(data stored in ACNUC17686 zone)

EMBL: AE017262

ID   AE017262; SV 2; circular; genomic DNA; STD; PRO; 2905187 BP.
AC   AE017262; AE017322-AE017331;
PR   Project:PRJNA85;
DT   09-DEC-2005 (Rel. 86, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
DE   Listeria monocytogenes str. 4b F2365, complete genome.
KW   .
OS   Listeria monocytogenes serotype 4b str. F2365
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Listeriaceae; Listeria.
RN   [1]
RC   Publication Status: Online-Only
RP   1-2905187
RX   DOI; 10.1093/nar/gkh562.
RX   PUBMED; 15115801.
RA   Nelson K.E., Fouts D.E., Mongodin E.F., Ravel J., DeBoy R.T., Kolonay J.F.,
RA   Rasko D.A., Angiuoli S.V., Gill S.R., Paulsen I.T., Peterson J., White O.,
RA   Nelson W.C., Nierman W., Beanan M.J., Brinkac L.M., Daugherty S.C.,
RA   Dodson R.J., Durkin A.S., Madupu R., Haft D.H., Selengut J., Van Aken S.,
RA   Khouri H., Fedorova N., Forberger H., Tran B., Kathariou S.,
RA   Wonderling L.D., Uhlich G.A., Bayles D.O., Luchansky J.B., Fraser C.M.;
RT   "Whole genome comparisons of serotype 4b and 1/2a strains of the food-borne
RT   pathogen Listeria monocytogenes reveal new insights into the core genome
RT   components of this species";
RL   Nucleic Acids Res. 32(8):2386-2395(2004).
RN   [2]
RP   1-2905187
RA   Nelson K.E., Fouts D.E., Mongodin E.F., Ravel J., DeBoy R.T., Rasko D.A.,
RA   Kolonay J.F., Angiuoli S., Gill S.R., Paulsen I.T., Peterson J.D.,
RA   White O., Nelson W.C., Nierman W.C., Van Aken S.E., Khouri H.M.,
RA   Fedorova N.B., Forberger H.A., Tran B., Fraser C.M.;
RT   ;
RL   Submitted (27-FEB-2004) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
RN   [3]
RC   Sequence update by submitter
RP   1-2905187
RA   Nelson K.E., Fouts D.E., Mongodin E.F., Ravel J., DeBoy R.T., Rasko D.A.,
RA   Kolonay J.F., Angiuoli S., Gill S.R., Paulsen I.T., Peterson J.D.,
RA   White O., Nelson W.C., Nierman W.C., Van Aken S.E., Khouri H.M.,
RA   Fedorova N.B., Forberger H.A., Tran B., Fraser C.M.;
RT   ;
RL   Submitted (07-DEC-2005) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
DR   MD5; 50eecad94079d58c3964b95cddce6e89.
DR   BioSample; SAMN02603980.
DR   COMPARE-RefGenome; 4b F2365.
DR   EnsemblGenomes-Gn; EBG00001435722.
DR   EnsemblGenomes-Gn; EBG00001435723.
DR   EnsemblGenomes-Gn; EBG00001435724.
DR   EnsemblGenomes-Gn; EBG00001435725.
DR   EnsemblGenomes-Gn; EBG00001435726.
DR   EnsemblGenomes-Gn; EBG00001435727.
DR   EnsemblGenomes-Gn; EBG00001435728.
DR   EnsemblGenomes-Gn; EBG00001435729.
DR   EnsemblGenomes-Gn; EBG00001435730.
DR   EnsemblGenomes-Gn; EBG00001435731.
DR   EnsemblGenomes-Gn; EBG00001435732.
DR   EnsemblGenomes-Gn; EBG00001435733.
DR   EnsemblGenomes-Gn; EBG00001435734.
DR   EnsemblGenomes-Gn; EBG00001435735.
DR   EnsemblGenomes-Gn; EBG00001435736.
DR   EnsemblGenomes-Gn; EBG00001435737.
DR   EnsemblGenomes-Gn; EBG00001435738.
DR   EnsemblGenomes-Gn; EBG00001435739.
DR   EnsemblGenomes-Gn; EBG00001435740.
DR   EnsemblGenomes-Gn; EBG00001435741.
DR   EnsemblGenomes-Gn; EBG00001435742.
DR   EnsemblGenomes-Gn; EBG00001435743.
DR   EnsemblGenomes-Gn; EBG00001435744.
DR   EnsemblGenomes-Gn; EBG00001435745.
DR   EnsemblGenomes-Gn; EBG00001435746.
DR   EnsemblGenomes-Gn; EBG00001435747.
DR   EnsemblGenomes-Gn; EBG00001435748.
DR   EnsemblGenomes-Gn; EBG00001435749.
DR   EnsemblGenomes-Gn; EBG00001435750.
DR   EnsemblGenomes-Gn; EBG00001435751.
DR   EnsemblGenomes-Gn; EBG00001435752.
DR   EnsemblGenomes-Gn; EBG00001435753.
DR   EnsemblGenomes-Gn; EBG00001435754.
DR   EnsemblGenomes-Gn; EBG00001435755.
DR   EnsemblGenomes-Gn; EBG00001435756.
DR   EnsemblGenomes-Gn; EBG00001435757.
DR   EnsemblGenomes-Gn; EBG00001435758.
DR   EnsemblGenomes-Gn; EBG00001435759.
DR   EnsemblGenomes-Gn; EBG00001435760.
DR   EnsemblGenomes-Gn; EBG00001435761.
DR   EnsemblGenomes-Gn; EBG00001435762.
DR   EnsemblGenomes-Gn; EBG00001435763.
DR   EnsemblGenomes-Gn; EBG00001435764.
DR   EnsemblGenomes-Gn; EBG00001435765.
DR   EnsemblGenomes-Gn; EBG00001435766.
DR   EnsemblGenomes-Gn; EBG00001435767.
DR   EnsemblGenomes-Gn; EBG00001435768.
DR   EnsemblGenomes-Gn; EBG00001435769.
DR   EnsemblGenomes-Gn; EBG00001435770.
DR   EnsemblGenomes-Gn; EBG00001435771.
DR   EnsemblGenomes-Gn; EBG00001435772.
DR   EnsemblGenomes-Gn; EBG00001435773.
DR   EnsemblGenomes-Gn; EBG00001435774.
DR   EnsemblGenomes-Gn; EBG00001435775.
DR   EnsemblGenomes-Gn; EBG00001435776.
DR   EnsemblGenomes-Gn; EBG00001435777.
DR   EnsemblGenomes-Gn; EBG00001435778.
DR   EnsemblGenomes-Gn; EBG00001435779.
DR   EnsemblGenomes-Gn; EBG00001435780.
DR   EnsemblGenomes-Gn; EBG00001435781.
DR   EnsemblGenomes-Gn; EBG00001435782.
DR   EnsemblGenomes-Gn; EBG00001435783.
DR   EnsemblGenomes-Gn; EBG00001435784.
DR   EnsemblGenomes-Gn; EBG00001435785.
DR   EnsemblGenomes-Gn; EBG00001435786.
DR   EnsemblGenomes-Gn; EBG00001435787.
DR   EnsemblGenomes-Gn; EBG00001435788.
DR   EnsemblGenomes-Gn; EBG00001435789.
DR   EnsemblGenomes-Gn; EBG00001435790.
DR   EnsemblGenomes-Gn; EBG00001435791.
DR   EnsemblGenomes-Gn; EBG00001435792.
DR   EnsemblGenomes-Gn; EBG00001435793.
DR   EnsemblGenomes-Gn; EBG00001435794.
DR   EnsemblGenomes-Gn; EBG00001435795.
DR   EnsemblGenomes-Gn; EBG00001435796.
DR   EnsemblGenomes-Gn; EBG00001435797.
DR   EnsemblGenomes-Gn; EBG00001435798.
DR   EnsemblGenomes-Gn; EBG00001435799.
DR   EnsemblGenomes-Gn; EBG00001435800.
DR   EnsemblGenomes-Gn; EBG00001435801.
DR   EnsemblGenomes-Gn; EBG00001435802.
DR   EnsemblGenomes-Gn; EBG00001435803.
DR   EnsemblGenomes-Gn; EBG00001435804.
DR   EnsemblGenomes-Gn; EBG00001435805.
DR   EnsemblGenomes-Gn; EBG00001435806.
DR   EnsemblGenomes-Gn; EBG00001435807.
DR   EnsemblGenomes-Gn; EBG00001435808.
DR   EnsemblGenomes-Gn; EBG00001435809.
DR   EnsemblGenomes-Gn; EBG00001435810.
DR   EnsemblGenomes-Gn; EBG00001435811.
DR   EnsemblGenomes-Gn; EBG00001435812.
DR   EnsemblGenomes-Gn; EBG00001435813.
DR   EnsemblGenomes-Gn; EBG00001435814.
DR   EnsemblGenomes-Gn; EBG00001435815.
DR   EnsemblGenomes-Gn; EBG00001435816.
DR   EnsemblGenomes-Gn; EBG00001435817.
DR   EnsemblGenomes-Gn; EBG00001435818.
DR   EnsemblGenomes-Gn; EBG00001435819.
DR   EnsemblGenomes-Gn; EBG00001435820.
DR   EnsemblGenomes-Gn; EBG00001435821.
DR   EnsemblGenomes-Gn; EBG00001435822.
DR   EnsemblGenomes-Gn; EBG00001435823.
DR   EnsemblGenomes-Gn; EBG00001435824.
DR   EnsemblGenomes-Gn; EBG00001435825.
DR   EnsemblGenomes-Gn; EBG00001435826.
DR   EnsemblGenomes-Gn; EBG00001435827.
DR   EnsemblGenomes-Gn; EBG00001435828.
DR   EnsemblGenomes-Gn; EBG00001435829.
DR   EnsemblGenomes-Gn; EBG00001435830.
DR   EnsemblGenomes-Gn; EBG00001435831.
DR   EnsemblGenomes-Gn; EBG00001435832.
DR   EnsemblGenomes-Gn; EBG00001435833.
DR   EnsemblGenomes-Gn; EBG00001435834.
DR   EnsemblGenomes-Gn; EBG00001435835.
DR   EnsemblGenomes-Gn; EBG00001435836.
DR   EnsemblGenomes-Gn; EBG00001435837.
DR   EnsemblGenomes-Gn; EBG00001435838.
DR   EnsemblGenomes-Gn; EBG00001435839.
DR   EnsemblGenomes-Gn; EBG00001435840.
DR   EnsemblGenomes-Gn; EBG00001435841.
DR   EnsemblGenomes-Gn; EBG00001435842.
DR   EnsemblGenomes-Gn; EBG00001435843.
DR   EnsemblGenomes-Gn; EBG00001435844.
DR   EnsemblGenomes-Gn; EBG00001435845.
DR   EnsemblGenomes-Gn; EBG00001435846.
DR   EnsemblGenomes-Gn; EBG00001435847.
DR   EnsemblGenomes-Gn; EBG00001435848.
DR   EnsemblGenomes-Gn; EBG00001435849.
DR   EnsemblGenomes-Gn; EBG00001435850.
DR   EnsemblGenomes-Gn; EBG00001435851.
DR   EnsemblGenomes-Gn; EBG00001435852.
DR   EnsemblGenomes-Gn; EBG00001435853.
DR   EnsemblGenomes-Gn; EBG00001435854.
DR   EnsemblGenomes-Gn; EBG00001435855.
DR   EnsemblGenomes-Gn; EBG00001435856.
DR   EnsemblGenomes-Gn; EBG00001435857.
DR   EnsemblGenomes-Gn; EBG00001435858.
DR   EnsemblGenomes-Gn; EBG00001435859.
DR   EnsemblGenomes-Gn; EBG00001435860.
DR   EnsemblGenomes-Gn; EBG00001435861.
DR   EnsemblGenomes-Gn; EBG00001435862.
DR   EnsemblGenomes-Gn; EBG00001435863.
DR   EnsemblGenomes-Gn; LMOf2365_2848.
DR   EnsemblGenomes-Gn; LMOf2365_2849.
DR   EnsemblGenomes-Gn; LMOf2365_2850.
DR   EnsemblGenomes-Gn; LMOf2365_2851.
DR   EnsemblGenomes-Gn; LMOf2365_2852.
DR   EnsemblGenomes-Gn; LMOf2365_2853.
DR   EnsemblGenomes-Gn; LMOf2365_2854.
DR   EnsemblGenomes-Gn; LMOf2365_2855.
DR   EnsemblGenomes-Gn; LMOf2365_2856.
DR   EnsemblGenomes-Gn; LMOf2365_2857.
DR   EnsemblGenomes-Gn; LMOf2365_2858.
DR   EnsemblGenomes-Gn; LMOf2365_2859.
DR   EnsemblGenomes-Gn; LMOf2365_2860.
DR   EnsemblGenomes-Gn; LMOf2365_2861.
DR   EnsemblGenomes-Gn; LMOf2365_2862.
DR   EnsemblGenomes-Gn; LMOf2365_2863.
DR   EnsemblGenomes-Gn; LMOf2365_2872.
DR   EnsemblGenomes-Gn; LMOf2365_2873.
DR   EnsemblGenomes-Gn; LMOf2365_2874.
DR   EnsemblGenomes-Gn; LMOf2365_2875.
DR   EnsemblGenomes-Gn; LMOf2365_2876.
DR   EnsemblGenomes-Gn; LMOf2365_2877.
DR   EnsemblGenomes-Gn; LMOf2365_2878.
DR   EnsemblGenomes-Gn; LMOf2365_2879.
DR   EnsemblGenomes-Gn; LMOf2365_2880.
DR   EnsemblGenomes-Gn; LMOf2365_2881.
DR   EnsemblGenomes-Gn; LMOf2365_2882.
DR   EnsemblGenomes-Gn; LMOf2365_2883.
DR   EnsemblGenomes-Gn; LMOf2365_2884.
DR   EnsemblGenomes-Gn; LMOf2365_2885.
DR   EnsemblGenomes-Gn; LMOf2365_2886.
DR   EnsemblGenomes-Gn; LMOf2365_2887.
DR   EnsemblGenomes-Gn; LMOf2365_2888.
DR   EnsemblGenomes-Gn; LMOf2365_2889.
DR   EnsemblGenomes-Gn; LMOf2365_2890.
DR   EnsemblGenomes-Gn; LMOf2365_2891.
DR   EnsemblGenomes-Gn; LMOf2365_2892.
DR   EnsemblGenomes-Gn; LMOf2365_2893.
DR   EnsemblGenomes-Gn; LMOf2365_2894.
DR   EnsemblGenomes-Gn; LMOf2365_2895.
DR   EnsemblGenomes-Gn; LMOf2365_2896.
DR   EnsemblGenomes-Gn; LMOf2365_2897.
DR   EnsemblGenomes-Gn; LMOf2365_2898.
DR   EnsemblGenomes-Gn; LMOf2365_2899.
DR   EnsemblGenomes-Gn; LMOf2365_2900.
DR   EnsemblGenomes-Gn; LMOf2365_2901.
DR   EnsemblGenomes-Gn; LMOf2365_2902.
DR   EnsemblGenomes-Gn; LMOf2365_2903.
DR   EnsemblGenomes-Gn; LMOf2365_2904.
DR   EnsemblGenomes-Gn; LMOf2365_2905.
DR   EnsemblGenomes-Gn; LMOf2365_2906.
DR   EnsemblGenomes-Gn; LMOf2365_2907.
DR   EnsemblGenomes-Gn; LMOf2365_2908.
DR   EnsemblGenomes-Gn; LMOf2365_2909.
DR   EnsemblGenomes-Gn; LMOf2365_2910.
DR   EnsemblGenomes-Gn; LMOf2365_2911.
DR   EnsemblGenomes-Gn; LMOf2365_2912.
DR   EnsemblGenomes-Gn; LMOf2365_2913.
DR   EnsemblGenomes-Gn; LMOf2365_2914.
DR   EnsemblGenomes-Gn; LMOf2365_2915.
DR   EnsemblGenomes-Gn; LMOf2365_2916.
DR   EnsemblGenomes-Gn; LMOf2365_2917.
DR   EnsemblGenomes-Gn; LMOf2365_2918.
DR   EnsemblGenomes-Gn; LMOf2365_2919.
DR   EnsemblGenomes-Gn; LMOf2365_2920.
DR   EnsemblGenomes-Gn; LMOf2365_2921.
DR   EnsemblGenomes-Gn; LMOf2365_2922.
DR   EnsemblGenomes-Gn; LMOf2365_2923.
DR   EnsemblGenomes-Gn; LMOf2365_2924.
DR   EnsemblGenomes-Gn; LMOf2365_2925.
DR   EnsemblGenomes-Gn; LMOf2365_2926.
DR   EnsemblGenomes-Gn; LMOf2365_2927.
DR   EnsemblGenomes-Gn; LMOf2365_2928.
DR   EnsemblGenomes-Gn; LMOf2365_2929.
DR   EnsemblGenomes-Gn; LMOf2365_2930.
DR   EnsemblGenomes-Gn; LMOf2365_2931.
DR   EnsemblGenomes-Gn; LMOf2365_2933.
DR   EnsemblGenomes-Gn; LMOf2365_2934.
DR   EnsemblGenomes-Gn; LMOf2365_2935.
DR   EnsemblGenomes-Gn; LMOf2365_2936.
DR   EnsemblGenomes-Gn; LMOf2365_2937.
DR   EnsemblGenomes-Gn; LMOf2365_2938.
DR   EnsemblGenomes-Gn; LMOf2365_2939.
DR   EnsemblGenomes-Gn; LMOf2365_2940.
DR   EnsemblGenomes-Gn; LMOf2365_2941.
DR   EnsemblGenomes-Tr; EBT00001813237.
DR   EnsemblGenomes-Tr; EBT00001813238.
DR   EnsemblGenomes-Tr; EBT00001813239.
DR   EnsemblGenomes-Tr; EBT00001813240.
DR   EnsemblGenomes-Tr; EBT00001813241.
DR   EnsemblGenomes-Tr; EBT00001813242.
DR   EnsemblGenomes-Tr; EBT00001813243.
DR   EnsemblGenomes-Tr; EBT00001813244.
DR   EnsemblGenomes-Tr; EBT00001813245.
DR   EnsemblGenomes-Tr; EBT00001813246.
DR   EnsemblGenomes-Tr; EBT00001813247.
DR   EnsemblGenomes-Tr; EBT00001813248.
DR   EnsemblGenomes-Tr; EBT00001813249.
DR   EnsemblGenomes-Tr; EBT00001813250.
DR   EnsemblGenomes-Tr; EBT00001813251.
DR   EnsemblGenomes-Tr; EBT00001813252.
DR   EnsemblGenomes-Tr; EBT00001813253.
DR   EnsemblGenomes-Tr; EBT00001813254.
DR   EnsemblGenomes-Tr; EBT00001813255.
DR   EnsemblGenomes-Tr; EBT00001813256.
DR   EnsemblGenomes-Tr; EBT00001813257.
DR   EnsemblGenomes-Tr; EBT00001813258.
DR   EnsemblGenomes-Tr; EBT00001813259.
DR   EnsemblGenomes-Tr; EBT00001813260.
DR   EnsemblGenomes-Tr; EBT00001813261.
DR   EnsemblGenomes-Tr; EBT00001813262.
DR   EnsemblGenomes-Tr; EBT00001813263.
DR   EnsemblGenomes-Tr; EBT00001813264.
DR   EnsemblGenomes-Tr; EBT00001813265.
DR   EnsemblGenomes-Tr; EBT00001813266.
DR   EnsemblGenomes-Tr; EBT00001813267.
DR   EnsemblGenomes-Tr; EBT00001813268.
DR   EnsemblGenomes-Tr; EBT00001813269.
DR   EnsemblGenomes-Tr; EBT00001813270.
DR   EnsemblGenomes-Tr; EBT00001813271.
DR   EnsemblGenomes-Tr; EBT00001813272.
DR   EnsemblGenomes-Tr; EBT00001813273.
DR   EnsemblGenomes-Tr; EBT00001813274.
DR   EnsemblGenomes-Tr; EBT00001813275.
DR   EnsemblGenomes-Tr; EBT00001813276.
DR   EnsemblGenomes-Tr; EBT00001813277.
DR   EnsemblGenomes-Tr; EBT00001813278.
DR   EnsemblGenomes-Tr; EBT00001813279.
DR   EnsemblGenomes-Tr; EBT00001813280.
DR   EnsemblGenomes-Tr; EBT00001813281.
DR   EnsemblGenomes-Tr; EBT00001813282.
DR   EnsemblGenomes-Tr; EBT00001813283.
DR   EnsemblGenomes-Tr; EBT00001813284.
DR   EnsemblGenomes-Tr; EBT00001813285.
DR   EnsemblGenomes-Tr; EBT00001813286.
DR   EnsemblGenomes-Tr; EBT00001813287.
DR   EnsemblGenomes-Tr; EBT00001813288.
DR   EnsemblGenomes-Tr; EBT00001813289.
DR   EnsemblGenomes-Tr; EBT00001813290.
DR   EnsemblGenomes-Tr; EBT00001813291.
DR   EnsemblGenomes-Tr; EBT00001813292.
DR   EnsemblGenomes-Tr; EBT00001813293.
DR   EnsemblGenomes-Tr; EBT00001813294.
DR   EnsemblGenomes-Tr; EBT00001813295.
DR   EnsemblGenomes-Tr; EBT00001813296.
DR   EnsemblGenomes-Tr; EBT00001813297.
DR   EnsemblGenomes-Tr; EBT00001813298.
DR   EnsemblGenomes-Tr; EBT00001813299.
DR   EnsemblGenomes-Tr; EBT00001813300.
DR   EnsemblGenomes-Tr; EBT00001813301.
DR   EnsemblGenomes-Tr; EBT00001813302.
DR   EnsemblGenomes-Tr; EBT00001813303.
DR   EnsemblGenomes-Tr; EBT00001813304.
DR   EnsemblGenomes-Tr; EBT00001813305.
DR   EnsemblGenomes-Tr; EBT00001813306.
DR   EnsemblGenomes-Tr; EBT00001813307.
DR   EnsemblGenomes-Tr; EBT00001813308.
DR   EnsemblGenomes-Tr; EBT00001813309.
DR   EnsemblGenomes-Tr; EBT00001813310.
DR   EnsemblGenomes-Tr; EBT00001813311.
DR   EnsemblGenomes-Tr; EBT00001813312.
DR   EnsemblGenomes-Tr; EBT00001813313.
DR   EnsemblGenomes-Tr; EBT00001813314.
DR   EnsemblGenomes-Tr; EBT00001813315.
DR   EnsemblGenomes-Tr; EBT00001813316.
DR   EnsemblGenomes-Tr; EBT00001813317.
DR   EnsemblGenomes-Tr; EBT00001813318.
DR   EnsemblGenomes-Tr; EBT00001813319.
DR   EnsemblGenomes-Tr; EBT00001813320.
DR   EnsemblGenomes-Tr; EBT00001813321.
DR   EnsemblGenomes-Tr; EBT00001813322.
DR   EnsemblGenomes-Tr; EBT00001813323.
DR   EnsemblGenomes-Tr; EBT00001813324.
DR   EnsemblGenomes-Tr; EBT00001813325.
DR   EnsemblGenomes-Tr; EBT00001813326.
DR   EnsemblGenomes-Tr; EBT00001813327.
DR   EnsemblGenomes-Tr; EBT00001813328.
DR   EnsemblGenomes-Tr; EBT00001813329.
DR   EnsemblGenomes-Tr; EBT00001813330.
DR   EnsemblGenomes-Tr; EBT00001813331.
DR   EnsemblGenomes-Tr; EBT00001813332.
DR   EnsemblGenomes-Tr; EBT00001813333.
DR   EnsemblGenomes-Tr; EBT00001813334.
DR   EnsemblGenomes-Tr; EBT00001813335.
DR   EnsemblGenomes-Tr; EBT00001813336.
DR   EnsemblGenomes-Tr; EBT00001813337.
DR   EnsemblGenomes-Tr; EBT00001813338.
DR   EnsemblGenomes-Tr; EBT00001813339.
DR   EnsemblGenomes-Tr; EBT00001813340.
DR   EnsemblGenomes-Tr; EBT00001813341.
DR   EnsemblGenomes-Tr; EBT00001813342.
DR   EnsemblGenomes-Tr; EBT00001813343.
DR   EnsemblGenomes-Tr; EBT00001813344.
DR   EnsemblGenomes-Tr; EBT00001813345.
DR   EnsemblGenomes-Tr; EBT00001813346.
DR   EnsemblGenomes-Tr; EBT00001813347.
DR   EnsemblGenomes-Tr; EBT00001813348.
DR   EnsemblGenomes-Tr; EBT00001813349.
DR   EnsemblGenomes-Tr; EBT00001813350.
DR   EnsemblGenomes-Tr; EBT00001813351.
DR   EnsemblGenomes-Tr; EBT00001813352.
DR   EnsemblGenomes-Tr; EBT00001813353.
DR   EnsemblGenomes-Tr; EBT00001813354.
DR   EnsemblGenomes-Tr; EBT00001813355.
DR   EnsemblGenomes-Tr; EBT00001813356.
DR   EnsemblGenomes-Tr; EBT00001813357.
DR   EnsemblGenomes-Tr; EBT00001813358.
DR   EnsemblGenomes-Tr; EBT00001813359.
DR   EnsemblGenomes-Tr; EBT00001813360.
DR   EnsemblGenomes-Tr; EBT00001813361.
DR   EnsemblGenomes-Tr; EBT00001813362.
DR   EnsemblGenomes-Tr; EBT00001813363.
DR   EnsemblGenomes-Tr; EBT00001813364.
DR   EnsemblGenomes-Tr; EBT00001813365.
DR   EnsemblGenomes-Tr; EBT00001813366.
DR   EnsemblGenomes-Tr; EBT00001813367.
DR   EnsemblGenomes-Tr; EBT00001813368.
DR   EnsemblGenomes-Tr; EBT00001813369.
DR   EnsemblGenomes-Tr; EBT00001813370.
DR   EnsemblGenomes-Tr; EBT00001813371.
DR   EnsemblGenomes-Tr; EBT00001813372.
DR   EnsemblGenomes-Tr; EBT00001813373.
DR   EnsemblGenomes-Tr; EBT00001813374.
DR   EnsemblGenomes-Tr; EBT00001813375.
DR   EnsemblGenomes-Tr; EBT00001813376.
DR   EnsemblGenomes-Tr; EBT00001813377.
DR   EnsemblGenomes-Tr; EBT00001813378.
DR   EnsemblGenomes-Tr; LMOf2365_2848-1.
DR   EnsemblGenomes-Tr; LMOf2365_2849-1.
DR   EnsemblGenomes-Tr; LMOf2365_2850-1.
DR   EnsemblGenomes-Tr; LMOf2365_2851-1.
DR   EnsemblGenomes-Tr; LMOf2365_2852-1.
DR   EnsemblGenomes-Tr; LMOf2365_2853-1.
DR   EnsemblGenomes-Tr; LMOf2365_2854-1.
DR   EnsemblGenomes-Tr; LMOf2365_2855-1.
DR   EnsemblGenomes-Tr; LMOf2365_2856-1.
DR   EnsemblGenomes-Tr; LMOf2365_2857-1.
DR   EnsemblGenomes-Tr; LMOf2365_2858-1.
DR   EnsemblGenomes-Tr; LMOf2365_2859-1.
DR   EnsemblGenomes-Tr; LMOf2365_2860-1.
DR   EnsemblGenomes-Tr; LMOf2365_2861-1.
DR   EnsemblGenomes-Tr; LMOf2365_2862-1.
DR   EnsemblGenomes-Tr; LMOf2365_2863-1.
DR   EnsemblGenomes-Tr; LMOf2365_2872-1.
DR   EnsemblGenomes-Tr; LMOf2365_2873-1.
DR   EnsemblGenomes-Tr; LMOf2365_2874-1.
DR   EnsemblGenomes-Tr; LMOf2365_2875-1.
DR   EnsemblGenomes-Tr; LMOf2365_2876-1.
DR   EnsemblGenomes-Tr; LMOf2365_2877-1.
DR   EnsemblGenomes-Tr; LMOf2365_2878-1.
DR   EnsemblGenomes-Tr; LMOf2365_2879-1.
DR   EnsemblGenomes-Tr; LMOf2365_2880-1.
DR   EnsemblGenomes-Tr; LMOf2365_2881-1.
DR   EnsemblGenomes-Tr; LMOf2365_2882-1.
DR   EnsemblGenomes-Tr; LMOf2365_2883-1.
DR   EnsemblGenomes-Tr; LMOf2365_2884-1.
DR   EnsemblGenomes-Tr; LMOf2365_2885-1.
DR   EnsemblGenomes-Tr; LMOf2365_2886-1.
DR   EnsemblGenomes-Tr; LMOf2365_2887-1.
DR   EnsemblGenomes-Tr; LMOf2365_2888-1.
DR   EnsemblGenomes-Tr; LMOf2365_2889-1.
DR   EnsemblGenomes-Tr; LMOf2365_2890-1.
DR   EnsemblGenomes-Tr; LMOf2365_2891-1.
DR   EnsemblGenomes-Tr; LMOf2365_2892-1.
DR   EnsemblGenomes-Tr; LMOf2365_2893-1.
DR   EnsemblGenomes-Tr; LMOf2365_2894-1.
DR   EnsemblGenomes-Tr; LMOf2365_2895-1.
DR   EnsemblGenomes-Tr; LMOf2365_2896-1.
DR   EnsemblGenomes-Tr; LMOf2365_2897-1.
DR   EnsemblGenomes-Tr; LMOf2365_2898-1.
DR   EnsemblGenomes-Tr; LMOf2365_2899-1.
DR   EnsemblGenomes-Tr; LMOf2365_2900-1.
DR   EnsemblGenomes-Tr; LMOf2365_2901-1.
DR   EnsemblGenomes-Tr; LMOf2365_2902-1.
DR   EnsemblGenomes-Tr; LMOf2365_2903-1.
DR   EnsemblGenomes-Tr; LMOf2365_2904-1.
DR   EnsemblGenomes-Tr; LMOf2365_2905-1.
DR   EnsemblGenomes-Tr; LMOf2365_2906-1.
DR   EnsemblGenomes-Tr; LMOf2365_2907-1.
DR   EnsemblGenomes-Tr; LMOf2365_2908-1.
DR   EnsemblGenomes-Tr; LMOf2365_2909-1.
DR   EnsemblGenomes-Tr; LMOf2365_2910-1.
DR   EnsemblGenomes-Tr; LMOf2365_2911-1.
DR   EnsemblGenomes-Tr; LMOf2365_2912-1.
DR   EnsemblGenomes-Tr; LMOf2365_2913-1.
DR   EnsemblGenomes-Tr; LMOf2365_2914-1.
DR   EnsemblGenomes-Tr; LMOf2365_2915-1.
DR   EnsemblGenomes-Tr; LMOf2365_2916-1.
DR   EnsemblGenomes-Tr; LMOf2365_2917-1.
DR   EnsemblGenomes-Tr; LMOf2365_2918-1.
DR   EnsemblGenomes-Tr; LMOf2365_2919-1.
DR   EnsemblGenomes-Tr; LMOf2365_2920-1.
DR   EnsemblGenomes-Tr; LMOf2365_2921-1.
DR   EnsemblGenomes-Tr; LMOf2365_2922-1.
DR   EnsemblGenomes-Tr; LMOf2365_2923-1.
DR   EnsemblGenomes-Tr; LMOf2365_2924-1.
DR   EnsemblGenomes-Tr; LMOf2365_2925-1.
DR   EnsemblGenomes-Tr; LMOf2365_2926-1.
DR   EnsemblGenomes-Tr; LMOf2365_2927-1.
DR   EnsemblGenomes-Tr; LMOf2365_2928-1.
DR   EnsemblGenomes-Tr; LMOf2365_2929-1.
DR   EnsemblGenomes-Tr; LMOf2365_2930-1.
DR   EnsemblGenomes-Tr; LMOf2365_2931-1.
DR   EnsemblGenomes-Tr; LMOf2365_2933-1.
DR   EnsemblGenomes-Tr; LMOf2365_2934-1.
DR   EnsemblGenomes-Tr; LMOf2365_2935-1.
DR   EnsemblGenomes-Tr; LMOf2365_2936-1.
DR   EnsemblGenomes-Tr; LMOf2365_2937-1.
DR   EnsemblGenomes-Tr; LMOf2365_2938-1.
DR   EnsemblGenomes-Tr; LMOf2365_2939-1.
DR   EnsemblGenomes-Tr; LMOf2365_2940-1.
DR   EnsemblGenomes-Tr; LMOf2365_2941-1.
DR   EuropePMC; PMC1797373; 17041050.
DR   EuropePMC; PMC2292909; 18256218.
DR   EuropePMC; PMC2583503; 18806004.
DR   EuropePMC; PMC2824700; 20067631.
DR   EuropePMC; PMC2918964; 20581187.
DR   EuropePMC; PMC2937515; 20656873.
DR   EuropePMC; PMC2996996; 20846431.
DR   EuropePMC; PMC3019230; 21126366.
DR   EuropePMC; PMC3133268; 21551300.
DR   EuropePMC; PMC3147710; 21685277.
DR   EuropePMC; PMC3497465; 23002226.
DR   EuropePMC; PMC3558321; 23267677.
DR   EuropePMC; PMC3561277; 23347599.
DR   EuropePMC; PMC419451; 15115801.
DR   EuropePMC; PMC4609684; 26311854.
DR   EuropePMC; PMC4780826; 26950338.
DR   EuropePMC; PMC4973958; 27489951.
DR   EuropePMC; PMC5581801.
DR   EuropePMC; PMC5648914; 28842547.
DR   EuropePMC; PMC6558679; 31198443.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00038; PrfA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF00615; LhrA.
DR   RFAM; RF00616; LhrC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01457; rli22.
DR   RFAM; RF01459; rliE.
DR   RFAM; RF01460; rliH.
DR   RFAM; RF01461; rli24.
DR   RFAM; RF01462; rli26.
DR   RFAM; RF01463; rli27.
DR   RFAM; RF01464; rliA.
DR   RFAM; RF01465; rli31.
DR   RFAM; RF01466; rli34.
DR   RFAM; RF01467; rli36.
DR   RFAM; RF01468; rli32.
DR   RFAM; RF01469; rli33.
DR   RFAM; RF01470; rli38.
DR   RFAM; RF01471; rliB.
DR   RFAM; RF01472; rli40.
DR   RFAM; RF01473; rli41.
DR   RFAM; RF01474; rli42.
DR   RFAM; RF01475; rli45.
DR   RFAM; RF01476; rliF.
DR   RFAM; RF01477; rli43.
DR   RFAM; RF01478; rli47.
DR   RFAM; RF01480; rli52.
DR   RFAM; RF01481; rli53.
DR   RFAM; RF01482; AdoCbl_riboswitch.
DR   RFAM; RF01483; rli56.
DR   RFAM; RF01484; rli59.
DR   RFAM; RF01485; rli61.
DR   RFAM; RF01487; rliI.
DR   RFAM; RF01488; rli49.
DR   RFAM; RF01489; sbrA.
DR   RFAM; RF01490; rli51.
DR   RFAM; RF01491; rli54.
DR   RFAM; RF01492; rli28.
DR   RFAM; RF01493; rli37.
DR   RFAM; RF01494; rliD.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01776; RatA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; AE017262.
DR   SILVA-SSU; AE017262.
DR   StrainInfo; 686331; 0.
CC   On or before Dec 7, 2005 this sequence version replaced
CC   gi:46879488, gi:46879761, gi:46880047, gi:46880337, gi:46880658,
CC   gi:46880951, gi:46881216, gi:46881491, gi:46881759, gi:46882038,
CC   gi:46882319.
FH   Key             Location/Qualifiers
FT   source          1..2905187
FT                   /organism="Listeria monocytogenes serotype 4b str. F2365"
FT                   /strain="4b F2365"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:265669"
FT   gene            319..1674
FT                   /gene="dnaA"
FT                   /locus_tag="LMOf2365_0001"
FT   CDS_pept        319..1674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="LMOf2365_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by similarity to SP:P05648; match to
FT                   protein family HMM PF00004; match to protein family HMM
FT                   PF00308; match to protein family HMM TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02791"
FT                   /db_xref="GOA:Q725H0"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q725H0"
FT                   /protein_id="AAT02791.1"
FT   gene            1868..3013
FT                   /gene="dnaN"
FT                   /locus_tag="LMOf2365_0002"
FT   CDS_pept        1868..3013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="LMOf2365_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P05649; match to
FT                   protein family HMM PF00712; match to protein family HMM
FT                   PF02767; match to protein family HMM PF02768; match to
FT                   protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02792"
FT                   /protein_id="AAT02792.1"
FT   gene            3121..4464
FT                   /locus_tag="LMOf2365_0003"
FT   CDS_pept        3121..4464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0003"
FT                   /product="MATE efflux family protein"
FT                   /note="identified by match to protein family HMM PF01554;
FT                   match to protein family HMM TIGR00797"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02793"
FT                   /protein_id="AAT02793.1"
FT   gene            4644..4865
FT                   /locus_tag="LMOf2365_0004"
FT   CDS_pept        4644..4865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0004"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0004"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02794"
FT                   /protein_id="AAT02794.1"
FT   gene            4869..5981
FT                   /gene="recF"
FT                   /locus_tag="LMOf2365_0005"
FT   CDS_pept        4869..5981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="LMOf2365_0005"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="identified by similarity to SP:P05651; match to
FT                   protein family HMM PF02463; match to protein family HMM
FT                   TIGR00611"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02795"
FT                   /db_xref="GOA:Q725G6"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q725G6"
FT                   /protein_id="AAT02795.1"
FT   gene            6030..7970
FT                   /gene="gyrB"
FT                   /locus_tag="LMOf2365_0006"
FT   CDS_pept        6030..7970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="LMOf2365_0006"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P05652; match to
FT                   protein family HMM PF00204; match to protein family HMM
FT                   PF00986; match to protein family HMM PF01751; match to
FT                   protein family HMM PF02518; match to protein family HMM
FT                   TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02796"
FT                   /protein_id="AAT02796.1"
FT                   DNAQYVKNLDV"
FT   gene            8065..10593
FT                   /gene="gyrA"
FT                   /locus_tag="LMOf2365_0007"
FT   CDS_pept        8065..10593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="LMOf2365_0007"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P05653; match to
FT                   protein family HMM PF00521; match to protein family HMM
FT                   PF03989; match to protein family HMM TIGR01063"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02797"
FT                   /protein_id="AAT02797.1"
FT   gene            10727..12241
FT                   /gene="cls-1"
FT                   /locus_tag="LMOf2365_0008"
FT   CDS_pept        10727..12241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cls-1"
FT                   /locus_tag="LMOf2365_0008"
FT                   /product="cardiolipin synthetase"
FT                   /EC_number="2.7.8.-"
FT                   /note="identified by similarity to SP:O66043; match to
FT                   protein family HMM PF00614"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02798"
FT                   /protein_id="AAT02798.1"
FT   gene            12257..12775
FT                   /gene="speG"
FT                   /locus_tag="LMOf2365_0009"
FT   CDS_pept        12257..12775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speG"
FT                   /locus_tag="LMOf2365_0009"
FT                   /product="spermidine N1-acetyltransferase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P37354; match to
FT                   protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02799"
FT                   /protein_id="AAT02799.1"
FT                   QHQYQEMDI"
FT   gene            12779..12895
FT                   /locus_tag="LMOf2365_0010"
FT   CDS_pept        12779..12895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0010"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02800"
FT                   /protein_id="AAT02800.1"
FT   gene            12917..13885
FT                   /locus_tag="LMOf2365_0011"
FT   CDS_pept        12917..13885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0011"
FT                   /product="mevalonate kinase"
FT                   /note="identified by similarity to GP:9937379; match to
FT                   protein family HMM PF00288; match to protein family HMM
FT                   TIGR00549"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02801"
FT                   /protein_id="AAT02801.1"
FT   gene            13842..14813
FT                   /gene="mvaD"
FT                   /locus_tag="LMOf2365_0012"
FT   CDS_pept        13842..14813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvaD"
FT                   /locus_tag="LMOf2365_0012"
FT                   /product="diphosphomevalonate decarboxylase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00288;
FT                   match to protein family HMM TIGR01240"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02802"
FT                   /protein_id="AAT02802.1"
FT   gene            14803..15873
FT                   /locus_tag="LMOf2365_0013"
FT   CDS_pept        14803..15873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0013"
FT                   /product="phosphomevalonate kinase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00288;
FT                   match to protein family HMM TIGR01220"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02803"
FT                   /protein_id="AAT02803.1"
FT                   GIKHLPFHTGRVQITE"
FT   gene            complement(15966..16160)
FT                   /locus_tag="LMOf2365_0014"
FT   CDS_pept        complement(15966..16160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0014"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02804"
FT                   /protein_id="AAT02804.1"
FT   gene            complement(16178..17851)
FT                   /pseudo
FT                   /locus_tag="LMOf2365_0015"
FT                   /note="putative autolysin, degenerate; this region contains
FT                   one or more premature stops and/or frameshifts which are
FT                   not the result of sequencing error; identified by
FT                   similarity to SP:P25147"
FT   gene            18301..19407
FT                   /gene="qoxA"
FT                   /locus_tag="LMOf2365_0016"
FT   CDS_pept        18301..19407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qoxA"
FT                   /locus_tag="LMOf2365_0016"
FT                   /product="quinol oxidase AA3, subunit II"
FT                   /EC_number="1.9.3.-"
FT                   /note="identified by similarity to SP:P34957; match to
FT                   protein family HMM PF02790; match to protein family HMM
FT                   PF06481; match to protein family HMM TIGR01432"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02805"
FT                   /protein_id="AAT02805.1"
FT   gene            19426..21405
FT                   /gene="qoxB"
FT                   /locus_tag="LMOf2365_0017"
FT   CDS_pept        19426..21405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qoxB"
FT                   /locus_tag="LMOf2365_0017"
FT                   /product="quinol oxidase AA3, subunit I"
FT                   /EC_number="1.9.3.-"
FT                   /note="identified by similarity to SP:P34956; match to
FT                   protein family HMM PF00115"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02806"
FT                   /protein_id="AAT02806.1"
FT   gene            21393..22004
FT                   /gene="qoxC"
FT                   /locus_tag="LMOf2365_0018"
FT   CDS_pept        21393..22004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qoxC"
FT                   /locus_tag="LMOf2365_0018"
FT                   /product="quinol oxidase AA3, subunit III"
FT                   /EC_number="1.9.3.-"
FT                   /note="identified by similarity to SP:P34958; match to
FT                   protein family HMM PF00510"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02807"
FT                   /protein_id="AAT02807.1"
FT   gene            22006..22338
FT                   /gene="qoxD"
FT                   /locus_tag="LMOf2365_0019"
FT   CDS_pept        22006..22338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qoxD"
FT                   /locus_tag="LMOf2365_0019"
FT                   /product="quinol oxidase AA3, subunit IV"
FT                   /EC_number="1.9.3.-"
FT                   /note="identified by similarity to SP:P34959; match to
FT                   protein family HMM PF03626"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02808"
FT                   /protein_id="AAT02808.1"
FT                   HMNHLL"
FT   gene            complement(22389..23507)
FT                   /locus_tag="LMOf2365_0020"
FT   CDS_pept        complement(22389..23507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0020"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:4584121"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02809"
FT                   /protein_id="AAT02809.1"
FT   gene            23733..25166
FT                   /locus_tag="LMOf2365_0021"
FT   CDS_pept        23733..25166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0021"
FT                   /product="glycosyl hydrolase, family 1"
FT                   /note="identified by match to protein family HMM PF00232"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02810"
FT                   /protein_id="AAT02810.1"
FT   gene            complement(25213..26034)
FT                   /locus_tag="LMOf2365_0022"
FT   CDS_pept        complement(25213..26034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0022"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0018"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02811"
FT                   /protein_id="AAT02811.1"
FT   gene            26275..27015
FT                   /locus_tag="LMOf2365_0023"
FT   CDS_pept        26275..27015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0023"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07702"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02812"
FT                   /protein_id="AAT02812.1"
FT   gene            27031..27432
FT                   /locus_tag="LMOf2365_0024"
FT   CDS_pept        27031..27432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0024"
FT                   /product="PTS system, fructose-specific, IIA component"
FT                   /note="identified by match to protein family HMM PF03610"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02813"
FT                   /protein_id="AAT02813.1"
FT   gene            27432..27920
FT                   /locus_tag="LMOf2365_0025"
FT   CDS_pept        27432..27920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0025"
FT                   /product="PTS system, mannose/fructose/sorbose family, IIB
FT                   component"
FT                   /note="identified by match to protein family HMM PF03830"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02814"
FT                   /protein_id="AAT02814.1"
FT   gene            27943..28746
FT                   /locus_tag="LMOf2365_0026"
FT   CDS_pept        27943..28746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0026"
FT                   /product="putative PTS system, mannose-specific, IIC
FT                   component"
FT                   /note="identified by similarity to SP:P08187; match to
FT                   protein family HMM PF03609"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02815"
FT                   /protein_id="AAT02815.1"
FT   gene            28727..29548
FT                   /locus_tag="LMOf2365_0027"
FT   CDS_pept        28727..29548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0027"
FT                   /product="PTS system, mannose/fructose/sorbose family, IID
FT                   component"
FT                   /note="identified by similarity to SP:P08188; match to
FT                   protein family HMM PF03613"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02816"
FT                   /protein_id="AAT02816.1"
FT   gene            29576..30280
FT                   /locus_tag="LMOf2365_0028"
FT   CDS_pept        29576..30280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0028"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:8894743; match to
FT                   protein family HMM PF01380"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02817"
FT                   /protein_id="AAT02817.1"
FT                   IEDKFADRIFHF"
FT   gene            30335..30976
FT                   /locus_tag="LMOf2365_0029"
FT   CDS_pept        30335..30976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0029"
FT                   /product="cutC family protein"
FT                   /note="identified by match to protein family HMM PF03932"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02818"
FT                   /protein_id="AAT02818.1"
FT   gene            31181..33085
FT                   /locus_tag="LMOf2365_0030"
FT   CDS_pept        31181..33085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0030"
FT                   /product="PTS system, beta-glucoside-specific, IIABC
FT                   component"
FT                   /note="identified by similarity to SP:P08722; match to
FT                   protein family HMM PF00358; match to protein family HMM
FT                   PF00367; match to protein family HMM PF02378; match to
FT                   protein family HMM TIGR00830; match to protein family HMM
FT                   TIGR01995"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02819"
FT                   /protein_id="AAT02819.1"
FT   gene            33167..34042
FT                   /locus_tag="LMOf2365_0031"
FT   CDS_pept        33167..34042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0031"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0027; match
FT                   to protein family HMM PF02016"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02820"
FT                   /protein_id="AAT02820.1"
FT                   NVSRETLTNF"
FT   gene            complement(34191..34811)
FT                   /locus_tag="LMOf2365_0032"
FT   CDS_pept        complement(34191..34811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0032"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02821"
FT                   /protein_id="AAT02821.1"
FT   gene            complement(34804..35451)
FT                   /pseudo
FT                   /locus_tag="LMOf2365_0033"
FT                   /note="ABC transporter, ATP-binding protein, authentic
FT                   point mutation; this gene contains a premature stop which
FT                   is not the result of sequencing error"
FT   gene            complement(35448..36170)
FT                   /locus_tag="LMOf2365_0034"
FT   CDS_pept        complement(35448..36170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0034"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to SP:P37493"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02822"
FT                   /protein_id="AAT02822.1"
FT                   LLCVFIVAIKKFKTTDIL"
FT   gene            complement(36172..36885)
FT                   /locus_tag="LMOf2365_0035"
FT   CDS_pept        complement(36172..36885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0035"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02823"
FT                   /protein_id="AAT02823.1"
FT                   LYLISSNTFIKKDFY"
FT   gene            complement(36872..37636)
FT                   /locus_tag="LMOf2365_0036"
FT   CDS_pept        complement(36872..37636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0036"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to SP:P37491"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02824"
FT                   /protein_id="AAT02824.1"
FT   gene            complement(37707..38156)
FT                   /locus_tag="LMOf2365_0037"
FT   CDS_pept        complement(37707..38156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0037"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:P37490"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02825"
FT                   /protein_id="AAT02825.1"
FT   gene            38379..38717
FT                   /locus_tag="LMOf2365_0038"
FT   CDS_pept        38379..38717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0038"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0028"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02826"
FT                   /protein_id="AAT02826.1"
FT                   EEAASVEE"
FT   gene            complement(38754..39563)
FT                   /locus_tag="LMOf2365_0039"
FT   CDS_pept        complement(38754..39563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0039"
FT                   /product="hydrolase, haloacid dehalogenase-like family"
FT                   /note="identified by similarity to GP:16412450; match to
FT                   protein family HMM PF00702; match to protein family HMM
FT                   TIGR00099; match to protein family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02827"
FT                   /protein_id="AAT02827.1"
FT   gene            complement(39580..40635)
FT                   /locus_tag="LMOf2365_0040"
FT   CDS_pept        complement(39580..40635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0040"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02828"
FT                   /protein_id="AAT02828.1"
FT                   LIIRESCGSKL"
FT   gene            40837..41802
FT                   /locus_tag="LMOf2365_0041"
FT   CDS_pept        40837..41802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0041"
FT                   /product="ROK family protein"
FT                   /note="identified by match to protein family HMM PF00480"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02829"
FT                   /protein_id="AAT02829.1"
FT   gene            41799..44201
FT                   /locus_tag="LMOf2365_0042"
FT   CDS_pept        41799..44201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0042"
FT                   /product="glycosyl hydrolase, family 9"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02830"
FT                   /protein_id="AAT02830.1"
FT   gene            44214..45572
FT                   /locus_tag="LMOf2365_0043"
FT   CDS_pept        44214..45572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0043"
FT                   /product="PTS system, beta-glucoside-specific, IIC
FT                   component"
FT                   /note="identified by similarity to SP:P46317; match to
FT                   protein family HMM PF02378; match to protein family HMM
FT                   TIGR00410"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02831"
FT                   /protein_id="AAT02831.1"
FT   gene            45574..46659
FT                   /locus_tag="LMOf2365_0044"
FT   CDS_pept        45574..46659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0044"
FT                   /product="SIS domain protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0034; match
FT                   to protein family HMM PF01380"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02832"
FT                   /protein_id="AAT02832.1"
FT   gene            46891..47916
FT                   /gene="argF-1"
FT                   /locus_tag="LMOf2365_0045"
FT   CDS_pept        46891..47916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argF-1"
FT                   /locus_tag="LMOf2365_0045"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00185;
FT                   match to protein family HMM PF02729; match to protein
FT                   family HMM TIGR00658"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02833"
FT                   /db_xref="GOA:Q725C8"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024903"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q725C8"
FT                   /protein_id="AAT02833.1"
FT                   L"
FT   gene            47989..49374
FT                   /locus_tag="LMOf2365_0046"
FT   CDS_pept        47989..49374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0046"
FT                   /product="amino acid permease family protein"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02834"
FT                   /protein_id="AAT02834.1"
FT                   END"
FT   gene            49361..50455
FT                   /locus_tag="LMOf2365_0047"
FT   CDS_pept        49361..50455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0047"
FT                   /product="peptidyl-arginine deiminase-like protein"
FT                   /note="identified by match to protein family HMM PF04371"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02835"
FT                   /db_xref="GOA:Q725C6"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="InterPro:IPR017754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q725C6"
FT                   /protein_id="AAT02835.1"
FT   gene            50468..51409
FT                   /gene="arcC"
FT                   /locus_tag="LMOf2365_0048"
FT   CDS_pept        50468..51409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcC"
FT                   /locus_tag="LMOf2365_0048"
FT                   /product="carbamate kinase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM TIGR00746"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02836"
FT                   /protein_id="AAT02836.1"
FT   gene            51510..52619
FT                   /locus_tag="LMOf2365_0049"
FT   CDS_pept        51510..52619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0049"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:EF0734; match to
FT                   protein family HMM PF04371"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02837"
FT                   /db_xref="GOA:Q725C4"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="InterPro:IPR017754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q725C4"
FT                   /protein_id="AAT02837.1"
FT   gene            52636..53415
FT                   /locus_tag="LMOf2365_0050"
FT   CDS_pept        52636..53415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0050"
FT                   /product="phosphosugar-binding protein"
FT                   /note="identified by match to protein family HMM PF01380"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02838"
FT                   /protein_id="AAT02838.1"
FT   gene            53519..54178
FT                   /locus_tag="LMOf2365_0051"
FT   CDS_pept        53519..54178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0051"
FT                   /product="DedA family protein"
FT                   /note="identified by similarity to SP:P09548; match to
FT                   protein family HMM PF00597"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02839"
FT                   /protein_id="AAT02839.1"
FT   gene            54257..55489
FT                   /gene="arcA"
FT                   /locus_tag="LMOf2365_0052"
FT   CDS_pept        54257..55489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcA"
FT                   /locus_tag="LMOf2365_0052"
FT                   /product="arginine deiminase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF02274;
FT                   match to protein family HMM TIGR01078"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02840"
FT                   /db_xref="GOA:Q725C1"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q725C1"
FT                   /protein_id="AAT02840.1"
FT                   MTMPLVRENLK"
FT   gene            55768..56061
FT                   /gene="rpsF"
FT                   /locus_tag="LMOf2365_0053"
FT   CDS_pept        55768..56061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="LMOf2365_0053"
FT                   /product="ribosomal protein S6"
FT                   /note="identified by match to protein family HMM PF01250;
FT                   match to protein family HMM TIGR00166"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02841"
FT                   /db_xref="GOA:Q725C0"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q725C0"
FT                   /protein_id="AAT02841.1"
FT   gene            56117..56653
FT                   /gene="ssb-1"
FT                   /locus_tag="LMOf2365_0054"
FT   CDS_pept        56117..56653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb-1"
FT                   /locus_tag="LMOf2365_0054"
FT                   /product="single-strand binding protein"
FT                   /note="identified by similarity to SP:P37455; match to
FT                   protein family HMM PF00436; match to protein family HMM
FT                   PF01336; match to protein family HMM TIGR00621"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02842"
FT                   /protein_id="AAT02842.1"
FT                   SDGKPIDISDDDLPF"
FT   gene            56697..56936
FT                   /gene="rpsR"
FT                   /locus_tag="LMOf2365_0055"
FT   CDS_pept        56697..56936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="LMOf2365_0055"
FT                   /product="ribosomal protein S18"
FT                   /note="identified by match to protein family HMM PF01084;
FT                   match to protein family HMM TIGR00165"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02843"
FT                   /db_xref="GOA:Q725B8"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q725B8"
FT                   /protein_id="AAT02843.1"
FT   gene            57089..57700
FT                   /locus_tag="LMOf2365_0056"
FT   CDS_pept        57089..57700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0056"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF03413"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02844"
FT                   /protein_id="AAT02844.1"
FT   gene            57957..58571
FT                   /locus_tag="LMOf2365_0057"
FT   CDS_pept        57957..58571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0057"
FT                   /product="putative accessory gene regulator protein B"
FT                   /note="identified by similarity to GP:16412462; match to
FT                   protein family HMM PF04647"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02845"
FT                   /db_xref="GOA:Q725B6"
FT                   /db_xref="InterPro:IPR006741"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q725B6"
FT                   /protein_id="AAT02845.1"
FT   gene            58564..58716
FT                   /locus_tag="LMOf2365_0058"
FT   CDS_pept        58564..58716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0058"
FT                   /product="putative accessory gene regulator protein D"
FT                   /note="identified by similarity to OMNI:NTL01LI0042"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02846"
FT                   /protein_id="AAT02846.1"
FT                   KNENK"
FT   gene            58812..60107
FT                   /gene="agrC"
FT                   /locus_tag="LMOf2365_0059"
FT   CDS_pept        58812..60107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agrC"
FT                   /locus_tag="LMOf2365_0059"
FT                   /product="accessory gene regulator protein C"
FT                   /note="identified by similarity to GP:1916243; match to
FT                   protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02847"
FT                   /protein_id="AAT02847.1"
FT   gene            60126..60854
FT                   /gene="agrA"
FT                   /locus_tag="LMOf2365_0060"
FT   CDS_pept        60126..60854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agrA"
FT                   /locus_tag="LMOf2365_0060"
FT                   /product="accessory gene regulator protein A"
FT                   /note="identified by similarity to SP:P13131; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF04397"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02848"
FT                   /protein_id="AAT02848.1"
FT   gene            61021..62994
FT                   /locus_tag="LMOf2365_0061"
FT   CDS_pept        61021..62994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0061"
FT                   /product="DHH subfamily 1 protein"
FT                   /note="identified by match to protein family HMM PF01368;
FT                   match to protein family HMM PF02272"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02849"
FT                   /protein_id="AAT02849.1"
FT   gene            62997..63443
FT                   /gene="rplI"
FT                   /locus_tag="LMOf2365_0062"
FT   CDS_pept        62997..63443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="LMOf2365_0062"
FT                   /product="ribosomal protein L9"
FT                   /note="identified by match to protein family HMM PF01281;
FT                   match to protein family HMM PF03948; match to protein
FT                   family HMM TIGR00158"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02850"
FT                   /db_xref="GOA:Q725B1"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q725B1"
FT                   /protein_id="AAT02850.1"
FT   gene            63468..64820
FT                   /gene="dnaB"
FT                   /locus_tag="LMOf2365_0063"
FT   CDS_pept        63468..64820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="LMOf2365_0063"
FT                   /product="replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by similarity to SP:P37469; match to
FT                   protein family HMM PF00772; match to protein family HMM
FT                   PF03796; match to protein family HMM TIGR00665"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02851"
FT                   /protein_id="AAT02851.1"
FT   gene            64876..65025
FT                   /locus_tag="LMOf2365_0064"
FT   CDS_pept        64876..65025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0064"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02852"
FT                   /protein_id="AAT02852.1"
FT                   YSGK"
FT   gene            65079..66371
FT                   /gene="purA"
FT                   /locus_tag="LMOf2365_0065"
FT   CDS_pept        65079..66371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="LMOf2365_0065"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00709;
FT                   match to protein family HMM TIGR00184"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02853"
FT                   /db_xref="GOA:Q725A8"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q725A8"
FT                   /protein_id="AAT02853.1"
FT   gene            66420..66572
FT                   /locus_tag="LMOf2365_0066"
FT   CDS_pept        66420..66572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0066"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02854"
FT                   /protein_id="AAT02854.1"
FT                   IIKSL"
FT   gene            66674..66967
FT                   /locus_tag="LMOf2365_0067"
FT   CDS_pept        66674..66967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0067"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0049; match
FT                   to protein family HMM PF06013"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02855"
FT                   /protein_id="AAT02855.1"
FT   gene            67116..70322
FT                   /locus_tag="LMOf2365_0068"
FT   CDS_pept        67116..70322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0068"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02856"
FT                   /protein_id="AAT02856.1"
FT   gene            70312..70827
FT                   /locus_tag="LMOf2365_0069"
FT   CDS_pept        70312..70827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0069"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0051"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02857"
FT                   /protein_id="AAT02857.1"
FT                   VAARNVFE"
FT   gene            70845..71096
FT                   /locus_tag="LMOf2365_0070"
FT   CDS_pept        70845..71096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0070"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0052"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02858"
FT                   /protein_id="AAT02858.1"
FT   gene            71118..72314
FT                   /locus_tag="LMOf2365_0071"
FT   CDS_pept        71118..72314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0071"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0053"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02859"
FT                   /protein_id="AAT02859.1"
FT   gene            72328..76821
FT                   /locus_tag="LMOf2365_0072"
FT   CDS_pept        72328..76821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0072"
FT                   /product="diarrheal toxin/FtsK/SpoIIIE family protein"
FT                   /note="identified by match to protein family HMM PF01580"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02860"
FT                   /protein_id="AAT02860.1"
FT   gene            76841..77236
FT                   /locus_tag="LMOf2365_0073"
FT   CDS_pept        76841..77236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0073"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02861"
FT                   /protein_id="AAT02861.1"
FT   gene            77229..77528
FT                   /locus_tag="LMOf2365_0074"
FT   CDS_pept        77229..77528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0074"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0056"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02862"
FT                   /protein_id="AAT02862.1"
FT   gene            77525..78226
FT                   /locus_tag="LMOf2365_0075"
FT   CDS_pept        77525..78226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0075"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0057"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02863"
FT                   /protein_id="AAT02863.1"
FT                   DELEFPYEEAK"
FT   gene            78227..78559
FT                   /locus_tag="LMOf2365_0076"
FT   CDS_pept        78227..78559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0076"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0058"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02864"
FT                   /protein_id="AAT02864.1"
FT                   IAALEV"
FT   gene            78573..80249
FT                   /locus_tag="LMOf2365_0077"
FT   CDS_pept        78573..80249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0077"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0059"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02865"
FT                   /protein_id="AAT02865.1"
FT   gene            80262..80651
FT                   /locus_tag="LMOf2365_0078"
FT   CDS_pept        80262..80651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0078"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0063"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02866"
FT                   /protein_id="AAT02866.1"
FT   gene            80789..81199
FT                   /locus_tag="LMOf2365_0079"
FT   CDS_pept        80789..81199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0079"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0064"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02867"
FT                   /protein_id="AAT02867.1"
FT   gene            81384..81638
FT                   /locus_tag="LMOf2365_0080"
FT   CDS_pept        81384..81638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0080"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02868"
FT                   /protein_id="AAT02868.1"
FT   gene            81770..82093
FT                   /locus_tag="LMOf2365_0081"
FT   CDS_pept        81770..82093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0081"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:19715005"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02869"
FT                   /protein_id="AAT02869.1"
FT                   NKQ"
FT   gene            82350..84047
FT                   /locus_tag="LMOf2365_0082"
FT   CDS_pept        82350..84047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0082"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0059"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02870"
FT                   /protein_id="AAT02870.1"
FT   gene            84049..84483
FT                   /locus_tag="LMOf2365_0083"
FT   CDS_pept        84049..84483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0083"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:P40737"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02871"
FT                   /protein_id="AAT02871.1"
FT   gene            84907..85617
FT                   /locus_tag="LMOf2365_0084"
FT   CDS_pept        84907..85617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0084"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02872"
FT                   /protein_id="AAT02872.1"
FT                   VDWYERLNLLKEIK"
FT   gene            85618..85941
FT                   /locus_tag="LMOf2365_0085"
FT   CDS_pept        85618..85941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0085"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02873"
FT                   /protein_id="AAT02873.1"
FT                   WEK"
FT   gene            86108..86401
FT                   /locus_tag="LMOf2365_0086"
FT   CDS_pept        86108..86401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0086"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02874"
FT                   /protein_id="AAT02874.1"
FT   gene            86538..87260
FT                   /locus_tag="LMOf2365_0087"
FT   CDS_pept        86538..87260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0087"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02875"
FT                   /protein_id="AAT02875.1"
FT                   QLFTAYCKFKFKEFHIEE"
FT   gene            87500..87682
FT                   /locus_tag="LMOf2365_0088"
FT   CDS_pept        87500..87682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0088"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02876"
FT                   /protein_id="AAT02876.1"
FT                   VPYVDVCVGIDPYDE"
FT   gene            88139..88240
FT                   /locus_tag="LMOf2365_0089"
FT   CDS_pept        88139..88240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0089"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02877"
FT                   /protein_id="AAT02877.1"
FT   gene            88367..88651
FT                   /locus_tag="LMOf2365_0090"
FT   CDS_pept        88367..88651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0090"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02878"
FT                   /protein_id="AAT02878.1"
FT   gene            88639..89088
FT                   /locus_tag="LMOf2365_0091"
FT   CDS_pept        88639..89088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0091"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02879"
FT                   /protein_id="AAT02879.1"
FT   gene            89326..90099
FT                   /locus_tag="LMOf2365_0092"
FT   CDS_pept        89326..90099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0092"
FT                   /product="putative transferase"
FT                   /note="identified by similarity to SP:P11435"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02880"
FT                   /protein_id="AAT02880.1"
FT   gene            90096..91148
FT                   /gene="ada"
FT                   /locus_tag="LMOf2365_0093"
FT   CDS_pept        90096..91148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ada"
FT                   /locus_tag="LMOf2365_0093"
FT                   /product="Ada regulatory protein"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P06134; match to
FT                   protein family HMM PF00165; match to protein family HMM
FT                   PF01035; match to protein family HMM PF02805; match to
FT                   protein family HMM TIGR00589"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02881"
FT                   /protein_id="AAT02881.1"
FT                   LIKHEKMVPR"
FT   gene            complement(91170..91883)
FT                   /locus_tag="LMOf2365_0094"
FT   CDS_pept        complement(91170..91883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0094"
FT                   /product="pentapeptide repeats domain protein"
FT                   /note="identified by match to protein family HMM PF00805"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02882"
FT                   /protein_id="AAT02882.1"
FT                   SHAPALMPLFGIRVK"
FT   gene            91939..92895
FT                   /locus_tag="LMOf2365_0095"
FT   CDS_pept        91939..92895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0095"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF00389;
FT                   match to protein family HMM PF02826"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02883"
FT                   /protein_id="AAT02883.1"
FT   gene            92983..93055
FT                   /locus_tag="LMOf2365_2848"
FT   tRNA            92983..93055
FT                   /locus_tag="LMOf2365_2848"
FT                   /product="tRNA-Lys"
FT   gene            93236..94759
FT                   /locus_tag="LMOf2365_0096"
FT   CDS_pept        93236..94759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0096"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GP:16412606; match to
FT                   protein family HMM PF06860"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02884"
FT                   /protein_id="AAT02884.1"
FT   gene            94741..95118
FT                   /locus_tag="LMOf2365_0097"
FT   CDS_pept        94741..95118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0097"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02885"
FT                   /protein_id="AAT02885.1"
FT   gene            95591..95935
FT                   /locus_tag="LMOf2365_0098"
FT   CDS_pept        95591..95935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0098"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02886"
FT                   /protein_id="AAT02886.1"
FT                   GIPEKMEIVK"
FT   gene            96061..96402
FT                   /locus_tag="LMOf2365_0099"
FT   CDS_pept        96061..96402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0099"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02887"
FT                   /protein_id="AAT02887.1"
FT                   KKNVKKDNP"
FT   gene            complement(96469..96837)
FT                   /locus_tag="LMOf2365_0100"
FT   CDS_pept        complement(96469..96837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0100"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="identified by match to protein family HMM PF00376"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02888"
FT                   /protein_id="AAT02888.1"
FT                   TVVRKIGIYEEKVKTRRV"
FT   gene            complement(96893..97876)
FT                   /locus_tag="LMOf2365_0101"
FT   CDS_pept        complement(96893..97876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0101"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02889"
FT                   /protein_id="AAT02889.1"
FT   gene            98267..98956
FT                   /locus_tag="LMOf2365_0102"
FT   CDS_pept        98267..98956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0102"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0129"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02890"
FT                   /protein_id="AAT02890.1"
FT                   KHKSNVF"
FT   gene            99033..104912
FT                   /locus_tag="LMOf2365_0103"
FT   CDS_pept        99033..104912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0103"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:16412551; match to
FT                   protein family HMM PF05738"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02891"
FT                   /protein_id="AAT02891.1"
FT   gene            104909..107218
FT                   /locus_tag="LMOf2365_0104"
FT   CDS_pept        104909..107218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0104"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0131"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02892"
FT                   /protein_id="AAT02892.1"
FT                   AVYDAQGALQLYVYQK"
FT   gene            107275..107517
FT                   /locus_tag="LMOf2365_0105"
FT   CDS_pept        107275..107517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0105"
FT                   /product="ATP synthase F0, C subunit family protein"
FT                   /note="identified by similarity to SP:Q05366; match to
FT                   protein family HMM PF00137"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02893"
FT                   /protein_id="AAT02893.1"
FT   gene            107529..108560
FT                   /locus_tag="LMOf2365_0106"
FT   CDS_pept        107529..108560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0106"
FT                   /product="putative ATP synthase F1, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02894"
FT                   /protein_id="AAT02894.1"
FT                   VKL"
FT   gene            108557..110053
FT                   /gene="atpA-1"
FT                   /locus_tag="LMOf2365_0107"
FT   CDS_pept        108557..110053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA-1"
FT                   /locus_tag="LMOf2365_0107"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF00306; match to protein
FT                   family HMM TIGR00962"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02895"
FT                   /db_xref="GOA:Q724W6"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724W6"
FT                   /protein_id="AAT02895.1"
FT   gene            110050..110919
FT                   /locus_tag="LMOf2365_0108"
FT   CDS_pept        110050..110919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0108"
FT                   /product="putative ATP synthase F1, gamma subunit"
FT                   /note="identified by match to protein family HMM PF00231"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02896"
FT                   /protein_id="AAT02896.1"
FT                   QTIRKDEE"
FT   gene            110920..112290
FT                   /gene="atpD-1"
FT                   /locus_tag="LMOf2365_0109"
FT   CDS_pept        110920..112290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD-1"
FT                   /locus_tag="LMOf2365_0109"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF00306; match to protein
FT                   family HMM PF02874; match to protein family HMM TIGR01039"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02897"
FT                   /db_xref="GOA:Q724W4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724W4"
FT                   /protein_id="AAT02897.1"
FT   gene            112303..112635
FT                   /locus_tag="LMOf2365_0110"
FT   CDS_pept        112303..112635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0110"
FT                   /product="putative ATP synthase F1, epsilon subunit"
FT                   /note="identified by match to protein family HMM PF02823"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02898"
FT                   /protein_id="AAT02898.1"
FT                   DDKRIF"
FT   gene            112616..113176
FT                   /locus_tag="LMOf2365_0111"
FT   CDS_pept        112616..113176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0138"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02899"
FT                   /protein_id="AAT02899.1"
FT   gene            113351..113983
FT                   /locus_tag="LMOf2365_0112"
FT   CDS_pept        113351..113983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0112"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0140"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02900"
FT                   /protein_id="AAT02900.1"
FT   gene            114281..115246
FT                   /gene="manL"
FT                   /locus_tag="LMOf2365_0113"
FT   CDS_pept        114281..115246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manL"
FT                   /locus_tag="LMOf2365_0113"
FT                   /product="PTS system, mannose-specific, IIAB component"
FT                   /EC_number=""
FT                   /note="identified by similarity to GP:5669855; match to
FT                   protein family HMM PF03610; match to protein family HMM
FT                   PF03830; match to protein family HMM TIGR00824"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02901"
FT                   /protein_id="AAT02901.1"
FT   gene            115270..116076
FT                   /locus_tag="LMOf2365_0114"
FT   CDS_pept        115270..116076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0114"
FT                   /product="PTS system, mannose/fructose/sorbose family, IIC
FT                   component"
FT                   /note="identified by similarity to SP:P08187; match to
FT                   protein family HMM PF03609"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02902"
FT                   /protein_id="AAT02902.1"
FT   gene            116098..117009
FT                   /locus_tag="LMOf2365_0115"
FT   CDS_pept        116098..117009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0115"
FT                   /product="PTS system, mannose/fructose/sorbose family, IID
FT                   component"
FT                   /note="identified by similarity to SP:P08188; match to
FT                   protein family HMM PF03613; match to protein family HMM
FT                   TIGR00828"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02903"
FT                   /protein_id="AAT02903.1"
FT   gene            117136..117525
FT                   /locus_tag="LMOf2365_0116"
FT   CDS_pept        117136..117525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0116"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:16412565; match to
FT                   protein family HMM PF06115"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02904"
FT                   /protein_id="AAT02904.1"
FT   gene            117647..117997
FT                   /locus_tag="LMOf2365_0117"
FT   CDS_pept        117647..117997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0117"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0145"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02905"
FT                   /protein_id="AAT02905.1"
FT                   AKGKKMEKILRK"
FT   gene            complement(118038..119555)
FT                   /locus_tag="LMOf2365_0118"
FT   CDS_pept        complement(118038..119555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0118"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02906"
FT                   /protein_id="AAT02906.1"
FT   gene            complement(119670..119963)
FT                   /locus_tag="LMOf2365_0119"
FT   CDS_pept        complement(119670..119963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0119"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="identified by match to protein family HMM PF01022"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02907"
FT                   /protein_id="AAT02907.1"
FT   gene            120075..120365
FT                   /locus_tag="LMOf2365_0120"
FT   CDS_pept        120075..120365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0120"
FT                   /product="YneC family protein"
FT                   /note="identified by match to protein family HMM PF03992"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02908"
FT                   /protein_id="AAT02908.1"
FT   gene            120379..121011
FT                   /locus_tag="LMOf2365_0121"
FT   CDS_pept        120379..121011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0121"
FT                   /product="nitroreductase family protein"
FT                   /note="identified by match to protein family HMM PF00881"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02909"
FT                   /protein_id="AAT02909.1"
FT   gene            121107..121478
FT                   /locus_tag="LMOf2365_0122"
FT   CDS_pept        121107..121478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0122"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0150"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02910"
FT                   /protein_id="AAT02910.1"
FT   gene            121757..124039
FT                   /gene="chiB"
FT                   /locus_tag="LMOf2365_0123"
FT   CDS_pept        121757..124039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chiB"
FT                   /locus_tag="LMOf2365_0123"
FT                   /product="chitinase B"
FT                   /EC_number=""
FT                   /note="identified by similarity to GP:2696017; match to
FT                   protein family HMM PF00041; match to protein family HMM
FT                   PF00704; match to protein family HMM PF02839"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02911"
FT                   /protein_id="AAT02911.1"
FT                   GPWLLIN"
FT   gene            124142..125044
FT                   /locus_tag="LMOf2365_0124"
FT   CDS_pept        124142..125044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0124"
FT                   /product="ROK family protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0765; match
FT                   to protein family HMM PF00480"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02912"
FT                   /protein_id="AAT02912.1"
FT   gene            complement(125069..126850)
FT                   /locus_tag="LMOf2365_0125"
FT   CDS_pept        complement(125069..126850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0125"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02913"
FT                   /protein_id="AAT02913.1"
FT                   GYYYNLYQSQFDMLQAL"
FT   gene            complement(126843..128609)
FT                   /locus_tag="LMOf2365_0126"
FT   CDS_pept        complement(126843..128609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0126"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02914"
FT                   /protein_id="AAT02914.1"
FT                   NKQLGTEANVNG"
FT   gene            128728..129561
FT                   /locus_tag="LMOf2365_0127"
FT   CDS_pept        128728..129561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0127"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF02311; match to protein
FT                   family HMM PF07883"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02915"
FT                   /protein_id="AAT02915.1"
FT   gene            129704..130711
FT                   /locus_tag="LMOf2365_0128"
FT   CDS_pept        129704..130711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0128"
FT                   /product="lipase"
FT                   /note="identified by similarity to GP:2853612; match to
FT                   protein family HMM PF07859"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02916"
FT                   /protein_id="AAT02916.1"
FT   gene            130827..131525
FT                   /locus_tag="LMOf2365_0129"
FT   CDS_pept        130827..131525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0129"
FT                   /product="EAL domain protein"
FT                   /note="identified by match to protein family HMM PF00563"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02917"
FT                   /protein_id="AAT02917.1"
FT                   GYLVNKPFPV"
FT   gene            complement(131495..132190)
FT                   /locus_tag="LMOf2365_0130"
FT   CDS_pept        complement(131495..132190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0130"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0157"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02918"
FT                   /protein_id="AAT02918.1"
FT                   QTGNGLLTR"
FT   gene            complement(132409..132870)
FT                   /locus_tag="LMOf2365_0131"
FT   CDS_pept        complement(132409..132870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0131"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06114"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02919"
FT                   /protein_id="AAT02919.1"
FT   misc_feature    132412..143134
FT                   /note="Putative lysogenic bacteriophage region. Possible
FT                   monocin; LambdaLm01"
FT   gene            complement(132867..133202)
FT                   /locus_tag="LMOf2365_0132"
FT   CDS_pept        complement(132867..133202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0132"
FT                   /product="putative prophage LambdaLm01, repressor protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02920"
FT                   /protein_id="AAT02920.1"
FT                   KKLHRGM"
FT   gene            133419..133847
FT                   /gene="lmaD"
FT                   /locus_tag="LMOf2365_0133"
FT   CDS_pept        133419..133847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lmaD"
FT                   /locus_tag="LMOf2365_0133"
FT                   /product="prophage LambdaLm01, antigen D"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02921"
FT                   /protein_id="AAT02921.1"
FT   gene            133859..134275
FT                   /gene="lmaC"
FT                   /locus_tag="LMOf2365_0134"
FT   CDS_pept        133859..134275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lmaC"
FT                   /locus_tag="LMOf2365_0134"
FT                   /product="prophage LambdaLm01, antigen C"
FT                   /note="identified by match to protein family HMM TIGR01637"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02922"
FT                   /protein_id="AAT02922.1"
FT   gene            134555..134944
FT                   /gene="lmaB"
FT                   /locus_tag="LMOf2365_0135"
FT   CDS_pept        134555..134944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lmaB"
FT                   /locus_tag="LMOf2365_0135"
FT                   /product="prophage LambdaLm01, antigen B"
FT                   /note="identified by similarity to OMNI:NTL01LM0117"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02923"
FT                   /protein_id="AAT02923.1"
FT   gene            134957..135469
FT                   /gene="lmaA"
FT                   /locus_tag="LMOf2365_0136"
FT   CDS_pept        134957..135469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lmaA"
FT                   /locus_tag="LMOf2365_0136"
FT                   /product="prophage LambdaLm01, antigen A"
FT                   /note="identified by similarity to OMNI:NTL01LM0118; match
FT                   to protein family HMM TIGR02126"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02924"
FT                   /protein_id="AAT02924.1"
FT                   TPVAPAE"
FT   gene            135517..135819
FT                   /locus_tag="LMOf2365_0137"
FT   CDS_pept        135517..135819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0137"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0164"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02925"
FT                   /protein_id="AAT02925.1"
FT   gene            135861..136265
FT                   /locus_tag="LMOf2365_0138"
FT   CDS_pept        135861..136265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0138"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0165"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02926"
FT                   /protein_id="AAT02926.1"
FT   gene            136252..138120
FT                   /locus_tag="LMOf2365_0139"
FT   CDS_pept        136252..138120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0139"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0166"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02927"
FT                   /protein_id="AAT02927.1"
FT   gene            138117..138935
FT                   /locus_tag="LMOf2365_0140"
FT   CDS_pept        138117..138935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0140"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0167; match
FT                   to protein family HMM PF06997"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02928"
FT                   /protein_id="AAT02928.1"
FT   gene            138945..140081
FT                   /locus_tag="LMOf2365_0141"
FT   CDS_pept        138945..140081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0141"
FT                   /product="putative prophage LambdaLm01, minor structural
FT                   protein"
FT                   /note="identified by match to protein family HMM PF06605;
FT                   match to protein family HMM TIGR01665"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02929"
FT                   /protein_id="AAT02929.1"
FT   gene            140071..140370
FT                   /locus_tag="LMOf2365_0142"
FT   CDS_pept        140071..140370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0142"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0169"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02930"
FT                   /protein_id="AAT02930.1"
FT   gene            140385..140960
FT                   /locus_tag="LMOf2365_0143"
FT   CDS_pept        140385..140960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0170"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02931"
FT                   /protein_id="AAT02931.1"
FT   gene            140975..141454
FT                   /locus_tag="LMOf2365_0144"
FT   CDS_pept        140975..141454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0144"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0171"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02932"
FT                   /protein_id="AAT02932.1"
FT   gene            141451..141987
FT                   /locus_tag="LMOf2365_0145"
FT   CDS_pept        141451..141987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0145"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0172"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02933"
FT                   /protein_id="AAT02933.1"
FT                   NTNNASWALRQLTVM"
FT   gene            142006..142428
FT                   /locus_tag="LMOf2365_0146"
FT   CDS_pept        142006..142428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0146"
FT                   /product="putative prophage LambdaLm01, holin"
FT                   /note="identified by match to protein family HMM PF05105;
FT                   match to protein family HMM TIGR01593"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02934"
FT                   /protein_id="AAT02934.1"
FT   gene            142409..143137
FT                   /locus_tag="LMOf2365_0147"
FT   CDS_pept        142409..143137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0147"
FT                   /product="prophage LambdaLm01, N-acetylmuramoyl-L-alanine
FT                   amidase, family 3"
FT                   /note="identified by similarity to OMNI:NTL01LI0174; match
FT                   to protein family HMM PF01520"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02935"
FT                   /protein_id="AAT02935.1"
FT   gene            complement(143175..145523)
FT                   /locus_tag="LMOf2365_0148"
FT   CDS_pept        complement(143175..145523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0148"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM PF00746; match to protein
FT                   family HMM PF02872; match to protein family HMM PF05738;
FT                   match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02936"
FT                   /protein_id="AAT02936.1"
FT   gene            145717..146466
FT                   /locus_tag="LMOf2365_0149"
FT   CDS_pept        145717..146466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0149"
FT                   /product="EAL domain protein"
FT                   /note="identified by match to protein family HMM PF00563"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02937"
FT                   /protein_id="AAT02937.1"
FT   gene            complement(146536..148044)
FT                   /locus_tag="LMOf2365_0150"
FT   CDS_pept        complement(146536..148044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0150"
FT                   /product="putative inosine-5'-monophosphate dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00478;
FT                   match to protein family HMM PF00571"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02938"
FT                   /protein_id="AAT02938.1"
FT   gene            148211..148444
FT                   /locus_tag="LMOf2365_0151"
FT   CDS_pept        148211..148444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0151"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06902"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02939"
FT                   /protein_id="AAT02939.1"
FT   gene            148456..148734
FT                   /locus_tag="LMOf2365_0152"
FT   CDS_pept        148456..148734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0152"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02940"
FT                   /protein_id="AAT02940.1"
FT   gene            149060..150634
FT                   /locus_tag="LMOf2365_0153"
FT   CDS_pept        149060..150634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0153"
FT                   /product="oligopeptide ABC transporter,
FT                   oligopeptide-binding protein"
FT                   /note="identified by similarity to SP:P42061; match to
FT                   protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02941"
FT                   /protein_id="AAT02941.1"
FT                   SKLYLTE"
FT   gene            150736..151686
FT                   /locus_tag="LMOf2365_0154"
FT   CDS_pept        150736..151686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0154"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /note="identified by similarity to SP:P42062; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02942"
FT                   /protein_id="AAT02942.1"
FT   gene            151697..152590
FT                   /locus_tag="LMOf2365_0155"
FT   CDS_pept        151697..152590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0155"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /note="identified by similarity to SP:P42063; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02943"
FT                   /protein_id="AAT02943.1"
FT                   FNVLGDVLRKGLSRRY"
FT   gene            152790..153074
FT                   /locus_tag="LMOf2365_0156"
FT   CDS_pept        152790..153074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0156"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0183"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02944"
FT                   /protein_id="AAT02944.1"
FT   gene            153075..153443
FT                   /locus_tag="LMOf2365_0157"
FT   CDS_pept        153075..153443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0157"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0184"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02945"
FT                   /protein_id="AAT02945.1"
FT                   NIYQLENQQQDLQKELLQ"
FT   gene            153440..154743
FT                   /pseudo
FT                   /locus_tag="LMOf2365_0158"
FT                   /note="conserved hypothetical protein, authentic
FT                   frameshift; this gene contains a frame shift which is not
FT                   the result of sequencing error; identified by similarity to
FT                   GP:16412606"
FT   gene            154753..154995
FT                   /locus_tag="LMOf2365_0159"
FT   CDS_pept        154753..154995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0159"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:19712958"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02946"
FT                   /protein_id="AAT02946.1"
FT   gene            155016..155459
FT                   /locus_tag="LMOf2365_0160"
FT   CDS_pept        155016..155459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0160"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02947"
FT                   /protein_id="AAT02947.1"
FT   gene            155691..155927
FT                   /locus_tag="LMOf2365_0161"
FT   CDS_pept        155691..155927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0161"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02948"
FT                   /protein_id="AAT02948.1"
FT   gene            155933..156166
FT                   /locus_tag="LMOf2365_0162"
FT   CDS_pept        155933..156166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0162"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:15622581"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02949"
FT                   /protein_id="AAT02949.1"
FT   gene            156477..156581
FT                   /locus_tag="LMOf2365_0163"
FT   CDS_pept        156477..156581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0163"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02950"
FT                   /protein_id="AAT02950.1"
FT   gene            156716..156865
FT                   /locus_tag="LMOf2365_0164"
FT   CDS_pept        156716..156865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0164"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02951"
FT                   /protein_id="AAT02951.1"
FT                   FLER"
FT   gene            157006..157377
FT                   /locus_tag="LMOf2365_0165"
FT   CDS_pept        157006..157377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0165"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02952"
FT                   /protein_id="AAT02952.1"
FT   gene            157421..157732
FT                   /locus_tag="LMOf2365_0166"
FT   CDS_pept        157421..157732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0166"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02953"
FT                   /protein_id="AAT02953.1"
FT   gene            complement(157865..159520)
FT                   /locus_tag="LMOf2365_0167"
FT   CDS_pept        complement(157865..159520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0167"
FT                   /product="bacterial extracellular solute-binding protein,
FT                   family 5"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02954"
FT                   /protein_id="AAT02954.1"
FT   gene            159743..160684
FT                   /locus_tag="LMOf2365_0168"
FT   CDS_pept        159743..160684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0168"
FT                   /product="zinc ABC transporter, zinc-binding protein"
FT                   /note="identified by similarity to SP:O05703; match to
FT                   protein family HMM PF01297"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02955"
FT                   /protein_id="AAT02955.1"
FT   gene            160697..161401
FT                   /gene="zurA-1"
FT                   /locus_tag="LMOf2365_0169"
FT   CDS_pept        160697..161401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zurA-1"
FT                   /locus_tag="LMOf2365_0169"
FT                   /product="zinc ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to SP:Q9XDA6; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02956"
FT                   /protein_id="AAT02956.1"
FT                   SMDLCKEPSKHQ"
FT   gene            161350..162156
FT                   /gene="zurM-1"
FT                   /locus_tag="LMOf2365_0170"
FT   CDS_pept        161350..162156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zurM-1"
FT                   /locus_tag="LMOf2365_0170"
FT                   /product="zinc ABC transporter, permease protein"
FT                   /note="identified by similarity to SP:P39832; match to
FT                   protein family HMM PF00950"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02957"
FT                   /protein_id="AAT02957.1"
FT   gene            complement(162160..162840)
FT                   /locus_tag="LMOf2365_0171"
FT   CDS_pept        complement(162160..162840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0171"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="identified by match to protein family HMM PF00027"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02958"
FT                   /protein_id="AAT02958.1"
FT                   QTSF"
FT   gene            163118..165457
FT                   /locus_tag="LMOf2365_0172"
FT   CDS_pept        163118..165457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0172"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06733"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02959"
FT                   /protein_id="AAT02959.1"
FT   gene            165502..166314
FT                   /locus_tag="LMOf2365_0173"
FT   CDS_pept        165502..166314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0173"
FT                   /product="Cof-like hydrolase"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR00099; match to protein
FT                   family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02960"
FT                   /protein_id="AAT02960.1"
FT   gene            166599..168668
FT                   /locus_tag="LMOf2365_0174"
FT   CDS_pept        166599..168668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0174"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM PF05737;
FT                   match to protein family HMM PF05738; match to protein
FT                   family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02961"
FT                   /protein_id="AAT02961.1"
FT   gene            168859..170601
FT                   /locus_tag="LMOf2365_0175"
FT   CDS_pept        168859..170601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0175"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05737;
FT                   match to protein family HMM PF05738"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02962"
FT                   /protein_id="AAT02962.1"
FT                   LRRK"
FT   gene            complement(170645..171481)
FT                   /locus_tag="LMOf2365_0176"
FT   CDS_pept        complement(170645..171481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0176"
FT                   /product="STAS domain protein"
FT                   /note="identified by match to protein family HMM PF01740"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02963"
FT                   /protein_id="AAT02963.1"
FT   gene            171698..172690
FT                   /gene="holB"
FT                   /locus_tag="LMOf2365_0177"
FT   CDS_pept        171698..172690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="LMOf2365_0177"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P37540; match to
FT                   protein family HMM TIGR00678"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02964"
FT                   /protein_id="AAT02964.1"
FT   gene            172696..173529
FT                   /locus_tag="LMOf2365_0178"
FT   CDS_pept        172696..173529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0178"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0204; match
FT                   to protein family HMM PF04468"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02965"
FT                   /protein_id="AAT02965.1"
FT   gene            173540..173929
FT                   /locus_tag="LMOf2365_0179"
FT   CDS_pept        173540..173929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0179"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:10172658; match to
FT                   protein family HMM PF06156"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02966"
FT                   /db_xref="GOA:Q724P5"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724P5"
FT                   /protein_id="AAT02966.1"
FT   gene            173978..174739
FT                   /locus_tag="LMOf2365_0180"
FT   CDS_pept        173978..174739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0180"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:P37543"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02967"
FT                   /protein_id="AAT02967.1"
FT   gene            174723..174992
FT                   /locus_tag="LMOf2365_0181"
FT   CDS_pept        174723..174992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0181"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:EF2693; match to
FT                   protein family HMM PF01541"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02968"
FT                   /db_xref="GOA:Q724P3"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724P3"
FT                   /protein_id="AAT02968.1"
FT   gene            174989..175870
FT                   /locus_tag="LMOf2365_0182"
FT   CDS_pept        174989..175870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0182"
FT                   /product="tetrapyrrole methylase family protein"
FT                   /note="identified by similarity to GP:16412629; match to
FT                   protein family HMM PF00590; match to protein family HMM
FT                   TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02969"
FT                   /protein_id="AAT02969.1"
FT                   KREVYSAYHEIK"
FT   gene            complement(175915..176199)
FT                   /locus_tag="LMOf2365_0183"
FT   CDS_pept        complement(175915..176199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0183"
FT                   /product="transition state regulatory protein AbrB"
FT                   /note="identified by similarity to SP:P08874; match to
FT                   protein family HMM PF04014; match to protein family HMM
FT                   TIGR01439"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02970"
FT                   /protein_id="AAT02970.1"
FT   gene            176313..177170
FT                   /locus_tag="LMOf2365_0184"
FT   CDS_pept        176313..177170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0184"
FT                   /product="glucose uptake protein"
FT                   /note="identified by similarity to GP:2226001; match to
FT                   protein family HMM PF06800"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02971"
FT                   /protein_id="AAT02971.1"
FT                   IAKS"
FT   gene            177238..178500
FT                   /locus_tag="LMOf2365_0185"
FT   CDS_pept        177238..178500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0185"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0211; match
FT                   to protein family HMM PF06742; match to protein family HMM
FT                   PF06863"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02972"
FT                   /protein_id="AAT02972.1"
FT   gene            complement(178648..179913)
FT                   /locus_tag="LMOf2365_0186"
FT   CDS_pept        complement(178648..179913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0186"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM PF06458; match to protein
FT                   family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02973"
FT                   /protein_id="AAT02973.1"
FT   gene            180191..181051
FT                   /locus_tag="LMOf2365_0187"
FT   CDS_pept        180191..181051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0187"
FT                   /product="glucose uptake protein"
FT                   /note="identified by similarity to GP:2226001; match to
FT                   protein family HMM PF06800"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02974"
FT                   /protein_id="AAT02974.1"
FT                   VAKGA"
FT   gene            181120..183117
FT                   /gene="metG"
FT                   /locus_tag="LMOf2365_0188"
FT   CDS_pept        181120..183117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metG"
FT                   /locus_tag="LMOf2365_0188"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM PF01588; match to protein
FT                   family HMM TIGR00398; match to protein family HMM
FT                   TIGR00399"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02975"
FT                   /db_xref="GOA:Q724N6"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724N6"
FT                   /protein_id="AAT02975.1"
FT   gene            183281..184495
FT                   /locus_tag="LMOf2365_0189"
FT   CDS_pept        183281..184495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0189"
FT                   /product="xylose repressor protein"
FT                   /note="identified by similarity to SP:P16557; match to
FT                   protein family HMM PF00480"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02976"
FT                   /protein_id="AAT02976.1"
FT                   QTLLR"
FT   gene            184531..185409
FT                   /locus_tag="LMOf2365_0190"
FT   CDS_pept        184531..185409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0190"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02977"
FT                   /protein_id="AAT02977.1"
FT                   QNKLQKRWSNY"
FT   gene            185409..186257
FT                   /locus_tag="LMOf2365_0191"
FT   CDS_pept        185409..186257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0191"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02978"
FT                   /protein_id="AAT02978.1"
FT                   E"
FT   gene            186285..187541
FT                   /locus_tag="LMOf2365_0192"
FT   CDS_pept        186285..187541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0192"
FT                   /product="sugar ABC transporter, sugar-binding protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02979"
FT                   /protein_id="AAT02979.1"
FT   gene            187624..190926
FT                   /locus_tag="LMOf2365_0193"
FT   CDS_pept        187624..190926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0193"
FT                   /product="glycosyl hydrolase, family 31"
FT                   /note="identified by match to protein family HMM PF01055"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02980"
FT                   /protein_id="AAT02980.1"
FT   gene            190929..193220
FT                   /locus_tag="LMOf2365_0194"
FT   CDS_pept        190929..193220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0194"
FT                   /product="alpha-glucosidase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:Q9F234; match to
FT                   protein family HMM PF01055"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02981"
FT                   /protein_id="AAT02981.1"
FT                   KTDKITRAGI"
FT   gene            193224..194885
FT                   /gene="malL-1"
FT                   /locus_tag="LMOf2365_0195"
FT   CDS_pept        193224..194885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malL-1"
FT                   /locus_tag="LMOf2365_0195"
FT                   /product="oligo-1,6-glucosidase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P21332; match to
FT                   protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02982"
FT                   /protein_id="AAT02982.1"
FT   gene            194958..195755
FT                   /locus_tag="LMOf2365_0196"
FT   CDS_pept        194958..195755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0196"
FT                   /product="deoxyribonuclease, TatD family"
FT                   /note="identified by match to protein family HMM PF01026;
FT                   match to protein family HMM TIGR00010"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02983"
FT                   /protein_id="AAT02983.1"
FT   gene            196047..197273
FT                   /locus_tag="LMOf2365_0197"
FT   CDS_pept        196047..197273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0197"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:P37546; match to
FT                   protein family HMM PF03990; match to protein family HMM
FT                   PF06725; match to protein family HMM PF07501"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02984"
FT                   /protein_id="AAT02984.1"
FT                   RMVTVKVLN"
FT   gene            197375..197950
FT                   /locus_tag="LMOf2365_0198"
FT   CDS_pept        197375..197950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0198"
FT                   /product="primase-related protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0224; match
FT                   to protein family HMM PF01751; match to protein family HMM
FT                   TIGR00334"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02985"
FT                   /protein_id="AAT02985.1"
FT   gene            197943..198830
FT                   /gene="ksgA"
FT                   /locus_tag="LMOf2365_0199"
FT   CDS_pept        197943..198830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="LMOf2365_0199"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by similarity to SP:P37468; match to
FT                   protein family HMM PF00398; match to protein family HMM
FT                   TIGR00755"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02986"
FT                   /db_xref="GOA:Q724M5"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724M5"
FT                   /protein_id="AAT02986.1"
FT                   AKLSNFLGDFLKEK"
FT   gene            198950..199207
FT                   /locus_tag="LMOf2365_0200"
FT   CDS_pept        198950..199207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0200"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:P37466; match to
FT                   protein family HMM PF06257"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02987"
FT                   /protein_id="AAT02987.1"
FT   gene            199346..200227
FT                   /gene="ispE"
FT                   /locus_tag="LMOf2365_0201"
FT   CDS_pept        199346..200227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="LMOf2365_0201"
FT                   /product="4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol
FT                   kinase activity"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00288;
FT                   match to protein family HMM TIGR00154"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02988"
FT                   /db_xref="GOA:Q724M3"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724M3"
FT                   /protein_id="AAT02988.1"
FT                   WSEGENDTNINN"
FT   gene            200249..200986
FT                   /locus_tag="LMOf2365_0202"
FT   CDS_pept        200249..200986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0202"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:VC1285; match to
FT                   protein family HMM PF04794"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02989"
FT                   /db_xref="GOA:Q724M2"
FT                   /db_xref="InterPro:IPR006879"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR022948"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724M2"
FT                   /protein_id="AAT02989.1"
FT   gene            201150..201968
FT                   /gene="purR"
FT                   /locus_tag="LMOf2365_0203"
FT   CDS_pept        201150..201968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purR"
FT                   /locus_tag="LMOf2365_0203"
FT                   /product="Pur operon transcriptional repressor"
FT                   /note="identified by similarity to SP:P37551; match to
FT                   protein family HMM PF00156; match to protein family HMM
FT                   TIGR01743"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02990"
FT                   /protein_id="AAT02990.1"
FT   gene            202144..202821
FT                   /locus_tag="LMOf2365_0204"
FT   CDS_pept        202144..202821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0204"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0230"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02991"
FT                   /protein_id="AAT02991.1"
FT                   APS"
FT   gene            202870..203562
FT                   /locus_tag="LMOf2365_0205"
FT   CDS_pept        202870..203562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0205"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02992"
FT                   /protein_id="AAT02992.1"
FT                   FHEEATQA"
FT   gene            203559..204767
FT                   /locus_tag="LMOf2365_0206"
FT   CDS_pept        203559..204767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0206"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02993"
FT                   /protein_id="AAT02993.1"
FT                   RSE"
FT   gene            205451..205759
FT                   /gene="spoVG-1"
FT                   /locus_tag="LMOf2365_0207"
FT   CDS_pept        205451..205759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVG-1"
FT                   /locus_tag="LMOf2365_0207"
FT                   /product="stage V sporulation protein G"
FT                   /note="identified by similarity to SP:P28015; match to
FT                   protein family HMM PF04026"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02994"
FT                   /db_xref="GOA:Q724L7"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724L7"
FT                   /protein_id="AAT02994.1"
FT   gene            205878..206186
FT                   /gene="spoVG-2"
FT                   /locus_tag="LMOf2365_0208"
FT   CDS_pept        205878..206186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVG-2"
FT                   /locus_tag="LMOf2365_0208"
FT                   /product="stage V sporulation protein G"
FT                   /note="identified by similarity to SP:P28015; match to
FT                   protein family HMM PF04026"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02995"
FT                   /db_xref="GOA:Q724L6"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724L6"
FT                   /protein_id="AAT02995.1"
FT   gene            206573..207946
FT                   /locus_tag="LMOf2365_0209"
FT   CDS_pept        206573..207946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0209"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="identified by similarity to SP:P14192; match to
FT                   protein family HMM PF00132; match to protein family HMM
FT                   PF00483; match to protein family HMM TIGR01173"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02996"
FT                   /db_xref="GOA:Q724L5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724L5"
FT                   /protein_id="AAT02996.1"
FT   gene            207997..208953
FT                   /gene="prs-1"
FT                   /locus_tag="LMOf2365_0210"
FT   CDS_pept        207997..208953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prs-1"
FT                   /locus_tag="LMOf2365_0210"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01251"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02997"
FT                   /db_xref="GOA:Q724L4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724L4"
FT                   /protein_id="AAT02997.1"
FT   gene            complement(208997..209710)
FT                   /gene="prfA"
FT                   /locus_tag="LMOf2365_0211"
FT   CDS_pept        complement(208997..209710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="LMOf2365_0211"
FT                   /product="listeriolysin regulatory protein"
FT                   /note="identified by similarity to SP:P22262"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02998"
FT                   /protein_id="AAT02998.1"
FT                   EWFYLACPATWGKLN"
FT   gene            complement(209983..210936)
FT                   /gene="plcA"
FT                   /locus_tag="LMOf2365_0212"
FT   CDS_pept        complement(209983..210936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plcA"
FT                   /locus_tag="LMOf2365_0212"
FT                   /product="1-phosphatidylinositol phosphodiesterase"
FT                   /note="identified by similarity to GP:887021; similarity to
FT                   SP:P34024; match to protein family HMM PF00388"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02999"
FT                   /protein_id="AAT02999.1"
FT   gene            211179..212768
FT                   /gene="hly"
FT                   /locus_tag="LMOf2365_0213"
FT   CDS_pept        211179..212768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hly"
FT                   /locus_tag="LMOf2365_0213"
FT                   /product="listeriolysin O"
FT                   /note="identified by similarity to SP:P13128; match to
FT                   protein family HMM PF01289"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03000"
FT                   /db_xref="GOA:Q724L1"
FT                   /db_xref="InterPro:IPR001869"
FT                   /db_xref="InterPro:IPR035390"
FT                   /db_xref="InterPro:IPR036359"
FT                   /db_xref="InterPro:IPR036363"
FT                   /db_xref="InterPro:IPR038700"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724L1"
FT                   /protein_id="AAT03000.1"
FT                   PKYSNSVDNPIE"
FT   gene            213099..214631
FT                   /gene="mpl"
FT                   /locus_tag="LMOf2365_0214"
FT   CDS_pept        213099..214631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpl"
FT                   /locus_tag="LMOf2365_0214"
FT                   /product="zinc metallopeptidase"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by similarity to SP:P34025; match to
FT                   protein family HMM PF01447; match to protein family HMM
FT                   PF02868; match to protein family HMM PF03413; match to
FT                   protein family HMM PF07504"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03001"
FT                   /protein_id="AAT03001.1"
FT   gene            214831..216645
FT                   /gene="actA"
FT                   /locus_tag="LMOf2365_0215"
FT   CDS_pept        214831..216645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="actA"
FT                   /locus_tag="LMOf2365_0215"
FT                   /product="actin-assembly inducing protein"
FT                   /note="identified by similarity to SP:P33379; match to
FT                   protein family HMM PF05058"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03002"
FT                   /protein_id="AAT03002.1"
FT   gene            216708..217550
FT                   /gene="plcB"
FT                   /locus_tag="LMOf2365_0216"
FT   CDS_pept        216708..217550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plcB"
FT                   /locus_tag="LMOf2365_0216"
FT                   /product="phospholipase C"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P09598; match to
FT                   protein family HMM PF00882"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03003"
FT                   /protein_id="AAT03003.1"
FT   gene            217622..217945
FT                   /locus_tag="LMOf2365_0217"
FT   CDS_pept        217622..217945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0217"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:18073184"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03004"
FT                   /protein_id="AAT03004.1"
FT                   NEE"
FT   gene            218078..218539
FT                   /locus_tag="LMOf2365_0218"
FT   CDS_pept        218078..218539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0218"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF06998"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03005"
FT                   /protein_id="AAT03005.1"
FT   gene            complement(218592..218924)
FT                   /locus_tag="LMOf2365_0219"
FT   CDS_pept        complement(218592..218924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0219"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:P33382; match to
FT                   protein family HMM PF01906"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03006"
FT                   /db_xref="GOA:Q724K5"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724K5"
FT                   /protein_id="AAT03006.1"
FT                   IEAQDY"
FT   gene            complement(218991..219674)
FT                   /locus_tag="LMOf2365_0220"
FT   CDS_pept        complement(218991..219674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0220"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:18073204; match to
FT                   protein family HMM PF06352"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03007"
FT                   /protein_id="AAT03007.1"
FT                   RNRTK"
FT   gene            complement(219743..220684)
FT                   /gene="ldh-1"
FT                   /locus_tag="LMOf2365_0221"
FT   CDS_pept        complement(219743..220684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ldh-1"
FT                   /locus_tag="LMOf2365_0221"
FT                   /product="L-lactate dehydrogenase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P33380; match to
FT                   protein family HMM PF00056; match to protein family HMM
FT                   PF02866; match to protein family HMM TIGR01771"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03008"
FT                   /db_xref="GOA:Q724K3"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724K3"
FT                   /protein_id="AAT03008.1"
FT   gene            220978..221601
FT                   /locus_tag="LMOf2365_0222"
FT   CDS_pept        220978..221601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0222"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="identified by match to protein family HMM PF01386;
FT                   match to protein family HMM TIGR00731"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03009"
FT                   /db_xref="GOA:Q724K2"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724K2"
FT                   /protein_id="AAT03009.1"
FT   gene            221691..222275
FT                   /locus_tag="LMOf2365_0223"
FT   CDS_pept        221691..222275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0223"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03010"
FT                   /protein_id="AAT03010.1"
FT   gene            222382..222942
FT                   /gene="pth"
FT                   /locus_tag="LMOf2365_0224"
FT   CDS_pept        222382..222942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="LMOf2365_0224"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01195;
FT                   match to protein family HMM TIGR00447"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03011"
FT                   /db_xref="GOA:Q724K0"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724K0"
FT                   /protein_id="AAT03011.1"
FT   gene            223056..226595
FT                   /gene="mfd"
FT                   /locus_tag="LMOf2365_0225"
FT   CDS_pept        223056..226595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="LMOf2365_0225"
FT                   /product="transcription-repair coupling factor"
FT                   /note="identified by similarity to SP:P37474; match to
FT                   protein family HMM PF00270; match to protein family HMM
FT                   PF00271; match to protein family HMM PF02559; match to
FT                   protein family HMM PF03461; match to protein family HMM
FT                   PF04851; match to protein family HMM TIGR00580"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03012"
FT                   /protein_id="AAT03012.1"
FT                   LRGAMKERASAEN"
FT   gene            226626..228215
FT                   /locus_tag="LMOf2365_0226"
FT   CDS_pept        226626..228215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0226"
FT                   /product="polysaccharide biosynthesis family protein"
FT                   /note="identified by match to protein family HMM PF01943"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03013"
FT                   /protein_id="AAT03013.1"
FT                   KLLALSKLVARK"
FT   gene            228239..228517
FT                   /locus_tag="LMOf2365_0227"
FT   CDS_pept        228239..228517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0227"
FT                   /product="S4 domain protein"
FT                   /note="identified by similarity to SP:P37557; match to
FT                   protein family HMM PF01479"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03014"
FT                   /protein_id="AAT03014.1"
FT   gene            228746..229132
FT                   /locus_tag="LMOf2365_0228"
FT   CDS_pept        228746..229132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0228"
FT                   /product="putative cell division protein DivIC"
FT                   /note="identified by similarity to SP:P37471; match to
FT                   protein family HMM PF04977"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03015"
FT                   /protein_id="AAT03015.1"
FT   gene            229283..229711
FT                   /locus_tag="LMOf2365_0229"
FT   CDS_pept        229283..229711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0229"
FT                   /product="RNA-binding protein"
FT                   /note="identified by match to protein family HMM PF00575"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03016"
FT                   /protein_id="AAT03016.1"
FT   gene            229818..231764
FT                   /locus_tag="LMOf2365_0230"
FT   CDS_pept        229818..231764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0230"
FT                   /product="conserved hypothetical protein/hypoxanthine
FT                   phosphoribosyltransferase, fusion"
FT                   /note="An unusual fusion between hypoxanthine
FT                   phosphoribosyltransferase (C-terminus) and a conserved
FT                   hypothetical protein (N-terminus).; identified by
FT                   similarity to GP:467456; match to protein family HMM
FT                   PF00156; match to protein family HMM PF01171; match to
FT                   protein family HMM TIGR01203; match to protein family HMM
FT                   TIGR02432; match to protein family HMM TIGR02433"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03017"
FT                   /db_xref="GOA:Q724J4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724J4"
FT                   /protein_id="AAT03017.1"
FT                   PYIGILKPEIYSE"
FT   gene            232111..234186
FT                   /gene="ftsH"
FT                   /locus_tag="LMOf2365_0231"
FT   CDS_pept        232111..234186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="LMOf2365_0231"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by similarity to SP:P37476; match to
FT                   protein family HMM PF00004; match to protein family HMM
FT                   PF01434; match to protein family HMM PF06480; match to
FT                   protein family HMM TIGR01241"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03018"
FT                   /protein_id="AAT03018.1"
FT   gene            234302..235081
FT                   /locus_tag="LMOf2365_0232"
FT   CDS_pept        234302..235081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0232"
FT                   /product="putative transcriptional activator, Baf family"
FT                   /note="identified by match to protein family HMM PF03309;
FT                   match to protein family HMM TIGR00671"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03019"
FT                   /db_xref="GOA:Q724J2"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724J2"
FT                   /protein_id="AAT03019.1"
FT   gene            235097..235981
FT                   /locus_tag="LMOf2365_0233"
FT   CDS_pept        235097..235981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0233"
FT                   /product="redox-regulated chaperone protein"
FT                   /note="identified by match to protein family HMM PF01430"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03020"
FT                   /db_xref="GOA:Q724J1"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724J1"
FT                   /protein_id="AAT03020.1"
FT                   SEEELEKLYEEAK"
FT   gene            236097..237023
FT                   /gene="cysK"
FT                   /locus_tag="LMOf2365_0234"
FT   CDS_pept        236097..237023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="LMOf2365_0234"
FT                   /product="cysteine synthase A"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P37887; match to
FT                   protein family HMM PF00291; match to protein family HMM
FT                   TIGR01136; match to protein family HMM TIGR01139"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03021"
FT                   /protein_id="AAT03021.1"
FT   gene            237468..237602
FT                   /locus_tag="LMOf2365_0235"
FT   CDS_pept        237468..237602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0235"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03022"
FT                   /protein_id="AAT03022.1"
FT   gene            237674..238741
FT                   /gene="folP"
FT                   /locus_tag="LMOf2365_0236"
FT   CDS_pept        237674..238741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="LMOf2365_0236"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00809;
FT                   match to protein family HMM TIGR01496"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03023"
FT                   /protein_id="AAT03023.1"
FT                   RMTDAITGKLDITKL"
FT   gene            238755..239129
FT                   /gene="folB"
FT                   /locus_tag="LMOf2365_0237"
FT   CDS_pept        238755..239129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="LMOf2365_0237"
FT                   /product="dihydroneopterin aldolase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF02152;
FT                   match to protein family HMM TIGR00525; match to protein
FT                   family HMM TIGR00526"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03024"
FT                   /protein_id="AAT03024.1"
FT   gene            239122..239601
FT                   /gene="folK"
FT                   /locus_tag="LMOf2365_0238"
FT   CDS_pept        239122..239601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="LMOf2365_0238"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01288;
FT                   match to protein family HMM TIGR01498"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03025"
FT                   /protein_id="AAT03025.1"
FT   gene            239677..240672
FT                   /locus_tag="LMOf2365_0239"
FT   CDS_pept        239677..240672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0239"
FT                   /product="dihydrouridine synthase family protein"
FT                   /note="identified by match to protein family HMM PF01207;
FT                   match to protein family HMM TIGR00737"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03026"
FT                   /protein_id="AAT03026.2"
FT   gene            240787..242283
FT                   /gene="lysS"
FT                   /locus_tag="LMOf2365_0240"
FT   CDS_pept        240787..242283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="LMOf2365_0240"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00152;
FT                   match to protein family HMM PF00587; match to protein
FT                   family HMM PF01336; match to protein family HMM TIGR00499"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03027"
FT                   /db_xref="GOA:Q724I4"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724I4"
FT                   /protein_id="AAT03027.1"
FT   gene            242736..244246
FT                   /gene="rrsA"
FT                   /locus_tag="LMOf2365_2849"
FT   rRNA            242736..244246
FT                   /gene="rrsA"
FT                   /locus_tag="LMOf2365_2849"
FT                   /product="16S ribosomal RNA"
FT   gene            244528..247459
FT                   /gene="rrlA"
FT                   /locus_tag="LMOf2365_2850"
FT   rRNA            244528..247459
FT                   /gene="rrlA"
FT                   /locus_tag="LMOf2365_2850"
FT                   /product="23S ribosomal RNA"
FT   gene            247537..247652
FT                   /gene="rrfA"
FT                   /locus_tag="LMOf2365_2851"
FT   rRNA            247537..247652
FT                   /gene="rrfA"
FT                   /locus_tag="LMOf2365_2851"
FT                   /product="5S ribosomal RNA"
FT   gene            247662..247734
FT                   /locus_tag="LMOf2365_2852"
FT   tRNA            247662..247734
FT                   /locus_tag="LMOf2365_2852"
FT                   /product="tRNA-Val"
FT   gene            247743..247818
FT                   /locus_tag="LMOf2365_2853"
FT   tRNA            247743..247818
FT                   /locus_tag="LMOf2365_2853"
FT                   /product="tRNA-Thr"
FT   gene            247859..247931
FT                   /locus_tag="LMOf2365_2854"
FT   tRNA            247859..247931
FT                   /locus_tag="LMOf2365_2854"
FT                   /product="tRNA-Lys"
FT   gene            247937..248018
FT                   /locus_tag="LMOf2365_2855"
FT   tRNA            247937..248018
FT                   /locus_tag="LMOf2365_2855"
FT                   /product="tRNA-Leu"
FT   gene            248033..248104
FT                   /locus_tag="LMOf2365_2856"
FT   tRNA            248033..248104
FT                   /locus_tag="LMOf2365_2856"
FT                   /product="tRNA-Gly"
FT   gene            248126..248211
FT                   /locus_tag="LMOf2365_2857"
FT   tRNA            248126..248211
FT                   /locus_tag="LMOf2365_2857"
FT                   /product="tRNA-Leu"
FT   gene            248224..248297
FT                   /locus_tag="LMOf2365_2858"
FT   tRNA            248224..248297
FT                   /locus_tag="LMOf2365_2858"
FT                   /product="tRNA-Arg"
FT   gene            248308..248381
FT                   /locus_tag="LMOf2365_2859"
FT   tRNA            248308..248381
FT                   /locus_tag="LMOf2365_2859"
FT                   /product="tRNA-Pro"
FT   gene            248400..248475
FT                   /locus_tag="LMOf2365_2860"
FT   tRNA            248400..248475
FT                   /locus_tag="LMOf2365_2860"
FT                   /product="tRNA-Ala"
FT   gene            248755..250265
FT                   /gene="rrsB"
FT                   /locus_tag="LMOf2365_2861"
FT   rRNA            248755..250265
FT                   /gene="rrsB"
FT                   /locus_tag="LMOf2365_2861"
FT                   /product="16S ribosomal RNA"
FT   gene            250547..253478
FT                   /gene="rrlB"
FT                   /locus_tag="LMOf2365_2862"
FT   rRNA            250547..253478
FT                   /gene="rrlB"
FT                   /locus_tag="LMOf2365_2862"
FT                   /product="23S ribosomal RNA"
FT   gene            253556..253671
FT                   /gene="rrfB"
FT                   /locus_tag="LMOf2365_2863"
FT   rRNA            253556..253671
FT                   /gene="rrfB"
FT                   /locus_tag="LMOf2365_2863"
FT                   /product="5S ribosomal RNA"
FT   gene            253816..254274
FT                   /gene="ctsR"
FT                   /locus_tag="LMOf2365_0241"
FT   CDS_pept        253816..254274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctsR"
FT                   /locus_tag="LMOf2365_0241"
FT                   /product="transcriptional regulator CtsR"
FT                   /note="identified by similarity to SP:P37568; match to
FT                   protein family HMM PF05848"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03028"
FT                   /protein_id="AAT03028.1"
FT   gene            254287..254805
FT                   /locus_tag="LMOf2365_0242"
FT   CDS_pept        254287..254805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0242"
FT                   /product="UVR domain protein"
FT                   /note="identified by match to protein family HMM PF02151"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03029"
FT                   /protein_id="AAT03029.1"
FT                   ALKAGGEDK"
FT   gene            254802..255824
FT                   /locus_tag="LMOf2365_0243"
FT   CDS_pept        254802..255824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0243"
FT                   /product="ATP:guanido phosphotransferase family protein"
FT                   /note="identified by similarity to SP:P37570; match to
FT                   protein family HMM PF00217"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03030"
FT                   /db_xref="GOA:Q724I1"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724I1"
FT                   /protein_id="AAT03030.1"
FT                   "
FT   gene            255853..258315
FT                   /locus_tag="LMOf2365_0244"
FT   CDS_pept        255853..258315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0244"
FT                   /product="ClpC ATPase"
FT                   /note="identified by similarity to GP:1314297; match to
FT                   protein family HMM PF00004; match to protein family HMM
FT                   PF02151; match to protein family HMM PF02861; match to
FT                   protein family HMM PF07724"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03031"
FT                   /protein_id="AAT03031.1"
FT                   TAKKVKTK"
FT   gene            258462..259835
FT                   /gene="radA"
FT                   /locus_tag="LMOf2365_0245"
FT   CDS_pept        258462..259835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="LMOf2365_0245"
FT                   /product="DNA repair protein RadA"
FT                   /note="identified by similarity to SP:P37572; match to
FT                   protein family HMM TIGR00416"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03032"
FT                   /protein_id="AAT03032.1"
FT   gene            259968..261041
FT                   /locus_tag="LMOf2365_0246"
FT   CDS_pept        259968..261041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0246"
FT                   /product="PIN/TRAM domain protein"
FT                   /note="identified by match to protein family HMM PF01850;
FT                   match to protein family HMM PF01938"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03033"
FT                   /protein_id="AAT03033.1"
FT                   TSVLQTSAGRMIFAKPS"
FT   gene            261061..261759
FT                   /gene="ispD"
FT                   /locus_tag="LMOf2365_0247"
FT   CDS_pept        261061..261759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="LMOf2365_0247"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   synthase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01128;
FT                   match to protein family HMM TIGR00453"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03034"
FT                   /db_xref="GOA:Q724H7"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724H7"
FT                   /protein_id="AAT03034.1"
FT                   LGELGGIAND"
FT   gene            261752..262225
FT                   /gene="ispF"
FT                   /locus_tag="LMOf2365_0248"
FT   CDS_pept        261752..262225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispF"
FT                   /locus_tag="LMOf2365_0248"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF02542;
FT                   match to protein family HMM TIGR00151"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03035"
FT                   /db_xref="GOA:Q724H6"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724H6"
FT                   /protein_id="AAT03035.1"
FT   gene            262244..263719
FT                   /gene="gltX"
FT                   /locus_tag="LMOf2365_0249"
FT   CDS_pept        262244..263719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="LMOf2365_0249"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00749;
FT                   match to protein family HMM TIGR00464"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03036"
FT                   /db_xref="GOA:Q724H5"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724H5"
FT                   /protein_id="AAT03036.1"
FT   gene            264118..264732
FT                   /gene="cysE"
FT                   /locus_tag="LMOf2365_0250"
FT   CDS_pept        264118..264732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="LMOf2365_0250"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:Q06750; match to
FT                   protein family HMM PF00132; match to protein family HMM
FT                   TIGR01172"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03037"
FT                   /protein_id="AAT03037.1"
FT   gene            264739..266154
FT                   /gene="cysS"
FT                   /locus_tag="LMOf2365_0251"
FT   CDS_pept        264739..266154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="LMOf2365_0251"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01406;
FT                   match to protein family HMM TIGR00435"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03038"
FT                   /db_xref="GOA:Q724H3"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724H3"
FT                   /protein_id="AAT03038.1"
FT                   LEDTAQGTRFRRG"
FT   gene            266158..266583
FT                   /locus_tag="LMOf2365_0252"
FT   CDS_pept        266158..266583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0252"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01BS00095; match
FT                   to protein family HMM PF05948"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03039"
FT                   /protein_id="AAT03039.1"
FT   gene            266567..267322
FT                   /locus_tag="LMOf2365_0253"
FT   CDS_pept        266567..267322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0253"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="identified by match to protein family HMM PF00588;
FT                   match to protein family HMM PF08032; match to protein
FT                   family HMM TIGR00186"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03040"
FT                   /protein_id="AAT03040.1"
FT   gene            267325..267837
FT                   /locus_tag="LMOf2365_0254"
FT   CDS_pept        267325..267837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0254"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05991"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03041"
FT                   /protein_id="AAT03041.1"
FT                   KWRRGEE"
FT   gene            267918..268523
FT                   /gene="sigH"
FT                   /locus_tag="LMOf2365_0255"
FT   CDS_pept        267918..268523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigH"
FT                   /locus_tag="LMOf2365_0255"
FT                   /product="RNA polymerase sigma-30 factor"
FT                   /note="identified by similarity to SP:P17869; match to
FT                   protein family HMM PF04542"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03042"
FT                   /protein_id="AAT03042.1"
FT   gene            268627..268776
FT                   /gene="rpmG-1"
FT                   /locus_tag="LMOf2365_0256"
FT   CDS_pept        268627..268776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG-1"
FT                   /locus_tag="LMOf2365_0256"
FT                   /product="ribosomal protein L33"
FT                   /note="identified by match to protein family HMM PF00471;
FT                   match to protein family HMM TIGR01023"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03043"
FT                   /db_xref="GOA:Q724G8"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724G8"
FT                   /protein_id="AAT03043.1"
FT                   RETK"
FT   gene            268796..268975
FT                   /gene="secE"
FT                   /locus_tag="LMOf2365_0257"
FT   CDS_pept        268796..268975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="LMOf2365_0257"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="identified by similarity to SP:Q06799; match to
FT                   protein family HMM PF00584; match to protein family HMM
FT                   TIGR00964"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03044"
FT                   /protein_id="AAT03044.1"
FT                   LIDFGIEQIIKLIV"
FT   gene            269105..269638
FT                   /gene="nusG"
FT                   /locus_tag="LMOf2365_0258"
FT   CDS_pept        269105..269638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="LMOf2365_0258"
FT                   /product="transcription antitermination factor NusG"
FT                   /note="identified by similarity to SP:Q06795; match to
FT                   protein family HMM PF00467; match to protein family HMM
FT                   PF02357; match to protein family HMM TIGR00922"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03045"
FT                   /protein_id="AAT03045.1"
FT                   ETPVEVDFNQIEKL"
FT   gene            269693..270163
FT                   /locus_tag="LMOf2365_0259"
FT   CDS_pept        269693..270163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0259"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0277"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03046"
FT                   /protein_id="AAT03046.1"
FT   gene            270290..270715
FT                   /gene="rplK"
FT                   /locus_tag="LMOf2365_0260"
FT   CDS_pept        270290..270715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="LMOf2365_0260"
FT                   /product="ribosomal protein L11"
FT                   /note="identified by match to protein family HMM PF00298;
FT                   match to protein family HMM PF03946; match to protein
FT                   family HMM TIGR01632"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03047"
FT                   /db_xref="GOA:Q724G4"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724G4"
FT                   /protein_id="AAT03047.1"
FT   gene            270755..271444
FT                   /gene="rplA"
FT                   /locus_tag="LMOf2365_0261"
FT   CDS_pept        270755..271444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="LMOf2365_0261"
FT                   /product="ribosomal protein L1"
FT                   /note="identified by match to protein family HMM PF00687;
FT                   match to protein family HMM TIGR01169"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03048"
FT                   /db_xref="GOA:Q724G3"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724G3"
FT                   /protein_id="AAT03048.1"
FT                   KVDPASL"
FT   gene            271692..272192
FT                   /gene="rplJ"
FT                   /locus_tag="LMOf2365_0262"
FT   CDS_pept        271692..272192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="LMOf2365_0262"
FT                   /product="ribosomal protein L10"
FT                   /note="identified by match to protein family HMM PF00466"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03049"
FT                   /db_xref="GOA:Q724G2"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724G2"
FT                   /protein_id="AAT03049.1"
FT                   QEA"
FT   gene            272271..272633
FT                   /gene="rplL"
FT                   /locus_tag="LMOf2365_0263"
FT   CDS_pept        272271..272633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="LMOf2365_0263"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="identified by match to protein family HMM PF00542;
FT                   match to protein family HMM TIGR00855"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03050"
FT                   /db_xref="GOA:Q724G1"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724G1"
FT                   /protein_id="AAT03050.1"
FT                   EIKAKLEEVGANVEVK"
FT   gene            272767..273381
FT                   /locus_tag="LMOf2365_0264"
FT   CDS_pept        272767..273381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0264"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:16412713; match to
FT                   protein family HMM PF05175"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03051"
FT                   /protein_id="AAT03051.1"
FT   gene            273728..274906
FT                   /locus_tag="LMOf2365_0265"
FT   CDS_pept        273728..274906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0265"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:4678913; match to
FT                   protein family HMM PF01139"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03052"
FT                   /protein_id="AAT03052.1"
FT   gene            275051..276046
FT                   /locus_tag="LMOf2365_0266"
FT   CDS_pept        275051..276046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0266"
FT                   /product="transcriptional regulator, DegA family"
FT                   /note="identified by similarity to SP:P37947; match to
FT                   protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03053"
FT                   /protein_id="AAT03053.1"
FT   gene            276184..277410
FT                   /locus_tag="LMOf2365_0267"
FT   CDS_pept        276184..277410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0267"
FT                   /product="sugar ABC transporter, sugar-binding protein"
FT                   /note="identified by similarity to SP:P29850; match to
FT                   protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03054"
FT                   /protein_id="AAT03054.1"
FT                   LVKDITPAK"
FT   gene            277428..278765
FT                   /locus_tag="LMOf2365_0268"
FT   CDS_pept        277428..278765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0268"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /note="identified by similarity to SP:Q04698; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03055"
FT                   /protein_id="AAT03055.1"
FT   gene            278767..279597
FT                   /locus_tag="LMOf2365_0269"
FT   CDS_pept        278767..279597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0269"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /note="identified by similarity to SP:Q04699; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03056"
FT                   /protein_id="AAT03056.1"
FT   gene            279612..281309
FT                   /gene="malL-2"
FT                   /locus_tag="LMOf2365_0270"
FT   CDS_pept        279612..281309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malL-2"
FT                   /locus_tag="LMOf2365_0270"
FT                   /product="oligo-1,6-glucosidase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P21332; match to
FT                   protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03057"
FT                   /protein_id="AAT03057.1"
FT   gene            281310..282752
FT                   /gene="gtfA"
FT                   /locus_tag="LMOf2365_0271"
FT   CDS_pept        281310..282752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gtfA"
FT                   /locus_tag="LMOf2365_0271"
FT                   /product="sucrose phosphorylase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P10249; match to
FT                   protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03058"
FT                   /protein_id="AAT03058.1"
FT   gene            282818..283063
FT                   /locus_tag="LMOf2365_0272"
FT   CDS_pept        282818..283063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0272"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03059"
FT                   /protein_id="AAT03059.1"
FT   gene            283072..283176
FT                   /locus_tag="LMOf2365_0273"
FT   CDS_pept        283072..283176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0273"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03060"
FT                   /protein_id="AAT03060.1"
FT   gene            283309..286863
FT                   /gene="rpoB"
FT                   /locus_tag="LMOf2365_0274"
FT   CDS_pept        283309..286863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="LMOf2365_0274"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P37870; match to
FT                   protein family HMM PF00562; match to protein family HMM
FT                   PF04560; match to protein family HMM PF04561; match to
FT                   protein family HMM PF04563; match to protein family HMM
FT                   PF04565; match to protein family HMM TIGR02013"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03061"
FT                   /db_xref="GOA:Q724F0"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724F0"
FT                   /protein_id="AAT03061.1"
FT                   NDAFNIVQPENAAAEKTE"
FT   gene            287034..290639
FT                   /gene="rpoC"
FT                   /locus_tag="LMOf2365_0275"
FT   CDS_pept        287034..290639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="LMOf2365_0275"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P37871; match to
FT                   protein family HMM PF00623; match to protein family HMM
FT                   PF04983; match to protein family HMM PF04997; match to
FT                   protein family HMM PF04998; match to protein family HMM
FT                   PF05000; match to protein family HMM TIGR02386"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03062"
FT                   /db_xref="GOA:Q724E9"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724E9"
FT                   /protein_id="AAT03062.1"
FT   gene            290739..291260
FT                   /locus_tag="LMOf2365_0276"
FT   CDS_pept        290739..291260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0276"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03063"
FT                   /protein_id="AAT03063.1"
FT                   ALLLLKKISA"
FT   gene            291326..292786
FT                   /locus_tag="LMOf2365_0277"
FT   CDS_pept        291326..292786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0277"
FT                   /product="glycosyl hydrolase, family 1"
FT                   /note="identified by match to protein family HMM PF00232"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03064"
FT                   /protein_id="AAT03064.1"
FT   gene            293001..293444
FT                   /locus_tag="LMOf2365_0278"
FT   CDS_pept        293001..293444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0278"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03065"
FT                   /protein_id="AAT03065.1"
FT   gene            293496..295157
FT                   /locus_tag="LMOf2365_0279"
FT   CDS_pept        293496..295157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0279"
FT                   /product="putative ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to SP:P15361; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03066"
FT                   /protein_id="AAT03066.1"
FT   gene            295154..296929
FT                   /locus_tag="LMOf2365_0280"
FT   CDS_pept        295154..296929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0280"
FT                   /product="putative ABC transporter, ATP-binding/permease
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03067"
FT                   /protein_id="AAT03067.1"
FT                   LLMSYRDKKNDFRNL"
FT   gene            297720..299366
FT                   /gene="inlC2"
FT                   /locus_tag="LMOf2365_0281"
FT   CDS_pept        297720..299366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="inlC2"
FT                   /locus_tag="LMOf2365_0281"
FT                   /product="internalin C2"
FT                   /note="identified by similarity to GP:2347104; match to
FT                   protein family HMM PF00560; match to protein family HMM
FT                   PF08191; match to protein family HMM TIGR02543"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03068"
FT                   /protein_id="AAT03068.1"
FT   gene            299575..301281
FT                   /gene="inlD"
FT                   /locus_tag="LMOf2365_0282"
FT   CDS_pept        299575..301281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="inlD"
FT                   /locus_tag="LMOf2365_0282"
FT                   /product="internalin D"
FT                   /note="identified by similarity to GP:2347105; match to
FT                   protein family HMM PF00560; match to protein family HMM
FT                   PF08191; match to protein family HMM TIGR02543"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03069"
FT                   /protein_id="AAT03069.1"
FT   gene            301493..302992
FT                   /gene="inlE"
FT                   /locus_tag="LMOf2365_0283"
FT   CDS_pept        301493..302992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="inlE"
FT                   /locus_tag="LMOf2365_0283"
FT                   /product="internalin E"
FT                   /note="identified by similarity to GP:2347106; match to
FT                   protein family HMM PF00560; match to protein family HMM
FT                   PF08191; match to protein family HMM TIGR01167; match to
FT                   protein family HMM TIGR02543"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03070"
FT                   /protein_id="AAT03070.1"
FT   gene            303078..304265
FT                   /locus_tag="LMOf2365_0284"
FT   CDS_pept        303078..304265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0284"
FT                   /product="peptidase, M20/M25/M40 family"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687; match to protein
FT                   family HMM TIGR01910"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03071"
FT                   /protein_id="AAT03071.1"
FT   gene            304412..304828
FT                   /locus_tag="LMOf2365_0285"
FT   CDS_pept        304412..304828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0285"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03072"
FT                   /protein_id="AAT03072.1"
FT   gene            304835..305794
FT                   /locus_tag="LMOf2365_0286"
FT   CDS_pept        304835..305794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0286"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03073"
FT                   /protein_id="AAT03073.1"
FT   gene            305866..306501
FT                   /locus_tag="LMOf2365_0287"
FT   CDS_pept        305866..306501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0287"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03074"
FT                   /protein_id="AAT03074.1"
FT   gene            306585..308471
FT                   /locus_tag="LMOf2365_0288"
FT   CDS_pept        306585..308471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0288"
FT                   /product="putative transporter"
FT                   /note="identified by similarity to SP:P37315; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03075"
FT                   /protein_id="AAT03075.1"
FT   gene            complement(308500..309585)
FT                   /locus_tag="LMOf2365_0289"
FT   CDS_pept        complement(308500..309585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0289"
FT                   /product="leucine rich repeat domain protein"
FT                   /note="identified by match to protein family HMM PF00560"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03076"
FT                   /protein_id="AAT03076.1"
FT   gene            complement(309719..310345)
FT                   /locus_tag="LMOf2365_0290"
FT   CDS_pept        complement(309719..310345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0290"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0294"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03077"
FT                   /protein_id="AAT03077.1"
FT   gene            complement(310346..311782)
FT                   /locus_tag="LMOf2365_0291"
FT   CDS_pept        complement(310346..311782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0291"
FT                   /product="glycosyl hydrolase, family 1"
FT                   /note="identified by match to protein family HMM PF00232"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03078"
FT                   /protein_id="AAT03078.1"
FT   gene            complement(311902..312714)
FT                   /locus_tag="LMOf2365_0292"
FT   CDS_pept        complement(311902..312714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0292"
FT                   /product="hydrolase, haloacid dehalogenase-like family"
FT                   /note="identified by similarity to OMNI:NTL01LI0194; match
FT                   to protein family HMM PF00702; match to protein family HMM
FT                   TIGR00099; match to protein family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03079"
FT                   /protein_id="AAT03079.1"
FT   gene            312850..313353
FT                   /locus_tag="LMOf2365_0293"
FT   CDS_pept        312850..313353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0293"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03080"
FT                   /protein_id="AAT03080.1"
FT                   LAIK"
FT   gene            complement(313390..314052)
FT                   /locus_tag="LMOf2365_0294"
FT   CDS_pept        complement(313390..314052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0294"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0298"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03081"
FT                   /protein_id="AAT03081.1"
FT   gene            complement(314310..315152)
FT                   /locus_tag="LMOf2365_0295"
FT   CDS_pept        complement(314310..315152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0295"
FT                   /product="competence protein ComEC/Rec2-related protein"
FT                   /note="identified by similarity to SP:P39695; match to
FT                   protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03082"
FT                   /protein_id="AAT03082.1"
FT   gene            complement(315169..315990)
FT                   /locus_tag="LMOf2365_0296"
FT   CDS_pept        complement(315169..315990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0296"
FT                   /product="hydrolase, haloacid dehalogenase-like family"
FT                   /note="identified by similarity to GP:16412731; match to
FT                   protein family HMM TIGR00099; match to protein family HMM
FT                   TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03083"
FT                   /protein_id="AAT03083.1"
FT   gene            316106..317077
FT                   /locus_tag="LMOf2365_0297"
FT   CDS_pept        316106..317077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0297"
FT                   /product="oxidoreductase, Gfo/Idh/MocA family"
FT                   /note="identified by match to protein family HMM PF01408;
FT                   match to protein family HMM PF02894"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03084"
FT                   /protein_id="AAT03084.1"
FT   gene            complement(317115..318215)
FT                   /locus_tag="LMOf2365_0298"
FT   CDS_pept        complement(317115..318215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0298"
FT                   /product="sugar ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to SP:Q00752; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03085"
FT                   /protein_id="AAT03085.1"
FT   gene            318506..320656
FT                   /gene="nrdD"
FT                   /locus_tag="LMOf2365_0299"
FT   CDS_pept        318506..320656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdD"
FT                   /locus_tag="LMOf2365_0299"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number=""
FT                   /note="identified by similarity to GP:4098081; match to
FT                   protein family HMM PF01228; match to protein family HMM
FT                   PF03477; match to protein family HMM TIGR02487"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03086"
FT                   /protein_id="AAT03086.1"
FT   gene            320649..321200
FT                   /gene="nrdG"
FT                   /locus_tag="LMOf2365_0300"
FT   CDS_pept        320649..321200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdG"
FT                   /locus_tag="LMOf2365_0300"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /EC_number=""
FT                   /note="identified by similarity to GP:4098082; match to
FT                   protein family HMM TIGR02491"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03087"
FT                   /protein_id="AAT03087.1"
FT   gene            complement(321344..322015)
FT                   /locus_tag="LMOf2365_0301"
FT   CDS_pept        complement(321344..322015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0301"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0307; match
FT                   to protein family HMM PF00027"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03088"
FT                   /protein_id="AAT03088.1"
FT                   D"
FT   gene            complement(322180..322959)
FT                   /locus_tag="LMOf2365_0302"
FT   CDS_pept        complement(322180..322959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0302"
FT                   /product="hydrolase, carbon-nitrogen family"
FT                   /note="identified by match to protein family HMM PF00795"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03089"
FT                   /protein_id="AAT03089.1"
FT   gene            complement(323049..323711)
FT                   /gene="metI"
FT                   /locus_tag="LMOf2365_0303"
FT   CDS_pept        complement(323049..323711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metI"
FT                   /locus_tag="LMOf2365_0303"
FT                   /product="D-methionine ABC transporter, permease protein"
FT                   /note="identified by similarity to SP:P31547; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03090"
FT                   /protein_id="AAT03090.1"
FT   gene            complement(323708..324724)
FT                   /gene="metN"
FT                   /locus_tag="LMOf2365_0304"
FT   CDS_pept        complement(323708..324724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metN"
FT                   /locus_tag="LMOf2365_0304"
FT                   /product="D-methionine ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by similarity to SP:Q8X7Z9; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03091"
FT                   /db_xref="GOA:Q724C0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724C0"
FT                   /protein_id="AAT03091.1"
FT   gene            complement(324739..325560)
FT                   /gene="metQ"
FT                   /locus_tag="LMOf2365_0305"
FT   CDS_pept        complement(324739..325560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metQ"
FT                   /locus_tag="LMOf2365_0305"
FT                   /product="D-methionine ABC transporter,
FT                   D-methionine-binding protein"
FT                   /note="identified by similarity to SP:P28635; match to
FT                   protein family HMM PF03180; match to protein family HMM
FT                   TIGR00363"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03092"
FT                   /protein_id="AAT03092.1"
FT   gene            325941..327122
FT                   /locus_tag="LMOf2365_0306"
FT   CDS_pept        325941..327122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0306"
FT                   /product="aminotransferase, class I"
FT                   /note="identified by match to protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03093"
FT                   /protein_id="AAT03093.1"
FT   gene            327335..328048
FT                   /locus_tag="LMOf2365_0307"
FT   CDS_pept        327335..328048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0307"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by similarity to SP:P13792; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03094"
FT                   /protein_id="AAT03094.1"
FT                   TRRGVGYYLRNPEQE"
FT   gene            328233..330065
FT                   /locus_tag="LMOf2365_0308"
FT   CDS_pept        328233..330065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0308"
FT                   /product="sensory box histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF00989; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03095"
FT                   /protein_id="AAT03095.1"
FT   gene            330062..331384
FT                   /locus_tag="LMOf2365_0309"
FT   CDS_pept        330062..331384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0309"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01SA0021; match
FT                   to protein family HMM PF07435"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03096"
FT                   /protein_id="AAT03096.1"
FT   gene            331387..332226
FT                   /locus_tag="LMOf2365_0310"
FT   CDS_pept        331387..332226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0310"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01BH4030; match
FT                   to protein family HMM PF03413"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03097"
FT                   /protein_id="AAT03097.1"
FT   gene            332347..333177
FT                   /locus_tag="LMOf2365_0311"
FT   CDS_pept        332347..333177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0311"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03098"
FT                   /protein_id="AAT03098.1"
FT   gene            333275..334777
FT                   /locus_tag="LMOf2365_0312"
FT   CDS_pept        333275..334777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0312"
FT                   /product="serine protease"
FT                   /EC_number="3.4.21.-"
FT                   /note="identified by similarity to SP:Q9LA06; match to
FT                   protein family HMM PF00089; match to protein family HMM
FT                   PF00595"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03099"
FT                   /protein_id="AAT03099.1"
FT   gene            335107..335202
FT                   /locus_tag="LMOf2365_0313"
FT   CDS_pept        335107..335202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0313"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03100"
FT                   /protein_id="AAT03100.1"
FT                   /translation="MTRKITLHRDLIREIDCRRRGSTVWWSLSFE"
FT   gene            335465..335944
FT                   /locus_tag="LMOf2365_0314"
FT   CDS_pept        335465..335944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0314"
FT                   /product="conserved hypothetical protein TIGR00246"
FT                   /note="identified by similarity to OMNI:NTL01LI0319; match
FT                   to protein family HMM PF02590; match to protein family HMM
FT                   TIGR00246"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03101"
FT                   /db_xref="GOA:Q724B0"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724B0"
FT                   /protein_id="AAT03101.1"
FT   gene            complement(335976..336839)
FT                   /locus_tag="LMOf2365_0315"
FT   CDS_pept        complement(335976..336839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0315"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03102"
FT                   /protein_id="AAT03102.1"
FT                   KPAFKS"
FT   gene            336958..337695
FT                   /locus_tag="LMOf2365_0316"
FT   CDS_pept        336958..337695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0316"
FT                   /product="nitroreductase family protein"
FT                   /note="identified by match to protein family HMM PF00881"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03103"
FT                   /protein_id="AAT03103.1"
FT   gene            337906..338544
FT                   /locus_tag="LMOf2365_0317"
FT   CDS_pept        337906..338544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0317"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0322"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03104"
FT                   /protein_id="AAT03104.1"
FT   gene            complement(338549..340420)
FT                   /locus_tag="LMOf2365_0318"
FT   CDS_pept        complement(338549..340420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0318"
FT                   /product="PRD/PTS system IIA 2 domain protein"
FT                   /note="identified by match to protein family HMM PF00359;
FT                   match to protein family HMM PF00874"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03105"
FT                   /protein_id="AAT03105.1"
FT   gene            complement(340519..341832)
FT                   /locus_tag="LMOf2365_0319"
FT   CDS_pept        complement(340519..341832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0319"
FT                   /product="PTS system, IIC component"
FT                   /note="identified by match to protein family HMM PF02378;
FT                   match to protein family HMM TIGR00410"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03106"
FT                   /protein_id="AAT03106.1"
FT   gene            complement(341837..342127)
FT                   /locus_tag="LMOf2365_0320"
FT   CDS_pept        complement(341837..342127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0320"
FT                   /product="PTS system, cellobiose-specific, IIB component"
FT                   /note="identified by match to protein family HMM PF02302"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03107"
FT                   /protein_id="AAT03107.1"
FT   gene            complement(342144..343535)
FT                   /locus_tag="LMOf2365_0321"
FT   CDS_pept        complement(342144..343535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0321"
FT                   /product="glycosyl hydrolase, family 1"
FT                   /note="identified by match to protein family HMM PF00232"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03108"
FT                   /protein_id="AAT03108.1"
FT                   KRREF"
FT   gene            complement(343528..343869)
FT                   /locus_tag="LMOf2365_0322"
FT   CDS_pept        complement(343528..343869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0322"
FT                   /product="PTS system, beta-glucoside-specific, IIA
FT                   component"
FT                   /note="identified by similarity to SP:P17335; match to
FT                   protein family HMM PF02255"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03109"
FT                   /protein_id="AAT03109.1"
FT                   QWKWSLSNE"
FT   gene            343921..344007
FT                   /locus_tag="LMOf2365_0323"
FT   CDS_pept        343921..344007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0323"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03110"
FT                   /protein_id="AAT03110.1"
FT                   /translation="MKLLFATLEVEIGLGELNRFLLHKSKQN"
FT   gene            344026..344476
FT                   /pseudo
FT                   /locus_tag="LMOf2365_0324"
FT                   /note="putative lipoprotein, authentic frameshift; this
FT                   gene contains a premature stop which is not the result of
FT                   sequencing error; identified by similarity to
FT                   OMNI:NTL01LI0322"
FT   gene            complement(344509..346176)
FT                   /locus_tag="LMOf2365_0325"
FT   CDS_pept        complement(344509..346176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0325"
FT                   /product="putative type II restriction enzyme Sau3AI"
FT                   /note="identified by similarity to SP:P16667; match to
FT                   protein family HMM PF02976"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03111"
FT                   /protein_id="AAT03111.1"
FT   gene            346304..346510
FT                   /locus_tag="LMOf2365_0326"
FT   CDS_pept        346304..346510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0326"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03112"
FT                   /protein_id="AAT03112.1"
FT   gene            346513..347922
FT                   /locus_tag="LMOf2365_0327"
FT   CDS_pept        346513..347922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0327"
FT                   /product="C-5 cytosine-specific DNA methylase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00145;
FT                   match to protein family HMM TIGR00675"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03113"
FT                   /protein_id="AAT03113.1"
FT                   GIELAKIESHE"
FT   gene            348172..349026
FT                   /locus_tag="LMOf2365_0328"
FT   CDS_pept        348172..349026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0328"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03114"
FT                   /protein_id="AAT03114.1"
FT                   GIF"
FT   gene            349247..349801
FT                   /locus_tag="LMOf2365_0329"
FT   CDS_pept        349247..349801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0329"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03115"
FT                   /protein_id="AAT03115.1"
FT   gene            349992..351071
FT                   /locus_tag="LMOf2365_0330"
FT   CDS_pept        349992..351071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0330"
FT                   /product="threonine aldolase family protein"
FT                   /note="identified by similarity to SP:P75823"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03116"
FT                   /protein_id="AAT03116.1"
FT   gene            351321..352241
FT                   /locus_tag="LMOf2365_0331"
FT   CDS_pept        351321..352241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0331"
FT                   /product="peptidase, M48 family"
FT                   /note="identified by match to protein family HMM PF01435"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03117"
FT                   /protein_id="AAT03117.1"
FT   gene            352266..353051
FT                   /locus_tag="LMOf2365_0332"
FT   CDS_pept        352266..353051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0332"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0337; match
FT                   to protein family HMM PF04794"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03118"
FT                   /protein_id="AAT03118.1"
FT   gene            353274..353948
FT                   /locus_tag="LMOf2365_0333"
FT   CDS_pept        353274..353948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0333"
FT                   /product="TENA/THI-4 family protein"
FT                   /note="identified by match to protein family HMM PF03070"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03119"
FT                   /protein_id="AAT03119.1"
FT                   YV"
FT   gene            353953..354750
FT                   /gene="thiM"
FT                   /locus_tag="LMOf2365_0334"
FT   CDS_pept        353953..354750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiM"
FT                   /locus_tag="LMOf2365_0334"
FT                   /product="hydroxyethylthiazole kinase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF02110;
FT                   match to protein family HMM TIGR00694"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03120"
FT                   /db_xref="GOA:Q723Z1"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723Z1"
FT                   /protein_id="AAT03120.1"
FT   gene            354747..355550
FT                   /gene="thiD-1"
FT                   /locus_tag="LMOf2365_0335"
FT   CDS_pept        354747..355550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD-1"
FT                   /locus_tag="LMOf2365_0335"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM TIGR00097"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03121"
FT                   /protein_id="AAT03121.1"
FT   gene            355547..356191
FT                   /gene="thiE"
FT                   /locus_tag="LMOf2365_0336"
FT   CDS_pept        355547..356191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="LMOf2365_0336"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF02581;
FT                   match to protein family HMM TIGR00693"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03122"
FT                   /db_xref="GOA:Q723Y9"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723Y9"
FT                   /protein_id="AAT03122.1"
FT   gene            complement(356218..357633)
FT                   /gene="bglH-1"
FT                   /locus_tag="LMOf2365_0337"
FT   CDS_pept        complement(356218..357633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglH-1"
FT                   /locus_tag="LMOf2365_0337"
FT                   /product="beta-glucosidase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P40740; match to
FT                   protein family HMM PF00232"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03123"
FT                   /protein_id="AAT03123.1"
FT                   WYKNVIATNGEDL"
FT   gene            complement(357848..359116)
FT                   /locus_tag="LMOf2365_0338"
FT   CDS_pept        complement(357848..359116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0338"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03124"
FT                   /protein_id="AAT03124.1"
FT   gene            359444..360103
FT                   /locus_tag="LMOf2365_0339"
FT   CDS_pept        359444..360103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0339"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to GP:16412775"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03125"
FT                   /protein_id="AAT03125.1"
FT   gene            360401..360793
FT                   /locus_tag="LMOf2365_0340"
FT   CDS_pept        360401..360793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0340"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0345; match
FT                   to protein family HMM PF08000"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03126"
FT                   /protein_id="AAT03126.1"
FT   gene            complement(360828..361601)
FT                   /locus_tag="LMOf2365_0341"
FT   CDS_pept        complement(360828..361601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0341"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03372"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03127"
FT                   /protein_id="AAT03127.1"
FT   gene            361756..362223
FT                   /locus_tag="LMOf2365_0342"
FT   CDS_pept        361756..362223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0342"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03128"
FT                   /protein_id="AAT03128.1"
FT   gene            362491..363393
FT                   /locus_tag="LMOf2365_0343"
FT   CDS_pept        362491..363393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0343"
FT                   /product="putative transcriptional activator"
FT                   /note="identified by match to protein family HMM PF01381;
FT                   match to protein family HMM TIGR01716"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03129"
FT                   /protein_id="AAT03129.1"
FT   gene            363557..364429
FT                   /locus_tag="LMOf2365_0344"
FT   CDS_pept        363557..364429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0344"
FT                   /product="putative transcriptional activator"
FT                   /note="identified by match to protein family HMM PF01381;
FT                   match to protein family HMM TIGR01716"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03130"
FT                   /protein_id="AAT03130.1"
FT                   ENNDIKTME"
FT   gene            364736..368677
FT                   /locus_tag="LMOf2365_0345"
FT   CDS_pept        364736..368677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0345"
FT                   /product="leucine rich repeat domain/ LPXTG-motif cell wall
FT                   anchor domain protein"
FT                   /note="identified by similarity to OMNI:NTL01LM2386; match
FT                   to protein family HMM PF00746; match to protein family HMM
FT                   PF06458; match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03131"
FT                   /protein_id="AAT03131.1"
FT   gene            368767..369495
FT                   /locus_tag="LMOf2365_0346"
FT   CDS_pept        368767..369495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0346"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:16412782"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03132"
FT                   /protein_id="AAT03132.1"
FT   gene            complement(369650..371506)
FT                   /locus_tag="LMOf2365_0347"
FT   CDS_pept        complement(369650..371506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0347"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03133"
FT                   /protein_id="AAT03133.1"
FT   gene            372017..372169
FT                   /locus_tag="LMOf2365_0348"
FT   CDS_pept        372017..372169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0348"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03134"
FT                   /protein_id="AAT03134.1"
FT                   HGGRK"
FT   gene            372153..375296
FT                   /locus_tag="LMOf2365_0349"
FT   CDS_pept        372153..375296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0349"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM PF00560;
FT                   match to protein family HMM PF08191; match to protein
FT                   family HMM TIGR01167; match to protein family HMM
FT                   TIGR02543"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03135"
FT                   /protein_id="AAT03135.1"
FT   gene            375686..381013
FT                   /locus_tag="LMOf2365_0350"
FT   CDS_pept        375686..381013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0350"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM PF00560;
FT                   match to protein family HMM PF06458; match to protein
FT                   family HMM PF07523; match to protein family HMM PF08191;
FT                   match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03136"
FT                   /db_xref="GOA:Q723X5"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR009459"
FT                   /db_xref="InterPro:IPR012569"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723X5"
FT                   /protein_id="AAT03136.1"
FT   gene            381237..381761
FT                   /locus_tag="LMOf2365_0351"
FT   CDS_pept        381237..381761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0351"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03137"
FT                   /protein_id="AAT03137.1"
FT                   LNKLDGILDRV"
FT   gene            381974..382258
FT                   /locus_tag="LMOf2365_0352"
FT   CDS_pept        381974..382258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0352"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0353"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03138"
FT                   /protein_id="AAT03138.1"
FT   gene            382259..382627
FT                   /locus_tag="LMOf2365_0353"
FT   CDS_pept        382259..382627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0353"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0354"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03139"
FT                   /protein_id="AAT03139.1"
FT                   RLHTLETKQATLQKEWSK"
FT   gene            382624..384060
FT                   /locus_tag="LMOf2365_0354"
FT   CDS_pept        382624..384060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0354"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF06860"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03140"
FT                   /protein_id="AAT03140.1"
FT   gene            384072..384467
FT                   /locus_tag="LMOf2365_0355"
FT   CDS_pept        384072..384467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0355"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01PM0501"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03141"
FT                   /protein_id="AAT03141.1"
FT   gene            384604..384723
FT                   /locus_tag="LMOf2365_0356"
FT   CDS_pept        384604..384723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0356"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03142"
FT                   /protein_id="AAT03142.1"
FT   gene            384828..385058
FT                   /locus_tag="LMOf2365_0357"
FT   CDS_pept        384828..385058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0357"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01NM00296"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03143"
FT                   /protein_id="AAT03143.1"
FT   gene            385137..385364
FT                   /locus_tag="LMOf2365_0358"
FT   CDS_pept        385137..385364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0358"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03144"
FT                   /protein_id="AAT03144.1"
FT   gene            385524..385793
FT                   /locus_tag="LMOf2365_0359"
FT   CDS_pept        385524..385793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0359"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03145"
FT                   /protein_id="AAT03145.1"
FT   gene            385787..385909
FT                   /locus_tag="LMOf2365_0360"
FT   CDS_pept        385787..385909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0360"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03146"
FT                   /protein_id="AAT03146.1"
FT   gene            386169..386357
FT                   /locus_tag="LMOf2365_0361"
FT   CDS_pept        386169..386357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0361"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:EFA0076"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03147"
FT                   /protein_id="AAT03147.1"
FT                   ADGKPLLADLSKLNGAE"
FT   gene            complement(386477..388474)
FT                   /gene="tkt-1"
FT                   /locus_tag="LMOf2365_0362"
FT   CDS_pept        complement(386477..388474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tkt-1"
FT                   /locus_tag="LMOf2365_0362"
FT                   /product="transketolase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00456;
FT                   match to protein family HMM PF02779; match to protein
FT                   family HMM PF02780; match to protein family HMM TIGR00232"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03148"
FT                   /protein_id="AAT03148.1"
FT   gene            complement(388476..389132)
FT                   /locus_tag="LMOf2365_0363"
FT   CDS_pept        complement(388476..389132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0363"
FT                   /product="transaldolase"
FT                   /note="identified by match to protein family HMM PF00923;
FT                   match to protein family HMM TIGR00875"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03149"
FT                   /db_xref="GOA:Q723W2"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723W2"
FT                   /protein_id="AAT03149.1"
FT   gene            complement(389179..389943)
FT                   /locus_tag="LMOf2365_0364"
FT   CDS_pept        complement(389179..389943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0364"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03150"
FT                   /protein_id="AAT03150.1"
FT   gene            complement(389968..390414)
FT                   /gene="rpiB-1"
FT                   /locus_tag="LMOf2365_0365"
FT   CDS_pept        complement(389968..390414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiB-1"
FT                   /locus_tag="LMOf2365_0365"
FT                   /product="ribose 5-phosphate isomerase B"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P37351; match to
FT                   protein family HMM PF02502; match to protein family HMM
FT                   TIGR00689; match to protein family HMM TIGR01120"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03151"
FT                   /protein_id="AAT03151.1"
FT   gene            complement(390421..391185)
FT                   /gene="tpiA-1"
FT                   /locus_tag="LMOf2365_0366"
FT   CDS_pept        complement(390421..391185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpiA-1"
FT                   /locus_tag="LMOf2365_0366"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00121"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03152"
FT                   /db_xref="GOA:Q723V9"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723V9"
FT                   /protein_id="AAT03152.1"
FT   gene            complement(391189..391839)
FT                   /locus_tag="LMOf2365_0367"
FT   CDS_pept        complement(391189..391839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0367"
FT                   /product="dihydroxyacetone kinase"
FT                   /note="identified by similarity to GP:15082276; match to
FT                   protein family HMM PF02734; match to protein family HMM
FT                   TIGR02365"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03153"
FT                   /protein_id="AAT03153.1"
FT   gene            complement(391861..392856)
FT                   /locus_tag="LMOf2365_0368"
FT   CDS_pept        complement(391861..392856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0368"
FT                   /product="dihydroxyacetone kinase"
FT                   /note="identified by similarity to GP:15082277; match to
FT                   protein family HMM PF02733"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03154"
FT                   /protein_id="AAT03154.1"
FT   gene            complement(392878..393219)
FT                   /locus_tag="LMOf2365_0369"
FT   CDS_pept        complement(392878..393219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0369"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0365"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03155"
FT                   /protein_id="AAT03155.1"
FT                   GGFLLSLFL"
FT   gene            complement(393235..393666)
FT                   /locus_tag="LMOf2365_0370"
FT   CDS_pept        complement(393235..393666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0370"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0366"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03156"
FT                   /protein_id="AAT03156.1"
FT   gene            complement(393751..394128)
FT                   /locus_tag="LMOf2365_0371"
FT   CDS_pept        complement(393751..394128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0371"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03610;
FT                   match to protein family HMM TIGR02364"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03157"
FT                   /protein_id="AAT03157.1"
FT   gene            394311..395075
FT                   /locus_tag="LMOf2365_0372"
FT   CDS_pept        394311..395075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0372"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="identified by match to protein family HMM PF00455"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03158"
FT                   /protein_id="AAT03158.1"
FT   gene            395141..395551
FT                   /locus_tag="LMOf2365_0373"
FT   CDS_pept        395141..395551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0373"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03159"
FT                   /protein_id="AAT03159.1"
FT   gene            395649..397418
FT                   /locus_tag="LMOf2365_0374"
FT   CDS_pept        395649..397418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0374"
FT                   /product="internalin"
FT                   /note="identified by similarity to GP:2347104; match to
FT                   protein family HMM PF00560; match to protein family HMM
FT                   PF08191; match to protein family HMM TIGR02543"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03160"
FT                   /protein_id="AAT03160.1"
FT                   FLTSLALLTLRRK"
FT   gene            complement(397459..398985)
FT                   /locus_tag="LMOf2365_0375"
FT   CDS_pept        complement(397459..398985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0375"
FT                   /product="putative long-chain acyl-CoA synthetase"
FT                   /note="identified by similarity to GP:12723568; match to
FT                   protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03161"
FT                   /protein_id="AAT03161.1"
FT   gene            399222..400742
FT                   /locus_tag="LMOf2365_0376"
FT   CDS_pept        399222..400742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0376"
FT                   /product="fumarate reductase, flavoprotein subunit"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:Q02469; match to
FT                   protein family HMM PF00890; match to protein family HMM
FT                   PF07992; match to protein family HMM TIGR01813"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03162"
FT                   /protein_id="AAT03162.1"
FT   gene            400946..401962
FT                   /locus_tag="LMOf2365_0377"
FT   CDS_pept        400946..401962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0377"
FT                   /product="oxidoreductase, YhhX family"
FT                   /note="identified by match to protein family HMM PF01408;
FT                   match to protein family HMM PF02894"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03163"
FT                   /protein_id="AAT03163.1"
FT   gene            402164..404018
FT                   /pseudo
FT                   /locus_tag="LMOf2365_0378"
FT                   /note="PTS system, fructose-specific, IIABC component,
FT                   authentic frameshift; this gene contains a frame shift
FT                   which is not the result of sequencing error; identified by
FT                   similarity to SP:P20966"
FT   gene            404018..404878
FT                   /locus_tag="LMOf2365_0379"
FT   CDS_pept        404018..404878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0379"
FT                   /product="fructose-bisphosphate aldolase, class II family"
FT                   /note="identified by match to protein family HMM PF01116;
FT                   match to protein family HMM TIGR00167"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03164"
FT                   /protein_id="AAT03164.1"
FT                   QRDKY"
FT   gene            404935..405705
FT                   /locus_tag="LMOf2365_0380"
FT   CDS_pept        404935..405705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0380"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="identified by match to protein family HMM PF00455"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03165"
FT                   /protein_id="AAT03165.1"
FT   gene            complement(405689..405916)
FT                   /locus_tag="LMOf2365_0381"
FT   CDS_pept        complement(405689..405916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0381"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03166"
FT                   /protein_id="AAT03166.1"
FT   gene            complement(406017..406634)
FT                   /locus_tag="LMOf2365_0382"
FT   CDS_pept        complement(406017..406634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0382"
FT                   /product="peptidase, S51 family"
FT                   /note="identified by match to protein family HMM PF03575"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03167"
FT                   /protein_id="AAT03167.1"
FT   gene            406729..407676
FT                   /locus_tag="LMOf2365_0383"
FT   CDS_pept        406729..407676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0383"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0381"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03168"
FT                   /protein_id="AAT03168.1"
FT   gene            407726..408235
FT                   /locus_tag="LMOf2365_0384"
FT   CDS_pept        407726..408235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0384"
FT                   /product="MutT/nudix family protein"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03169"
FT                   /protein_id="AAT03169.1"
FT                   ATSIHF"
FT   gene            408331..409050
FT                   /locus_tag="LMOf2365_0385"
FT   CDS_pept        408331..409050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0385"
FT                   /product="conserved hypothetical protein TIGR01033"
FT                   /note="identified by similarity to OMNI:NTL01LI0386; match
FT                   to protein family HMM PF01709; match to protein family HMM
FT                   TIGR01033"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03170"
FT                   /db_xref="GOA:Q723U1"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026562"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723U1"
FT                   /protein_id="AAT03170.1"
FT                   EDLEDVQKVYHNVELED"
FT   gene            409087..409422
FT                   /gene="phnA"
FT                   /locus_tag="LMOf2365_0386"
FT   CDS_pept        409087..409422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnA"
FT                   /locus_tag="LMOf2365_0386"
FT                   /product="alkylphosphonate utilization operon protein PhnA"
FT                   /note="identified by match to protein family HMM PF03831;
FT                   match to protein family HMM TIGR00686"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03171"
FT                   /protein_id="AAT03171.1"
FT                   SEFVKKI"
FT   gene            complement(409462..410175)
FT                   /locus_tag="LMOf2365_0387"
FT   CDS_pept        complement(409462..410175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0387"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07702"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03172"
FT                   /protein_id="AAT03172.1"
FT                   HTYESFVFETVFVQN"
FT   gene            410332..411774
FT                   /locus_tag="LMOf2365_0388"
FT   CDS_pept        410332..411774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0388"
FT                   /product="glycosyl hydrolase, family 1"
FT                   /note="identified by match to protein family HMM PF00232"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03173"
FT                   /protein_id="AAT03173.1"
FT   gene            411767..413101
FT                   /locus_tag="LMOf2365_0389"
FT   CDS_pept        411767..413101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0389"
FT                   /product="PTS system, beta-glucoside-specific, IIC
FT                   component"
FT                   /note="identified by match to protein family HMM PF02378;
FT                   match to protein family HMM TIGR00410"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03174"
FT                   /protein_id="AAT03174.1"
FT   gene            413119..413421
FT                   /locus_tag="LMOf2365_0390"
FT   CDS_pept        413119..413421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0390"
FT                   /product="PTS system, beta-glucoside-specific, IIB
FT                   component"
FT                   /note="identified by similarity to SP:P46318; match to
FT                   protein family HMM PF02302"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03175"
FT                   /protein_id="AAT03175.1"
FT   gene            413508..413702
FT                   /locus_tag="LMOf2365_0391"
FT   CDS_pept        413508..413702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0391"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0392"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03176"
FT                   /protein_id="AAT03176.1"
FT   gene            complement(413741..414661)
FT                   /locus_tag="LMOf2365_0392"
FT   CDS_pept        complement(413741..414661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0392"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0393"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03177"
FT                   /protein_id="AAT03177.1"
FT   gene            414764..415183
FT                   /locus_tag="LMOf2365_0393"
FT   CDS_pept        414764..415183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0393"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0394"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03178"
FT                   /protein_id="AAT03178.1"
FT   gene            complement(415232..415993)
FT                   /locus_tag="LMOf2365_0394"
FT   CDS_pept        complement(415232..415993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0394"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="identified by match to protein family HMM PF00455"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03179"
FT                   /protein_id="AAT03179.1"
FT   gene            416188..417654
FT                   /gene="mmsA"
FT                   /locus_tag="LMOf2365_0395"
FT   CDS_pept        416188..417654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmsA"
FT                   /locus_tag="LMOf2365_0395"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P42412; match to
FT                   protein family HMM PF00171; match to protein family HMM
FT                   TIGR01722"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03180"
FT                   /db_xref="GOA:Q723T1"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR023510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723T1"
FT                   /protein_id="AAT03180.1"
FT   gene            417667..418488
FT                   /locus_tag="LMOf2365_0396"
FT   CDS_pept        417667..418488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0396"
FT                   /product="putative iolB protein"
FT                   /note="identified by similarity to SP:P42413; match to
FT                   protein family HMM PF06845"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03181"
FT                   /db_xref="GOA:Q723T0"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR023770"
FT                   /db_xref="InterPro:IPR024203"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723T0"
FT                   /protein_id="AAT03181.1"
FT   gene            418505..419482
FT                   /locus_tag="LMOf2365_0397"
FT   CDS_pept        418505..419482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0397"
FT                   /product="putative iolC protein"
FT                   /note="identified by similarity to SP:P42414; match to
FT                   protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03182"
FT                   /db_xref="GOA:Q723S9"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR022841"
FT                   /db_xref="InterPro:IPR023314"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030830"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723S9"
FT                   /protein_id="AAT03182.1"
FT   gene            419492..421411
FT                   /locus_tag="LMOf2365_0398"
FT   CDS_pept        419492..421411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0398"
FT                   /product="thiamine-pyrophosphate-requiring enzyme"
FT                   /note="identified by match to protein family HMM PF00205;
FT                   match to protein family HMM PF02776"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03183"
FT                   /db_xref="GOA:Q723S8"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR023757"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR030817"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723S8"
FT                   /protein_id="AAT03183.1"
FT                   ARLY"
FT   gene            421544..421915
FT                   /locus_tag="LMOf2365_0399"
FT   CDS_pept        421544..421915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0399"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0403"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03184"
FT                   /protein_id="AAT03184.1"
FT   gene            422009..422377
FT                   /locus_tag="LMOf2365_0400"
FT   CDS_pept        422009..422377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0400"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0404"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03185"
FT                   /protein_id="AAT03185.1"
FT                   GLFIFTDYTRHQDTGEER"
FT   gene            complement(422401..423516)
FT                   /locus_tag="LMOf2365_0401"
FT   CDS_pept        complement(422401..423516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0401"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF06772"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03186"
FT                   /protein_id="AAT03186.1"
FT   gene            423647..424312
FT                   /gene="ung-1"
FT                   /locus_tag="LMOf2365_0402"
FT   CDS_pept        423647..424312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ung-1"
FT                   /locus_tag="LMOf2365_0402"
FT                   /product="uracil-DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="identified by similarity to SP:P39615; match to
FT                   protein family HMM PF03167; match to protein family HMM
FT                   TIGR00628"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03187"
FT                   /db_xref="GOA:Q723S4"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723S4"
FT                   /protein_id="AAT03187.1"
FT   gene            424480..424779
FT                   /locus_tag="LMOf2365_0403"
FT   CDS_pept        424480..424779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0403"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0407"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03188"
FT                   /protein_id="AAT03188.1"
FT   gene            424776..425720
FT                   /locus_tag="LMOf2365_0404"
FT   CDS_pept        424776..425720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0404"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01SA1454; match
FT                   to protein family HMM PF07251"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03189"
FT                   /db_xref="GOA:Q723S2"
FT                   /db_xref="InterPro:IPR022853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723S2"
FT                   /protein_id="AAT03189.1"
FT   gene            425755..426204
FT                   /locus_tag="LMOf2365_0405"
FT   CDS_pept        425755..426204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0405"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:16412840"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03190"
FT                   /protein_id="AAT03190.1"
FT   gene            426315..427031
FT                   /locus_tag="LMOf2365_0406"
FT   CDS_pept        426315..427031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0406"
FT                   /product="NLP/P60 family protein"
FT                   /note="identified by match to protein family HMM PF00877"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03191"
FT                   /protein_id="AAT03191.1"
FT                   YWKKYIAGYGRVANLK"
FT   gene            427087..427512
FT                   /locus_tag="LMOf2365_0407"
FT   CDS_pept        427087..427512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0407"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03192"
FT                   /protein_id="AAT03192.1"
FT   gene            complement(427515..428315)
FT                   /gene="proC"
FT                   /locus_tag="LMOf2365_0408"
FT   CDS_pept        complement(427515..428315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="LMOf2365_0408"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P00373; match to
FT                   protein family HMM PF01089; match to protein family HMM
FT                   TIGR00112"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03193"
FT                   /protein_id="AAT03193.1"
FT   gene            428664..428876
FT                   /locus_tag="LMOf2365_0409"
FT   CDS_pept        428664..428876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0409"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03194"
FT                   /protein_id="AAT03194.1"
FT   gene            428922..429023
FT                   /locus_tag="LMOf2365_0410"
FT   CDS_pept        428922..429023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0410"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03195"
FT                   /protein_id="AAT03195.1"
FT   gene            429060..429161
FT                   /locus_tag="LMOf2365_0411"
FT   CDS_pept        429060..429161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0411"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03196"
FT                   /protein_id="AAT03196.1"
FT   gene            429199..429300
FT                   /locus_tag="LMOf2365_0412"
FT   CDS_pept        429199..429300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0412"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03197"
FT                   /protein_id="AAT03197.1"
FT   gene            429391..430614
FT                   /locus_tag="LMOf2365_0413"
FT   CDS_pept        429391..430614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0413"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM PF07523;
FT                   match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03198"
FT                   /protein_id="AAT03198.1"
FT                   SYQKKANK"
FT   gene            430731..431381
FT                   /locus_tag="LMOf2365_0414"
FT   CDS_pept        430731..431381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0414"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03199"
FT                   /protein_id="AAT03199.1"
FT   gene            431426..432025
FT                   /locus_tag="LMOf2365_0415"
FT   CDS_pept        431426..432025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0415"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03200"
FT                   /protein_id="AAT03200.1"
FT   gene            432043..432717
FT                   /locus_tag="LMOf2365_0416"
FT   CDS_pept        432043..432717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0416"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03201"
FT                   /protein_id="AAT03201.1"
FT                   KL"
FT   gene            432702..433880
FT                   /locus_tag="LMOf2365_0417"
FT   CDS_pept        432702..433880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0417"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03202"
FT                   /protein_id="AAT03202.1"
FT   gene            433899..434042
FT                   /locus_tag="LMOf2365_0418"
FT   CDS_pept        433899..434042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0418"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03203"
FT                   /protein_id="AAT03203.1"
FT                   EQ"
FT   gene            434113..434595
FT                   /locus_tag="LMOf2365_0419"
FT   CDS_pept        434113..434595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0419"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03204"
FT                   /protein_id="AAT03204.1"
FT   gene            434764..436667
FT                   /pseudo
FT                   /locus_tag="LMOf2365_0420"
FT                   /note="PTS system, IIABC component, degenerate; this region
FT                   contains one or more premature stops and/or frameshifts
FT                   which are not the result of sequencing error"
FT   gene            436683..439316
FT                   /locus_tag="LMOf2365_0421"
FT   CDS_pept        436683..439316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0421"
FT                   /product="glycosyl hydrolase, family 38"
FT                   /note="identified by match to protein family HMM PF01074;
FT                   match to protein family HMM PF07748"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03205"
FT                   /protein_id="AAT03205.1"
FT                   SYLFEK"
FT   gene            439349..441283
FT                   /locus_tag="LMOf2365_0422"
FT   CDS_pept        439349..441283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0422"
FT                   /product="PRD/PTS system IIA 2 domain protein"
FT                   /note="identified by match to protein family HMM PF00359;
FT                   match to protein family HMM PF00874; match to protein
FT                   family HMM PF02302"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03206"
FT                   /protein_id="AAT03206.1"
FT                   LANDILKKK"
FT   gene            441410..441826
FT                   /locus_tag="LMOf2365_0423"
FT   CDS_pept        441410..441826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0423"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0424"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03207"
FT                   /protein_id="AAT03207.1"
FT   gene            441823..442215
FT                   /locus_tag="LMOf2365_0424"
FT   CDS_pept        441823..442215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0424"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03208"
FT                   /protein_id="AAT03208.1"
FT   gene            442324..443331
FT                   /locus_tag="LMOf2365_0425"
FT   CDS_pept        442324..443331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0425"
FT                   /product="phosphate transporter family protein"
FT                   /note="identified by match to protein family HMM PF01384"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03209"
FT                   /protein_id="AAT03209.1"
FT   gene            443347..443727
FT                   /locus_tag="LMOf2365_0426"
FT   CDS_pept        443347..443727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0426"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03210"
FT                   /protein_id="AAT03210.1"
FT   gene            443796..444188
FT                   /locus_tag="LMOf2365_0427"
FT   CDS_pept        443796..444188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0427"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0428; match
FT                   to protein family HMM PF06619"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03211"
FT                   /protein_id="AAT03211.1"
FT   gene            444201..444623
FT                   /locus_tag="LMOf2365_0428"
FT   CDS_pept        444201..444623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0428"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0429; match
FT                   to protein family HMM PF07009"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03212"
FT                   /protein_id="AAT03212.1"
FT   gene            444851..447322
FT                   /gene="inlF"
FT                   /locus_tag="LMOf2365_0429"
FT   CDS_pept        444851..447322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="inlF"
FT                   /locus_tag="LMOf2365_0429"
FT                   /product="internalin"
FT                   /note="identified by similarity to GP:2347102; match to
FT                   protein family HMM PF00560; match to protein family HMM
FT                   PF08191; match to protein family HMM TIGR01167; match to
FT                   protein family HMM TIGR02543"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03213"
FT                   /protein_id="AAT03213.1"
FT                   SSAFYIWRKKA"
FT   gene            complement(447370..449973)
FT                   /locus_tag="LMOf2365_0430"
FT   CDS_pept        complement(447370..449973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0430"
FT                   /product="putative phosphoenolpyruvate synthase"
FT                   /note="identified by similarity to GP:2995397; match to
FT                   protein family HMM PF00391; match to protein family HMM
FT                   PF01326"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03214"
FT                   /protein_id="AAT03214.1"
FT   gene            complement(450173..451051)
FT                   /locus_tag="LMOf2365_0431"
FT   CDS_pept        complement(450173..451051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0431"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0431"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03215"
FT                   /protein_id="AAT03215.1"
FT                   AQGLTLCKFEQ"
FT   gene            451388..451579
FT                   /locus_tag="LMOf2365_0432"
FT   CDS_pept        451388..451579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0432"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0432"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03216"
FT                   /protein_id="AAT03216.1"
FT                   VNKTRAFAQGFKQGWSGK"
FT   gene            451606..452415
FT                   /locus_tag="LMOf2365_0433"
FT   CDS_pept        451606..452415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0433"
FT                   /product="ZIP zinc transporter family protein"
FT                   /note="identified by match to protein family HMM PF02535"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03217"
FT                   /protein_id="AAT03217.1"
FT   gene            452708..454108
FT                   /locus_tag="LMOf2365_0434"
FT   CDS_pept        452708..454108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0434"
FT                   /product="polysaccharide deacetylase family protein"
FT                   /note="identified by similarity to OMNI:NTL02SP1332; match
FT                   to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03218"
FT                   /protein_id="AAT03218.1"
FT                   KTDSRMVK"
FT   gene            454235..454438
FT                   /locus_tag="LMOf2365_0435"
FT   CDS_pept        454235..454438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0435"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03219"
FT                   /protein_id="AAT03219.1"
FT   gene            454440..454850
FT                   /locus_tag="LMOf2365_0436"
FT   CDS_pept        454440..454850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0436"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0436"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03220"
FT                   /protein_id="AAT03220.1"
FT   gene            complement(454903..455202)
FT                   /locus_tag="LMOf2365_0437"
FT   CDS_pept        complement(454903..455202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0437"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0437"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03221"
FT                   /protein_id="AAT03221.1"
FT   gene            complement(455283..455837)
FT                   /locus_tag="LMOf2365_0438"
FT   CDS_pept        complement(455283..455837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LL0877; match
FT                   to protein family HMM PF06736"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03222"
FT                   /protein_id="AAT03222.1"
FT   gene            455984..456796
FT                   /locus_tag="LMOf2365_0439"
FT   CDS_pept        455984..456796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0439"
FT                   /product="Cof-like hydrolase"
FT                   /note="identified by match to protein family HMM TIGR00099;
FT                   match to protein family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03223"
FT                   /protein_id="AAT03223.1"
FT   gene            complement(456815..457672)
FT                   /locus_tag="LMOf2365_0440"
FT   CDS_pept        complement(456815..457672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0440"
FT                   /product="putative sugar transporter"
FT                   /note="identified by similarity to GP:2226001; match to
FT                   protein family HMM PF06800"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03224"
FT                   /protein_id="AAT03224.1"
FT                   SLLK"
FT   gene            457835..459796
FT                   /locus_tag="LMOf2365_0441"
FT   CDS_pept        457835..459796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0441"
FT                   /product="PRD/PTS system IIA 2 domain protein"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF00359; match to protein
FT                   family HMM PF00874; match to protein family HMM PF02302"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03225"
FT                   /protein_id="AAT03225.1"
FT                   TQLKSAAEIYEHLLKDGM"
FT   gene            459796..460260
FT                   /locus_tag="LMOf2365_0442"
FT   CDS_pept        459796..460260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0442"
FT                   /product="PTS system, fructose-specific, IIA component"
FT                   /note="identified by match to protein family HMM PF00359;
FT                   match to protein family HMM TIGR00848"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03226"
FT                   /protein_id="AAT03226.1"
FT   gene            460257..460577
FT                   /locus_tag="LMOf2365_0443"
FT   CDS_pept        460257..460577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0443"
FT                   /product="PTS system, fructose-specific, IIB component"
FT                   /note="identified by match to protein family HMM PF02379;
FT                   match to protein family HMM TIGR00829"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03227"
FT                   /protein_id="AAT03227.1"
FT                   EK"
FT   gene            460590..461696
FT                   /locus_tag="LMOf2365_0444"
FT   CDS_pept        460590..461696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0444"
FT                   /product="PTS system, fructose-specific, IIC component"
FT                   /note="identified by match to protein family HMM PF02378;
FT                   match to protein family HMM TIGR01427"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03228"
FT                   /protein_id="AAT03228.1"
FT   gene            461712..464294
FT                   /locus_tag="LMOf2365_0445"
FT   CDS_pept        461712..464294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0445"
FT                   /product="glycosyl hydrolase, family 38"
FT                   /note="identified by match to protein family HMM PF01074;
FT                   match to protein family HMM PF07748"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03229"
FT                   /protein_id="AAT03229.1"
FT   gene            complement(464317..465192)
FT                   /locus_tag="LMOf2365_0446"
FT   CDS_pept        complement(464317..465192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0446"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03230"
FT                   /protein_id="AAT03230.1"
FT                   LRLIKKTCSK"
FT   gene            465310..465879
FT                   /locus_tag="LMOf2365_0447"
FT   CDS_pept        465310..465879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0447"
FT                   /product="acetyltransferase, CysE/LacA/LpxA/NodL family"
FT                   /note="identified by similarity to SP:Q09707; match to
FT                   protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03231"
FT                   /protein_id="AAT03231.1"
FT   gene            465893..466639
FT                   /locus_tag="LMOf2365_0448"
FT   CDS_pept        465893..466639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0448"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03232"
FT                   /protein_id="AAT03232.1"
FT   gene            466835..467260
FT                   /locus_tag="LMOf2365_0449"
FT   CDS_pept        466835..467260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0449"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0450"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03233"
FT                   /protein_id="AAT03233.1"
FT   gene            467516..474103
FT                   /locus_tag="LMOf2365_0450"
FT   CDS_pept        467516..474103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0450"
FT                   /product="putative wall-associated protein"
FT                   /note="identified by similarity to SP:Q07833; match to
FT                   protein family HMM PF02018; match to protein family HMM
FT                   PF05593; match to protein family HMM TIGR01643"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03234"
FT                   /protein_id="AAT03234.1"
FT   gene            474103..474585
FT                   /locus_tag="LMOf2365_0451"
FT   CDS_pept        474103..474585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0451"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03235"
FT                   /protein_id="AAT03235.1"
FT   gene            474856..474969
FT                   /locus_tag="LMOf2365_0452"
FT   CDS_pept        474856..474969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0452"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03236"
FT                   /protein_id="AAT03236.1"
FT   gene            475465..475815
FT                   /locus_tag="LMOf2365_0453"
FT   CDS_pept        475465..475815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0453"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03237"
FT                   /protein_id="AAT03237.1"
FT                   KDLGFLVDELAL"
FT   gene            475978..476568
FT                   /locus_tag="LMOf2365_0454"
FT   CDS_pept        475978..476568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0454"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:19915967"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03238"
FT                   /protein_id="AAT03238.1"
FT   gene            476595..477041
FT                   /locus_tag="LMOf2365_0455"
FT   CDS_pept        476595..477041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0455"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03239"
FT                   /protein_id="AAT03239.1"
FT   gene            477058..477666
FT                   /locus_tag="LMOf2365_0456"
FT   CDS_pept        477058..477666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0456"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03240"
FT                   /protein_id="AAT03240.1"
FT   gene            477810..478076
FT                   /locus_tag="LMOf2365_0457"
FT   CDS_pept        477810..478076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0457"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03241"
FT                   /protein_id="AAT03241.1"
FT   gene            478116..478472
FT                   /locus_tag="LMOf2365_0458"
FT   CDS_pept        478116..478472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0458"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03242"
FT                   /protein_id="AAT03242.1"
FT                   LGIYIYYVIASFIY"
FT   gene            478648..478902
FT                   /locus_tag="LMOf2365_0459"
FT   CDS_pept        478648..478902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0459"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03243"
FT                   /protein_id="AAT03243.1"
FT   gene            478915..479082
FT                   /locus_tag="LMOf2365_0460"
FT   CDS_pept        478915..479082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0460"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03244"
FT                   /protein_id="AAT03244.1"
FT                   VYIAVYVGIF"
FT   gene            479199..479693
FT                   /locus_tag="LMOf2365_0461"
FT   CDS_pept        479199..479693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0461"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03245"
FT                   /protein_id="AAT03245.1"
FT                   C"
FT   gene            479903..480169
FT                   /locus_tag="LMOf2365_0462"
FT   CDS_pept        479903..480169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0462"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03246"
FT                   /protein_id="AAT03246.1"
FT   gene            480288..481076
FT                   /locus_tag="LMOf2365_0463"
FT   CDS_pept        480288..481076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0463"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03247"
FT                   /protein_id="AAT03247.1"
FT   gene            481229..481894
FT                   /locus_tag="LMOf2365_0464"
FT   CDS_pept        481229..481894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0464"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03248"
FT                   /protein_id="AAT03248.1"
FT   gene            complement(482137..482376)
FT                   /locus_tag="LMOf2365_0465"
FT   CDS_pept        complement(482137..482376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0465"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03249"
FT                   /protein_id="AAT03249.1"
FT   gene            482394..482981
FT                   /locus_tag="LMOf2365_0466"
FT   CDS_pept        482394..482981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0466"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03250"
FT                   /protein_id="AAT03250.1"
FT   gene            483006..483152
FT                   /locus_tag="LMOf2365_0467"
FT   CDS_pept        483006..483152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0467"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03251"
FT                   /protein_id="AAT03251.1"
FT                   LTS"
FT   gene            483130..483705
FT                   /locus_tag="LMOf2365_0468"
FT   CDS_pept        483130..483705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0468"
FT                   /product="PBS lyase HEAT-like repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03252"
FT                   /protein_id="AAT03252.1"
FT   gene            483744..483869
FT                   /locus_tag="LMOf2365_0469"
FT   CDS_pept        483744..483869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0469"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03253"
FT                   /protein_id="AAT03253.1"
FT   gene            483988..484089
FT                   /locus_tag="LMOf2365_0470"
FT   CDS_pept        483988..484089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0470"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03254"
FT                   /protein_id="AAT03254.1"
FT   gene            484412..486814
FT                   /gene="inlA"
FT                   /locus_tag="LMOf2365_0471"
FT   CDS_pept        484412..486814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="inlA"
FT                   /locus_tag="LMOf2365_0471"
FT                   /product="internalin A"
FT                   /note="identified by similarity to SP:P25146; match to
FT                   protein family HMM PF00560; match to protein family HMM
FT                   PF00746; match to protein family HMM PF08191; match to
FT                   protein family HMM TIGR01167; match to protein family HMM
FT                   TIGR02543"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03255"
FT                   /db_xref="GOA:Q723K6"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR012569"
FT                   /db_xref="InterPro:IPR013378"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR024634"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR042229"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723K6"
FT                   /protein_id="AAT03255.1"
FT   gene            486899..488791
FT                   /pseudo
FT                   /gene="inlB"
FT                   /locus_tag="LMOf2365_0472"
FT                   /note="internalin B, authentic point mutation; this gene
FT                   contains a premature stop which is not the result of
FT                   sequencing error; identified by similarity to SP:P25147"
FT   gene            complement(488906..489373)
FT                   /locus_tag="LMOf2365_0473"
FT   CDS_pept        complement(488906..489373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0473"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03256"
FT                   /protein_id="AAT03256.1"
FT   gene            489490..490335
FT                   /locus_tag="LMOf2365_0474"
FT   CDS_pept        489490..490335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0474"
FT                   /product="putative ytfG protein"
FT                   /note="identified by similarity to SP:P39315"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03257"
FT                   /protein_id="AAT03257.1"
FT                   "
FT   gene            490530..491108
FT                   /locus_tag="LMOf2365_0475"
FT   CDS_pept        490530..491108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0475"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03258"
FT                   /protein_id="AAT03258.1"
FT   gene            complement(491141..492409)
FT                   /locus_tag="LMOf2365_0476"
FT   CDS_pept        complement(491141..492409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0476"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0457; match
FT                   to protein family HMM PF00668"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03259"
FT                   /protein_id="AAT03259.1"
FT   gene            492547..493050
FT                   /locus_tag="LMOf2365_0477"
FT   CDS_pept        492547..493050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0477"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03260"
FT                   /protein_id="AAT03260.1"
FT                   THES"
FT   gene            complement(493092..495128)
FT                   /locus_tag="LMOf2365_0478"
FT   CDS_pept        complement(493092..495128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0478"
FT                   /product="penicillin-binding protein"
FT                   /note="identified by match to protein family HMM PF00905;
FT                   match to protein family HMM PF03717; match to protein
FT                   family HMM PF05223"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03261"
FT                   /protein_id="AAT03261.1"
FT   gene            495300..495614
FT                   /locus_tag="LMOf2365_0479"
FT   CDS_pept        495300..495614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0479"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0459"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03262"
FT                   /protein_id="AAT03262.1"
FT                   "
FT   gene            495751..496680
FT                   /locus_tag="LMOf2365_0480"
FT   CDS_pept        495751..496680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0480"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by similarity to SP:Q02115; match to
FT                   protein family HMM PF03816; match to protein family HMM
FT                   TIGR00350"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03263"
FT                   /protein_id="AAT03263.1"
FT   gene            complement(496728..497276)
FT                   /locus_tag="LMOf2365_0481"
FT   CDS_pept        complement(496728..497276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0481"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GP:5578868"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03264"
FT                   /protein_id="AAT03264.1"
FT   gene            497510..498235
FT                   /locus_tag="LMOf2365_0482"
FT   CDS_pept        497510..498235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0482"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0463"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03265"
FT                   /protein_id="AAT03265.1"
FT   gene            complement(498279..498944)
FT                   /locus_tag="LMOf2365_0483"
FT   CDS_pept        complement(498279..498944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0483"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0464; match
FT                   to protein family HMM PF06912"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03266"
FT                   /protein_id="AAT03266.1"
FT   gene            complement(498965..499720)
FT                   /locus_tag="LMOf2365_0484"
FT   CDS_pept        complement(498965..499720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0484"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0465"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03267"
FT                   /protein_id="AAT03267.1"
FT   gene            complement(499837..501996)
FT                   /locus_tag="LMOf2365_0485"
FT   CDS_pept        complement(499837..501996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0485"
FT                   /product="putative peptidase"
FT                   /note="identified by match to protein family HMM PF01841"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03268"
FT                   /protein_id="AAT03268.1"
FT   gene            complement(501993..503141)
FT                   /locus_tag="LMOf2365_0486"
FT   CDS_pept        complement(501993..503141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0486"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0467; match
FT                   to protein family HMM PF01882"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03269"
FT                   /protein_id="AAT03269.1"
FT   gene            complement(503146..504093)
FT                   /locus_tag="LMOf2365_0487"
FT   CDS_pept        complement(503146..504093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0487"
FT                   /product="magnesium chelatase, subunit ChII family protein"
FT                   /note="identified by match to protein family HMM PF01078;
FT                   match to protein family HMM PF07726"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03270"
FT                   /protein_id="AAT03270.1"
FT   gene            504261..505844
FT                   /locus_tag="LMOf2365_0488"
FT   CDS_pept        504261..505844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0488"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:16412913; match to
FT                   protein family HMM PF07905"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03271"
FT                   /protein_id="AAT03271.1"
FT                   RILGGNNNNK"
FT   gene            505978..507261
FT                   /locus_tag="LMOf2365_0489"
FT   CDS_pept        505978..507261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0489"
FT                   /product="cytosine/purines/uracil/thiamine/allantoin
FT                   permease family protein"
FT                   /note="identified by match to protein family HMM PF02133"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03272"
FT                   /protein_id="AAT03272.1"
FT   gene            507262..508362
FT                   /locus_tag="LMOf2365_0490"
FT   CDS_pept        507262..508362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0490"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0471; match
FT                   to protein family HMM PF06032"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03273"
FT                   /protein_id="AAT03273.1"
FT   gene            508355..509905
FT                   /locus_tag="LMOf2365_0491"
FT   CDS_pept        508355..509905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0491"
FT                   /product="hydantoinase/oxoprolinase family protein"
FT                   /note="identified by match to protein family HMM PF01968;
FT                   match to protein family HMM PF05378"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03274"
FT                   /protein_id="AAT03274.1"
FT   gene            complement(510079..510306)
FT                   /locus_tag="LMOf2365_0492"
FT   CDS_pept        complement(510079..510306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0492"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03275"
FT                   /protein_id="AAT03275.1"
FT   gene            510541..512079
FT                   /locus_tag="LMOf2365_0493"
FT   CDS_pept        510541..512079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0493"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03276"
FT                   /protein_id="AAT03276.1"
FT   gene            512381..514495
FT                   /locus_tag="LMOf2365_0494"
FT   CDS_pept        512381..514495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0494"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0798; match
FT                   to protein family HMM TIGR02167; match to protein family
FT                   HMM TIGR02543"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03277"
FT                   /protein_id="AAT03277.1"
FT                   GNLVFSINYE"
FT   gene            514631..516700
FT                   /locus_tag="LMOf2365_0495"
FT   CDS_pept        514631..516700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0495"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM TIGR02167;
FT                   match to protein family HMM TIGR02543"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03278"
FT                   /protein_id="AAT03278.1"
FT   gene            516766..517239
FT                   /locus_tag="LMOf2365_0496"
FT   CDS_pept        516766..517239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0496"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03279"
FT                   /protein_id="AAT03279.1"
FT   gene            517259..517744
FT                   /locus_tag="LMOf2365_0497"
FT   CDS_pept        517259..517744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0497"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03280"
FT                   /protein_id="AAT03280.1"
FT   gene            517796..518077
FT                   /locus_tag="LMOf2365_0498"
FT   CDS_pept        517796..518077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0498"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03281"
FT                   /protein_id="AAT03281.1"
FT   gene            518151..518417
FT                   /locus_tag="LMOf2365_0499"
FT   CDS_pept        518151..518417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0499"
FT                   /product="putative transposase OrfA, IS3 family"
FT                   /note="This gene is marked putative because transposase
FT                   OrfB appears to be missing.; identified by similarity to
FT                   OMNI:NTL01LL0091"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03282"
FT                   /protein_id="AAT03282.1"
FT   gene            518926..519102
FT                   /locus_tag="LMOf2365_0500"
FT   CDS_pept        518926..519102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0500"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03283"
FT                   /protein_id="AAT03283.1"
FT                   NWFLYNKYLSKKT"
FT   gene            519153..519770
FT                   /locus_tag="LMOf2365_0501"
FT   CDS_pept        519153..519770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0501"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03284"
FT                   /protein_id="AAT03284.1"
FT   gene            520080..520424
FT                   /locus_tag="LMOf2365_0502"
FT   CDS_pept        520080..520424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0502"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03285"
FT                   /protein_id="AAT03285.1"
FT                   QFLNNFKTME"
FT   gene            520831..521073
FT                   /locus_tag="LMOf2365_0503"
FT   CDS_pept        520831..521073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0503"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI1685"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03286"
FT                   /protein_id="AAT03286.1"
FT   gene            complement(521156..522133)
FT                   /locus_tag="LMOf2365_0504"
FT   CDS_pept        complement(521156..522133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0504"
FT                   /product="HD domain protein"
FT                   /note="identified by similarity to OMNI:NTL01BS00578; match
FT                   to protein family HMM PF01966"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03287"
FT                   /protein_id="AAT03287.1"
FT   gene            522237..522572
FT                   /locus_tag="LMOf2365_0505"
FT   CDS_pept        522237..522572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0505"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0472"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03288"
FT                   /protein_id="AAT03288.1"
FT                   KVVGNLV"
FT   gene            523033..523392
FT                   /locus_tag="LMOf2365_0506"
FT   CDS_pept        523033..523392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0506"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0477"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03289"
FT                   /protein_id="AAT03289.1"
FT                   EDDQVKHPPLQEQND"
FT   gene            523644..524204
FT                   /locus_tag="LMOf2365_0507"
FT   CDS_pept        523644..524204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0507"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0478"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03290"
FT                   /protein_id="AAT03290.1"
FT   gene            524314..526014
FT                   /locus_tag="LMOf2365_0508"
FT   CDS_pept        524314..526014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0508"
FT                   /product="putative antigen"
FT                   /note="identified by similarity to OMNI:NTL01SPL0347; match
FT                   to protein family HMM PF06100"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03291"
FT                   /protein_id="AAT03291.1"
FT   gene            526165..527268
FT                   /locus_tag="LMOf2365_0509"
FT   CDS_pept        526165..527268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0509"
FT                   /product="conserved hypothetical protein TIGR00048"
FT                   /note="identified by similarity to OMNI:NTL01LI0480; match
FT                   to protein family HMM PF04055; match to protein family HMM
FT                   TIGR00048"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03292"
FT                   /db_xref="GOA:Q723G9"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723G9"
FT                   /protein_id="AAT03292.1"
FT   gene            527358..527837
FT                   /locus_tag="LMOf2365_0510"
FT   CDS_pept        527358..527837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0510"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0481; match
FT                   to protein family HMM PF06445"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03293"
FT                   /protein_id="AAT03293.1"
FT   gene            527995..528360
FT                   /locus_tag="LMOf2365_0511"
FT   CDS_pept        527995..528360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0511"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01BH3296; match
FT                   to protein family HMM PF03992"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03294"
FT                   /db_xref="GOA:Q723G7"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR023953"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723G7"
FT                   /protein_id="AAT03294.1"
FT                   IARFEVVHVQNPVIVEK"
FT   gene            528488..528856
FT                   /pseudo
FT                   /locus_tag="LMOf2365_0512"
FT                   /note="conserved hypothetical protein, authentic point
FT                   mutation; this gene contains a premature stop which is not
FT                   the result of sequencing error; identified by similarity to
FT                   OMNI:NTL01LI0184"
FT   gene            528853..530154
FT                   /locus_tag="LMOf2365_0513"
FT   CDS_pept        528853..530154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0513"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:16412606"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03295"
FT                   /protein_id="AAT03295.1"
FT   gene            530167..530544
FT                   /locus_tag="LMOf2365_0514"
FT   CDS_pept        530167..530544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0514"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03296"
FT                   /protein_id="AAT03296.1"
FT   gene            530778..531353
FT                   /locus_tag="LMOf2365_0515"
FT   CDS_pept        530778..531353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LM0480; match
FT                   to protein family HMM PF00881"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03297"
FT                   /protein_id="AAT03297.1"
FT   gene            531418..531588
FT                   /gene="rpmF-1"
FT                   /locus_tag="LMOf2365_0516"
FT   CDS_pept        531418..531588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmF-1"
FT                   /locus_tag="LMOf2365_0516"
FT                   /product="ribosomal protein L32"
FT                   /note="identified by match to protein family HMM PF01783;
FT                   match to protein family HMM TIGR01031"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03298"
FT                   /db_xref="GOA:Q723G3"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723G3"
FT                   /protein_id="AAT03298.1"
FT                   GTYKGRTIIEK"
FT   gene            531680..532408
FT                   /locus_tag="LMOf2365_0517"
FT   CDS_pept        531680..532408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0517"
FT                   /product="MutT/nudix family protein"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03299"
FT                   /protein_id="AAT03299.1"
FT   gene            complement(532445..533338)
FT                   /locus_tag="LMOf2365_0518"
FT   CDS_pept        complement(532445..533338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0518"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03300"
FT                   /protein_id="AAT03300.1"
FT                   KAFKDFALRYGKKHFL"
FT   gene            533536..535530
FT                   /locus_tag="LMOf2365_0519"
FT   CDS_pept        533536..535530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0519"
FT                   /product="NADH:flavin oxidoreductase"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF00724; match to protein
FT                   family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03301"
FT                   /protein_id="AAT03301.1"
FT   gene            535630..536505
FT                   /gene="aroE-1"
FT                   /locus_tag="LMOf2365_0520"
FT   CDS_pept        535630..536505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE-1"
FT                   /locus_tag="LMOf2365_0520"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P54374; match to
FT                   protein family HMM PF01488; match to protein family HMM
FT                   TIGR00507"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03302"
FT                   /db_xref="GOA:Q723F9"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723F9"
FT                   /protein_id="AAT03302.1"
FT                   PVDYIKEILF"
FT   gene            536571..537329
FT                   /gene="aroD"
FT                   /locus_tag="LMOf2365_0521"
FT   CDS_pept        536571..537329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroD"
FT                   /locus_tag="LMOf2365_0521"
FT                   /product="3-dehydroquinate dehydratase, type I"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P05194; match to
FT                   protein family HMM PF01487; match to protein family HMM
FT                   TIGR01093"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03303"
FT                   /db_xref="GOA:Q723F8"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018508"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723F8"
FT                   /protein_id="AAT03303.1"
FT   gene            complement(537398..538306)
FT                   /locus_tag="LMOf2365_0522"
FT   CDS_pept        complement(537398..538306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0522"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03304"
FT                   /protein_id="AAT03304.1"
FT   gene            complement(538381..540141)
FT                   /locus_tag="LMOf2365_0523"
FT   CDS_pept        complement(538381..540141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0523"
FT                   /product="hydrolase, CocE/NonD family"
FT                   /note="identified by match to protein family HMM PF02129;
FT                   match to protein family HMM TIGR00976"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03305"
FT                   /protein_id="AAT03305.1"
FT                   SYIQLPIINK"
FT   gene            540333..540926
FT                   /locus_tag="LMOf2365_0524"
FT   CDS_pept        540333..540926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0524"
FT                   /product="lipase/acylhydrolase family protein"
FT                   /note="identified by match to protein family HMM PF00657"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03306"
FT                   /protein_id="AAT03306.1"
FT   gene            541112..542071
FT                   /locus_tag="LMOf2365_0525"
FT   CDS_pept        541112..542071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0525"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03307"
FT                   /protein_id="AAT03307.1"
FT   gene            542146..542370
FT                   /locus_tag="LMOf2365_0526"
FT   CDS_pept        542146..542370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0526"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:SP1473; match to
FT                   protein family HMM PF05979"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03308"
FT                   /db_xref="GOA:Q723F3"
FT                   /db_xref="InterPro:IPR009242"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723F3"
FT                   /protein_id="AAT03308.1"
FT   gene            542537..542986
FT                   /gene="rpiB-2"
FT                   /locus_tag="LMOf2365_0527"
FT   CDS_pept        542537..542986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiB-2"
FT                   /locus_tag="LMOf2365_0527"
FT                   /product="ribose 5-phosphate isomerase B"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P37351; match to
FT                   protein family HMM PF02502; match to protein family HMM
FT                   TIGR00689; match to protein family HMM TIGR01120"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03309"
FT                   /protein_id="AAT03309.1"
FT   gene            542983..543651
FT                   /locus_tag="LMOf2365_0528"
FT   CDS_pept        542983..543651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0528"
FT                   /product="ribulose-phosphate 3-epimerase family protein"
FT                   /note="identified by match to protein family HMM PF00834"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03310"
FT                   /protein_id="AAT03310.1"
FT                   "
FT   gene            543658..544308
FT                   /locus_tag="LMOf2365_0529"
FT   CDS_pept        543658..544308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0529"
FT                   /product="putative transaldolase"
FT                   /note="identified by match to protein family HMM PF00923"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03311"
FT                   /protein_id="AAT03311.1"
FT   gene            544417..546477
FT                   /locus_tag="LMOf2365_0530"
FT   CDS_pept        544417..546477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0530"
FT                   /product="PTS system, IIA 2 domain protein"
FT                   /note="identified by match to protein family HMM PF00359;
FT                   match to protein family HMM PF00874"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03312"
FT                   /protein_id="AAT03312.1"
FT   gene            546481..547083
FT                   /locus_tag="LMOf2365_0531"
FT   CDS_pept        546481..547083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0531"
FT                   /product="SIS domain protein"
FT                   /note="identified by similarity to GP:16412942; match to
FT                   protein family HMM PF01380"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03313"
FT                   /protein_id="AAT03313.1"
FT   gene            547111..547578
FT                   /locus_tag="LMOf2365_0532"
FT   CDS_pept        547111..547578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0532"
FT                   /product="PTS system, IIA component"
FT                   /note="identified by match to protein family HMM PF00359"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03314"
FT                   /protein_id="AAT03314.1"
FT   gene            547595..547993
FT                   /locus_tag="LMOf2365_0533"
FT   CDS_pept        547595..547993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0533"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0500"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03315"
FT                   /protein_id="AAT03315.1"
FT   gene            548004..548654
FT                   /gene="rpe-1"
FT                   /locus_tag="LMOf2365_0534"
FT   CDS_pept        548004..548654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpe-1"
FT                   /locus_tag="LMOf2365_0534"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00834;
FT                   match to protein family HMM PF01816; match to protein
FT                   family HMM TIGR01163"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03316"
FT                   /protein_id="AAT03316.1"
FT   gene            548651..549697
FT                   /locus_tag="LMOf2365_0535"
FT   CDS_pept        548651..549697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0535"
FT                   /product="alcohol dehydrogenase, zinc-dependent"
FT                   /note="identified by match to protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03317"
FT                   /protein_id="AAT03317.1"
FT                   GKVLFFPE"
FT   gene            549713..550006
FT                   /locus_tag="LMOf2365_0536"
FT   CDS_pept        549713..550006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0536"
FT                   /product="putative PTS system, galactitol-specific, IIB
FT                   component"
FT                   /note="identified by similarity to SP:P37188; match to
FT                   protein family HMM PF02302"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03318"
FT                   /protein_id="AAT03318.1"
FT   gene            550021..551292
FT                   /locus_tag="LMOf2365_0537"
FT   CDS_pept        550021..551292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0537"
FT                   /product="putative PTS system, galactitol-specific, IIC
FT                   component"
FT                   /note="identified by similarity to SP:P37189; match to
FT                   protein family HMM PF03611"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03319"
FT                   /protein_id="AAT03319.1"
FT   gene            551432..552367
FT                   /gene="prs-2"
FT                   /locus_tag="LMOf2365_0538"
FT   CDS_pept        551432..552367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prs-2"
FT                   /locus_tag="LMOf2365_0538"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01251"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03320"
FT                   /db_xref="GOA:Q723E1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723E1"
FT                   /protein_id="AAT03320.1"
FT   repeat_region   552505..552533
FT                   /rpt_family="CRISPR"
FT                   /note="LMOf2365_2865"
FT   repeat_region   552571..552599
FT                   /rpt_family="CRISPR"
FT                   /note="LMOf2365_2867"
FT   repeat_region   552637..552664
FT                   /rpt_family="CRISPR"
FT                   /note="LMOf2365_2869"
FT   repeat_region   552701..552729
FT                   /rpt_family="CRISPR"
FT                   /note="LMOf2365_2871"
FT   gene            552989..553567
FT                   /locus_tag="LMOf2365_0539"
FT   CDS_pept        552989..553567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0539"
FT                   /product="putative lipoprotein"
FT                   /note="identified by similarity to OMNI:NTL01LI0506"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03321"
FT                   /protein_id="AAT03321.1"
FT   gene            553674..554354
FT                   /locus_tag="LMOf2365_0540"
FT   CDS_pept        553674..554354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0540"
FT                   /product="glutamine amidotransferase, class I"
FT                   /note="identified by match to protein family HMM PF00117"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03322"
FT                   /protein_id="AAT03322.1"
FT                   PKTI"
FT   gene            complement(554379..554738)
FT                   /locus_tag="LMOf2365_0541"
FT   CDS_pept        complement(554379..554738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0541"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0508; match
FT                   to protein family HMM TIGR02058"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03323"
FT                   /protein_id="AAT03323.1"
FT                   NDLMYIVNASVETGY"
FT   gene            complement(554745..555203)
FT                   /locus_tag="LMOf2365_0542"
FT   CDS_pept        complement(554745..555203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0542"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03324"
FT                   /protein_id="AAT03324.1"
FT   gene            555585..557414
FT                   /locus_tag="LMOf2365_0543"
FT   CDS_pept        555585..557414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0543"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03325"
FT                   /protein_id="AAT03325.1"
FT   gene            557515..557946
FT                   /locus_tag="LMOf2365_0544"
FT   CDS_pept        557515..557946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0544"
FT                   /product="universal stress protein family"
FT                   /note="identified by match to protein family HMM PF00582"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03326"
FT                   /protein_id="AAT03326.1"
FT   gene            complement(557993..559423)
FT                   /locus_tag="LMOf2365_0545"
FT   CDS_pept        complement(557993..559423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0545"
FT                   /product="capA domain protein"
FT                   /note="identified by similarity to OMNI:NTL01BS03583"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03327"
FT                   /protein_id="AAT03327.1"
FT                   ISKPIEGGVTEYTYFDPF"
FT   gene            complement(559544..560359)
FT                   /locus_tag="LMOf2365_0546"
FT   CDS_pept        complement(559544..560359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0546"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03328"
FT                   /protein_id="AAT03328.1"
FT   gene            complement(560640..561008)
FT                   /locus_tag="LMOf2365_0547"
FT   CDS_pept        complement(560640..561008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0547"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF06993"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03329"
FT                   /protein_id="AAT03329.1"
FT                   LVKQGLPAVLALVAVLLV"
FT   gene            561155..562570
FT                   /locus_tag="LMOf2365_0548"
FT   CDS_pept        561155..562570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0548"
FT                   /product="drug resistance transporter, EmrB/QacA family"
FT                   /note="identified by similarity to SP:O35018; match to
FT                   protein family HMM PF07690; match to protein family HMM
FT                   TIGR00711"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03330"
FT                   /protein_id="AAT03330.1"
FT                   IGLLCSLFIRKAK"
FT   gene            562702..563706
FT                   /locus_tag="LMOf2365_0549"
FT   CDS_pept        562702..563706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0549"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0516"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03331"
FT                   /protein_id="AAT03331.1"
FT   gene            complement(563739..565055)
FT                   /locus_tag="LMOf2365_0550"
FT   CDS_pept        complement(563739..565055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0550"
FT                   /product="glycosyl hydrolase, family 4"
FT                   /note="identified by match to protein family HMM PF02056"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03332"
FT                   /protein_id="AAT03332.1"
FT   gene            565257..566009
FT                   /locus_tag="LMOf2365_0551"
FT   CDS_pept        565257..566009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0551"
FT                   /product="phosphosugar-binding transcriptional regulator,
FT                   RpiR family"
FT                   /note="identified by match to protein family HMM PF01380;
FT                   match to protein family HMM PF01418"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03333"
FT                   /protein_id="AAT03333.1"
FT   gene            566116..566559
FT                   /locus_tag="LMOf2365_0552"
FT   CDS_pept        566116..566559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0524"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03334"
FT                   /protein_id="AAT03334.1"
FT   gene            complement(566605..568266)
FT                   /locus_tag="LMOf2365_0553"
FT   CDS_pept        complement(566605..568266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0553"
FT                   /product="sulfate transporter family protein"
FT                   /note="identified by match to protein family HMM PF00916;
FT                   match to protein family HMM PF01740"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03335"
FT                   /protein_id="AAT03335.1"
FT   gene            complement(568321..568422)
FT                   /locus_tag="LMOf2365_0554"
FT   CDS_pept        complement(568321..568422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0554"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03336"
FT                   /protein_id="AAT03336.1"
FT   gene            complement(568406..569146)
FT                   /locus_tag="LMOf2365_0555"
FT   CDS_pept        complement(568406..569146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0555"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="identified by similarity to SP:P32184; match to
FT                   protein family HMM PF00376; match to protein family HMM
FT                   PF07739"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03337"
FT                   /protein_id="AAT03337.1"
FT   gene            569376..570851
FT                   /locus_tag="LMOf2365_0556"
FT   CDS_pept        569376..570851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0556"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03338"
FT                   /protein_id="AAT03338.1"
FT   gene            570844..572340
FT                   /locus_tag="LMOf2365_0557"
FT   CDS_pept        570844..572340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0557"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0528"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03339"
FT                   /protein_id="AAT03339.1"
FT   gene            572351..573601
FT                   /locus_tag="LMOf2365_0558"
FT   CDS_pept        572351..573601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0558"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03340"
FT                   /protein_id="AAT03340.1"
FT                   KDTILKRETKWYKTERF"
FT   gene            573617..575668
FT                   /locus_tag="LMOf2365_0559"
FT   CDS_pept        573617..575668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0559"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0530"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03341"
FT                   /protein_id="AAT03341.1"
FT   gene            575683..576537
FT                   /locus_tag="LMOf2365_0560"
FT   CDS_pept        575683..576537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0560"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0531"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03342"
FT                   /protein_id="AAT03342.1"
FT                   YDV"
FT   gene            576597..577427
FT                   /locus_tag="LMOf2365_0561"
FT   CDS_pept        576597..577427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0561"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0532"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03343"
FT                   /protein_id="AAT03343.1"
FT   gene            577505..577774
FT                   /locus_tag="LMOf2365_0562"
FT   CDS_pept        577505..577774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0562"
FT                   /product="ACT domain protein"
FT                   /note="identified by match to protein family HMM PF01842"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03344"
FT                   /db_xref="GOA:Q723B7"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR022986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723B7"
FT                   /protein_id="AAT03344.1"
FT   gene            577793..579148
FT                   /locus_tag="LMOf2365_0563"
FT   CDS_pept        577793..579148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0563"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05167"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03345"
FT                   /db_xref="GOA:Q723B6"
FT                   /db_xref="InterPro:IPR007841"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723B6"
FT                   /protein_id="AAT03345.1"
FT   gene            complement(579188..580156)
FT                   /locus_tag="LMOf2365_0564"
FT   CDS_pept        complement(579188..580156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0564"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03346"
FT                   /protein_id="AAT03346.1"
FT   gene            580328..581650
FT                   /locus_tag="LMOf2365_0565"
FT   CDS_pept        580328..581650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0565"
FT                   /product="glycosyl hydrolase, family 4"
FT                   /note="identified by match to protein family HMM PF02056"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03347"
FT                   /protein_id="AAT03347.1"
FT   gene            581754..583025
FT                   /locus_tag="LMOf2365_0566"
FT   CDS_pept        581754..583025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0566"
FT                   /product="putative N-carbamoyl-L-amino acid amidohydrolase"
FT                   /note="identified by similarity to SP:Q01264; match to
FT                   protein family HMM PF01546; match to protein family HMM
FT                   PF07687; match to protein family HMM TIGR01879"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03348"
FT                   /protein_id="AAT03348.1"
FT   gene            582991..584166
FT                   /locus_tag="LMOf2365_0567"
FT   CDS_pept        582991..584166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0567"
FT                   /product="putative carboxypeptidase"
FT                   /note="identified by similarity to SP:P80092; match to
FT                   protein family HMM PF01546; match to protein family HMM
FT                   PF07687; match to protein family HMM TIGR01891"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03349"
FT                   /protein_id="AAT03349.1"
FT   gene            complement(584214..585230)
FT                   /locus_tag="LMOf2365_0568"
FT   CDS_pept        complement(584214..585230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0568"
FT                   /product="putative tagatose 1,6-diphosphate aldolase"
FT                   /note="identified by match to protein family HMM PF04274"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03350"
FT                   /db_xref="GOA:Q723B1"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR005927"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723B1"
FT                   /protein_id="AAT03350.1"
FT   gene            585467..586660
FT                   /locus_tag="LMOf2365_0569"
FT   CDS_pept        585467..586660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0569"
FT                   /product="putative penicillin-binding protein"
FT                   /note="identified by similarity to OMNI:NTL01BS01695; match
FT                   to protein family HMM PF00144"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03351"
FT                   /protein_id="AAT03351.1"
FT   gene            complement(586701..587621)
FT                   /locus_tag="LMOf2365_0570"
FT   CDS_pept        complement(586701..587621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0570"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /note="identified by match to protein family HMM PF01497"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03352"
FT                   /protein_id="AAT03352.1"
FT   gene            complement(587732..588082)
FT                   /gene="srlB"
FT                   /locus_tag="LMOf2365_0571"
FT   CDS_pept        complement(587732..588082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srlB"
FT                   /locus_tag="LMOf2365_0571"
FT                   /product="PTS system, glucitol/sorbitol-specific, IIA
FT                   component"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P05706; match to
FT                   protein family HMM PF03829"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03353"
FT                   /protein_id="AAT03353.1"
FT                   FPTITVGDSIQF"
FT   gene            complement(588101..589087)
FT                   /gene="srlE"
FT                   /locus_tag="LMOf2365_0572"
FT   CDS_pept        complement(588101..589087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srlE"
FT                   /locus_tag="LMOf2365_0572"
FT                   /product="PTS system, glucitol/sorbitol-specific, IIBC
FT                   component"
FT                   /EC_number=""
FT                   /note="identified by similarity to GP:4928286; match to
FT                   protein family HMM PF03612; match to protein family HMM
FT                   PF07663"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03354"
FT                   /protein_id="AAT03354.1"
FT   gene            complement(589108..589629)
FT                   /gene="srlA"
FT                   /locus_tag="LMOf2365_0573"
FT   CDS_pept        complement(589108..589629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srlA"
FT                   /locus_tag="LMOf2365_0573"
FT                   /product="PTS system, glucitol/sorbitol-specific, IIC
FT                   component"
FT                   /note="identified by similarity to SP:P56579; match to
FT                   protein family HMM PF03608; match to protein family HMM
FT                   TIGR00821"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03355"
FT                   /protein_id="AAT03355.1"
FT                   TKFLMRKEKV"
FT   gene            complement(589654..590034)
FT                   /locus_tag="LMOf2365_0574"
FT   CDS_pept        complement(589654..590034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0574"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0545"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03356"
FT                   /protein_id="AAT03356.1"
FT   gene            complement(590089..591339)
FT                   /locus_tag="LMOf2365_0575"
FT   CDS_pept        complement(590089..591339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0575"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0546"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03357"
FT                   /protein_id="AAT03357.1"
FT                   STTVWKLRKLQDETFNK"
FT   gene            complement(591597..592544)
FT                   /locus_tag="LMOf2365_0576"
FT   CDS_pept        complement(591597..592544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0576"
FT                   /product="putative DNA-binding transcriptional regulator"
FT                   /note="identified by similarity to SP:P39140; match to
FT                   protein family HMM PF04198"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03358"
FT                   /protein_id="AAT03358.1"
FT   gene            592912..593577
FT                   /locus_tag="LMOf2365_0577"
FT   CDS_pept        592912..593577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0577"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:16412992"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03359"
FT                   /protein_id="AAT03359.1"
FT   gene            593595..595628
FT                   /locus_tag="LMOf2365_0578"
FT   CDS_pept        593595..595628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0578"
FT                   /product="leucine rich repeat domain protein"
FT                   /note="identified by match to protein family HMM PF00560"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03360"
FT                   /protein_id="AAT03360.1"
FT   gene            595668..595964
FT                   /locus_tag="LMOf2365_0579"
FT   CDS_pept        595668..595964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0579"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03361"
FT                   /protein_id="AAT03361.1"
FT   gene            596008..596850
FT                   /locus_tag="LMOf2365_0580"
FT   CDS_pept        596008..596850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0580"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0551"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03362"
FT                   /protein_id="AAT03362.1"
FT   gene            596926..597957
FT                   /locus_tag="LMOf2365_0581"
FT   CDS_pept        596926..597957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0581"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06030"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03363"
FT                   /protein_id="AAT03363.1"
FT                   NEK"
FT   gene            complement(598014..598649)
FT                   /locus_tag="LMOf2365_0582"
FT   CDS_pept        complement(598014..598649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0582"
FT                   /product="CBS domain protein"
FT                   /note="identified by match to protein family HMM PF00571"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03364"
FT                   /protein_id="AAT03364.1"
FT   gene            598871..600040
FT                   /locus_tag="LMOf2365_0583"
FT   CDS_pept        598871..600040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0583"
FT                   /product="alcohol dehydrogenase, iron-dependent"
FT                   /note="identified by match to protein family HMM PF00465"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03365"
FT                   /protein_id="AAT03365.1"
FT   gene            600130..601608
FT                   /locus_tag="LMOf2365_0584"
FT   CDS_pept        600130..601608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0584"
FT                   /product="proton-dependent oligopeptide transporter"
FT                   /note="identified by similarity to SP:P36574; match to
FT                   protein family HMM PF00854; match to protein family HMM
FT                   PF07690; match to protein family HMM TIGR00924"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03366"
FT                   /protein_id="AAT03366.1"
FT   gene            601737..602444
FT                   /locus_tag="LMOf2365_0585"
FT   CDS_pept        601737..602444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0585"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03367"
FT                   /protein_id="AAT03367.1"
FT                   FYVEAGKKAQGGV"
FT   gene            602445..603140
FT                   /locus_tag="LMOf2365_0586"
FT   CDS_pept        602445..603140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0586"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0586"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03368"
FT                   /protein_id="AAT03368.1"
FT                   IEAGKLVLV"
FT   gene            complement(603182..604222)
FT                   /locus_tag="LMOf2365_0587"
FT   CDS_pept        complement(603182..604222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0587"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0563"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03369"
FT                   /protein_id="AAT03369.1"
FT                   CIKFVK"
FT   gene            604622..605527
FT                   /locus_tag="LMOf2365_0588"
FT   CDS_pept        604622..605527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0588"
FT                   /product="magnesium transporter, CorA family"
FT                   /note="identified by match to protein family HMM PF01544"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0588"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03370"
FT                   /protein_id="AAT03370.1"
FT   gene            complement(605570..606946)
FT                   /gene="gdhA"
FT                   /locus_tag="LMOf2365_0589"
FT   CDS_pept        complement(605570..606946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gdhA"
FT                   /locus_tag="LMOf2365_0589"
FT                   /product="glutamate dehydrogenase, NADP-specific"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P00370; match to
FT                   protein family HMM PF00208; match to protein family HMM
FT                   PF02812"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03371"
FT                   /protein_id="AAT03371.1"
FT                   "
FT   gene            complement(607439..607750)
FT                   /gene="hisE"
FT                   /locus_tag="LMOf2365_0590"
FT   CDS_pept        complement(607439..607750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisE"
FT                   /locus_tag="LMOf2365_0590"
FT                   /product="phosphoribosyl-ATP pyrophosphohydrolase"
FT                   /note="identified by match to protein family HMM PF01503"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0590"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03372"
FT                   /db_xref="GOA:Q722Y9"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q722Y9"
FT                   /protein_id="AAT03372.1"
FT   gene            complement(607751..608068)
FT                   /gene="hisI"
FT                   /locus_tag="LMOf2365_0591"
FT   CDS_pept        complement(607751..608068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisI"
FT                   /locus_tag="LMOf2365_0591"
FT                   /product="phosphoribosyl-AMP cyclohydrolase"
FT                   /note="identified by similarity to SP:Q92E90; match to
FT                   protein family HMM PF01502"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0591"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03373"
FT                   /db_xref="GOA:Q722Y8"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q722Y8"
FT                   /protein_id="AAT03373.1"
FT                   F"
FT   gene            complement(608065..608820)
FT                   /gene="hisF"
FT                   /locus_tag="LMOf2365_0592"
FT   CDS_pept        complement(608065..608820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="LMOf2365_0592"
FT                   /product="imidazoleglycerol phosphate synthase, cyclase
FT                   subunit"
FT                   /EC_number="4.1.3.-"
FT                   /note="identified by similarity to SP:O34727; match to
FT                   protein family HMM PF00977; match to protein family HMM
FT                   TIGR00735"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03374"
FT                   /db_xref="GOA:Q722Y7"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q722Y7"
FT                   /protein_id="AAT03374.1"
FT   gene            complement(608810..609532)
FT                   /gene="hisA"
FT                   /locus_tag="LMOf2365_0593"
FT   CDS_pept        complement(608810..609532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /locus_tag="LMOf2365_0593"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:O35006; match to
FT                   protein family HMM PF00977; match to protein family HMM
FT                   TIGR00007"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03375"
FT                   /db_xref="GOA:Q722Y6"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q722Y6"
FT                   /protein_id="AAT03375.1"
FT                   YNHDISMSDIVEVEQIAY"
FT   gene            complement(609511..610137)
FT                   /gene="hisH"
FT                   /locus_tag="LMOf2365_0594"
FT   CDS_pept        complement(609511..610137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="LMOf2365_0594"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /EC_number="2.4.2.-"
FT                   /note="identified by similarity to SP:O34565; match to
FT                   protein family HMM PF00117; match to protein family HMM
FT                   PF07685; match to protein family HMM TIGR01855"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03376"
FT                   /db_xref="GOA:Q722Y5"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q722Y5"
FT                   /protein_id="AAT03376.1"
FT   gene            complement(610138..610722)
FT                   /gene="hisB"
FT                   /locus_tag="LMOf2365_0595"
FT   CDS_pept        complement(610138..610722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /locus_tag="LMOf2365_0595"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:O34683; match to
FT                   protein family HMM PF00475"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0595"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03377"
FT                   /db_xref="GOA:Q722Y4"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q722Y4"
FT                   /protein_id="AAT03377.1"
FT   gene            complement(610723..612006)
FT                   /gene="hisD"
FT                   /locus_tag="LMOf2365_0596"
FT   CDS_pept        complement(610723..612006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisD"
FT                   /locus_tag="LMOf2365_0596"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:O34651; match to
FT                   protein family HMM PF00815; match to protein family HMM
FT                   TIGR00069"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03378"
FT                   /db_xref="GOA:Q722Y3"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q722Y3"
FT                   /protein_id="AAT03378.1"
FT   gene            complement(612003..612644)
FT                   /gene="hisG"
FT                   /locus_tag="LMOf2365_0597"
FT   CDS_pept        complement(612003..612644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisG"
FT                   /locus_tag="LMOf2365_0597"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:O34520; match to
FT                   protein family HMM PF01634; match to protein family HMM
FT                   TIGR00070"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0597"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03379"
FT                   /db_xref="GOA:Q722Y2"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q722Y2"
FT                   /protein_id="AAT03379.1"
FT   gene            complement(612644..613822)
FT                   /locus_tag="LMOf2365_0598"
FT   CDS_pept        complement(612644..613822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0598"
FT                   /product="putative ATP phosphoribosyltransferase regulatory
FT                   subunit"
FT                   /note="identified by similarity to SP:O34459; match to
FT                   protein family HMM PF00587"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03380"
FT                   /db_xref="GOA:Q722Y1"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q722Y1"
FT                   /protein_id="AAT03380.1"
FT   gene            613974..614801
FT                   /gene="hisK"
FT                   /locus_tag="LMOf2365_0599"
FT   CDS_pept        613974..614801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisK"
FT                   /locus_tag="LMOf2365_0599"
FT                   /product="histidinol-phosphatase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:O34411; match to
FT                   protein family HMM TIGR01856"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03381"
FT                   /protein_id="AAT03381.1"
FT   gene            complement(614786..615082)
FT                   /gene="ogt-1"
FT                   /locus_tag="LMOf2365_0600"
FT   CDS_pept        complement(614786..615082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ogt-1"
FT                   /locus_tag="LMOf2365_0600"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P37429; match to
FT                   protein family HMM PF01035; match to protein family HMM
FT                   TIGR00589"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03382"
FT                   /protein_id="AAT03382.1"
FT   gene            615159..616190
FT                   /locus_tag="LMOf2365_0601"
FT   CDS_pept        615159..616190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0601"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0577"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03383"
FT                   /protein_id="AAT03383.1"
FT                   YYD"
FT   gene            complement(616233..617528)
FT                   /locus_tag="LMOf2365_0602"
FT   CDS_pept        complement(616233..617528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0602"
FT                   /product="xanthine/uracil permease family protein"
FT                   /note="identified by match to protein family HMM PF00860"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0602"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03384"
FT                   /protein_id="AAT03384.1"
FT   gene            617844..619238
FT                   /locus_tag="LMOf2365_0603"
FT   CDS_pept        617844..619238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0603"
FT                   /product="glycosyl hydrolase, family 1"
FT                   /note="identified by match to protein family HMM PF00232"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0603"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03385"
FT                   /protein_id="AAT03385.1"
FT                   NNGFED"
FT   gene            619282..620010
FT                   /locus_tag="LMOf2365_0604"
FT   CDS_pept        619282..620010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0604"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07702"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03386"
FT                   /protein_id="AAT03386.1"
FT   gene            620459..621922
FT                   /locus_tag="LMOf2365_0605"
FT   CDS_pept        620459..621922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0605"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0581; match
FT                   to protein family HMM PF06458"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0605"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03387"
FT                   /protein_id="AAT03387.1"
FT   gene            complement(621977..622435)
FT                   /locus_tag="LMOf2365_0606"
FT   CDS_pept        complement(621977..622435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0606"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to OMNI:SA0807"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03388"
FT                   /protein_id="AAT03388.1"
FT   gene            complement(622449..623201)
FT                   /locus_tag="LMOf2365_0607"
FT   CDS_pept        complement(622449..623201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0607"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0583; match
FT                   to protein family HMM PF06738"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0607"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03389"
FT                   /protein_id="AAT03389.1"
FT   gene            623330..623575
FT                   /locus_tag="LMOf2365_0608"
FT   CDS_pept        623330..623575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0608"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:16413028"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03390"
FT                   /protein_id="AAT03390.1"
FT   gene            623591..624253
FT                   /locus_tag="LMOf2365_0609"
FT   CDS_pept        623591..624253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0609"
FT                   /product="phospholipase/carboxylesterase family protein"
FT                   /note="identified by match to protein family HMM PF02230"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0609"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03391"
FT                   /protein_id="AAT03391.1"
FT   gene            complement(624284..625468)
FT                   /locus_tag="LMOf2365_0610"
FT   CDS_pept        complement(624284..625468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0610"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0586"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0610"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03392"
FT                   /protein_id="AAT03392.1"
FT   gene            complement(625556..626989)
FT                   /gene="iap"
FT                   /locus_tag="LMOf2365_0611"
FT   CDS_pept        complement(625556..626989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iap"
FT                   /locus_tag="LMOf2365_0611"
FT                   /product="protein P60"
FT                   /note="identified by similarity to SP:P21171; match to
FT                   protein family HMM PF00877; match to protein family HMM
FT                   PF01476"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0611"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03393"
FT                   /protein_id="AAT03393.1"
FT   gene            627408..629738
FT                   /locus_tag="LMOf2365_0612"
FT   CDS_pept        627408..629738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0612"
FT                   /product="putative preprotein translocase, SecA subunit"
FT                   /note="identified by match to protein family HMM PF00271;
FT                   match to protein family HMM PF01043; match to protein
FT                   family HMM PF07516; match to protein family HMM PF07517"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0612"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03394"
FT                   /db_xref="GOA:Q722W7"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q722W7"
FT                   /protein_id="AAT03394.1"
FT   gene            629854..631026
FT                   /locus_tag="LMOf2365_0613"
FT   CDS_pept        629854..631026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0613"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF01594"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0613"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03395"
FT                   /protein_id="AAT03395.1"
FT   gene            631284..631997
FT                   /locus_tag="LMOf2365_0614"
FT   CDS_pept        631284..631997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0614"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0590"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0614"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03396"
FT                   /protein_id="AAT03396.1"
FT                   HEATITWTLSDAPGV"
FT   gene            632065..633090
FT                   /locus_tag="LMOf2365_0615"
FT   CDS_pept        632065..633090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0615"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:16413035; match to
FT                   protein family HMM PF06030"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03397"
FT                   /protein_id="AAT03397.1"
FT                   K"
FT   gene            633108..635573
FT                   /locus_tag="LMOf2365_0616"
FT   CDS_pept        633108..635573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0616"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:16413036"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0616"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03398"
FT                   /protein_id="AAT03398.1"
FT                   IEWTLTDAP"
FT   gene            635685..637088
FT                   /gene="phrB"
FT                   /locus_tag="LMOf2365_0617"
FT   CDS_pept        635685..637088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phrB"
FT                   /locus_tag="LMOf2365_0617"
FT                   /product="deoxyribodipyrimidine photolyase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P25078; match to
FT                   protein family HMM PF00875; match to protein family HMM
FT                   PF03441"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0617"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03399"
FT                   /protein_id="AAT03399.1"
FT                   SKEHSRGNI"
FT   gene            637226..637639
FT                   /locus_tag="LMOf2365_0618"
FT   CDS_pept        637226..637639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0618"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0594"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0618"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03400"
FT                   /protein_id="AAT03400.1"
FT   gene            637639..639408
FT                   /locus_tag="LMOf2365_0619"
FT   CDS_pept        637639..639408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0619"
FT                   /product="DAK2 domain protein"
FT                   /note="identified by similarity to GP:16413039; match to
FT                   protein family HMM PF02645; match to protein family HMM
FT                   PF02734"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0619"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03401"
FT                   /protein_id="AAT03401.1"
FT                   SVAVAGIKKEETI"
FT   gene            639405..640178
FT                   /locus_tag="LMOf2365_0620"
FT   CDS_pept        639405..640178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0620"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF06966"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0620"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03402"
FT                   /protein_id="AAT03402.1"
FT   gene            640306..640848
FT                   /locus_tag="LMOf2365_0621"
FT   CDS_pept        640306..640848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0621"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0597"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0621"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03403"
FT                   /protein_id="AAT03403.1"
FT                   ETEGKAKDSAKKHWFSK"
FT   gene            641099..641875
FT                   /locus_tag="LMOf2365_0622"
FT   CDS_pept        641099..641875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0622"
FT                   /product="formate/nitrite transporter family protein"
FT                   /note="identified by similarity to SP:P11097; match to
FT                   protein family HMM PF01226"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0622"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03404"
FT                   /protein_id="AAT03404.1"
FT   gene            complement(641913..643019)
FT                   /gene="metX"
FT                   /locus_tag="LMOf2365_0623"
FT   CDS_pept        complement(641913..643019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metX"
FT                   /locus_tag="LMOf2365_0623"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P45131; match to
FT                   protein family HMM PF00561; match to protein family HMM
FT                   TIGR01392"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0623"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03405"
FT                   /db_xref="GOA:Q722V6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q722V6"
FT                   /protein_id="AAT03405.1"
FT   gene            complement(643036..644313)
FT                   /locus_tag="LMOf2365_0624"
FT   CDS_pept        complement(643036..644313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0624"
FT                   /product="O-acetylhomoserine (thiol)-lyase"
FT                   /EC_number=""
FT                   /note="identified by similarity to GP:15777939; match to
FT                   protein family HMM PF01053; match to protein family HMM
FT                   TIGR01326"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0624"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03406"
FT                   /protein_id="AAT03406.1"
FT   gene            644760..645287
FT                   /locus_tag="LMOf2365_0625"
FT   CDS_pept        644760..645287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0625"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0625"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03407"
FT                   /protein_id="AAT03407.1"
FT                   AIATFFFIGKNS"
FT   gene            complement(645376..646077)
FT                   /locus_tag="LMOf2365_0626"
FT   CDS_pept        complement(645376..646077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0626"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="identified by match to protein family HMM PF00027"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0626"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03408"
FT                   /protein_id="AAT03408.1"
FT                   QKLKENHEPYI"
FT   gene            complement(646153..646701)
FT                   /locus_tag="LMOf2365_0627"
FT   CDS_pept        complement(646153..646701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0627"
FT                   /product="BioY family protein"
FT                   /note="identified by match to protein family HMM PF02632"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0627"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03409"
FT                   /protein_id="AAT03409.1"
FT   gene            646895..647227
FT                   /locus_tag="LMOf2365_0628"
FT   CDS_pept        646895..647227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0628"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="identified by match to protein family HMM PF03551"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0628"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03410"
FT                   /protein_id="AAT03410.1"
FT                   GDAVNE"
FT   gene            647220..647810
FT                   /locus_tag="LMOf2365_0629"
FT   CDS_pept        647220..647810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0629"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0605; match
FT                   to protein family HMM PF08006"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0629"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03411"
FT                   /protein_id="AAT03411.1"
FT   gene            647803..648903
FT                   /locus_tag="LMOf2365_0630"
FT   CDS_pept        647803..648903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0630"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03412"
FT                   /protein_id="AAT03412.1"
FT   gene            649009..649509
FT                   /locus_tag="LMOf2365_0631"
FT   CDS_pept        649009..649509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0631"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by similarity to OMNI:NTL01LI0607; match
FT                   to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0631"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03413"
FT                   /protein_id="AAT03413.1"
FT                   EEE"
FT   gene            complement(649557..649943)
FT                   /locus_tag="LMOf2365_0632"
FT   CDS_pept        complement(649557..649943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0632"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0608"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0632"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03414"
FT                   /protein_id="AAT03414.1"
FT   gene            complement(649997..650341)
FT                   /locus_tag="LMOf2365_0633"
FT   CDS_pept        complement(649997..650341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0633"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0609"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0633"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03415"
FT                   /protein_id="AAT03415.1"
FT                   KHSDDNWARC"
FT   gene            complement(650490..651830)
FT                   /locus_tag="LMOf2365_0634"
FT   CDS_pept        complement(650490..651830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0634"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF01554;
FT                   match to protein family HMM TIGR00797"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0634"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03416"
FT                   /protein_id="AAT03416.1"
FT   gene            651996..652457
FT                   /locus_tag="LMOf2365_0635"
FT   CDS_pept        651996..652457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0635"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0635"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03417"
FT                   /protein_id="AAT03417.1"
FT   gene            652465..654189
FT                   /locus_tag="LMOf2365_0636"
FT   CDS_pept        652465..654189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0636"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0636"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03418"
FT                   /protein_id="AAT03418.1"
FT   gene            654186..656003
FT                   /locus_tag="LMOf2365_0637"
FT   CDS_pept        654186..656003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0637"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0637"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03419"
FT                   /protein_id="AAT03419.1"
FT   gene            656120..656419
FT                   /locus_tag="LMOf2365_0638"
FT   CDS_pept        656120..656419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0638"
FT                   /product="rhodanese-like domain protein"
FT                   /note="identified by match to protein family HMM PF00581"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0638"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03420"
FT                   /protein_id="AAT03420.1"
FT   gene            complement(656462..658231)
FT                   /locus_tag="LMOf2365_0639"
FT   CDS_pept        complement(656462..658231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0639"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="identified by match to protein family HMM PF00560;
FT                   match to protein family HMM PF00746; match to protein
FT                   family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0639"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03421"
FT                   /protein_id="AAT03421.1"
FT                   GVAILFFRQRKHS"
FT   gene            complement(658392..659018)
FT                   /locus_tag="LMOf2365_0640"
FT   CDS_pept        complement(658392..659018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0640"
FT                   /product="flavodoxin-like fold domain protein"
FT                   /note="identified by match to protein family HMM PF02525"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0640"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03422"
FT                   /db_xref="GOA:Q722T9"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q722T9"
FT                   /protein_id="AAT03422.1"
FT   gene            659187..659636
FT                   /locus_tag="LMOf2365_0641"
FT   CDS_pept        659187..659636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0641"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0641"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03423"
FT                   /protein_id="AAT03423.1"
FT   gene            659639..660580
FT                   /locus_tag="LMOf2365_0642"
FT   CDS_pept        659639..660580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0642"
FT                   /product="alcohol dehydrogenase, zinc-dependent"
FT                   /note="identified by match to protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0642"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03424"
FT                   /protein_id="AAT03424.1"
FT   gene            660675..661208
FT                   /locus_tag="LMOf2365_0643"
FT   CDS_pept        660675..661208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0643"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by similarity to OMNI:EF0951; match to
FT                   protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0643"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03425"
FT                   /protein_id="AAT03425.1"
FT                   DSRYLDVTMMYLVI"
FT   gene            complement(661205..661447)
FT                   /locus_tag="LMOf2365_0644"
FT   CDS_pept        complement(661205..661447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0644"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0620"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0644"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03426"
FT                   /protein_id="AAT03426.1"
FT   gene            661554..663305
FT                   /locus_tag="LMOf2365_0645"
FT   CDS_pept        661554..663305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0645"
FT                   /product="glycerophosphoryl diester phosphodiesterase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF03009"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0645"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03427"
FT                   /protein_id="AAT03427.1"
FT                   IENRLGF"
FT   gene            complement(663344..663838)
FT                   /locus_tag="LMOf2365_0646"
FT   CDS_pept        complement(663344..663838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0646"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0646"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03428"
FT                   /protein_id="AAT03428.1"
FT                   K"
FT   gene            complement(663918..665060)
FT                   /locus_tag="LMOf2365_0647"
FT   CDS_pept        complement(663918..665060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0647"
FT                   /product="protein kinase domain protein"
FT                   /note="identified by match to protein family HMM PF00069"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0647"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03429"
FT                   /protein_id="AAT03429.1"
FT   gene            665167..665622
FT                   /locus_tag="LMOf2365_0648"
FT   CDS_pept        665167..665622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0648"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0624"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0648"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03430"
FT                   /protein_id="AAT03430.1"
FT   gene            665678..666070
FT                   /locus_tag="LMOf2365_0649"
FT   CDS_pept        665678..666070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0649"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0625"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0649"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03431"
FT                   /protein_id="AAT03431.1"
FT   gene            666167..666907
FT                   /locus_tag="LMOf2365_0650"
FT   CDS_pept        666167..666907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0650"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0626; match
FT                   to protein family HMM PF01925"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0650"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03432"
FT                   /protein_id="AAT03432.1"
FT   gene            666993..667271
FT                   /locus_tag="LMOf2365_0651"
FT   CDS_pept        666993..667271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0651"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0627"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0651"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03433"
FT                   /protein_id="AAT03433.1"
FT   gene            667288..667566
FT                   /locus_tag="LMOf2365_0652"
FT   CDS_pept        667288..667566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0652"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0628"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0652"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03434"
FT                   /protein_id="AAT03434.1"
FT   gene            complement(667594..668037)
FT                   /locus_tag="LMOf2365_0653"
FT   CDS_pept        complement(667594..668037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0653"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0653"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03435"
FT                   /protein_id="AAT03435.1"
FT   gene            complement(668068..668769)
FT                   /locus_tag="LMOf2365_0654"
FT   CDS_pept        complement(668068..668769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0654"
FT                   /product="putative lipase/acylhydrolase"
FT                   /note="identified by match to protein family HMM PF00657"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0654"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03436"
FT                   /protein_id="AAT03436.1"
FT                   KFIQYASFHKA"
FT   gene            complement(668854..670533)
FT                   /locus_tag="LMOf2365_0655"
FT   CDS_pept        complement(668854..670533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0655"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0655"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03437"
FT                   /protein_id="AAT03437.1"
FT   gene            670836..675596
FT                   /locus_tag="LMOf2365_0656"
FT   CDS_pept        670836..675596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0656"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM PF05738;
FT                   match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0656"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03438"
FT                   /protein_id="AAT03438.1"
FT                   LRRKSTK"
FT   gene            675693..675968
FT                   /locus_tag="LMOf2365_0657"
FT   CDS_pept        675693..675968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0657"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0633"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0657"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03439"
FT                   /protein_id="AAT03439.1"
FT   gene            676011..676538
FT                   /locus_tag="LMOf2365_0658"
FT   CDS_pept        676011..676538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0658"
FT                   /product="hydrolase, isochorismatase family"
FT                   /note="identified by match to protein family HMM PF00857"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0658"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03440"
FT                   /protein_id="AAT03440.1"
FT                   SMEETINEMEHN"
FT   gene            676899..678929
FT                   /locus_tag="LMOf2365_0659"
FT   CDS_pept        676899..678929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0659"
FT                   /product="PTS system IIA 2 domain protein"
FT                   /note="identified by match to protein family HMM PF00359;
FT                   match to protein family HMM PF00874"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0659"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03441"
FT                   /protein_id="AAT03441.1"
FT   gene            678931..679383
FT                   /locus_tag="LMOf2365_0660"
FT   CDS_pept        678931..679383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0660"
FT                   /product="putative PTS system, fructose-specific, IIA
FT                   component"
FT                   /note="identified by similarity to SP:P32155; match to
FT                   protein family HMM PF00359; match to protein family HMM
FT                   TIGR00848"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0660"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03442"
FT                   /protein_id="AAT03442.1"
FT   gene            679384..680445
FT                   /locus_tag="LMOf2365_0661"
FT   CDS_pept        679384..680445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0661"
FT                   /product="putative PTS system, fructose-specific, IIC
FT                   component"
FT                   /note="identified by similarity to SP:P32672; match to
FT                   protein family HMM PF02378; match to protein family HMM
FT                   TIGR01427"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0661"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03443"
FT                   /protein_id="AAT03443.1"
FT                   QDIDDLDINFEDI"
FT   gene            680460..680768
FT                   /locus_tag="LMOf2365_0662"
FT   CDS_pept        680460..680768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0662"
FT                   /product="putative PTS system, fructose-specific, IIB
FT                   component"
FT                   /note="identified by similarity to SP:P32673; match to
FT                   protein family HMM PF02379; match to protein family HMM
FT                   TIGR00829"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0662"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03444"
FT                   /protein_id="AAT03444.1"
FT   gene            680795..682063
FT                   /locus_tag="LMOf2365_0663"
FT   CDS_pept        680795..682063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0663"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:15978906"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0663"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03445"
FT                   /protein_id="AAT03445.1"
FT   gene            682153..682857
FT                   /locus_tag="LMOf2365_0664"
FT   CDS_pept        682153..682857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0664"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01549"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0664"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03446"
FT                   /protein_id="AAT03446.1"
FT                   EQQLFAILQEIF"
FT   gene            682962..683378
FT                   /locus_tag="LMOf2365_0665"
FT   CDS_pept        682962..683378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0665"
FT                   /product="Rrf2 family protein"
FT                   /note="identified by similarity to OMNI:NTL01BH0657; match
FT                   to protein family HMM PF02082; match to protein family HMM
FT                   TIGR00738"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0665"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03447"
FT                   /protein_id="AAT03447.1"
FT   gene            683391..683984
FT                   /locus_tag="LMOf2365_0666"
FT   CDS_pept        683391..683984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0666"
FT                   /product="methyltransferase, UbiE/COQ5 family"
FT                   /note="identified by match to protein family HMM PF01209"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0666"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03448"
FT                   /protein_id="AAT03448.1"
FT   gene            complement(684053..684142)
FT                   /locus_tag="LMOf2365_2872"
FT   tRNA            complement(684053..684142)
FT                   /locus_tag="LMOf2365_2872"
FT                   /product="tRNA-Ser"
FT   gene            684684..685355
FT                   /locus_tag="LMOf2365_0667"
FT   CDS_pept        684684..685355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0667"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:SP2182"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0667"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03449"
FT                   /protein_id="AAT03449.1"
FT                   G"
FT   gene            685385..685570
FT                   /locus_tag="LMOf2365_0668"
FT   CDS_pept        685385..685570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0668"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0668"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03450"
FT                   /protein_id="AAT03450.1"
FT                   FQTLRYRNAKKSIKAK"
FT   gene            685685..685928
FT                   /pseudo
FT                   /locus_tag="LMOf2365_0669"
FT                   /note="bacteriophage PSA Gp22 protein, degenerate; this
FT                   region contains one or more premature stops and/or
FT                   frameshifts which are not the result of sequencing error;
FT                   identified by similarity to GP:17402432"
FT   gene            686111..686644
FT                   /locus_tag="LMOf2365_0670"
FT   CDS_pept        686111..686644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0670"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by similarity to GP:425488"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0670"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03451"
FT                   /protein_id="AAT03451.1"
FT                   VEDTDKGINFYSEG"
FT   gene            686708..687625
FT                   /locus_tag="LMOf2365_0671"
FT   CDS_pept        686708..687625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0671"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0671"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03452"
FT                   /protein_id="AAT03452.1"
FT   gene            687891..689771
FT                   /gene="cadA"
FT                   /locus_tag="LMOf2365_0672"
FT   CDS_pept        687891..689771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cadA"
FT                   /locus_tag="LMOf2365_0672"
FT                   /product="cadmium-translocating P-type ATPase"
FT                   /EC_number="3.6.3.-"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00702; match to protein
FT                   family HMM TIGR01494; match to protein family HMM
FT                   TIGR01512; match to protein family HMM TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0672"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03453"
FT                   /protein_id="AAT03453.1"
FT   gene            689866..690594
FT                   /locus_tag="LMOf2365_0673"
FT   CDS_pept        689866..690594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0673"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0673"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03454"
FT                   /protein_id="AAT03454.1"
FT   gene            690734..691384
FT                   /locus_tag="LMOf2365_0674"
FT   CDS_pept        690734..691384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0674"
FT                   /product="putative transaldolase"
FT                   /note="identified by match to protein family HMM PF00923"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0674"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03455"
FT                   /protein_id="AAT03455.1"
FT   gene            complement(691427..693268)
FT                   /locus_tag="LMOf2365_0675"
FT   CDS_pept        complement(691427..693268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0675"
FT                   /product="sulfatase family protein"
FT                   /note="identified by match to protein family HMM PF00884"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0675"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03456"
FT                   /protein_id="AAT03456.1"
FT   gene            693482..694873
FT                   /locus_tag="LMOf2365_0676"
FT   CDS_pept        693482..694873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0676"
FT                   /product="amino acid permease family protein"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0676"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03457"
FT                   /protein_id="AAT03457.1"
FT                   ELLKK"
FT   gene            694963..695802
FT                   /locus_tag="LMOf2365_0677"
FT   CDS_pept        694963..695802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0677"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by similarity to OMNI:EF0656; match to
FT                   protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0677"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03458"
FT                   /protein_id="AAT03458.1"
FT   gene            complement(695885..696169)
FT                   /locus_tag="LMOf2365_0678"
FT   CDS_pept        complement(695885..696169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0678"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0646"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0678"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03459"
FT                   /protein_id="AAT03459.1"
FT   gene            696267..697217
FT                   /locus_tag="LMOf2365_0679"
FT   CDS_pept        696267..697217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0679"
FT                   /product="magnesium transporter, CorA family"
FT                   /note="identified by match to protein family HMM PF01544"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0679"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03460"
FT                   /protein_id="AAT03460.1"
FT   gene            697241..697882
FT                   /locus_tag="LMOf2365_0680"
FT   CDS_pept        697241..697882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0680"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0680"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03461"
FT                   /protein_id="AAT03461.1"
FT   gene            697925..700615
FT                   /locus_tag="LMOf2365_0681"
FT   CDS_pept        697925..700615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0681"
FT                   /product="phage infection protein"
FT                   /note="identified by similarity to SP:P49022"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0681"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03462"
FT                   /protein_id="AAT03462.1"
FT   gene            700661..701308
FT                   /locus_tag="LMOf2365_0682"
FT   CDS_pept        700661..701308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0682"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0682"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03463"
FT                   /protein_id="AAT03463.1"
FT   gene            complement(701318..701854)
FT                   /locus_tag="LMOf2365_0683"
FT   CDS_pept        complement(701318..701854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0683"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by similarity to OMNI:PG1761; match to
FT                   protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0683"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03464"
FT                   /protein_id="AAT03464.1"
FT                   KKNGFYLYQKELSQK"
FT   gene            complement(701841..702827)
FT                   /locus_tag="LMOf2365_0684"
FT   CDS_pept        complement(701841..702827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0684"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0652; match
FT                   to protein family HMM PF06161"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0684"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03465"
FT                   /protein_id="AAT03465.1"
FT   gene            702982..703224
FT                   /locus_tag="LMOf2365_0685"
FT   CDS_pept        702982..703224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0685"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0653"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0685"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03466"
FT                   /protein_id="AAT03466.1"
FT   gene            703292..703999
FT                   /locus_tag="LMOf2365_0686"
FT   CDS_pept        703292..703999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0686"
FT                   /product="serine/threonine protein phosphatase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0686"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03467"
FT                   /protein_id="AAT03467.1"
FT                   EEKVITKSFSVKK"
FT   gene            704427..706565
FT                   /locus_tag="LMOf2365_0687"
FT   CDS_pept        704427..706565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0687"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01HP01062"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0687"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03468"
FT                   /protein_id="AAT03468.1"
FT                   SNLFEENGFEDHFKNYWK"
FT   gene            complement(706695..707258)
FT                   /locus_tag="LMOf2365_0688"
FT   CDS_pept        complement(706695..707258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0688"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF04238"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0688"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03469"
FT                   /protein_id="AAT03469.1"
FT   gene            707378..707794
FT                   /locus_tag="LMOf2365_0689"
FT   CDS_pept        707378..707794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0689"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0656"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0689"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03470"
FT                   /protein_id="AAT03470.1"
FT   gene            707837..708466
FT                   /locus_tag="LMOf2365_0690"
FT   CDS_pept        707837..708466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0690"
FT                   /product="endonuclease III domain protein"
FT                   /note="identified by match to protein family HMM PF00633;
FT                   match to protein family HMM PF00730"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0690"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03471"
FT                   /protein_id="AAT03471.1"
FT   gene            complement(708463..709359)
FT                   /locus_tag="LMOf2365_0691"
FT   CDS_pept        complement(708463..709359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0691"
FT                   /product="putative transcriptional activator"
FT                   /note="identified by match to protein family HMM PF01381;
FT                   match to protein family HMM TIGR01716"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0691"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03472"
FT                   /protein_id="AAT03472.1"
FT                   ILLDQFIRIKGIDIVKS"
FT   gene            709593..709874
FT                   /locus_tag="LMOf2365_0692"
FT   CDS_pept        709593..709874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0692"
FT                   /product="putative transposase OrfA, IS3 family"
FT                   /note="This gene is marked putative because transposase
FT                   OrfB appears to be missing.; identified by similarity to
FT                   OMNI:NTL01LL0091; match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0692"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03473"
FT                   /protein_id="AAT03473.1"
FT   gene            710152..712626
FT                   /locus_tag="LMOf2365_0693"
FT   CDS_pept        710152..712626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0693"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0693"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03474"
FT                   /protein_id="AAT03474.1"
FT                   FCLGAWYLLRRK"
FT   gene            712807..713478
FT                   /locus_tag="LMOf2365_0693.1"
FT   CDS_pept        712807..713478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0693.1"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to PIR:AB1110"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0693.1"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03475"
FT                   /protein_id="AAT03475.1"
FT                   L"
FT   gene            713667..715283
FT                   /locus_tag="LMOf2365_0694"
FT   CDS_pept        713667..715283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0694"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM PF06458; match to protein
FT                   family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0694"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03476"
FT                   /protein_id="AAT03476.1"
FT   gene            complement(715369..715677)
FT                   /locus_tag="LMOf2365_0695"
FT   CDS_pept        complement(715369..715677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0695"
FT                   /product="carboxymuconolactone decarboxylase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02627"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0695"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03477"
FT                   /protein_id="AAT03477.1"
FT   gene            complement(715740..716555)
FT                   /gene="thiD-2"
FT                   /locus_tag="LMOf2365_0696"
FT   CDS_pept        complement(715740..716555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD-2"
FT                   /locus_tag="LMOf2365_0696"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM TIGR00097"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0696"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03478"
FT                   /protein_id="AAT03478.1"
FT   gene            complement(716581..717447)
FT                   /locus_tag="LMOf2365_0697"
FT   CDS_pept        complement(716581..717447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0697"
FT                   /product="Cof-like hydrolase"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR00099; match to protein
FT                   family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0697"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03479"
FT                   /protein_id="AAT03479.1"
FT                   KMLETND"
FT   gene            717621..718184
FT                   /locus_tag="LMOf2365_0698"
FT   CDS_pept        717621..718184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0698"
FT                   /product="acetyltransferase, CysE/LacA/LpxA/NodL family"
FT                   /note="identified by similarity to OMNI:SP0074; match to
FT                   protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0698"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03480"
FT                   /protein_id="AAT03480.1"
FT   gene            718181..718444
FT                   /locus_tag="LMOf2365_0699"
FT   CDS_pept        718181..718444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0699"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0666"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0699"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03481"
FT                   /protein_id="AAT03481.1"
FT   gene            718454..718831
FT                   /locus_tag="LMOf2365_0700"
FT   CDS_pept        718454..718831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0700"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF04241"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0700"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03482"
FT                   /protein_id="AAT03482.1"
FT   gene            718945..719880
FT                   /locus_tag="LMOf2365_0701"
FT   CDS_pept        718945..719880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0701"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0701"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03483"
FT                   /protein_id="AAT03483.1"
FT   gene            719873..720643
FT                   /locus_tag="LMOf2365_0702"
FT   CDS_pept        719873..720643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0702"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF01061"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0702"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03484"
FT                   /protein_id="AAT03484.1"
FT   gene            720762..720893
FT                   /locus_tag="LMOf2365_0703"
FT   CDS_pept        720762..720893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0703"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0703"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03485"
FT                   /protein_id="AAT03485.1"
FT   gene            720906..721787
FT                   /locus_tag="LMOf2365_0704"
FT   CDS_pept        720906..721787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0704"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0704"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03486"
FT                   /protein_id="AAT03486.1"
FT                   QVYGITGGAPIN"
FT   gene            721805..721981
FT                   /locus_tag="LMOf2365_0705"
FT   CDS_pept        721805..721981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0705"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0671"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0705"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03487"
FT                   /protein_id="AAT03487.1"
FT                   SKAEEWYKNHKES"
FT   gene            722106..722714
FT                   /pseudo
FT                   /locus_tag="LMOf2365_0706"
FT                   /note="conserved hypothetical protein, authentic point
FT                   mutation; this gene contains a premature stop which is not
FT                   the result of sequencing error; identified by similarity to
FT                   OMNI:NTL01LI0672"
FT   gene            723238..723339
FT                   /locus_tag="LMOf2365_0707"
FT   CDS_pept        723238..723339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0707"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0707"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03488"
FT                   /protein_id="AAT03488.1"
FT   gene            723626..724054
FT                   /locus_tag="LMOf2365_0708"
FT   CDS_pept        723626..724054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0708"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05656"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0708"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03489"
FT                   /protein_id="AAT03489.1"
FT   gene            complement(724093..724302)
FT                   /locus_tag="LMOf2365_0709"
FT   CDS_pept        complement(724093..724302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0709"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0677"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0709"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03490"
FT                   /protein_id="AAT03490.1"
FT   gene            complement(724321..725241)
FT                   /locus_tag="LMOf2365_0710"
FT   CDS_pept        complement(724321..725241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0710"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0678"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0710"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03491"
FT                   /db_xref="GOA:Q722M0"
FT                   /db_xref="InterPro:IPR021009"
FT                   /db_xref="InterPro:IPR038245"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q722M0"
FT                   /protein_id="AAT03491.1"
FT   gene            725613..725927
FT                   /locus_tag="LMOf2365_0711"
FT   CDS_pept        725613..725927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0711"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0679"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0711"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03492"
FT                   /protein_id="AAT03492.1"
FT                   "
FT   gene            725920..726687
FT                   /gene="fliP"
FT                   /locus_tag="LMOf2365_0712"
FT   CDS_pept        725920..726687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliP"
FT                   /locus_tag="LMOf2365_0712"
FT                   /product="flagellar biosynthesis protein FliP"
FT                   /note="identified by similarity to SP:P33133; match to
FT                   protein family HMM PF00813"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0712"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03493"
FT                   /protein_id="AAT03493.1"
FT   gene            726700..726972
FT                   /gene="fliQ"
FT                   /locus_tag="LMOf2365_0713"
FT   CDS_pept        726700..726972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliQ"
FT                   /locus_tag="LMOf2365_0713"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /note="identified by similarity to SP:P33134; match to
FT                   protein family HMM PF01313"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0713"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03494"
FT                   /protein_id="AAT03494.1"
FT   gene            726975..727736
FT                   /gene="fliR"
FT                   /locus_tag="LMOf2365_0714"
FT   CDS_pept        726975..727736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliR"
FT                   /locus_tag="LMOf2365_0714"
FT                   /product="flagellar biosynthetic protein FliR"
FT                   /note="identified by similarity to SP:P35537; match to
FT                   protein family HMM PF01311"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0714"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03495"
FT                   /protein_id="AAT03495.1"
FT   gene            727752..728798
FT                   /locus_tag="LMOf2365_0715"
FT   CDS_pept        727752..728798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0715"
FT                   /product="putative flagellar biosynthetic protein flhB"
FT                   /note="identified by similarity to SP:P35538; match to
FT                   protein family HMM PF01312"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0715"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03496"
FT                   /protein_id="AAT03496.1"
FT                   MDADKIKF"
FT   gene            728845..730920
FT                   /gene="flhA"
FT                   /locus_tag="LMOf2365_0716"
FT   CDS_pept        728845..730920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhA"
FT                   /locus_tag="LMOf2365_0716"
FT                   /product="flagellar biosynthesis protein FlhA"
FT                   /note="identified by similarity to SP:P35620; match to
FT                   protein family HMM PF00771"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0716"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03497"
FT                   /protein_id="AAT03497.1"
FT   gene            730942..732165
FT                   /locus_tag="LMOf2365_0717"
FT   CDS_pept        730942..732165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0717"
FT                   /product="putative flagellar biosynthesis protein FlhF"
FT                   /note="identified by similarity to SP:Q01960; match to
FT                   protein family HMM PF00448"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0717"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03498"
FT                   /protein_id="AAT03498.1"
FT                   TDRRRVLE"
FT   gene            732162..732941
FT                   /locus_tag="LMOf2365_0718"
FT   CDS_pept        732162..732941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0718"
FT                   /product="putative flagellar basal-body rod protein"
FT                   /note="identified by similarity to SP:P23446; match to
FT                   protein family HMM PF00460"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0718"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03499"
FT                   /protein_id="AAT03499.1"
FT   gene            732970..733758
FT                   /gene="cheR"
FT                   /locus_tag="LMOf2365_0719"
FT   CDS_pept        732970..733758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheR"
FT                   /locus_tag="LMOf2365_0719"
FT                   /product="chemotaxis protein methyltransferase CheR"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P31105; match to
FT                   protein family HMM PF01739; match to protein family HMM
FT                   PF03705"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0719"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03500"
FT                   /protein_id="AAT03500.1"
FT   gene            733783..734118
FT                   /locus_tag="LMOf2365_0720"
FT   CDS_pept        733783..734118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0720"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0688"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0720"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03501"
FT                   /protein_id="AAT03501.1"
FT                   NEVELVR"
FT   gene            734145..734996
FT                   /gene="motA"
FT                   /locus_tag="LMOf2365_0721"
FT   CDS_pept        734145..734996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motA"
FT                   /locus_tag="LMOf2365_0721"
FT                   /product="chemotaxis protein MotA"
FT                   /note="identified by similarity to SP:P28611; match to
FT                   protein family HMM PF01618"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0721"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03502"
FT                   /protein_id="AAT03502.1"
FT                   TR"
FT   gene            734956..735783
FT                   /gene="motB"
FT                   /locus_tag="LMOf2365_0722"
FT   CDS_pept        734956..735783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motB"
FT                   /locus_tag="LMOf2365_0722"
FT                   /product="chemotaxis protein MotB"
FT                   /note="identified by similarity to SP:P28612; match to
FT                   protein family HMM PF00691"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0722"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03503"
FT                   /protein_id="AAT03503.1"
FT   gene            735784..736293
FT                   /locus_tag="LMOf2365_0723"
FT   CDS_pept        735784..736293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0723"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0691"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0723"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03504"
FT                   /protein_id="AAT03504.1"
FT                   KIKLVN"
FT   gene            736316..738229
FT                   /locus_tag="LMOf2365_0724"
FT   CDS_pept        736316..738229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0724"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0724"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03505"
FT                   /protein_id="AAT03505.1"
FT                   NR"
FT   gene            738242..739150
FT                   /gene="cheV"
FT                   /locus_tag="LMOf2365_0725"
FT   CDS_pept        738242..739150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheV"
FT                   /locus_tag="LMOf2365_0725"
FT                   /product="chemotaxis protein CheV"
FT                   /note="identified by similarity to SP:P37599; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF01584"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0725"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03506"
FT                   /protein_id="AAT03506.1"
FT   gene            739388..740251
FT                   /locus_tag="LMOf2365_0726"
FT   CDS_pept        739388..740251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0726"
FT                   /product="flagellin"
FT                   /note="identified by similarity to SP:Q05203; match to
FT                   protein family HMM PF00669; match to protein family HMM
FT                   PF00700"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0726"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03507"
FT                   /protein_id="AAT03507.1"
FT                   TQLINS"
FT   gene            740526..740885
FT                   /gene="cheY"
FT                   /locus_tag="LMOf2365_0727"
FT   CDS_pept        740526..740885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheY"
FT                   /locus_tag="LMOf2365_0727"
FT                   /product="chemotaxis protein CheY"
FT                   /note="identified by similarity to SP:P24072; match to
FT                   protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0727"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03508"
FT                   /protein_id="AAT03508.1"
FT                   FQADRVLEALEKAAK"
FT   gene            740905..742761
FT                   /gene="cheA"
FT                   /locus_tag="LMOf2365_0728"
FT   CDS_pept        740905..742761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheA"
FT                   /locus_tag="LMOf2365_0728"
FT                   /product="chemotaxis protein CheA"
FT                   /note="identified by similarity to SP:P29072; match to
FT                   protein family HMM PF01584; match to protein family HMM
FT                   PF01627; match to protein family HMM PF02518; match to
FT                   protein family HMM PF02895; match to protein family HMM
FT                   PF07194"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0728"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03509"
FT                   /protein_id="AAT03509.1"
FT   gene            742774..743073
FT                   /locus_tag="LMOf2365_0729"
FT   CDS_pept        742774..743073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0729"
FT                   /product="flagellar motor switch domain protein"
FT                   /note="identified by match to protein family HMM PF01052"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0729"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03510"
FT                   /protein_id="AAT03510.1"
FT   gene            743092..743502
FT                   /locus_tag="LMOf2365_0730"
FT   CDS_pept        743092..743502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0730"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:16413154"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0730"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03511"
FT                   /protein_id="AAT03511.1"
FT   gene            743518..744564
FT                   /locus_tag="LMOf2365_0731"
FT   CDS_pept        743518..744564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0731"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0699"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0731"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03512"
FT                   /protein_id="AAT03512.1"
FT                   AFDLEEET"
FT   gene            744566..744988
FT                   /gene="flgD"
FT                   /locus_tag="LMOf2365_0732"
FT   CDS_pept        744566..744988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgD"
FT                   /locus_tag="LMOf2365_0732"
FT                   /product="flagellar hook assembly protein FlgD"
FT                   /note="identified by match to protein family HMM PF03963"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0732"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03513"
FT                   /protein_id="AAT03513.1"
FT   gene            745008..746243
FT                   /locus_tag="LMOf2365_0733"
FT   CDS_pept        745008..746243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0733"
FT                   /product="putative flagellar hook protein FlgE"
FT                   /note="identified by similarity to SP:P75937; match to
FT                   protein family HMM PF00460; match to protein family HMM
FT                   PF06429; match to protein family HMM PF07559"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0733"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03514"
FT                   /protein_id="AAT03514.1"
FT                   DDVMKQIVNLIQ"
FT   gene            746257..746493
FT                   /locus_tag="LMOf2365_0734"
FT   CDS_pept        746257..746493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0734"
FT                   /product="putative flagellar motor switch protein"
FT                   /note="identified by similarity to SP:P15070; match to
FT                   protein family HMM PF01052"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0734"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03515"
FT                   /protein_id="AAT03515.1"
FT   gene            746514..747506
FT                   /gene="fliM"
FT                   /locus_tag="LMOf2365_0735"
FT   CDS_pept        746514..747506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliM"
FT                   /locus_tag="LMOf2365_0735"
FT                   /product="flagellar motor switch protein FliM"
FT                   /note="identified by similarity to SP:Q57511; match to
FT                   protein family HMM PF01052; match to protein family HMM
FT                   PF02154"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0735"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03516"
FT                   /protein_id="AAT03516.1"
FT   gene            747542..749056
FT                   /locus_tag="LMOf2365_0736"
FT   CDS_pept        747542..749056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0736"
FT                   /product="flagellar motor switch domain protein"
FT                   /note="identified by similarity to GP:7009585; match to
FT                   protein family HMM PF01052; match to protein family HMM
FT                   PF04509"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0736"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03517"
FT                   /protein_id="AAT03517.1"
FT   gene            749080..750465
FT                   /locus_tag="LMOf2365_0737"
FT   CDS_pept        749080..750465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0737"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0705"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0737"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03518"
FT                   /protein_id="AAT03518.1"
FT                   AMK"
FT   gene            750488..751654
FT                   /locus_tag="LMOf2365_0738"
FT   CDS_pept        750488..751654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0738"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0706"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0738"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03519"
FT                   /protein_id="AAT03519.1"
FT   gene            751761..752225
FT                   /locus_tag="LMOf2365_0739"
FT   CDS_pept        751761..752225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0739"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0707"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0739"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03520"
FT                   /protein_id="AAT03520.1"
FT   gene            752235..752663
FT                   /locus_tag="LMOf2365_0740"
FT   CDS_pept        752235..752663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0740"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0708"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0740"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03521"
FT                   /protein_id="AAT03521.1"
FT   gene            752683..754203
FT                   /locus_tag="LMOf2365_0741"
FT   CDS_pept        752683..754203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0741"
FT                   /product="flagellar hook-associated protein 1-related
FT                   protein"
FT                   /note="identified by similarity to SP:P33235; match to
FT                   protein family HMM PF01239; match to protein family HMM
FT                   PF06429; match to protein family HMM TIGR02492"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0741"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03522"
FT                   /protein_id="AAT03522.1"
FT   gene            754215..755090
FT                   /locus_tag="LMOf2365_0742"
FT   CDS_pept        754215..755090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0742"
FT                   /product="putative flagellar hook-associated protein FlgL"
FT                   /note="identified by similarity to SP:P29744; match to
FT                   protein family HMM PF00669; match to protein family HMM
FT                   TIGR02550"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0742"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03523"
FT                   /protein_id="AAT03523.1"
FT                   VQKLSILNYM"
FT   gene            755129..756391
FT                   /gene="fliD"
FT                   /locus_tag="LMOf2365_0743"
FT   CDS_pept        755129..756391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliD"
FT                   /locus_tag="LMOf2365_0743"
FT                   /product="flagellar hook-associated protein 2"
FT                   /note="identified by similarity to GP:145988; match to
FT                   protein family HMM PF02465; match to protein family HMM
FT                   PF07195"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0743"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03524"
FT                   /protein_id="AAT03524.1"
FT   gene            756410..756796
FT                   /locus_tag="LMOf2365_0744"
FT   CDS_pept        756410..756796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0744"
FT                   /product="putative flagellar protein FliS"
FT                   /note="identified by similarity to SP:P39739"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0744"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03525"
FT                   /protein_id="AAT03525.1"
FT   gene            756768..757049
FT                   /locus_tag="LMOf2365_0745"
FT   CDS_pept        756768..757049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0745"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0713"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0745"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03526"
FT                   /protein_id="AAT03526.1"
FT   gene            757070..757471
FT                   /gene="flgB"
FT                   /locus_tag="LMOf2365_0746"
FT   CDS_pept        757070..757471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /locus_tag="LMOf2365_0746"
FT                   /product="flagellar basal-body rod protein FlgB"
FT                   /note="identified by similarity to SP:P24500; match to
FT                   protein family HMM TIGR01396"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0746"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03527"
FT                   /protein_id="AAT03527.1"
FT   gene            757483..757893
FT                   /gene="flgC"
FT                   /locus_tag="LMOf2365_0747"
FT   CDS_pept        757483..757893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /locus_tag="LMOf2365_0747"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /note="identified by similarity to SP:P24501; match to
FT                   protein family HMM PF06429; match to protein family HMM
FT                   TIGR01395"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0747"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03528"
FT                   /protein_id="AAT03528.1"
FT   gene            757910..758206
FT                   /locus_tag="LMOf2365_0748"
FT   CDS_pept        757910..758206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0748"
FT                   /product="putative flagellar hook-basal body complex
FT                   protein FliE"
FT                   /note="identified by similarity to SP:P25797"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0748"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03529"
FT                   /db_xref="GOA:Q722I5"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q722I5"
FT                   /protein_id="AAT03529.1"
FT   gene            758274..759926
FT                   /gene="fliF"
FT                   /locus_tag="LMOf2365_0749"
FT   CDS_pept        758274..759926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /locus_tag="LMOf2365_0749"
FT                   /product="flagellar M-ring protein FliF"
FT                   /note="identified by similarity to SP:P23447; match to
FT                   protein family HMM PF01514; match to protein family HMM
FT                   TIGR00206"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0749"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03530"
FT                   /protein_id="AAT03530.1"
FT   gene            759929..761035
FT                   /gene="fliG"
FT                   /locus_tag="LMOf2365_0750"
FT   CDS_pept        759929..761035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliG"
FT                   /locus_tag="LMOf2365_0750"
FT                   /product="flagellar motor switch protein FliG"
FT                   /note="identified by similarity to SP:P23448; match to
FT                   protein family HMM PF01706"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0750"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03531"
FT                   /protein_id="AAT03531.1"
FT   gene            761022..761714
FT                   /locus_tag="LMOf2365_0751"
FT   CDS_pept        761022..761714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0751"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0751"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03532"
FT                   /protein_id="AAT03532.1"
FT                   KILGGDKP"
FT   gene            761711..763012
FT                   /gene="fliI"
FT                   /locus_tag="LMOf2365_0752"
FT   CDS_pept        761711..763012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliI"
FT                   /locus_tag="LMOf2365_0752"
FT                   /product="flagellum-specific ATP synthase FliI"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P23445; match to
FT                   protein family HMM PF00006; match to protein family HMM
FT                   TIGR01026"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0752"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03533"
FT                   /protein_id="AAT03533.1"
FT   gene            763029..763697
FT                   /locus_tag="LMOf2365_0753"
FT   CDS_pept        763029..763697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0753"
FT                   /product="transglycosylase, SLT family"
FT                   /note="identified by match to protein family HMM PF01464"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0753"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03534"
FT                   /protein_id="AAT03534.1"
FT                   "
FT   gene            763711..764355
FT                   /locus_tag="LMOf2365_0754"
FT   CDS_pept        763711..764355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0754"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0722"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0754"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03535"
FT                   /protein_id="AAT03535.1"
FT   gene            764474..764800
FT                   /locus_tag="LMOf2365_0755"
FT   CDS_pept        764474..764800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0755"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="identified by match to protein family HMM PF03551"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0755"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03536"
FT                   /protein_id="AAT03536.1"
FT                   GGQA"
FT   gene            764800..765123
FT                   /locus_tag="LMOf2365_0756"
FT   CDS_pept        764800..765123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0756"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0724; match
FT                   to protein family HMM PF06304"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0756"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03537"
FT                   /protein_id="AAT03537.1"
FT                   SIK"
FT   gene            complement(765166..765813)
FT                   /locus_tag="LMOf2365_0757"
FT   CDS_pept        complement(765166..765813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0757"
FT                   /product="fibronectin-binding protein"
FT                   /note="identified by similarity to GP:15594010; match to
FT                   protein family HMM PF07299"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0757"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03538"
FT                   /protein_id="AAT03538.1"
FT   gene            766084..767814
FT                   /locus_tag="LMOf2365_0758"
FT   CDS_pept        766084..767814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0758"
FT                   /product="pyruvate oxidase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P37063; match to
FT                   protein family HMM PF00205; match to protein family HMM
FT                   PF02776"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0758"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03539"
FT                   /protein_id="AAT03539.1"
FT                   "
FT   gene            767976..769781
FT                   /locus_tag="LMOf2365_0759"
FT   CDS_pept        767976..769781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0759"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /note="identified by similarity to SP:P39216; match to
FT                   protein family HMM PF00015; match to protein family HMM
FT                   PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0759"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03540"
FT                   /protein_id="AAT03540.1"
FT   gene            769794..770522
FT                   /locus_tag="LMOf2365_0760"
FT   CDS_pept        769794..770522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0760"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0728"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0760"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03541"
FT                   /protein_id="AAT03541.1"
FT   gene            complement(770565..770777)
FT                   /locu