWKEVGGKDEKINVINRPASSGTRATFEKTIMKDAKINDGTGTTQDSNGAVEQAINSTP
FT                   GSVSYLAMSYMVGEKKGALQTVKIDGAEPKVENIASGKYPFWSYEYMVTKGEAKEATKA
FT                   YIDYVKGKDFEKQVEDMGYIPMSKLNK"
FT   gene            735123..736016
FT                   /locus_tag="BAS0682"
FT   CDS_pept        735123..736016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0682"
FT                   /product="phosphate ABC transporter, permease protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0682"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53010"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53010.1"
FT                   /translation="MMKGKKQINYVKSEYIGRSLVTFCGIFIVLVTLAIIAFICGKGIQ
FT                   SFTQSGISFTEMLTSTKWSPNADEGTFGAVIFIVGSTVVSLGAVIISAPIAIALAIFMN
FT                   LISPKFGNKVLKPVLELLVGIPSVVYGLLGVTILVPLLRDSFGGVGFSLIAGIVVLSIM
FT                   ILPTIASIASDAIRSVPFDYLEASYGLGSTKWQAISRVIVPAAKKGILTGVVLGLARAF
FT                   GEALAVQMVIGNTIKLPEGIYSPTATLTGILTMDMTNTLNGTAWNNALWTLAMILLVIS
FT                   FLFILVIRAIGQRGER"
FT   gene            736019..736939
FT                   /locus_tag="BAS0683"
FT   CDS_pept        736019..736939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0683"
FT                   /product="phosphate ABC transporter, permease protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0683"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53011"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53011.1"
FT                   /translation="MNARTVNKVWTGIFYAIAALVVALLVFLVFEILQKGWGFWDPNFL
FT                   FGEPSNTRAGGGIGPQLFNSFYMLVITLIISIPLGLGAGIYLAEYAKQGRFLNFVRLCI
FT                   ETMASLPSIVVGLFGLLVFVTMTGWGYTVMGGALALTILNLPGLTRVCENAISEVPSNV
FT                   KEASLGLGATKWQTITRIIIPSSLPQIITGVILAAGRIFGEAAALIYTAGLTSPILNSA
FT                   ADFSSPAHPLNPFRPAETLAVHIWKLNSEGIIPDAKLIATKSAAVLIIMVLLFNVISRL
FT                   VASILHKRFTGAKRKSKTTKKVKAA"
FT   gene            737125..737649
FT                   /locus_tag="BAS0684"
FT   CDS_pept        737125..737649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0684"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0684"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53012"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53012.1"
FT                   /translation="MFFLQMSGFPGSGKSTVSKYIGELTGAIIVDHDVLKSALLRSLEV
FT                   KGIESTIIGGLAYDAEWALIDSYLEQGHSVILDSPCLYEGMVGKGIKLSNKHGVKYKYI
FT                   ECYLNDMEEINMRLQTRKRLVSQIEKVESEVAFKKWLDGGKRPLNSEYLIVNSSEPLER
FT                   YAEKMMDYMSR"
FT   gene            complement(737693..740737)
FT                   /locus_tag="BAS0685"
FT   CDS_pept        complement(737693..740737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0685"
FT                   /product="transporter, AcrB/AcrD/AcrF family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0685"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53013"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53013.1"
FT                   /translation="MDRLTKFSLKNRAAVIIMVFLISILGVYSGSKLPMEFLPSIDNPA
FT                   VTVTTLSPGLDAEAMTKEVTDPLEKQFRNLEHIDNITSSTHEGLSRIDIAYTSKANMKD
FT                   ATREVEKAINTIKLPKDATKPIVSQLNTTMIPLAQIAIQKQNGFSKADEKQIEKEIVPQ
FT                   LESIDGVANVMFFGKSTSELSIILDPNQLKDKNVTTEQILKVLQGKETSTPAGAVTVNK
FT                   EEYNLRVIGDIKNVDDIKNITVAPHVKLQDVAQIELKQHYDTISHINGEEGTGLIIMKE
FT                   PSKNAVAIGKEIDKKIKDISKQYKDQFSIKLLASTHEQVENAVTSMGKEVILGAIAATL
FT                   IILIFLRNFRTTLIAVVSIPLSILLTLFLLHQSNITLNTLTLGGLAVAVGRLVDDSIVV
FT                   IENIFRRLQKEYFSKDIILDATKEVAVAITSSTLTTVAVFLPIGLVSGVIGKLMLPMVL
FT                   AVVYSILSSLIVALTVVPLMAFLLLKKIKHKKPSSSPRYVATLKWALSHKFIILLTSFL
FT                   LFAGSIAAYVLLPKANIKSEDDTMLSINMTFPADYALETQKQKAFDFEKKLLSNSDVTD
FT                   VILRMGSSAEDAQWGQTTKNNLASIFVVFKKGSDIDQYIKELKKEHNAFEPAELDYIKT
FT                   SYSSSGGGNNLQFNVTATNETNLKKAATIVETKLKNMDDLSKVKTNLEDSKKEWQIHVD
FT                   QTKAEQLGLTPELAAQQVAFLMKKSPIGEVSINNEKTTIMIEHKKESITKQEDILNTNI
FT                   LSPINGPIPLKDIATISEKQLQTEVFHKDGKETIQITAEASNEDLSKVSAEVNKAITDL
FT                   DLPSGAKVNIAGATESMQENFTDLFKIMGIAIGIVYLIMVITFGQARAPFAILFSLPLA
FT                   AVGGILGLIISGTPVDVNSLIGALMLIGIVVTNAIVLIERVQQNREHGMETREALLEAG
FT                   STRLRPIIMTAITTIVAMLPLLFGQSQAGSMVSKSLAVVVIGGLAVSTVLTLVVVPVMY
FT                   ELLDKIGRKRRSRRKINTSTETPDI"
FT   gene            741460..742969
FT                   /locus_tag="rRNA-16s-10"
FT   rRNA            741460..742969
FT                   /locus_tag="rRNA-16s-10"
FT                   /product="16S ribosomal RNA"
FT   gene            743145..746055
FT                   /locus_tag="rRNA-23s-10"
FT   rRNA            743145..746055
FT                   /locus_tag="rRNA-23s-10"
FT                   /product="23S ribosomal RNA"
FT   gene            746154..746272
FT                   /locus_tag="rRNA-5s-10"
FT   rRNA            746154..746272
FT                   /locus_tag="rRNA-5s-10"
FT                   /product="5S ribosomal RNA"
FT   gene            746275..746353
FT                   /locus_tag="tRNA-Val-4"
FT   tRNA            746275..746353
FT                   /locus_tag="tRNA-Val-4"
FT                   /product="tRNA-Val"
FT   gene            746362..746439
FT                   /locus_tag="tRNA-Gln-3"
FT   tRNA            746362..746439
FT                   /locus_tag="tRNA-Gln-3"
FT                   /product="tRNA-Gln"
FT   gene            746441..746519
FT                   /locus_tag="tRNA-Lys-1"
FT   tRNA            746441..746519
FT                   /locus_tag="tRNA-Lys-1"
FT                   /product="tRNA-Lys"
FT   gene            746531..746614
FT                   /locus_tag="tRNA-Leu-3"
FT   tRNA            746531..746614
FT                   /locus_tag="tRNA-Leu-3"
FT                   /product="tRNA-Leu"
FT   gene            746641..746718
FT                   /locus_tag="tRNA-Gly-5"
FT   tRNA            746641..746718
FT                   /locus_tag="tRNA-Gly-5"
FT                   /product="tRNA-Gly"
FT   gene            746732..746823
FT                   /locus_tag="tRNA-Leu-1"
FT   tRNA            746732..746823
FT                   /locus_tag="tRNA-Leu-1"
FT                   /product="tRNA-Leu"
FT   gene            746824..746900
FT                   /locus_tag="tRNA-Arg-3"
FT   tRNA            746824..746900
FT                   /locus_tag="tRNA-Arg-3"
FT                   /product="tRNA-Arg"
FT   gene            746908..746984
FT                   /locus_tag="tRNA-Pro-2"
FT   tRNA            746908..746984
FT                   /locus_tag="tRNA-Pro-2"
FT                   /product="tRNA-Pro"
FT   gene            746998..747073
FT                   /locus_tag="tRNA-Ala-3"
FT   tRNA            746998..747073
FT                   /locus_tag="tRNA-Ala-3"
FT                   /product="tRNA-Ala"
FT   gene            747091..747186
FT                   /locus_tag="tRNA-Ser-2"
FT   tRNA            747091..747186
FT                   /locus_tag="tRNA-Ser-2"
FT                   /product="tRNA-Ser"
FT   gene            747238..747333
FT                   /locus_tag="tRNA-Ser-5"
FT   tRNA            747238..747333
FT                   /locus_tag="tRNA-Ser-5"
FT                   /product="tRNA-Ser"
FT   gene            747351..747430
FT                   /locus_tag="tRNA-Met-2"
FT   tRNA            747351..747430
FT                   /locus_tag="tRNA-Met-2"
FT                   /product="tRNA-Met"
FT   gene            747432..747510
FT                   /locus_tag="tRNA-Asp-5"
FT   tRNA            747432..747510
FT                   /locus_tag="tRNA-Asp-5"
FT                   /product="tRNA-Asp"
FT   gene            747516..747594
FT                   /locus_tag="tRNA-Phe-3"
FT   tRNA            747516..747594
FT                   /locus_tag="tRNA-Phe-3"
FT                   /product="tRNA-Phe"
FT   gene            747601..747676
FT                   /locus_tag="tRNA-Thr-1"
FT   tRNA            747601..747676
FT                   /locus_tag="tRNA-Thr-1"
FT                   /product="tRNA-Thr"
FT   gene            747680..747753
FT                   /locus_tag="tRNA-Trp-1"
FT   tRNA            747680..747753
FT                   /locus_tag="tRNA-Trp-1"
FT                   /product="tRNA-Trp"
FT   gene            747761..747840
FT                   /locus_tag="tRNA-Ile-3"
FT   tRNA            747761..747840
FT                   /locus_tag="tRNA-Ile-3"
FT                   /product="tRNA-Ile"
FT   gene            747846..747923
FT                   /locus_tag="tRNA-Asn-2"
FT   tRNA            747846..747923
FT                   /locus_tag="tRNA-Asn-2"
FT                   /product="tRNA-Asn"
FT   gene            747922..747996
FT                   /locus_tag="tRNA-Glu-3"
FT   tRNA            747922..747996
FT                   /locus_tag="tRNA-Glu-3"
FT                   /product="tRNA-Glu"
FT   gene            748132..748551
FT                   /locus_tag="BAS0687"
FT   CDS_pept        748132..748551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0687"
FT                   /product="CBS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0687"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53014"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53014.1"
FT                   /translation="MTRVRDVMSTHIVQCTPLDNVYEAAVKMKEESIGLIPVVENEQVV
FT                   GLVTDRDLVVRGIAEKHPGSNKITNVMTTNIISVAPDDSLEKATELMAQHQIRRLPVVE
FT                   SDQLVGMLALGDLAIRESADDQAGFALSEISEHTE"
FT   gene            748846..749997
FT                   /locus_tag="BAS0688"
FT   CDS_pept        748846..749997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0688"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0688"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53015"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53015.1"
FT                   /translation="MKAVQRDPNWNLVTDTYIEPNNFAELFSLLVPCHPKGEGKERTIL
FT                   VWKEKEFYKEENLAAFIVYGMNKAKNLPQFHKDEIPTLVRILRLCQEIGWYEEANTFMV
FT                   NQGLAEFVHTSLEYETWDLLTQAVALNYLIIKYRIGELTDGDVEIWDRVKFNEKCITDC
FT                   KHLLSHKEVLEFTFFYMCKRAKSLSKEQLNSDMMSLAMYCNTFVYDLYTYDLLRKYRKC
FT                   TDFLSYYGPSQAVLACQRAVLSQISDRLDPLKTTHVDDYLYVMKDMMEHMTIGIMDRYD
FT                   HFIGKLLSYVPFFEMIQVPQHAYYCEELLYICKGIAYKEEILRNYLFIQLHDCLPSFFK
FT                   LFLKNKRYATIHDILFYWCDDEQRMSLERKYNLSFIYEKYACG"
FT   gene            complement(750226..750558)
FT                   /locus_tag="BAS0689"
FT   CDS_pept        complement(750226..750558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0689"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0689"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53016"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53016.1"
FT                   /translation="MPRNIPLLIEYLAFLGLICCLIIYNTNTLFLSIIIAFVALEIMME
FT                   AFQVQLKQKIAHIYNAIFLLSALITNIISNGFYLTTVFPVFFMAILLFIARYIHVPNNK
FT                   KHEQEA"
FT   gene            complement(750564..751724)
FT                   /locus_tag="BAS0690"
FT   CDS_pept        complement(750564..751724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0690"
FT                   /product="peptidase, M23/M37 family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0690"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53017"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53017.1"
FT                   /translation="MNMKATALTATTVAIASLLPSMGETNVQTANAEQLSNVKTGYVKV
FT                   HQVALHTKDNANSSSIDTIRFNTKVNILETTNGWYKVSVNNKVGYVQKDSILLKNKLQS
FT                   NNQYIVNANALNVRSEPNLESSILDVLPNGKFVTIQEEQGEWYKILHNGKAGYVQKAFV
FT                   SNDSQPLVKGITVQNNTKYTVATPKLNVRSNASTSSALLGSLQNGTQLQVVETVGTWYK
FT                   IRFGTGYGYVAKHYVVQNQTQSQTQTAQPTSIPAVFKFPTQGRISSTFDMRWEQMHYGI
FT                   DIAAQGNVSIQAAAAGKVVKSYYSASYGNVVFIAHQINGKLYTTVYAHMKDRTVQAGDQ
FT                   VQAGQLVGHMGNTGHSYGQHLHFELHNGEWNFEKTNAVNPLPYLVR"
FT   gene            752355..753050
FT                   /locus_tag="BAS0691"
FT   CDS_pept        752355..753050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0691"
FT                   /product="transcriptional activator TenA, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0691"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53018"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53018.1"
FT                   /translation="MKFCDRLLETVQPVWEMSHNHPFVVGMGDGTLEKDKFQYYIIQDY
FT                   LYLLDYAKLYAIGVVKATNPQVMGKFAEQIDGILNGEMTIHKQYAKRLGISIEEIESAK
FT                   PSAKNLAYTNYMMSVSQNGTLAELIAALLPCMWSYWEIGKRLNDIPGARDHEFFGEWIQ
FT                   GYSSEEYGNLCIWLIDLLNEMAVGKSEKELDRLEEIFLYSSRFEYLFWDMSYRKEMWGF
FT                   EEQEHTTVS"
FT   gene            753019..753768
FT                   /locus_tag="BAS0692"
FT   CDS_pept        753019..753768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0692"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0692"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53019"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53019.1"
FT                   /translation="MRSKNILQFHNVSFHYDEKPIINELNASIQDKEFVSIIGPSGCGK
FT                   STLFRLITGLEEASTGQIELTETKSHPVGYMPQKDMLLPWRTIIENAALPLECQGVQKK
FT                   EAQIKAKELLQKFGLQGYETKYPKDLSGGMRQRVSFIRTLLTGGEILLLDEPFSALDAL
FT                   TKASLQEWLFEQWKEWEKTILFITHDVEEALFLSNRIFVVENQPITTLTERIVPLDRNR
FT                   TRKDLYKPEVLALKDELLSMLQRQVLV"
FT   gene            753768..754520
FT                   /locus_tag="BAS0693"
FT   CDS_pept        753768..754520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0693"
FT                   /product="ABC transporter, permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0693"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53020"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53020.1"
FT                   /translation="MSRLKELIPALTLSSILLTMWEVGARIVDEMYILPSPSAIVMKIW
FT                   KLKDILFTVHLPATLYVVLIGVVISVVLGVGLAMLMNASSWMERAFYPLLVASQTIPIT
FT                   ALAPLFVLWFGYTIWSKVVVTVLITFFPIAVNTYDGLRSTKKEWEELLVTYGATKKDVF
FT                   LKLKLPSALPYFFSALKIAVPLSVIGAAIGEWLGAQAGLGYFSKRMMTQLDGAGVFAPI
FT                   VLLSLLAIFFVILISVLEKKFISWRKHS"
FT   gene            754517..755518
FT                   /locus_tag="BAS0694"
FT   CDS_pept        754517..755518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0694"
FT                   /product="ABC transporter, substrate-binding protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0694"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53021"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53021.1"
FT                   /translation="MKFLKRIFVFTLLVAMIAGCSSNSASDKSKKEKEITVMLDWYPNA
FT                   VHSFIYAAIEKGYFKEEGVKVNIKFPSNPTDPLTLAAAGKVTVGLYYQPDVVMAKANEQ
FT                   IPVKSIGAVVRSPLNHVVSLKSAGIQSPKDLEGKTVGYFGTPLSEMYLKTMVKEAGGNP
FT                   DTVKVVDVGFDLVPALITKKVDAVTGAYINHEVPVMRHEGHEPAYFNPADYGVPNYHEL
FT                   VFVTGDKTLKKDKEALQAFLRGAKKGYDFMKKNPDEALNILLNHQEKENFPLVPEVEKE
FT                   SMKILLEKMETKDEPFLSDSKESWEKQNKWLKDKGMTKEIVPANELFENILK"
FT   gene            755529..756149
FT                   /locus_tag="BAS0695"
FT   CDS_pept        755529..756149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0695"
FT                   /product="regulatory protein TenI"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0695"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53022"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53022.1"
FT                   /translation="MKNELHVISNGHMSFEELVSVAMQIESEIDYLHIREREKSTKELY
FT                   EGVESLLKKGFPASKLVINDRIDIAILLNIPRVQLGYRSTDVRSVKEKFSYLHVGYSVH
FT                   SLEEAIEAFKNGADSLVYGHVFPTECKKGVPARGLEEISDIARSLSIPIIAIGGITPEN
FT                   TKDILASEVSGIAVMSGIVSSSNPYSKAKSYKESIRKWAEKHV"
FT   gene            756142..757251
FT                   /locus_tag="BAS0696"
FT   CDS_pept        756142..757251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0696"
FT                   /product="glycine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0696"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53023"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53023.1"
FT                   /translation="MCKKYDVAIIGGGVIGSSVAHFLAERGHKVAIVEKQQIASEASKA
FT                   AAGLLGVQAEWDEYDPLFDLARESRAIFPQLAEVLREKTGIDIGYEEKGIYRIAQNEDE
FT                   KERILHIMDWQQKTGEDSYFLTGDRLREQEPYLSESIIGAVYYPKDGHVIAPELTKAFA
FT                   HSAAISGADIYEQTEVFDIRIENKKVIGIVTSEGMISCEKVVIAGGSWSTKLLGYFHRE
FT                   WGTYPVKGEVVAVKSRKQLLKAPIFQERFYIAPKRGGRYVIGATMKPHTFNKTVQPESI
FT                   TSILERAYTILPALKEAEWESTWAGLRPQSNHEAPYMGEHEEIKGLYACTGHYRNGILL
FT                   SPVSGQYMADLIEGKQENHLLDSLLSKTV"
FT   gene            757267..757470
FT                   /locus_tag="BAS0697"
FT   CDS_pept        757267..757470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0697"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0697"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53024"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53024.1"
FT                   /translation="MNLKINGNQIEVPESVKTVAELLTHLELDNRIVVVERNKDILQKD
FT                   DHTDTSVFDGDQIEIVTFVGGG"
FT   gene            757467..758243
FT                   /locus_tag="BAS0698"
FT   CDS_pept        757467..758243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0698"
FT                   /product="thiazole biosynthesis protein ThiG"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0698"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53025"
FT                   /db_xref="GOA:Q81UX4"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81UX4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53025.1"
FT                   /translation="MIMLNIGPFSFHSRLLLGTGKFPDFDVQQKAIDVSEAEVLTFAVR
FT                   RMDIFDAKQPNLLEKLDVKKYKLLPNTAGAKNAEEAVRIAKLAKASGLCDMIKVEVIGD
FT                   DRTLLPDPVETLRASEMLLEEGFIVLPYTSDDVVLARKLQELGVHAIMPGASPIGSGLG
FT                   IVNPLNLSFIIEQATVPVIVDAGIGSPADAAFAMELGADGVLLNTAVSGAKDPIKMAQA
FT                   MKLSIEAGRLGFEAGRIARKRCATASSPLEGMSVVE"
FT   gene            758236..759255
FT                   /locus_tag="BAS0699"
FT   CDS_pept        758236..759255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0699"
FT                   /product="hesA/moeB/thiF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0699"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53026"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53026.1"
FT                   /translation="MNNRYSRQELFSPIGEEGQQKIRKKHVLIIGAGALGSANAEMFVR
FT                   AGVGTVTIVDRDYVDWSNLQRQQLYVESDVENNLPKAVAAKKRLEEINSEVRVKALVQD
FT                   VTAEELEELVTNVNVMIDATDNFETRFIVNDIAQKYSIPWIYGACVGSYGLSYTILPSK
FT                   TPCLSCLLQSIPLGGATCDTAGIISPAVSLVVSHQVTEALKLLVEDYESLRDGLVSFDV
FT                   WKNEYSCMNVQKLRKHNCPSCGENALYPYLNKENTSKTAVLCGRNTVQIRPPYKEEMDF
FT                   ERYKELLNDRVNDLNVNPYLLSFSVEEKRLVAFKDGRVLVHGTKDISEAKTVYHRYFG"
FT   gene            759271..760083
FT                   /locus_tag="BAS0700"
FT   CDS_pept        759271..760083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0700"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0700"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53027"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53027.1"
FT                   /translation="MKVNKALTIAGSDSGGGAGIQADLKTFQELGVYGMTAITAITAQN
FT                   TLGVQGVYPVSLEGITEQLNSIGTDLTPDAVKIGMLFSSEIIQIVAEYINKFGWNNIVL
FT                   DPVMIAKGGASLLQQEAVQALKEYLLPVATVITPNVPEAEVLTGLEIHNIEDSKEAAKV
FT                   LHELGAKYVLMKGGHAEYQGNEVIDLLFDGEKFIEFRSERIPSKQTHGSGCTFASAVTA
FT                   GLAKGYSMEEAVQEAKRFISIAIEEPLHIGSGHGPTNHFAYKMNKAQV"
FT   gene            760525..760794
FT                   /locus_tag="BAS0701"
FT   CDS_pept        760525..760794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0701"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0701"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53028"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53028.1"
FT                   /translation="MRNCGFDWTYSCSKEQDFTSICECIKKVILLGDELPIVSFFTEHI
FT                   RFSFQAPITVVTRNKRYPARLYETIGAAFVVFTNCDNISFLFFE"
FT   gene            complement(760722..760904)
FT                   /locus_tag="BAS0702"
FT   CDS_pept        complement(760722..760904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0702"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0702"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53029"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53029.1"
FT                   /translation="MEKWGRASPILELALSIPPNDSLYLLVTTPSSPFHPPYSKNKKDI
FT                   LSQFVNTTNAAPIVS"
FT   gene            761749..763416
FT                   /locus_tag="BAS0703"
FT   CDS_pept        761749..763416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0703"
FT                   /product="potassium-transporting ATPase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0703"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53030"
FT                   /db_xref="GOA:Q81UW7"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81UW7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53030.1"
FT                   /translation="MIWVAVVITMLLFILVAKPTGIYLEKAFQGSKKLDKVFGPFEKLI
FT                   FKITGVKEYNQTWKQYALSLVLLNGFMIVVVYFIFRLQGVLPLNPAHIEGMEPTLAFNT
FT                   AISFMADTNLQHYSGENGLSYLSQLIGITFLMFAAPATTLALVMAFIRGLAGKELGNFF
FT                   IDFTRALTRVFLPIAFMAALVFVALGVPQTLDGAVTAQTIDGAKQSILRGPVASFVAIK
FT                   ELGNNGGGFFGANSTHPFENPGQMSNILQMMLMMLLPTALPFTYGRMVGNKKQGRILFV
FT                   SLFMVFLLGFITITTSELNGNPALNAMGIEHVQGSTEGKEVRFGTVFSSLYATVTTAAE
FT                   TGAVNTMHDTLTPIGGLVPLVNMMLNTVYGGVGAGFVNIIMYAIIAVFISGLMVGRTPE
FT                   FLGKKIEGKEMKLIAVTILFHPLLILGFSALALSTSLGTDAISHSGFHGLTQVVYEYTS
FT                   SAANNGSGFEGLGDNTPFWNITTGLVMFLGRYFSLITMLAVAASLKEKTVVPETVGTFR
FT                   TDNGLFGGIFIGTIVIVGALTFFPMLVLGPIAEFLTLK"
FT   gene            763427..765520
FT                   /locus_tag="BAS0704"
FT   CDS_pept        763427..765520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0704"
FT                   /product="potassium-transporting ATPase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0704"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53031"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53031.1"
FT                   /translation="MMRPVVVKEKRVNESHIHAVEDEVRQAKTMDRDIVKHAMKQSVAK
FT                   LNPKVMIKNPIMFVVEIGFVITFILSFLPSHSSSIPGWFNITVSLILLFTVLFANFAEA
FT                   LAEGRGKAQADSLKQSKKDVFANVVKENGEIVQVSATDLRKDDVVIVKQGEMIPSDGEV
FT                   IKGLASVDESAITGESAPVIKEAGGDFCSVTGGTMVVSDEITIVITSNPGKSFIDKMIS
FT                   LVEGAARQKTPNEIALNTVLTSLTLIFLIVVVTLPIFTNYLGFQIDTAVLVALLVCLIP
FT                   TTIGGLLSAIGIAGMDRVTKFNVLAMSGKAVEAAGDINTIILDKTGTITFGNRMAHTLL
FT                   PVGNETIEQVGKWAAISSVLDETPEGRSVIEYVQAKSISYNRELAEQGEFIPFKAETRM
FT                   SGVDLQDGMKVRKGAVGSVIEWVRSQGGTIPKDVNQKADFISKEGGTPLVVAVDNRIYG
FT                   LIYLKDTVKPGMRERFEQLRQMGIKTVMCTGDNPLTAATIAKEAGVDEFVAECKPEDKI
FT                   AVIKAEQDKGKLVAMTGDGTNDAPALAQADVGLAMNSGTTAAKEAANMIDLDSNPTKII
FT                   EVVGIGKQLLMTRGALTTFSIANDIAKYFAIIPAMFTLAIPQMEALNIMKLTSPLSAIL
FT                   SALLFNAVIIPLLIPLAMKGIAYKPMSSNALLGRNLLIYGLGGVIVPFIGIKVIDIIVG
FT                   LFI"
FT   gene            765537..766118
FT                   /locus_tag="BAS0705"
FT   CDS_pept        765537..766118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0705"
FT                   /product="potassium-transporting ATPase, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0705"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53032"
FT                   /db_xref="GOA:Q81UW5"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81UW5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53032.1"
FT                   /translation="MAKKQSILSPIIRITFTFLVLCGLVYPLIVTGIAQAVMKDNADGS
FT                   LIYNDKNEVIGSKLIGQNFTDPRYFHGRVSSIEYKAEASGSNNYAPSNPDLEKRVEKSI
FT                   EEWKKQNPSVPVTEVPIDLVTNSGSGLDPDISPKAASVQVERISKLTNIPKETLDQLIK
FT                   DQTEGAALGLFGETRVNVLKLNLGLQKIMK"
FT   gene            766181..767329
FT                   /locus_tag="BAS0706"
FT   CDS_pept        766181..767329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0706"
FT                   /product="sensor histidine kinase KdpD"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0706"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53033"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53033.1"
FT                   /translation="MLYADDYKPTFQRRTPEEYLEYIRQQNRGKLKLYVGAAPGVGKSY
FT                   KMLYDAREMKKDGMDIVIGLIETHGRKETEEAIADLEKVPLKEIQYKGKVFYELDVEGI
FT                   IKRAPQVVVVDELAHSNVPGSKNKKRYMDVQELIDAGISVLSAFNIQHLESVHDIVAQI
FT                   TNVKVRERIPDFILQKANEIQLVDATPEVLRKRLIDGKIYKEEKIQQSLQNFFTLNNLG
FT                   ALRELSLREVADDMDEKISQTVIEPIGVKEKILVCVQYSSTAEKLIRRGWRMADRLNAE
FT                   LYVLNVEREKIDSLSAGKKQTIEEWKSLTNQFDASFVLEEANGRKPADVIIEVAKRLQV
FT                   TQILLGQSARTRWDEIRKGSIVNEIMRETKYIDIHIVADQRA"
FT   gene            complement(767354..768535)
FT                   /locus_tag="BAS0707"
FT   CDS_pept        complement(767354..768535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0707"
FT                   /product="major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0707"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53034"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53034.1"
FT                   /translation="MKKSKLTFILYVVCMSALLGSFAQNIYTPILPMIQNSFHTSLYLV
FT                   NVTVSLFTFVLAIMQLIYGPLIDTKGRKSVLIPSLIISTIGSIGCAFSANIYLFLFFRA
FT                   VQAIGIAAIPVVAATIIGDLFEGKERGEAMSLYQMLLALAPAIGPLIGGYLGSINGHVS
FT                   VFLFLSILGILLLTINISLLPETKPTVSQQPQSKKNHWFILKNKTGFSITLIGFIQFCI
FT                   YFCFLVFLPSISTNLFHLTASEIGLMFVPMSLSIMLGSYCFKLLQKRFTTKQALFITSF
FT                   FNIICVTLFSFTYSINIPFIIIVTSLYGFSMGLSMPTHTTLLTEEFVQERATAIGMYNF
FT                   IRYLGMGTVPLVGGFLVFNQNYFWIFFLGAIMFLLIILYAMKMLRFPTTQKVK"
FT   gene            768676..769137
FT                   /locus_tag="BAS0708"
FT   CDS_pept        768676..769137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0708"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0708"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53035"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53035.1"
FT                   /translation="MKHAMKQMEILSDIRTLLHKKEEHLKRQNEKFLYETGVSSMSLSE
FT                   LHVIECIGKNGLMNVTAITTEMGMTKGAISKICTKLFQKQFVEKMQMLDNQKEIFFRLT
FT                   ESGNEIYKAHEKLHKQAEEKWLLLLDRYTKEEQDFIQRFVKDVSDHLEI"
FT   gene            769266..770120
FT                   /locus_tag="BAS0709"
FT   CDS_pept        769266..770120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0709"
FT                   /product="phospholipase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0709"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53036"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53036.1"
FT                   /translation="MLENTGLVLEGGGMRGVYTGGILEYFMEQDLYFPYVIGVSAGACH
FT                   AASYLSRQRNRNKTVNIDYASHPKYLSYKNLWRKRQLFDMDFIFHEIPEKHVPFDFETY
FT                   FNSPERFLVGTTDCETGQSVYFEKEGTNDDALNLLQASSSLPFIAPVVNYRGKQLLDGG
FT                   ISDPIPVRKAQEDGFKKSVVILTRNHGYAKKKSRFGWVAAKAYKKYPNLVNTMLNRYEV
FT                   YNETLHYIEKEEQAGNLFVIRPEVPLQVDRMEKDTAKLQSLYEQGYEDAKRQFADLKAF
FT                   LQK"
FT   gene            770137..770451
FT                   /locus_tag="BAS0710"
FT   CDS_pept        770137..770451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0710"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53037"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53037.1"
FT                   /translation="MGFSAVFFIIGFNAECWLYTFLGYGIRWIKVCREVIHMENVYKGL
FT                   RHTGYTMMLIFGGVFLLRWFIHDEMLLDQLIGCSVGMVMVISSVFIQKYSKELQVEEKY
FT                   "
FT   gene            complement(770549..771850)
FT                   /locus_tag="BAS0711"
FT   CDS_pept        complement(770549..771850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0711"
FT                   /product="xanthine/uracil permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0711"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53038"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53038.1"
FT                   /translation="MFNLSKHKTSIKTEIMAGIITFLTMAYIIVVNPVILGDAGVPFEQ
FT                   AFTATIIAAVVGTLFMAIFTNLPIAIAPGMGLNAYFSYSVVKAHEGMTFAIAFSAVFVA
FT                   GMILILLSFTSFRTKLMEAIPENLKHAITAGIGLFIAFIGLRLTGIVTKNEANLVGLGD
FT                   LHSAPVLLALAGLGITIVLMSLNVNGALFIGMLLTGIIAFFTGQLTFSNGVTSMPGLPE
FT                   GIIVSNPITAVSDVINYGLYGVVFSFFLVTLFDTTGTLLGVAQQGGFMKDGKLPKAGRA
FT                   LLSDSFSATIGSMFGTTPSTAYIESSAGVAAGGRTGLTTVTVAVLFALAAFFGPLVSAV
FT                   SGVSAITAPSLIIVGSLMMGSVRHIDWDAFDEAFPAFLVILSMPLTSSIATGIALGFIS
FT                   YPLMKVAKGKFRAVHPLVYVFGILFAYQLIFLPH"
FT   gene            772052..772918
FT                   /locus_tag="BAS0712"
FT   CDS_pept        772052..772918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0712"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0712"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53039"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53039.1"
FT                   /translation="MPQQKNFVTMPAQHQNKQPGIESLMNPLPQFEDPNYKGSEKLKGK
FT                   NVLITGGDSGIGRAVSIAFAKEGANIAIAYLDEEGDANETKQYVEKEGVKCVLLPGDLS
FT                   DEQHCKDIVQETVRQLGSLNILVNNVAQQYPQQGLEYITAEQLEKTFRINIFSYFHVTK
FT                   AALSHLKQGDVIINTASIVAYEGNETLIDYSATKGAIVAFTRSLSQSLVQKGIRVNGVA
FT                   PGPIWTPLIPSSFDEKKVSQFGSNVPMQRPGQPYELAPAYVYLASSDSSYVTGQMIHVN
FT                   GGVIVNG"
FT   gene            772985..773221
FT                   /locus_tag="BAS0713"
FT   CDS_pept        772985..773221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0713"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0713"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53040"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53040.1"
FT                   /translation="MKKLYFVILLFFILPVSAFANTDHLILVNLTTNQLSFFENGNYTK
FT                   TFPVTTGRDRTPTPEGNFCIINKYKNKEYHRKK"
FT   gene            773347..773745
FT                   /locus_tag="BAS0714"
FT   CDS_pept        773347..773745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0714"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0714"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53041"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53041.1"
FT                   /translation="MHDRDIQWLYDRVHLQTKVIISRFHTSPEYEANKLGYRVVSWNGR
FT                   KIEEEQIGILTLVDRVDIYWQEPNGQLTKVKTVLPNERYAVYSKRKDGIYYIGNNLYIV
FT                   DETGEKIRYEQIPSSILSNIYKRKYNVP"
FT   gene            773850..774101
FT                   /locus_tag="BAS0715"
FT   CDS_pept        773850..774101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0715"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0715"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53042"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53042.1"
FT                   /translation="MKSEFAFKVFLVTTCLFIVCLYAFLVFSFYVPYVDLILFFGFIWA
FT                   FVKAREGEKSIYRRITLCGTAVLVILYFFIMHDFWRGM"
FT   gene            complement(774112..775053)
FT                   /locus_tag="BAS0716"
FT   CDS_pept        complement(774112..775053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0716"
FT                   /product="fructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0716"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53043"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53043.1"
FT                   /translation="MRNVFCIGELLIDFVCRNTNVSLVNGSNFEKKAGGAPANVAAAIT
FT                   KLGGHATFMGQVGNDPFGEFLEQTLQHAHVDTSMLIKDKQTTLAFVSIDQNGERDFTFM
FT                   RGADGEYHFNSIDLSKIKTNDLIHFGSATALLSSPLKDTYFQLLQHARESGQFISFDPN
FT                   YRNALITNTEQFIQDCLTFIKHAHFVKVSQEEAIMLSKESDLQQSALKLLNHGAKAVAI
FT                   TLGKDGTLLATKDKQTIVPSISIQQVDTTGAGDAFVGAMLYQIAKSEQMFLHNFEGLTT
FT                   FISFANKVGALTCTNYGAISSLPSLTDVKAYE"
FT   gene            complement(775050..776525)
FT                   /locus_tag="BAS0717"
FT   CDS_pept        complement(775050..776525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0717"
FT                   /product="sucrose-6-phosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0717"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53044"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53044.1"
FT                   /translation="MSKYKTILQSNKDELHSLYEIANQDSWKPIYHIHPPFGLMNDPNG
FT                   VSYYNDEYHVFYQWYPFGPIHGMKHWGHVKSKDLINWERMPVAIIPTESYESHGAYSGS
FT                   AIVKDDLLHLLYTGNIKNPDDSRDAKQCMATMDSQYTMTKYSNNPVIDIIPDGYTKHVR
FT                   DPKVWKHNDIYYMLLGAQRKNKTGTLLLYKSKDLYNWNFQGEITTNLKEFGFMWECPDY
FT                   FQLSGKDVLLFSPQGIEKDREDFHNIYNVVYAIGHFDIKNLYFHIDSYYEADKGFDFYA
FT                   PQTLEDSTSRRLLFAWAGSSEITYPSDDYMWAHCLTLPRELTLEDNILKQKPVSELTKL
FT                   RTTKKEISGDITAGLNVLSTLDNEGSYELIVTLKTEDAKRFGLSLFHNEEECFPITFNR
FT                   EQGTISIDRGNFYHQFGGEYGFERCKKIDIQDTIELQIFVDKSIVEIFLYDGSTVFTSR
FT                   VFPRKDMKHHIAIFSDAKLNFTITQYKLKRGIV"
FT   gene            complement(776543..777919)
FT                   /locus_tag="BAS0718"
FT   CDS_pept        complement(776543..777919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0718"
FT                   /product="PTS system, sucrose-specific IIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0718"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53045"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53045.1"
FT                   /translation="MNMKQIATQVLQNIGGKENIMRATHCATRLRLVLKDETKINASEI
FT                   ENIDEVKGAFATTEQYQIIFGTGIVNKVYDEFSKLIGIAELDSTRSNDIPKKKMNPIAR
FT                   LAKTLSNIFVPIIPAIVASGLLMGLLGMLKAFKLVPGDHSLIQLLDMFSSAAFIILPIL
FT                   IGVSAAKEFGGNIFLGAVVGGILTHPSLTNPWTLSNAKPTVLHFLGMDIDMIGYQGTVL
FT                   PILLCVYVMSTIEKELRKRVPNSLDLLVTPFLTIIITGFLSLIIIGPIGYKIGDGITYL
FT                   LNTIYQFAGPVAGLIFGGLYSTIVLTGLHHSFHAIEAGLLANKDIGVNFLLPIWSMANV
FT                   AQGGATLAVYFKTKNKKTKEIAIPAAASAFLGITEPAIFGVNLKLGKPFIAAAIGGAIG
FT                   GAYVVWMQVAANAYGLTGIPMLTIVAPLGMMNMIHYIIGFAIAVTTAFVATFILYKESK
FT                   "
FT   gene            complement(778048..779034)
FT                   /locus_tag="BAS0719"
FT   CDS_pept        complement(778048..779034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0719"
FT                   /product="sucrose operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0719"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53046"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53046.1"
FT                   /translation="MTKTIADIAKLAGVAKSTVSRYLNGGYVSDKTKLKIESIIQETNF
FT                   SPNTFAQSLKAKTTNLIGVIIPRLDSFATMKTLIGIDNTLQENNYQMLVANANQTIETE
FT                   IQAMENFIKQRVAGIILLTKTLTNKHQQIIANSNIPILFVGQEYKDQYCLVHDDYDAAY
FT                   ELGAYVLSQGHRNIAYLGVEKDDISVGINRKNGFQKAIENLEPTCSVCYYETSFHIEDA
FT                   MKQVQHILDNNRPTLIVCATDNIALGAMKVIHSHSLSVPGDISVTGFGGYDISEMVHPS
FT                   LTTIAFDYEYAGKLAATSLSQLVENKTIPKILHSRYTLKIQESVDKI"
FT   gene            complement(779152..779367)
FT                   /locus_tag="BAS0720"
FT   CDS_pept        complement(779152..779367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0720"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0720"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53047"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53047.1"
FT                   /translation="MPEVRCSVSNCSFWGQGNFCQASAIIVQPDADESGQTENNSYTNA
FT                   VLTNETLESSVATSVETCCHTFKPRY"
FT   gene            complement(779440..779859)
FT                   /locus_tag="BAS0721"
FT   CDS_pept        complement(779440..779859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0721"
FT                   /product="thioredoxin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0721"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53048"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53048.1"
FT                   /translation="MKKMLIFGGIIIVLFAAIFAVTQMEKKNASTDEKGYYSNKISLED
FT                   LNKNIEDKKEQTISFYQTSCVHCQKVSPIVVPLAKDLNVDMKVIDIENLNEPWDKYNIQ
FT                   GTPTIIHFKDGKEVSRISGEQSKDKFKEWFEQTKK"
FT   gene            complement(779872..780291)
FT                   /locus_tag="BAS0722"
FT   CDS_pept        complement(779872..780291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0722"
FT                   /product="disulfide bond formation protein B , putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0722"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53049"
FT                   /db_xref="GOA:Q81UU9"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR012187"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81UU9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53049.1"
FT                   /translation="MGREKKQEYALFTAWGASFIATLGSLYFSEIMKFEPCVLCWYQRI
FT                   FMYPFVLWLGIAVVKKDYRIASYSLPIASIGACISLYHYVIQKVAAFSAAGAACGRVPC
FT                   TGEYINWFGFVTIPFLALIGFITIAVCSFIVIKNK"
FT   gene            complement(780457..780705)
FT                   /locus_tag="BAS0723"
FT   CDS_pept        complement(780457..780705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0723"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0723"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53050"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53050.1"
FT                   /translation="MQKYNDYDKALYYTYCCNWDKLLVLMVQTNDQLFSKRIEHFLHAY
FT                   QYSKELPEVDKQLQLLFQYIDHASQKSHVEEVEQIQM"
FT   gene            complement(780822..781331)
FT                   /locus_tag="BAS0724"
FT   CDS_pept        complement(780822..781331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0724"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0724"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53051"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53051.1"
FT                   /translation="MKKYVFSLLAVLSLILAGCGSSGTNEKKSSESKEEHDHASHTQQA
FT                   DIQEKTKGVDTLPTFLDKLDPQMKDIYTVAGQNAELLDWIPCYCGCGESVGHKNNKNCF
FT                   IREIKKNGEVVWDSHATTCVNCLEIAVESASMKQKGKSTLEIRNYIDNKYKEGYGKPTP
FT                   TPMPKA"
FT   gene            complement(781377..782255)
FT                   /locus_tag="BAS0725"
FT   CDS_pept        complement(781377..782255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0725"
FT                   /product="spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0725"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53052"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53052.1"
FT                   /translation="MFRKMDWKNFSICFAAYLLLFCLTVLRTYIEVIQVWVFPTIKPWK
FT                   LTLLFLLVAYYIIRGGFRSVTGICFWGVIIPIFVLLFLVFPMKYAHVRNIFPILNHSPL
FT                   EILTSAKASALEFLGFEAILVFYPFIKKGKSLNKWAHGGIAFTTILYVILAIVSLMYYS
FT                   PGQLHHTIWPTLTMLKIIKVPFIQRFEYIIIFLWYLIILPNLCLTILSSCCISKKSFHI
FT                   PFKITLPLFIAAIFISSLFFTNREGINTLNTVLSQAGLYIVYAYIPILFVFHSLRWHFK
FT                   NRSKKSSPDTP"
FT   gene            complement(782498..783493)
FT                   /locus_tag="BAS0726"
FT   CDS_pept        complement(782498..783493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0726"
FT                   /product="spore germination protein GerYC"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0726"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53053"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53053.1"
FT                   /translation="MIHVGGFDITKNKKFRGTILYPDYTKGVQSKPETQSTHAGTIETI
FT                   SSLLNAKSPHTIAVGQMRVVLFGKAFGEHGLGDVINNLQRDPNIGRDVQLALVDGSSEE
FT                   LLKHVRTNGSLYLSELLEQNIKTETIPRTALNIFLYNFYSSGCDPFLPYIQVSEDKSAS
FT                   IKGLAFLKKDKVAMYTDRKRSFLFKLLINPTKNGRYEVPIRQGKHKGVIATQNLSGNSV
FT                   CSLSSNGDIPKVNIHLKLNGLVKNAPSWLDLSKGKNVTYVKRHIEKMLEKDLNELIKQF
FT                   QENKIDPIGIREEIRSHSRKWSMKQIQDMYPNVDIAVNVKINVVQSGIGE"
FT   gene            complement(783577..785082)
FT                   /locus_tag="BAS0727"
FT   CDS_pept        complement(783577..785082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0727"
FT                   /product="spore germination protein GerYA"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0727"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53054"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53054.1"
FT                   /translation="MFHLSSKKKKQTFCSIPDFIHAMKKSSDFSSYNIIEDGTLCLFYY
FT                   KSTVESLIIKRFILAPIKNKLDEIQHIDDILNVVSIEDTLINPSIDDIREKLLGGYVLL
FT                   QLKKGSGQAAYALLRAESTVLGTRLVNDTENEYSVIGPKVGFVENVDINIHLLRRNIVT
FT                   EQLIFKEVSIGSMSKTKIVVAYIEGITNEQHINTAMQRLQDIDFDYPFDATLVEQLISD
FT                   NSNSPFRVLLPTERLDRSVYALLNGGVVILTDGSPYALAGPATLLDFFVSPEDYYLPWI
FT                   AGSFLRLVRFFGAAFSLFSSAIYTAVLTYHYQMIPADLLGPIIYSRANVPFPPVLEALF
FT                   LEITIELLREAGARLPTKVGQTIGIVGGIVIGQASVEAALTSTILLIAVALSALASFTT
FT                   PTVKMSSTIRILRFPLIILAGAFGGVGLIVGFVFILAHLIHLKSLGSPYLLPLYPFRGL
FT                   GTAEGLLRLPFSQTAERASFLRPKKKWRYDPNKAKEKRDGEEK"
FT   gene            complement(785207..785452)
FT                   /locus_tag="BAS0728"
FT   CDS_pept        complement(785207..785452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0728"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0728"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53055"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53055.1"
FT                   /translation="MQKSTPDGLKQKMKEYNIGLRQLTVLTIISQKSNTPLDDVLKMKK
FT                   DEMDMKQIAEKLNVKKEDIRAEMIKLVKSIKEKKTN"
FT   gene            complement(785458..785844)
FT                   /locus_tag="BAS0729"
FT   CDS_pept        complement(785458..785844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0729"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0729"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53056"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53056.1"
FT                   /translation="MCKVFHIIHLGGVYMYKKIVVSMTMAALLCGISTFPASAATPKEV
FT                   TLHHHKPISEEEMQSLEKLGYNKHEIWKAAHIAKMSKKEIKDVLAYYKQNNSWEKTAEH
FT                   FGVDPSKLKKHHMNKETKKHYCNN"
FT   gene            786035..786595
FT                   /locus_tag="BAS0730"
FT   CDS_pept        786035..786595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0730"
FT                   /product="nitroreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0730"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53057"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53057.1"
FT                   /translation="MTTYTSIANVIKERRSVRTFTDKAVDKELLIELLNDATWAPNHKH
FT                   REPWNCKLYIGEGRQKLVDAVLNSFTEEERAKRGKILSDRFLSTPAQIVVYINEDPRQI
FT                   QRDEDYAATCAFMQNFQLLAWERGLGCVWKSGGLNYNPLFIEGLGLTRGQRIVGILHLG
FT                   YFDKSPEGKARTPITEKMEIIEG"
FT   gene            786711..788129
FT                   /locus_tag="BAS0731"
FT   CDS_pept        786711..788129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0731"
FT                   /product="stage V sporulation protein R"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0731"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53058"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53058.1"
FT                   /translation="MRASDDKALQYAIAEITEIATGFGLDFYPMRYEICPAEIIYTFGA
FT                   YGMPTRFSHWSFGKQFFRMKLQYDLGLSKIYELVINSDPCYAFLLDTNSLIQNKLIVAH
FT                   VLAHCDFFKNNIRFSNTKRDMVESMSATAEWVKAYEHKYGKEEVETFLDAVLAIQEHID
FT                   PSLMRPKLAWSIDDLEEEEVEKKKASQYDDLWNLDNRNKKQERSNVRKKKKIPPQPEKD
FT                   LLLFIEEYSRELEDWQRDILTMMREEMLYFWPQLETKIMNEGWASFWHQRILREMDLTS
FT                   DEAIEFAKLNAGVVQPSKTSINPYYLGIKMFEDIEERYNNPTEEMKRRGVKPGSGRDKI
FT                   FEVREIEWDVSFLRNYLNKDLVMREDMYLFQRQGKEYKVIDKEWEHVRDQLVNMRTNGG
FT                   FPYLVVEDGDYLKNGELYIKHSYEGIELDLKYLEKVLPYLHQLWGRTVHMESIVESKGV
FT                   VFSYDGKMVHRKYV"
FT   gene            788237..789499
FT                   /locus_tag="BAS0732"
FT   CDS_pept        788237..789499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0732"
FT                   /product="alkaline ceramidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0732"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53059"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53059.1"
FT                   /translation="MSKVGVCKVDITPPIGIDFVGYHRETGINNIEEHIYGTVFVFEKD
FT                   EMKIVFISIDNIGMLVEDTNMIREQVASELHVPFERITVVYTHTHSGPETVGDDPLVQS
FT                   YKTILVNNVVHGAVTANKNLKQCEVGWGVTTGDIGVNRRERTFDGRAKMGTNIEGVVDK
FT                   RIGMLAIRHAETKELSGIVVFCTAHPNVLKGDSDVLSADYPGMTREILEKIVNCPVIIV
FT                   QGAAGNVNAKYRGSREALKKMAYTLSGHVLTMLPTVTYSPIVNVRTVSSTMQMKLKDIP
FT                   EMNEIRSMAQLVEKQWGVNTDEWLTIVLEKYKQGIRQLRIDLEVQLFQINDGIFSGIPM
FT                   EPFSETALEMKESLQNELAFFGGYTNGYIGYLPTKEEFAYGGYEVELSPVVYGPVTNLL
FT                   MPLEENTAELVVKRVMGLYNT"
FT   gene            complement(789621..790091)
FT                   /locus_tag="BAS0733"
FT   CDS_pept        complement(789621..790091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0733"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0733"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53060"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53060.1"
FT                   /translation="MDQTFNELDLTSLLSLSFSTLITELHDKLSELGFEDIRPAHGFMF
FT                   KRILPNGATGIELAEYLGVSKQAVSKMVDSLENSGYVTRKTHPTDKRGKIIVLTERGLA
FT                   VMKAKEEIVAEIEQRWIENIGTERMQMLKEDLTTFVTKENTEKLSSNIRPVW"
FT   gene            790189..790773
FT                   /locus_tag="BAS0734"
FT   CDS_pept        790189..790773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0734"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0734"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53061"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53061.1"
FT                   /translation="MVHIVKVRGSVFAPYALLEPIKDPATGRLFEYAGDAREFTPYAAN
FT                   AKRSRLEQEVNIDFYKREIFTYADACIVTVKITNPDGSTEYQKGEISTENIVCTNIVWG
FT                   EDEVSFEMRASASNPLNAAAPAADYLLAIRVNKSGTVHVEGVHDGFPCYEFYKQVDFGP
FT                   FESIYIHDFRETNDTPAALAGEMEYSFKTTV"
FT   gene            790907..791491
FT                   /locus_tag="BAS0735"
FT   CDS_pept        790907..791491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0735"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0735"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53062"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53062.1"
FT                   /translation="MTNIIKIRASVFIPMSWTEAKMDMETGQVIQFEGDSREFTPHAVN
FT                   TMRSRVEQEVVVDFYKQEVFSYANTGITTEKVISPDGSVNKRTGKASTENIVCTDIVWN
FT                   SGGVQFKMSASASNPLNVYAPPVDYVLNVCVKKDGSIDVQGEHDGFPCFEFYKQVDFGP
FT                   FEKIYTHDFRETGDTAAALGGNMDYSFTKRL"
FT   gene            791700..793364
FT                   /locus_tag="BAS0736"
FT   CDS_pept        791700..793364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0736"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase,
FT                   class I"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0736"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53063"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53063.1"
FT                   /translation="MSRKIVVVGGVAGGASVAARLRRLSEEDEIIMVERGEYISFANCG
FT                   LPYYIGGVITERQKLLVQTVERMSKRFNLDIRVLSEVVKINKEEKTITIKNVTTNETYN
FT                   EAYDVLILSPGAKPIVPSIPGIEEAKALFTLRNVPDTDRIKAYIDEKKPRHATVIGGGF
FT                   IGVEMVENLRERGIEVTLVEMANQVMPPIDYEMAAYVHEHMKNHDVELVFEDGVDALEE
FT                   NGAVVRLKSGSVIQTDMLILAIGVQPESSLAKGAGLALGVRGTIKVNEKFQTSDPHIYA
FT                   IGDAIEVKDFVTETETMIPLAWPANRQGRMLADIIHGHTDSLYKGTLGTSVAKVFDLTV
FT                   ATTGLNEKILKRLNIPYEVVHVQANSHAGYYPNATPVLIKLIFNKDSGKIYGAQTLGRD
FT                   GVDKRMDVIATAIKANLTVLDLPDLELSYAPPYSSAKDPVNMVGYAASNIVDGFVDTVQ
FT                   WHEIDRIVENGGYLIDVREPNELKQGMIKGSINIPLDELRDRLEEVPVDKDIYITCQLG
FT                   MRGYVAARMLMEKGYKVKNVDGGFKLYGTVLPERIVY"
FT   gene            793550..793813
FT                   /locus_tag="BAS0737"
FT   CDS_pept        793550..793813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0737"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0737"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53064"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53064.1"
FT                   /translation="MEYNQDMKNRLKRIEGQVRGVLRMMEEGKDCREVITQLTASRSAL
FT                   DRTIGLVVGTNLEQCLREQFESGNGSNEELIKEAVQLLVKSR"
FT   gene            793902..794462
FT                   /locus_tag="BAS0738"
FT   CDS_pept        793902..794462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0738"
FT                   /product="rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0738"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53065"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53065.1"
FT                   /translation="MSIKVDMSLDCKGLACPMPIVKTKKAIEGLASGQVIEVKATDKGS
FT                   TVDIKSWANKVGHQYIGTKHESDILMHYVRKAHEHEVNEVVKYPHTITNIELEEILVSG
FT                   EECTVLDVREAAEFAFGHIPSATSMPLGELESLVLDKTKQIYVVCRTGNRSDVACQMLK
FT                   EKGYTNVKNVIPGMIEWQGNIEN"
FT   gene            794501..795631
FT                   /locus_tag="BAS0739"
FT   CDS_pept        794501..795631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0739"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0739"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53066"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53066.1"
FT                   /translation="MEVKSLQAKDVAEKVLFGELFILDVRNETDYEDWKIEGKQISSIN
FT                   KPYFDLLDGVDQIVSELPKDKDVLVVCAKEGSSIFVAEQLTEAGLENIYYLAGGMKAWS
FT                   EYVKPIKVGDLKNGGSMYQFNRLGKGCLSYMVVSNGEAAVIDAIRTVEAYEQFAKENGV
FT                   TITNVMDTHLHADHISGGRKLAEKVGGTYWLPPKDAEEVVFSYEPLVEGSVITVGGTKI
FT                   EIDALYSPGHTIGSTSFIVDNSYLLSGDILFVDSIGRPDLAGKAEDWVSDLRNTLYSRY
FT                   KELSQSLIVLPAHYSKISEMDESGIVSAKLKDLFEHNAGLNIEDEGEFRKVVTENLPPQ
FT                   PNAYEEIRQTNMGKIHPSVDEEREMEIGPNRCAVHK"
FT   gene            795663..795893
FT                   /locus_tag="BAS0740"
FT   CDS_pept        795663..795893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0740"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0740"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53067"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53067.1"
FT                   /translation="MMNVKQVLDAKDLACPMPIVRTKRAMDTLQTGEVLEVQVTDKGSV
FT                   KDIPAWANKSGHDIVKHEEEGDVLKFWIKKA"
FT   gene            795952..796284
FT                   /locus_tag="BAS0741"
FT   CDS_pept        795952..796284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0741"
FT                   /product="rhodanese-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0741"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53068"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53068.1"
FT                   /translation="MYLLHGLLFHAFYLWKGVQNINGKELKSIVGKQGKYFIDVRTVGE
FT                   YRGNHMKGFQNIPLNDLASKTNQLDKNREVIVICQSGMRSKQAAKMLKKLGFQHVINVS
FT                   GGMNGL"
FT   gene            796299..796595
FT                   /locus_tag="BAS0742"
FT   CDS_pept        796299..796595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0742"
FT                   /product="conserved hypothetical protein, rhodanese-like
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0742"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53069"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53069.1"
FT                   /translation="MKEMIAKELEEKLLRKEAVNIVDVREVEEVAEGKIPEACNIPLGL
FT                   LEFRMHELDKKKEYIIVCRSGGRSARAVQFLEGYGFRVINMVGGMLAWEGKVE"
FT   gene            796656..797135
FT                   /locus_tag="BAS0743"
FT   CDS_pept        796656..797135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0743"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0743"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53070"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53070.1"
FT                   /translation="MEQQKKTTIVLFSGDYDKAMAAYIIANGAAAYDQEVTIFHTFWGL
FT                   NALRKDEHVEVKKTFIEKVFGKMMPRGADKMGLSKMNFAGMGPKMIKGIMKKHNAMPLP
FT                   DLIDLAKEQGIKLVACQMTVDLLGLKEEEIMEGVEFAGVGAYLADASDGNVNLFI"
FT   gene            797169..797933
FT                   /locus_tag="BAS0744"
FT   CDS_pept        797169..797933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0744"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0744"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53071"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53071.1"
FT                   /translation="MSLVVLLFIIGFIGSFISGMVGIGGAIINYPMILYIPVLLGFTGY
FT                   TAHEVSGITAVQVFFATFAGAWAYRKSNDMDKTLVVYMGASILIGSFIGSFGANALEEH
FT                   TVNVVYAALATIAAIMMFVPKRNNGDELKYNKWLASLLAFIVGGASGIIGAGGSFLLVP
FT                   IMLVILKLPIRRTIATSIAITFISSVGITTGKVITGQVVVMPALIIAIASIFAAPLGAR
FT                   VGKRINQKALQYMLSILIVGTAVKMWIDMISK"
FT   gene            complement(797967..798407)
FT                   /locus_tag="BAS0745"
FT   CDS_pept        complement(797967..798407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0745"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0745"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53072"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53072.1"
FT                   /translation="MKAAVKHNISDFKDYLKSNDIYMEENIDENDGSVHFSVGLETEAG
FT                   AKIQLIAAFQNEHPTVDIYCFNVAHVPDATATNDILHVINELNTSYRFAKFTLNKQNAI
FT                   DISTSLAFSEPNFNPALVFEHTRMLYKLANDEYKNLMKVIWA"
FT   gene            complement(798553..799749)
FT                   /locus_tag="BAS0746"
FT   CDS_pept        complement(798553..799749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0746"
FT                   /product="transcription antiterminator, LytR family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0746"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53073"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53073.1"
FT                   /translation="MEQNPSLQENTRSKPKKSKKKIKIIISVILFFLIVGGGYTWFLVN
FT                   KASSAVRNAAHDLARGDKSDLRDKAVKPITNNVSVLVMGVDESDVRGKEYGEAIRTDAL
FT                   LLATFNKDSKTVKLLSIPRDTYTYIPVEKKKDKITHAHAYGSTKNGKDGGPQASIDAVE
FT                   KLLNVPVDYFVKFNFKSFMKIVDDLGGIEVDVPVEFTEQDSNDNADAIHLKKGVQKLNS
FT                   EEALALARTRHIDSDAMRGQRQQLVIEAILEKLTSVGSVTKVGNIIDDINGQFVTNLTF
FT                   DDMLSFYKYGADSSIEKLQIQGDDCYMEKGDDTCSKSAGGGRTYFYNPDKKELAKVTND
FT                   LRTHLGLPAYTKTDSDSKKTSTEKTKESKSENSSERESSNNESKNSNEDKETSSNDNE"
FT   gene            800063..801061
FT                   /locus_tag="BAS0747"
FT   CDS_pept        800063..801061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0747"
FT                   /product="alcohol dehydrogenase, zinc-containing"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0747"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53074"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53074.1"
FT                   /translation="MNHTSFRAIVVNETESKQFVRNVVAREVSSLPEGDVFIQVHYSSL
FT                   NYKDALSATGNKGVTRIYPHTPGIDAAGVVVSSKDATIKAGDQVIVTGYDLGMNTSGGF
FT                   GEYIRVPASWIVPLPEEMSLKESMMYGTAGFTAALSVYKLIGAGITPSMGDVLVTGATG
FT                   GVGSVAVSILSKLGFNVVGATGKMEEEEMLLRLGAKKVIHRAELNDESGRPMLQGIYAG
FT                   VIDTVGGHMLETALKTVKYGGCVTTCGNVAGQELQTTVYPFILRGISLLGIDSVQCPVD
FT                   VRRDVWTLLANEWGNKELRSYTEECILEELDEKFTLILQGRLKGRTVINMK"
FT   gene            complement(801096..802751)
FT                   /locus_tag="BAS0748"
FT   CDS_pept        complement(801096..802751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0748"
FT                   /product="Na/Pi-cotransporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0748"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53075"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53075.1"
FT                   /translation="MEYNVQDMIFQFIGGLGIFLFGIKYMGDGLQQAAGDRLRDILDRF
FT                   TTNPLMGVLAGMLVTVLIQSSSGTTALTVGLVSAGFMTLRQAIGVIMGANIGTTVTAFI
FT                   IGIKIGEYALPIMAVGAILLFFFKNKKVHSLGQVIFGFGMLFFGLELMSTGMKPLRSLE
FT                   SFQELTVSMSDNPILGIVVGTVFTLIVQSSSATIGILQELFGQGAIDLQAALPVLFGDN
FT                   IGTTITAVLAAIGTSIAARRAALVHVIFNIVGTIIFTILLIPFTNLIQYFQTSLNLNPE
FT                   MTIAFAHGTFNVTNTIIQFPFIAVLAWIVTKIIRGEDAAIDFKPQHLNPIFIEQSPAIA
FT                   LTEAQKEIIRMAEFSLHGLKEANQFLNTQDKKHVDMATQLEGAINNLDKKITEYLVLLS
FT                   EKPLSPTDSEKHSVLAGVVGDIERVGDHVENLVELVDFQISNRVSLSNEALAELNEMLE
FT                   LTISTLQDAINALTNFDTELAQTVIAKERKIDQMERVLRKRHVLRLNERSCSGDASIIY
FT                   VDMVSNLERIGDHAVNIADGVLGEQGKINLKQSL"
FT   gene            complement(803082..804599)
FT                   /locus_tag="BAS0749"
FT   CDS_pept        complement(803082..804599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0749"
FT                   /product="major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0749"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53076"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53076.1"
FT                   /translation="MYTPLSSSYCKPFQIYVVKKYISPSHSLLFESAFVKEKTISIIHN
FT                   NYQSIHLYFTSFFHSCVVFPQICQFFTSKIVVRFQGTFLDCYIGQYIYSKEKRNFYIGD
FT                   EYMGEAILVKREPLWTKEFVALILANLCMFLGFQMLIPTLPVYVKEIGGTSSNIGFVVG
FT                   MFTVAALFVRPLTGNALQKFSKKIILMIGTAICLLAMGSYLFASTVFLLLAVRILHGAG
FT                   FGITTTTYGTVVSDLIPQARRGEGMGYFGLSGTIAMALGPLIGLWLMQTYNFTILFLCA
FT                   LSCTIVSLILTKLLQIKKSPQPPKQTSGTFLDGFIERKALLPSLLILCITLMYGGIGSF
FT                   ITLFATEVGIADISLFLFNALAIAVTRPFSGKLYDAKGHSFVIIPGVIITFAGIILLSY
FT                   TTTIPSLIIAAACYGSGFGAIQPALQAWMIDRVAPHRRGVATATFFSAFDLGIGAGAII
FT                   FGFIAHFTNYATVYRYSSLLLIAFLFIYITSVKKQKHGDKNTEKAAG"
FT   gene            804600..805688
FT                   /locus_tag="BAS0750"
FT   CDS_pept        804600..805688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0750"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0750"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53077"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53077.1"
FT                   /translation="MRRLGISIYPEHSTVEKDKEYLTLASKYGFNRVFTCLLSVDGEKE
FT                   KIIEEFKETISHANALGFQVLVDISPAVFEQLGISYNDLSFFHELGAYGIRLDVGFSGL
FT                   EESIMTYNPYGLKIEINMSNGTKYVDNIMSHRPNRENLIGCHNFYPHRYSGLSYNHFIT
FT                   CSKQFKDYGMRTAAFISSFDATYGPWPVTEGLCTLEQHRELPMTTQAKHLFATELIDDV
FT                   IIANAYAPEEELQALGALNKEKQTFDIELYDTTTELERIIVLDEPHFYRGDVSEYMIRS
FT                   TQSRVKYKKEEFKPHHTREIKRGDLLIDNEQYGQYKGELQIALKDMVNTGKTNVVGRIV
FT                   EEEIFLLDYLQAWDKFGFTLKR"
FT   gene            805761..807701
FT                   /locus_tag="BAS0751"
FT   CDS_pept        805761..807701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0751"
FT                   /product="transcription antiterminator, BglG family"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0751"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53078"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53078.1"
FT                   /translation="MTKVHQRLISILEEFLEEKSMLNRAFLASRLHVSTKTIQKDIKLL
FT                   NDILEENGAKIESQRGTGYELEIIQTKKFEEFCVSLFQKQTEKIPTSYEERIAYILQRI
FT                   LTTEGYVKLSQLAEEIYVSKSTVNLIMKDVTDICGRYQLQIEKRPYYGIRIVGEEFHIR
FT                   SCLSQYGLPRYDHTPFHEQFEQSDTYVSLPHIPLIRSVILKYIEGGTIYLSDIEIDNLV
FT                   IHIAIALKRCEDQHYMKGLNEEQAELIIKKEYAIAKQIVGDLEKELHLSFPEEEVLYVT
FT                   MHLLSTAVTSKDRYENVEELLGKDLYAFMQHILFKVAEERNLVFYYDEELLFGFGVHLK
FT                   TLLNRLKYKLNTRNPLLAEVKKNYPYAFEIAVLVGDIIGEYTGESIPESEIGYIAIHFG
FT                   GAMSRLQEQNQKKRCLLVCATGQGSAQLLKYKILSQFRDKLEIVGITGYYQLKVEDLYK
FT                   EKIDCIISTIHIPSGLPVPIIKVNSIFDDKEIKSIGQQLFTHVNNSVQQYMKEDLIFLN
FT                   HSASTKEEVIQFLCEKAAEKNYVPEHFYDSVMERENTSPTAVGNLVAIPHPMQLLSAET
FT                   FLMFCTLEKAVDWGDKKVQVIILFSVKRNNNEDLQRLYDFLYDIMSSQSTIEKLTHAEG
FT                   IEDFQEVLLSI"
FT   gene            807813..808133
FT                   /locus_tag="BAS0752"
FT   CDS_pept        807813..808133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0752"
FT                   /product="PTS system, cellobiose-specific IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0752"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53079"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53079.1"
FT                   /translation="MADMQTPFALILHGGNARSIALEAIAFARQGDFENASEKMTLASE
FT                   EISAAHRIQTDLIQEEARGNHAEISLLLVHAQDHLMNAITVKELAEEFITLHKRMEEKV
FT                   IA"
FT   gene            808135..808440
FT                   /locus_tag="BAS0753"
FT   CDS_pept        808135..808440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0753"
FT                   /product="PTS system, cellobiose-specific IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0753"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53080"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53080.1"
FT                   /translation="MYILLCCAAGMSTSMVVRKMQEEAKKQGKDYKIKAVDSELVKLEI
FT                   KNADVVLIGPQVKYLFPAVQFLAKSYDIPVAIIEQRDYGMCDGLKVLKQAEQLVLA"
FT   gene            808523..809833
FT                   /locus_tag="BAS0754"
FT   CDS_pept        808523..809833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0754"
FT                   /product="PTS system, cellobiose-specific IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0754"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53081"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53081.1"
FT                   /translation="MNGFMSFMEQKIMPTTQKIAGQRHLLAIRNGVISTLPLTIVGSFF
FT                   VIFLNLPIDAYMEWIAPFRHILDIPFRFTVGLMALYAAFGVGASLANFYQLNQLSAGLL
FT                   SVLAFLLASVEPIQITKAVPGVIDAGRYISVGTLSATSLFGAIVTALIAVEIYHFMIKH
FT                   NISIKLPDSVPPAVSNSFAALIPTLAVILLFWGIRYGLKFDVNTTITYLIAPLKSVLVG
FT                   NNLFGGLLTVFLIVFFWSFGIHGPAILGPIIRPMWDSAILENMEVFTATGNAHQLPNLF
FT                   TEQFIQWFVWIGGSGSTLALVIMFMFSKSKFLKELGRLSFVPGLFNINEPIIFGAPIVM
FT                   NPILIIPFVITPLVTTTVSYFAVVSGMIPLMMAKLPFTMLAPIAAVISTDWTIMAGVLV
FT                   LVNFVISFVIYYPFFKMYEKQQLAGEEKEKCSEQLSS"
FT   gene            809809..810087
FT                   /locus_tag="BAS0755"
FT   CDS_pept        809809..810087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0755"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0755"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53082"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53082.1"
FT                   /translation="MLGAIIILITFVAGQCIAHYSKWVQSKSLLVLLLVSIVFIGCSMG
FT                   AYVMLSLQSPYVIIVPTILCATCLSAKYRFTSMALIQRVKEMQKHGA"
FT   gene            810077..811162
FT                   /locus_tag="BAS0756"
FT   CDS_pept        810077..811162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0756"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0756"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53083"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53083.1"
FT                   /translation="MERKLGISLYPEHSTKEQDMAYISAAARHGFSRIFTCLLSVNRPK
FT                   EEIIAEFKEIINHAKDNNMEVILDVAPAVFDQLGISYSDLSFFAELGADGIRLDLGFDG
FT                   LTEAKMTNNPYGLKIELNVSNDIAYLENILSHQANKSALIGCHNFYPQKFTGLPYEYFI
FT                   RCSERFKKYGIRTAAFITSHAANIGPWDINDGLCTLEEHRNLPIEVQAKHLWATGFIDD
FT                   VIIGNAYASEEELEKLGNLNRYMLQLKVHFVDEVTEVEKRATLQELHVRRVDITEYMVR
FT                   STEVRKKYKDYDFPVRKSVRQERGQVVIGNNSFGKYKGELQIILKEMPIDERKNIVGTI
FT                   AEEELFLLDYVGAWTQFTCVE"
FT   gene            complement(811432..812592)
FT                   /locus_tag="BAS0757"
FT   CDS_pept        complement(811432..812592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0757"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0757"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53084"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53084.1"
FT                   /translation="MKKFMGIATAAVFGLGIFTTSAKAETIVTTDVLNVRENPTTESKV
FT                   VGKLLDGYKVNVLHTENGWSKVKLNSGKEAFISADYTKDTYYVTANVLNVRAGANTDSE
FT                   ILGKLKQDDVIETTHQVENGWIQFEYNGKTAYVHVPYLTGKAPVKVQPVVKAEKTTTVQ
FT                   DTAKAVATTKAREVAETQAKAKAEEATKAREVAEAQAAAKAREAAKAQEAAKAQAEAKA
FT                   QEAAEAQAAAKAQEAAKAREAAKAQAEAKAQEAAEAREAAKAQKPATQQPVAKETETSA
FT                   PSSSRELRVVATAYTADPLENGYKAGDQVKSALGHNLTANPNMKLIAVDPSVIPLGSKV
FT                   WVEGYGVAIAGDTGGAIKGNKIDVLMPDKGTSSNWGRKTVTVKVLN"
FT   gene            complement(813163..814338)
FT                   /locus_tag="BAS0758"
FT   CDS_pept        complement(813163..814338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0758"
FT                   /product="ABC transporter, permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0758"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53085"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53085.1"
FT                   /translation="MNTSENIRMALSSIFAHKMRSILTMLGIIIGISAIITIISMGDGT
FT                   NAKFKKELGQGKDNEVTIYYNNPDYGTDNAKITADMLNRLQTVPGVKDVYPDVSMKVKA
FT                   SAGSKDVNLDLKGGTGAFMTDSKIKLVHGRELNDSELNQAIPAVILNEEAFNKLFSGWE
FT                   SNQYTDIKGKPYKIVGVYETKNDFGMPMPEGYTSLENAPVISGVTEYDSVRLTMTSPTE
FT                   RKSVEKQAVSVLNEMKAPKFEHKFEAQDLGEFTKQLDESIGMMKMVFGGIAAISLLVGG
FT                   IGVMNIMLVSVTERTREIGIRKALGATRGKVLTQFLIESCILTGLGGFIGFMLGIFFAW
FT                   IVSIFAGWPLVVSKELGLLAVGISMLIGIIFGLLPANKAAKLDPIECLRYE"
FT   gene            complement(814341..815015)
FT                   /locus_tag="BAS0759"
FT   CDS_pept        complement(814341..815015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAS0759"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAS0759"
FT                   /db_xref="EnsemblGenomes-Tr:AAT53086"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAT53086.1"
FT                   /translati