(data stored in ACNUC7421 zone)

EMBL: AE017282

ID   AE017282; SV 2; circular; genomic DNA; STD; PRO; 3304561 BP.
XX
AC   AE017282;
XX
PR   Project:PRJNA21;
XX
DT   05-OCT-2004 (Rel. 81, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 12)
XX
DE   Methylococcus capsulatus str. Bath, complete genome.
XX
KW   .
XX
OS   Methylococcus capsulatus str. Bath
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Methylococcales;
OC   Methylococcaceae; Methylococcus.
XX
RN   [1]
RP   1-3304561
RX   DOI; 10.1371/journal.pbio.0020303.
RX   PUBMED; 15383840.
RA   Ward N., Larsen O., Sakwa J., Bruseth L., Khouri H., Durkin A.S.,
RA   Dimitrov G., Jiang L., Scanlan D., Kang K.H., Lewis M., Nelson K.E.,
RA   Methe B., Wu M., Heidelberg J.F., Paulsen I.T., Fouts D., Ravel J.,
RA   Tettelin H., Ren Q., Read T., DeBoy R.T., Seshadri R., Salzberg S.L.,
RA   Jensen H.B., Birkeland N.K., Nelson W.C., Dodson R.J., Grindhaug S.H.,
RA   Holt I., Eidhammer I., Jonasen I., Vanaken S., Utterback T.,
RA   Feldblyum T.V., Fraser C.M., Lillehaug J.R., Eisen J.A.;
RT   "Genomic insights into methanotrophy: the complete genome sequence of
RT   Methylococcus capsulatus (Bath)";
RL   PLoS Biol. 2(10):E303-E303(2004).
XX
RN   [2]
RP   1-3304561
RA   Ward N.L., Larsen O., Eisen J.A., Sakwa J., Bruseth L., Khouri H.M.,
RA   Durkin A.S., Dimitrov G., Jiang L., Scanlan D., Kang K.H., Lewis M.R.,
RA   Nelson K.E., Methe B.A., Wu M., Heidelberg J.F., Paulsen I.T., Fouts D.,
RA   Ravel J., Tettelin H., Ren Q., Read T.D., DeBoy R.T., Seshadri R.,
RA   Salzberg S.L., Jensen H.B., Birkeland N.K., Nelson W.C., Dodson R.J.,
RA   Grindhaug S.H., Holt I.E., Eidhammer I., Jonasen I., Van Aken S.,
RA   Utterback T., Feldblyum T.V., Lillehaug J., Fraser C.M.;
RT   ;
RL   Submitted (01-OCT-2004) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-3304561
RA   Ward N.L., Larsen O., Eisen J.A., Sakwa J., Bruseth L., Khouri H.M.,
RA   Durkin A.S., Dimitrov G., Jiang L., Scanlan D., Kang K.H., Lewis M.R.,
RA   Nelson K.E., Methe B.A., Wu M., Heidelberg J.F., Paulsen I.T., Fouts D.,
RA   Ravel J., Tettelin H., Ren Q., Read T.D., DeBoy R.T., Seshadri R.,
RA   Salzberg S.L., Jensen H.B., Birkeland N.K., Nelson W.C., Dodson R.J.,
RA   Grindhaug S.H., Holt I.E., Eidhammer I., Jonasen I., Van Aken S.,
RA   Utterback T., Feldblyum T.V., Lillehaug J., Fraser C.M.;
RT   ;
RL   Submitted (17-MAY-2005) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
DR   MD5; a3f174faa53d6a41de8ebd9159d510be.
DR   BioSample; SAMN02603968.
DR   EnsemblGenomes-Gn; EBG00001055516.
DR   EnsemblGenomes-Gn; EBG00001055517.
DR   EnsemblGenomes-Gn; EBG00001055518.
DR   EnsemblGenomes-Gn; EBG00001055519.
DR   EnsemblGenomes-Gn; EBG00001055520.
DR   EnsemblGenomes-Gn; EBG00001055521.
DR   EnsemblGenomes-Gn; EBG00001055522.
DR   EnsemblGenomes-Gn; EBG00001055523.
DR   EnsemblGenomes-Gn; EBG00001055524.
DR   EnsemblGenomes-Gn; EBG00001055525.
DR   EnsemblGenomes-Gn; EBG00001055526.
DR   EnsemblGenomes-Gn; EBG00001055527.
DR   EnsemblGenomes-Gn; EBG00001055528.
DR   EnsemblGenomes-Gn; EBG00001055529.
DR   EnsemblGenomes-Gn; EBG00001055530.
DR   EnsemblGenomes-Gn; EBG00001055531.
DR   EnsemblGenomes-Gn; EBG00001055532.
DR   EnsemblGenomes-Gn; EBG00001055533.
DR   EnsemblGenomes-Gn; EBG00001055534.
DR   EnsemblGenomes-Gn; EBG00001055535.
DR   EnsemblGenomes-Gn; EBG00001055536.
DR   EnsemblGenomes-Gn; EBG00001055537.
DR   EnsemblGenomes-Gn; EBG00001055538.
DR   EnsemblGenomes-Gn; EBG00001055539.
DR   EnsemblGenomes-Gn; EBG00001055540.
DR   EnsemblGenomes-Gn; EBG00001055541.
DR   EnsemblGenomes-Gn; EBG00001055542.
DR   EnsemblGenomes-Gn; EBG00001055543.
DR   EnsemblGenomes-Gn; EBG00001055544.
DR   EnsemblGenomes-Gn; EBG00001055545.
DR   EnsemblGenomes-Gn; EBG00001055546.
DR   EnsemblGenomes-Gn; EBG00001055547.
DR   EnsemblGenomes-Gn; EBG00001055548.
DR   EnsemblGenomes-Gn; EBG00001055549.
DR   EnsemblGenomes-Gn; EBG00001055550.
DR   EnsemblGenomes-Gn; EBG00001055551.
DR   EnsemblGenomes-Gn; EBG00001055552.
DR   EnsemblGenomes-Gn; EBG00001055553.
DR   EnsemblGenomes-Gn; EBG00001055554.
DR   EnsemblGenomes-Gn; EBG00001055555.
DR   EnsemblGenomes-Gn; EBG00001055556.
DR   EnsemblGenomes-Gn; EBG00001055557.
DR   EnsemblGenomes-Gn; EBG00001055558.
DR   EnsemblGenomes-Gn; EBG00001055559.
DR   EnsemblGenomes-Gn; EBG00001055560.
DR   EnsemblGenomes-Gn; EBG00001055561.
DR   EnsemblGenomes-Gn; EBG00001055562.
DR   EnsemblGenomes-Gn; EBG00001055563.
DR   EnsemblGenomes-Gn; EBG00001055564.
DR   EnsemblGenomes-Gn; EBG00001055565.
DR   EnsemblGenomes-Gn; EBG00001055566.
DR   EnsemblGenomes-Gn; EBG00001055567.
DR   EnsemblGenomes-Gn; EBG00001055568.
DR   EnsemblGenomes-Gn; EBG00001055569.
DR   EnsemblGenomes-Gn; EBG00001055570.
DR   EnsemblGenomes-Gn; EBG00001055571.
DR   EnsemblGenomes-Gn; EBG00001055572.
DR   EnsemblGenomes-Gn; EBG00001055573.
DR   EnsemblGenomes-Gn; EBG00001055574.
DR   EnsemblGenomes-Gn; EBG00001055575.
DR   EnsemblGenomes-Gn; EBG00001055576.
DR   EnsemblGenomes-Gn; EBG00001055577.
DR   EnsemblGenomes-Gn; MCA_Mc16SA.
DR   EnsemblGenomes-Gn; MCA_Mc16SB.
DR   EnsemblGenomes-Gn; MCA_Mc23SA.
DR   EnsemblGenomes-Gn; MCA_Mc23SB.
DR   EnsemblGenomes-Gn; MCA_Mc5SA.
DR   EnsemblGenomes-Gn; MCA_Mc5SB.
DR   EnsemblGenomes-Gn; MCA_tRNA-Ala-1.
DR   EnsemblGenomes-Gn; MCA_tRNA-Ala-2.
DR   EnsemblGenomes-Gn; MCA_tRNA-Ala-3.
DR   EnsemblGenomes-Gn; MCA_tRNA-Arg-1.
DR   EnsemblGenomes-Gn; MCA_tRNA-Arg-2.
DR   EnsemblGenomes-Gn; MCA_tRNA-Arg-3.
DR   EnsemblGenomes-Gn; MCA_tRNA-Arg-4.
DR   EnsemblGenomes-Gn; MCA_tRNA-Asn-1.
DR   EnsemblGenomes-Gn; MCA_tRNA-Asp-1.
DR   EnsemblGenomes-Gn; MCA_tRNA-Cys-1.
DR   EnsemblGenomes-Gn; MCA_tRNA-Gln-1.
DR   EnsemblGenomes-Gn; MCA_tRNA-Gln-2.
DR   EnsemblGenomes-Gn; MCA_tRNA-Glu-1.
DR   EnsemblGenomes-Gn; MCA_tRNA-Glu-2.
DR   EnsemblGenomes-Gn; MCA_tRNA-Gly-1.
DR   EnsemblGenomes-Gn; MCA_tRNA-Gly-2.
DR   EnsemblGenomes-Gn; MCA_tRNA-Gly-3.
DR   EnsemblGenomes-Gn; MCA_tRNA-His-1.
DR   EnsemblGenomes-Gn; MCA_tRNA-Ile-1.
DR   EnsemblGenomes-Gn; MCA_tRNA-Ile-2.
DR   EnsemblGenomes-Gn; MCA_tRNA-Leu-1.
DR   EnsemblGenomes-Gn; MCA_tRNA-Leu-2.
DR   EnsemblGenomes-Gn; MCA_tRNA-Leu-3.
DR   EnsemblGenomes-Gn; MCA_tRNA-Leu-4.
DR   EnsemblGenomes-Gn; MCA_tRNA-Leu-5.
DR   EnsemblGenomes-Gn; MCA_tRNA-Lys-1.
DR   EnsemblGenomes-Gn; MCA_tRNA-Lys-2.
DR   EnsemblGenomes-Gn; MCA_tRNA-Met-1.
DR   EnsemblGenomes-Gn; MCA_tRNA-Met-2.
DR   EnsemblGenomes-Gn; MCA_tRNA-Met-3.
DR   EnsemblGenomes-Gn; MCA_tRNA-Phe-1.
DR   EnsemblGenomes-Gn; MCA_tRNA-Pro-1.
DR   EnsemblGenomes-Gn; MCA_tRNA-Pro-2.
DR   EnsemblGenomes-Gn; MCA_tRNA-Pro-3.
DR   EnsemblGenomes-Gn; MCA_tRNA-Ser-1.
DR   EnsemblGenomes-Gn; MCA_tRNA-Ser-2.
DR   EnsemblGenomes-Gn; MCA_tRNA-Ser-3.
DR   EnsemblGenomes-Gn; MCA_tRNA-Ser-4.
DR   EnsemblGenomes-Gn; MCA_tRNA-Thr-1.
DR   EnsemblGenomes-Gn; MCA_tRNA-Thr-2.
DR   EnsemblGenomes-Gn; MCA_tRNA-Thr-3.
DR   EnsemblGenomes-Gn; MCA_tRNA-Trp-1.
DR   EnsemblGenomes-Gn; MCA_tRNA-Tyr-1.
DR   EnsemblGenomes-Gn; MCA_tRNA-Val-1.
DR   EnsemblGenomes-Gn; MCA_tRNA-Val-2.
DR   EnsemblGenomes-Gn; MCA_tRNA-Val-3.
DR   EnsemblGenomes-Tr; EBT00001657763.
DR   EnsemblGenomes-Tr; EBT00001657764.
DR   EnsemblGenomes-Tr; EBT00001657765.
DR   EnsemblGenomes-Tr; EBT00001657766.
DR   EnsemblGenomes-Tr; EBT00001657767.
DR   EnsemblGenomes-Tr; EBT00001657768.
DR   EnsemblGenomes-Tr; EBT00001657769.
DR   EnsemblGenomes-Tr; EBT00001657770.
DR   EnsemblGenomes-Tr; EBT00001657771.
DR   EnsemblGenomes-Tr; EBT00001657772.
DR   EnsemblGenomes-Tr; EBT00001657773.
DR   EnsemblGenomes-Tr; EBT00001657774.
DR   EnsemblGenomes-Tr; EBT00001657775.
DR   EnsemblGenomes-Tr; EBT00001657776.
DR   EnsemblGenomes-Tr; EBT00001657777.
DR   EnsemblGenomes-Tr; EBT00001657778.
DR   EnsemblGenomes-Tr; EBT00001657779.
DR   EnsemblGenomes-Tr; EBT00001657780.
DR   EnsemblGenomes-Tr; EBT00001657781.
DR   EnsemblGenomes-Tr; EBT00001657782.
DR   EnsemblGenomes-Tr; EBT00001657783.
DR   EnsemblGenomes-Tr; EBT00001657784.
DR   EnsemblGenomes-Tr; EBT00001657785.
DR   EnsemblGenomes-Tr; EBT00001657786.
DR   EnsemblGenomes-Tr; EBT00001657787.
DR   EnsemblGenomes-Tr; EBT00001657788.
DR   EnsemblGenomes-Tr; EBT00001657789.
DR   EnsemblGenomes-Tr; EBT00001657790.
DR   EnsemblGenomes-Tr; EBT00001657791.
DR   EnsemblGenomes-Tr; EBT00001657792.
DR   EnsemblGenomes-Tr; EBT00001657793.
DR   EnsemblGenomes-Tr; EBT00001657794.
DR   EnsemblGenomes-Tr; EBT00001657795.
DR   EnsemblGenomes-Tr; EBT00001657796.
DR   EnsemblGenomes-Tr; EBT00001657797.
DR   EnsemblGenomes-Tr; EBT00001657798.
DR   EnsemblGenomes-Tr; EBT00001657799.
DR   EnsemblGenomes-Tr; EBT00001657800.
DR   EnsemblGenomes-Tr; EBT00001657801.
DR   EnsemblGenomes-Tr; EBT00001657802.
DR   EnsemblGenomes-Tr; EBT00001657803.
DR   EnsemblGenomes-Tr; EBT00001657804.
DR   EnsemblGenomes-Tr; EBT00001657805.
DR   EnsemblGenomes-Tr; EBT00001657806.
DR   EnsemblGenomes-Tr; EBT00001657807.
DR   EnsemblGenomes-Tr; EBT00001657808.
DR   EnsemblGenomes-Tr; EBT00001657809.
DR   EnsemblGenomes-Tr; EBT00001657810.
DR   EnsemblGenomes-Tr; EBT00001657811.
DR   EnsemblGenomes-Tr; EBT00001657812.
DR   EnsemblGenomes-Tr; EBT00001657813.
DR   EnsemblGenomes-Tr; EBT00001657814.
DR   EnsemblGenomes-Tr; EBT00001657815.
DR   EnsemblGenomes-Tr; EBT00001657816.
DR   EnsemblGenomes-Tr; EBT00001657817.
DR   EnsemblGenomes-Tr; EBT00001657818.
DR   EnsemblGenomes-Tr; EBT00001657819.
DR   EnsemblGenomes-Tr; EBT00001657820.
DR   EnsemblGenomes-Tr; EBT00001657821.
DR   EnsemblGenomes-Tr; EBT00001657822.
DR   EnsemblGenomes-Tr; EBT00001657823.
DR   EnsemblGenomes-Tr; EBT00001657824.
DR   EnsemblGenomes-Tr; MCA_Mc16SA-1.
DR   EnsemblGenomes-Tr; MCA_Mc16SB-1.
DR   EnsemblGenomes-Tr; MCA_Mc23SA-1.
DR   EnsemblGenomes-Tr; MCA_Mc23SB-1.
DR   EnsemblGenomes-Tr; MCA_Mc5SA-1.
DR   EnsemblGenomes-Tr; MCA_Mc5SB-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Ala-1-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Ala-2-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Ala-3-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Arg-1-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Arg-2-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Arg-3-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Arg-4-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Asn-1-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Asp-1-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Cys-1-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Gln-1-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Gln-2-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Glu-1-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Glu-2-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Gly-1-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Gly-2-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Gly-3-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-His-1-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Ile-1-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Ile-2-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Leu-1-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Leu-2-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Leu-3-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Leu-4-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Leu-5-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Lys-1-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Lys-2-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Met-1-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Met-2-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Met-3-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Phe-1-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Pro-1-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Pro-2-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Pro-3-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Ser-1-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Ser-2-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Ser-3-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Ser-4-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Thr-1-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Thr-2-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Thr-3-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Trp-1-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Tyr-1-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Val-1-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Val-2-1.
DR   EnsemblGenomes-Tr; MCA_tRNA-Val-3-1.
DR   EuropePMC; PMC1273839; 16239585.
DR   EuropePMC; PMC3127593; 21460105.
DR   EuropePMC; PMC4257694; 25479164.
DR   EuropePMC; PMC517821; 15383840.
DR   EuropePMC; PMC6288188; 30564208.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; AE017282.
DR   SILVA-SSU; AE017282.
DR   StrainInfo; 108702; 0.
XX
CC   On May 18, 2005 this sequence version replaced gi:53756053.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3304561
FT                   /organism="Methylococcus capsulatus str. Bath"
FT                   /strain="Bath"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:243233"
FT   gene            44..1921
FT                   /gene="gidA"
FT                   /locus_tag="MCA0001"
FT   CDS_pept        44..1921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="MCA0001"
FT                   /product="glucose inhibited division protein A"
FT                   /note="identified by similarity to SP:P17112; match to
FT                   protein family HMM PF01134; match to protein family HMM
FT                   TIGR00136"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90762"
FT                   /db_xref="GOA:Q60CS5"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60CS5"
FT                   /protein_id="AAU90762.1"
FT                   /translation="MFFDDEFDVIVVGGGHAGTEAALAAARTGARTLLLTQNVETLGQM
FT                   SCNPAIGGIGKGHLVKEIDAMGGLMARAADRAGIQFRILNASKGPAVRATRAQADRSLY
FT                   RKAVREGLSAQENLSLFQQTVVDLIVEGRRAAGVVTQMGLKFRSRCVVLTVGTFLAGRI
FT                   HIGLENYDGGRAGDPPATDLARRLRDLGFKVARLKTGTPPRIDRRSVDFSRMAEQPGDD
FT                   PTPVFSFLGTREEHPPQVSCYITRTNERTHELIRAGLDRSPMFTGVIEGIGPRYCPSIE
FT                   DKVVRFAERDSHQIFVEPEGLDSLEIYPNGISTSLPFDVQLAVVRSIQGFEDARITRPG
FT                   YAIEYDFFDPRDLRHSLETRHMENLFFAGQINGTTGYEEAAAQGLLAGLNAARKARDLE
FT                   PWWPGRDEAYLGVLVDDLITRGTSEPYRMFTSRAEYRLVLREDNADLRLTETGRALGLV
FT                   DDARWSAFEAKREAIETLGARLAARRIRPDSSQAESWNALTEIPLQREASLLELLRRPD
FT                   VGLEHIAGHAPDLFEGMDRAVREQVEIAAKYTGYIERQQAEIERVRRYEAWQLPDSMDY
FT                   GKVIGLSSEVREKLGRVRPATVGQAARIPGITPAAISLLLVHLRRTGAA"
FT   gene            1936..2553
FT                   /gene="gidB"
FT                   /locus_tag="MCA0002"
FT   CDS_pept        1936..2553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="MCA0002"
FT                   /product="glucose-inhibited division protein B"
FT                   /note="identified by similarity to SP:P17113; match to
FT                   protein family HMM PF02527; match to protein family HMM
FT                   TIGR00138"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90761"
FT                   /db_xref="GOA:Q60CS4"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60CS4"
FT                   /protein_id="AAU90761.1"
FT                   /translation="MLERGLSELGSDAGGDQRERLLRFLELLRKWNRVYSLTAIEDPCE
FT                   GVRLHLLDSLSIASFLHGRRVLDVGTGPGLPGIPLAIVQPERRFVLLDCNAKKIRFVRQ
FT                   AVIELGLANVVPVQARIESFTDAEGFDCVLARAYASLAEIWTDAAPLLRTGGTVLALKG
FT                   RRPEAELGDLPAGVAVGIHRLRVPGVEAERHLAELKPTGQDS"
FT   gene            2554..3342
FT                   /locus_tag="MCA0003"
FT   CDS_pept        2554..3342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0003"
FT                   /product="ParA family protein"
FT                   /note="identified by match to protein family HMM PF01656"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90760"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CS3"
FT                   /protein_id="AAU90760.1"
FT                   /translation="MGKAKIIAIANQKGGVGKTTTGVNLAASLAATKNRVLLIDLDPQG
FT                   NATMGCGVDKRSLSRSSYQVLIRQAPASEAIIELDGPGFDLIPSNSDLAAAQVDLLQIE
FT                   GRDRCLREALEPCLGHYRFILIDCPPSLNMLTVNALVAADSVLIPMQCEYYALEGLSDL
FT                   MDTLGKIRATVNPRLAVEGLLRTMYDTRSRLANEVSEQLLEHFPDRVFRTVIPRNIRLA
FT                   EAPSHGVPVMYHDKSSKGALAYLALAGEIVRRNERKTAAA"
FT   gene            3364..4212
FT                   /locus_tag="MCA0004"
FT   CDS_pept        3364..4212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0004"
FT                   /product="ParB family protein"
FT                   /note="identified by similarity to SP:P26497; match to
FT                   protein family HMM PF02195; match to protein family HMM
FT                   TIGR00180"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90759"
FT                   /db_xref="GOA:Q60CS2"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CS2"
FT                   /protein_id="AAU90759.1"
FT                   /translation="MKKPALGRGLEALLGEARLDPKQESLRKLPIEHLEPSPFQPRKDF
FT                   DSAKLRELADSISAQGIVQPIVVRSAEPGRYQIVAGERRWRAAQLAGVREVPVVVREVP
FT                   DQAALAIALIENIQREDLNPLEEAEAIQRLLEEHRMTHQQVADALGKSRVTITNLNRLN
FT                   DLHPDAKALLRAGEIDMGHARALLALPYGQQGEAARRVAEKRLSVRETESLVNGLLKAA
FT                   DAGPKPAKVVDPDIARLERRMTERLGAGVRIQHGAKGAGRLVISYASLEQLEGLLARFE
FT                   G"
FT   gene            4268..4639
FT                   /locus_tag="MCA0005"
FT   CDS_pept        4268..4639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0005"
FT                   /product="putative ATP synthase protein I"
FT                   /note="identified by similarity to SP:P25760; match to
FT                   protein family HMM PF03899"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90758"
FT                   /db_xref="GOA:Q60CS1"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CS1"
FT                   /protein_id="AAU90758.1"
FT                   /translation="MPEMLGGRLYGGVRRIIRWQLVVMVVCGVIAYVAGGWKTAISASA
FT                   GGLIAFVPNAFFALRFGFFDPTRSARDIVRAFYVGESMKLVLTGVLFFLAFQFRELEFL
FT                   PLFSGFMVALGVYWIALLQ"
FT   gene            4667..5446
FT                   /gene="atpB-1"
FT                   /locus_tag="MCA0006"
FT   CDS_pept        4667..5446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB-1"
FT                   /locus_tag="MCA0006"
FT                   /product="ATP synthase F0, A subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by similarity to SP:P00855; match to
FT                   protein family HMM PF00119; match to protein family HMM
FT                   TIGR01131"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90757"
FT                   /db_xref="GOA:Q60CS0"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60CS0"
FT                   /protein_id="AAU90757.1"
FT                   /translation="MATEAHDAGGATGYIVHHLTPLSSGEGFWTLHVDTLFFSVFLGAV
FT                   FLFFFRKAAEQATAGVPGPFQNFVEMIVEFVDTQVKDSFHGRNALIAPLALSIFAWVFL
FT                   MNAMDLLPVDLLPDVGKAIGLEYLRVVPSTDLNATFGMSISVFFLIIFYSLKVKGPGHF
FT                   AMEFLFHPFSHWALVPFNLLLNTVEYLAKPVSLGLRLFGNMYAGELIFILIALLPWWVQ
FT                   PALSFPWAVFHILIITLQAFIFMVLTIVYLSLAHESH"
FT   gene            5502..5747
FT                   /gene="atpE-1"
FT                   /locus_tag="MCA0007"
FT   CDS_pept        5502..5747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE-1"
FT                   /locus_tag="MCA0007"
FT                   /product="ATP synthase F0, C subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by similarity to SP:P12991; match to
FT                   protein family HMM PF00137; match to protein family HMM
FT                   TIGR01260"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90756"
FT                   /db_xref="GOA:Q60CR9"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CR9"
FT                   /protein_id="AAU90756.1"
FT                   /translation="METVYGMTAIAVGIILGLGAMGTAIGFGLLGGKFLEGAARQPEMV
FT                   PMLQVKMFIVAGLLDAVTMIGVGLALFFTFANPFVK"
FT   gene            5810..6283
FT                   /gene="atpF"
FT                   /locus_tag="MCA0008"
FT   CDS_pept        5810..6283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="MCA0008"
FT                   /product="ATP synthase F0, B subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by similarity to SP:P00859; match to
FT                   protein family HMM PF00430; match to protein family HMM
FT                   TIGR01144"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90747"
FT                   /db_xref="GOA:Q60CR8"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60CR8"
FT                   /protein_id="AAU90747.1"
FT                   /translation="MNINATLFGQMVTFALLVWFTMKYVWPPLLQALEERKKKIAEGLA
FT                   AAEKGKHEMELAEKRATAALKEAKDQAAEIVNQAQKRANALVDESKEAAKIEGERILAN
FT                   ARSEIDRELENAKEELRKQVSALAISAAEKILQREVDQKKHKEILAGLGKQLG"
FT   gene            6290..6826
FT                   /gene="atpH"
FT                   /locus_tag="MCA0009"
FT   CDS_pept        6290..6826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="MCA0009"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by similarity to SP:P00831; match to
FT                   protein family HMM PF00213; match to protein family HMM
FT                   TIGR01145"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90746"
FT                   /db_xref="GOA:Q60CR7"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60CR7"
FT                   /protein_id="AAU90746.1"
FT                   /translation="MSELTTLARPYAVAVFKAAKEAGNIQEWADMLEFLKQVMADPLMQ
FT                   RAASDPKAGKDRFIAKFLDLCKGHVIPEGENFIRLLASNGRLGLVGTIADMFAEFRAEE
FT                   EGYVDVDVITAYPLEESETTNLNALVEKWMSRKGRLHVTVDESLIAGVVLRAGGRVVDA
FT                   SVHGQLQRLAKRLSN"
FT   gene            6842..8383
FT                   /gene="atpA-1"
FT                   /locus_tag="MCA0010"
FT   CDS_pept        6842..8383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA-1"
FT                   /locus_tag="MCA0010"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by similarity to SP:P00822; match to
FT                   protein family HMM PF00006; match to protein family HMM
FT                   PF00306; match to protein family HMM PF02874; match to
FT                   protein family HMM TIGR00962"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90745"
FT                   /db_xref="GOA:Q60CR6"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60CR6"
FT                   /protein_id="AAU90745.1"
FT                   /translation="MQLNASEISDLIKQRIGKFDLGVESRSEGTIVSLTDGIVRIHGLQ
FT                   DVMQGEMVEFPGNTYGMALNLERDSVGAVVLGSYEHLSEGDTAKCTGRILEVPVGEALL
FT                   GRVVDALGNPIDGAGPIDAKLFSPIEKIAPGVISRQSVSQPLQTGLKAIDSMIPVGRGQ
FT                   RELIIGDRQTGKTAIAIDAIINQKGTGVKCIYVAVGQKQSSIANVVRKLQEHGAMEHTI
FT                   VVSASASESAALQFIAPYAGCAMGEYFRDRGEDALIVYDDLTKQAWAYRQISLLLRRPP
FT                   GREAYPGDVFYLHSRLLERASRINAEEVERLTKGEVKGKTGSLTALPIIETQAGDVSAF
FT                   VPTNVISITDGQIFLETNLFNAGIRPAVNAGLSVSRVGGAAQTKVIKKLGGGIRLDLAQ
FT                   YRELAAFAQFASDLDEATRKQIERGQRVTELMKQNQYSPMSIAQMAVSLFAANEGYLDD
FT                   IEVSKVRDFEDALQEYMKSQCAELLKSIDATGDYNDAIQAGLHEAIKKFKATHAW"
FT   gene            8394..9257
FT                   /gene="atpG-1"
FT                   /locus_tag="MCA0011"
FT   CDS_pept        8394..9257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG-1"
FT                   /locus_tag="MCA0011"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by similarity to SP:P00837; match to
FT                   protein family HMM PF00231; match to protein family HMM
FT                   TIGR01146"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90744"
FT                   /db_xref="GOA:Q60CR5"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60CR5"
FT                   /protein_id="AAU90744.1"
FT                   /translation="MAVGKEIRIKIASVRNTQKITRAMEMVAASKMRRTQDRLQATRPY
FT                   ARKIARIIKHLAQANPEYKNPFMVERPVKRVGVVLVSSDRGLCGGLNSNLFRLLLRRMR
FT                   AWGEAGVEVRLGVIGQKGASFFGGVGADVAAQVVRLGDTPHLEGIIGVLKVMLDAYGEG
FT                   EIDELYVAHNEFVNTMTQKPKLECLAPIKAEELSDELKGHWDYLYEPDAKTVLDALITR
FT                   YIESLVFQGLVENNACEQAARMVAMKSASDNAGKLIKELQLIYNKARQAAITQEIAEIV
FT                   GGAAAV"
FT   gene            9293..10675
FT                   /gene="atpD-1"
FT                   /locus_tag="MCA0012"
FT   CDS_pept        9293..10675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD-1"
FT                   /locus_tag="MCA0012"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by similarity to SP:P43715; match to
FT                   protein family HMM PF00006; match to protein family HMM
FT                   PF00306; match to protein family HMM PF02874; match to
FT                   protein family HMM TIGR01039"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90743"
FT                   /db_xref="GOA:Q60CR4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60CR4"
FT                   /protein_id="AAU90743.1"
FT                   /translation="MSSGKIVQIIGAVVDAEFPRESLPKIYDALRVDEVGLVLEVQQQL
FT                   GDGVVRCIAMGSTDGVRRGVTVTNTGAPISVPVGTETLGRIMNVLGDPIDEKGPIGEKE
FT                   RWGIHRKAPSYQDQAAANELLETGIKVIDLICPFAKGGKVGLFGGAGVGKTVNMMELIR
FT                   NIAIEHSGYSVFAGVGERTREGNDFYHEMKESNVLDKVSLVYGQMNEPPGNRLRVALTG
FT                   LTIAEKFRDEGRDVLLFIDNIYRYTLAGTEVSALLGRMPSAVGYQPNLAEEMGILQERI
FT                   TSTKTGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRQIAELGIYPAVDPLDSTS
FT                   RQLDPLVIGHEHYETTRRVQSTLQRYKELRDIIAILGMDELSENDKLIVSRARKIQRFL
FT                   SQPFFVAEVFTGSPGKYVPLKDTIAGFKGIVDGDYDDVPEQAFYMVGSIDEALEKAKRL
FT                   AA"
FT   gene            10701..11123
FT                   /gene="atpC-1"
FT                   /locus_tag="MCA0013"
FT   CDS_pept        10701..11123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC-1"
FT                   /locus_tag="MCA0013"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by similarity to SP:P00832; match to
FT                   protein family HMM PF00401; match to protein family HMM
FT                   PF02823; match to protein family HMM TIGR01216"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90742"
FT                   /db_xref="GOA:Q60CR3"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60CR3"
FT                   /protein_id="AAU90742.1"
FT                   /translation="MAMTMHVDIVSAEGEIFSGQAELVVAPGQEGEVGIAARHAPFLSP
FT                   LKPGEVRVKSEGQEPLSFYVSGGMLEVQPYLVTILSETAVRAKDIDEAAAQEAKRAAEE
FT                   ALADRSGRMEYAKAQAQLAEAVAQLRTLENYRKGRA"
FT   gene            11242..12627
FT                   /gene="glmU"
FT                   /locus_tag="MCA0014"
FT   CDS_pept        11242..12627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="MCA0014"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /EC_number="2.7.7.23"
FT                   /note="identified by similarity to SP:P17114; match to
FT                   protein family HMM PF00132; match to protein family HMM
FT                   PF00483; match to protein family HMM TIGR01173"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90741"
FT                   /db_xref="GOA:Q60CR2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60CR2"
FT                   /protein_id="AAU90741.1"
FT                   /translation="MEVIALILAAGQGTRMRSGLPKVLHRIGGLCLLEHVYRLAAALEV
FT                   RETVIVYGHGGEQALSALGHLPATWIEQKKRRGTGHAVMQAVDRIGDDSTVLVLYGDVP
FT                   LLRRETVETLLHHAGESSLGLLTVELDNPTGYGRIIRDASGRVLRIVEEKDATPEERAV
FT                   REVNTGILAVEGAPLKRWLKALRNDNAQGEYYLTDIVAMAVAEGYFIDATHPTSPDEVL
FT                   GVNDRRQLAELERIYQVHQARALMERGVTLRDPARFDLRGEIVELGRDVEIDVNVILEG
FT                   RIALGDEVRIGPNVYLKDTVIGPGVAVLANSVIEGAVIGAGSRVGPFARLRPESVLAEG
FT                   VHIGNFVEVKQSDIAVGSKVNHLSYIGDASIGRGVNVGAGTITCNYDGVAKHRTIIEDG
FT                   AFIGSDTQLVAPVRVGRNATIGAGSTITRDTPEDCLTLSRARQLSVEGWKRPEKARKES
FT                   CAE"
FT   gene            12615..14447
FT                   /gene="glmS"
FT                   /locus_tag="MCA0015"
FT   CDS_pept        12615..14447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="MCA0015"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /EC_number="2.6.1.16"
FT                   /note="identified by similarity to SP:P17169; match to
FT                   protein family HMM PF00310; match to protein family HMM
FT                   PF01380; match to protein family HMM TIGR01135"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90732"
FT                   /db_xref="GOA:Q60CR1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CR1"
FT                   /protein_id="AAU90732.1"
FT                   /translation="MCGIVGAVAHRNVTPILLEGLRRLEYRGYDSAGIAVIAADGSLER
FT                   VRRPGKLRELEAALESALVEGETGIAHTRWATHGVPSERNAHPHVCRERVAVVHNGIIE
FT                   NHEALRRQLQQKGYEFLSETDTEVVVNQIHDFLEQGFPLLEAVRATVGILEGAYAIGVV
FT                   STCEPGRLIAARKGSPLVVGLGESENFVASDVFALVGETQRFVFLEEGDLVELTTESVR
FT                   VYGKDGGRVERPVHETRLAPDSVERGEYRHYMQKEIHEQPVAVEKTLSGRIHQGKVLSA
FT                   AFGERAEAAFEHVRAVQIVACGTSYHAGKVARYWFEALAGLPCSVEVASEFRYRRQVVQ
FT                   PGTLFVTISQSGETADTLAALKAAKELGYAHTLAICNVPESSIVRESDSCLMTRAGPEI
FT                   GVASTKAFTTQLTALLLLVLALGRRHALAAEQEAKIVRELETLPAQIRHVLQLEDEIAA
FT                   WAELFGEKHHALYLGRGAQYPVAMEGALKLKEISYIHAEAYPAGELKHGPLALIDNEMP
FT                   VVAVAPNNELLEKLKSNLQEVQARGGELYVFADAEAPIENVPGVRILRVAETDEVVAPI
FT                   VYSVPLQLLAYHVALIKGTDVDQPRNLAKSVTVE"
FT   gene            14534..16618
FT                   /gene="metG"
FT                   /locus_tag="MCA0016"
FT   CDS_pept        14534..16618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metG"
FT                   /locus_tag="MCA0016"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /note="identified by similarity to SP:P00959; match to
FT                   protein family HMM PF00133; match to protein family HMM
FT                   PF01588; match to protein family HMM TIGR00398; match to
FT                   protein family HMM TIGR00399"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90731"
FT                   /db_xref="GOA:Q60CR0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60CR0"
FT                   /protein_id="AAU90731.1"
FT                   /translation="MTSPRKILVTSALPYANGPIHLGHLVEYIQTDIWVRFQKMRGHDC
FT                   RYVCADDTHGTPIMLRAEKEGISPEELIARVHGEHLRDFTGFHIEFDNYYSTHSEETRA
FT                   HAADIYGRLKDRGLIESRAIEQYFDPVKEMFLPDRFIKGECPKCHAKDQYGDSCEVCGT
FT                   TYSPTDLINPYSVVSGAAPVRRESVHYFFKLGECAEFLKDWTRSGALQTEAANKLNEWF
FT                   EAGLSDWDISRDAPYFGFEIPDAPGKYFYVWLDAPIGYMGSFQNLCDRLGLDFAEYWKK
FT                   DSEAELYHFIGKDILYFHALFWPAMLEHSGFRTPTRIFAHGFLTVNGEKMSKSRGTFIT
FT                   AQSYLEQGLNPEWLRYYYACKLNGTMEDIDLSLEDFVARVNSDLVGKYINIASRTAGFV
FT                   TKFFDGRLDVPMQLADGEALDFLIDRLRDSAEEISGYYDSRDYNKAIRKIMELADEVNI
FT                   FVNEKKPWEIAKRDDSYSRGYLRVVCAITLNLFRLLTIYLKPILPRLAEAVEGFLKIPS
FT                   LTWQDAQTLLPQGHTINDYQHLMTRIDPKQVDALVEANRQSLQATAGQPEPHSQVRHAE
FT                   HQQRQVQPIAETISIDDFAKVDLRIARIANAEHVEGADKLLKLTLDLGGETRTVFAGIK
FT                   SAYAPETLIGRLTVMVANLAPRKMKFGLSEGMVLAAGPGGGDIFLLSPDEGAQPGMKVK
FT                   "
FT   gene            16626..17981
FT                   /gene="bioA"
FT                   /locus_tag="MCA0017"
FT   CDS_pept        16626..17981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioA"
FT                   /locus_tag="MCA0017"
FT                   /product="adenosylmethionine--8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /EC_number="2.6.1.62"
FT                   /note="identified by similarity to SP:P22805; match to
FT                   protein family HMM PF00202; match to protein family HMM
FT                   TIGR00508"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90730"
FT                   /db_xref="GOA:Q60CQ9"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CQ9"
FT                   /protein_id="AAU90730.1"
FT                   /translation="MGSAGRQWMERDLAVLWHPCSQMKDHESLPLIPIRRGEGVWLEDF
FT                   DGRRYLDAISSWWVNLFGHCHPAINAALADQLGRLEHVIFAGFSHEPGIRLAERLVDIT
FT                   PPGLERCFYADNGSAAVEVALKMSFHYWRNRGRPGKTRFVTLENSYHGETLGALAVGDV
FT                   PLYKETYRPLLMEAVAAPSPDAYGREPGETEAGYAERRFRDMLAILERGADEICAVIVE
FT                   PLVQCAGGMRMYDPLYLRLLRAACDRLGIHLIADEIAVGFGRTGTLFACEQAGISPDFL
FT                   CLSKGLTGGYLPLAAVLTRPEIYAAFYDDYGTLKAFLHSHSYTGNPLACRAALATLELF
FT                   DATDVLGRNRELARCMADATERFQEHPHVAEVRQRGMILAIEMVKDKTTREPYPWQERR
FT                   GLRVYRRALERGVLLRPLGNVIYFMPPYLITPEQIRLMAEVAWEGLLVAAED"
FT   gene            17988..18719
FT                   /locus_tag="MCA0018"
FT   CDS_pept        17988..18719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0018"
FT                   /product="conserved hypothetical protein TIGR00046"
FT                   /note="identified by match to protein family HMM PF04452;
FT                   match to protein family HMM TIGR00046"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90729"
FT                   /db_xref="GOA:Q60CQ8"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CQ8"
FT                   /protein_id="AAU90729.1"
FT                   /translation="MRISRLYLPVPLASGADVVLDGERAHYLRTVLRLKRGFDLTVFNG
FT                   EGGEFAARIGVCHREAVSLTVGAHRPDDRESRLDVRLGLGISRGERMDLAIQKAVELGV
FT                   GAITPLFTERCVVQLDGERKAQRLEHWRRVVWAACEQSGRNRVPEVLEPRSLEAWLPEA
FT                   AGLRICLDPHAVHGLRELAPPVGSVTLLSGPEGGFSDAERDMAVAAAFVPIRLGPRVLR
FT                   TETAALAALAAIQTLWGDMAV"
FT   gene            18756..19217
FT                   /locus_tag="MCA0019"
FT   CDS_pept        18756..19217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0019"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL03PA01045"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90728"
FT                   /db_xref="GOA:Q60CQ7"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CQ7"
FT                   /protein_id="AAU90728.1"
FT                   /translation="MILLALVLHVLSAVLWVGGMFFAHQVLRPVAAGLLQAPERLRLWN
FT                   AVFARFFPWVKGAIVLLFLTGFGLIHAYGGFGQVGWPVHLMLLIALSMTVIFGLIYARP
FT                   YQALKAAVAAEDWAVGAEALGVIRRLVGINLVLGLITAAVASGGSFLPI"
FT   gene            complement(19221..20051)
FT                   /gene="djlA"
FT                   /locus_tag="MCA0020"
FT   CDS_pept        complement(19221..20051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="djlA"
FT                   /locus_tag="MCA0020"
FT                   /product="DnaJ-like protein DjlA"
FT                   /note="identified by similarity to SP:Q45885; match to
FT                   protein family HMM PF00226"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90727"
FT                   /db_xref="GOA:Q60CQ6"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR023749"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CQ6"
FT                   /protein_id="AAU90727.1"
FT                   /translation="MSWLGKLLGGTFGFLLGGPLGALLGAAIVHKLDGGKDKYAQIESD
FT                   PSPDAQHRIQMAFFTATFSVMGHVARADGRVSEAEITVARTVMNRMSLSEGMRRTAIEL
FT                   FSRGKQPDFPLREAVEQFRKECHRRYALLRIFLEIQLEAAFADGPVNQAEERVLLDICD
FT                   RLRISRFEYHAMKGRLDAALRFARAYQNSSYGGHRNTPARRREDTLEDAYAMLGIEASA
FT                   GADEVKRAYRKLISRHHPDKLVARGMPEEMVRIANEKTQQIRKAYEVIAAARNL"
FT   gene            20139..21032
FT                   /gene="purC"
FT                   /locus_tag="MCA0021"
FT   CDS_pept        20139..21032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="MCA0021"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="identified by match to protein family HMM PF01259;
FT                   match to protein family HMM TIGR00081"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90726"
FT                   /db_xref="GOA:Q60CQ5"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60CQ5"
FT                   /protein_id="AAU90726.1"
FT                   /translation="MTAPETLFESSLSSLRLKARGKVRDIYEAGDDLMLIVTTDRLSAF
FT                   DVILPDPIPGKGRVLTRVSRFWFERLKDRVPNHLSGTPLEAVLPDPAEREQVEGRAMVV
FT                   KRLRPLPVEAVVRGYLIGSGWKDYQRSGAVCGIGLPSGLRLAERLPDALFTPSTKAEMG
FT                   SHDENIGFDQVVGLIGRELAERMREVALGLYREAAAYALDRGIIIADTKFEFGVDEAGV
FT                   LHWIDEALTPDSSRFWPADGYRPGISPPSFDKQFVRDYLETLEWDKKPPAPHLPPDILA
FT                   RTAEKYREAERRLTGE"
FT   gene            complement(21053..22330)
FT                   /gene="cca"
FT                   /locus_tag="MCA0022"
FT   CDS_pept        complement(21053..22330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cca"
FT                   /locus_tag="MCA0022"
FT                   /product="tRNA nucleotidyltransferase"
FT                   /EC_number="2.7.7.72"
FT                   /note="identified by similarity to SP:P06961; match to
FT                   protein family HMM PF01743; match to protein family HMM
FT                   PF01966"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90718"
FT                   /db_xref="GOA:Q60CQ4"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR012006"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60CQ4"
FT                   /protein_id="AAU90718.1"
FT                   /translation="MKAFLVGGAVRDRLLGLPVRERDWVVVGESPETMIARGFRPVGRD
FT                   FPVFLHPETHEEYALARTERKTAPGYRGFVVHAAPDVTLEQDLERRDLTINAMAETPDG
FT                   RLVDPFGGRRDLEARLLRHVSSAFAEDPVRILRVARFTARLTPLGFRVAPETLVEMRRM
FT                   VEAGEVDALVPERVWAEFAKALAEPAPSAFFRTLRDCGALKRLFPEIERLFGVPQPPRH
FT                   HPEIDTGVHTLMVLDQAARLTADPSARFAALTHDLGKALTPPELWPSHRGHERLGLGAL
FT                   NTLCDRFRAPNAFRRLAEKVMRYHGLCHRAAELRTSTLVDLLDRLGALKRHDDTLEPFL
FT                   LACEADARGRAGFEERPYPQADWLREAQRAAVSVDSRPLIEQRLQGPAFGRALRQLRIA
FT                   AVRRLRAARSPATPAGRLPHPQGEGE"
FT   gene            22396..23280
FT                   /locus_tag="MCA0023"
FT   CDS_pept        22396..23280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0023"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to OMNI:NTL03PA00341; match
FT                   to protein family HMM PF01925"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90717"
FT                   /db_xref="GOA:Q60CQ3"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CQ3"
FT                   /protein_id="AAU90717.1"
FT                   /translation="MYTTLTFYLAFGALAGVASGLFGIGGGAIIVPFLVWLFPGQGVPE
FT                   SILMIMAVATSLATIVVTSVASVRAHHRRGAVVWPLVWRLVPGIALGTVAGSIVADHLP
FT                   TRQFERLFAVFLMLVAVQVYRGRREETAGEKPVPPGVMTGGGIMIGLLSALFGIGGGSI
FT                   TVPFLLRCRQNIRHAVAVSSACGFPIAVVGTLSYVVLGWGHPSLPAHSLGYIYWPAFLG
FT                   IGAASVLTAPYGAALAHRLPMRGLKRLFAAVLFLLGARMLARSADPSWLAVLNEGLGTA
FT                   AASAQRLKSFLGP"
FT   gene            complement(23287..23994)
FT                   /gene="pgl-1"
FT                   /locus_tag="MCA0024"
FT   CDS_pept        complement(23287..23994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgl-1"
FT                   /locus_tag="MCA0024"
FT                   /product="6-phosphogluconolactonase"
FT                   /EC_number="3.1.1.31"
FT                   /note="identified by similarity to GP:4558604; match to
FT                   protein family HMM TIGR01198"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90716"
FT                   /db_xref="GOA:Q60CQ2"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CQ2"
FT                   /protein_id="AAU90716.1"
FT                   /translation="MTEIRWFDDNTSLAPALAAAVAEDVRAALATDPAAILAVSGGRSP
FT                   VPVFEALREADLDWARVIVTLVDERWVPETDPASNAALVKTHLLQGKAAAARFLPLYTG
FT                   DASAAAAETRLARSFAELPRPFAALILGMGDDGHTASLFPASPNLEAGLALGGTVENTP
FT                   PCLAQVGAIAPTERVSLTLPWILDARHIYLQFGGAGKVEVFNAALAGPNRQYPVSFVLA
FT                   QTRTPVTVFAARS"
FT   gene            complement(23996..25483)
FT                   /gene="zwf-1"
FT                   /locus_tag="MCA0025"
FT   CDS_pept        complement(23996..25483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zwf-1"
FT                   /locus_tag="MCA0025"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="identified by similarity to SP:P22992; match to
FT                   protein family HMM PF00479; match to protein family HMM
FT                   PF02781; match to protein family HMM TIGR00871"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90715"
FT                   /db_xref="GOA:Q60CQ1"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CQ1"
FT                   /protein_id="AAU90715.1"
FT                   /translation="MSAVSQLPFPESFNMVFFGGAGDLVTRKLLPAMYQCHKNGLLVEA
FT                   GHILCVDRQDLSEEAFLELADEKACQFIPTADWDAAVWAGFRQRLAYLRIDATQPEQYA
FT                   PLKERLKKAPAAVTVFYLSTAPSLFATICAHLTRQGLNGPHSRVVLEKPLGHDLASANA
FT                   ITADVDRYFHENQVYRIDHYLGKESVQNLMALRFGNALFEPLWRRMWIRDVQITIAEDV
FT                   GIGSRAGFYDKAGALRDMVQNHLLQLLCFVAMEPPASLDSNAIRNEKLKVLESLVPFTE
FT                   EDVHQKTVRGQYRAGICGGKAVPGYLEEEGIPPGSHTETFVAIKAEIANWRWAGVPFYL
FT                   FTGKRLPERLAEIVIHFHDVPHPIFPLPKSGACAPAKLVIRLQPDEFIRLYLYAKQPGD
FT                   SMELQPVSLDLNFAEQFKVRRAEGGYERLLLDAIRGNQALFVRHDEQEQAWRWVEPILN
FT                   TWANDPKGPEPYAAGTWGPAASLDLLRRDGICWHEGK"
FT   gene            complement(25693..28341)
FT                   /locus_tag="MCA0026"
FT   CDS_pept        complement(25693..28341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0026"
FT                   /product="putative type III restriction-modification
FT                   system, R subunit"
FT                   /note="identified by similarity to SP:P08764; match to
FT                   protein family HMM PF04851"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90714"
FT                   /db_xref="GOA:Q60CT5"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CT5"
FT                   /protein_id="AAU90714.1"
FT                   /translation="MLGHQRDVSAILSTLQAEFPTLTDFERDFPSLCFALATGVGKTRL
FT                   MGAFIAYLHLAHGINNFFVLAPNLTIYNKLITDFTRNTPKYVFKGIAEFAQQPPLIITG
FT                   DNYDQTGAAVDDQSVGFAFDVRINIFNISKINSEVRGGREPRIKRMREVLGDSYFNHLA
FT                   NLPDLVLLMDESHRYRASAGVRAINELKPLFGLEVTATPFVESSRGPVPFKNVVMDYPL
FT                   ARAMEDGFVKEPAVVTQRNFKASDHTPDEVEKIKLEDGVRLHETTKVELLTYARENGVK
FT                   PVKPFMLVIARDTTHAVQLKSLIESAQFYEGRYAGKVIQVDSSRTGAEEEEMITRLLAV
FT                   ESVDEPTEIVIHVNMLKEGWDVTNLYTIVPLRAANARTLIEQSIGRGLRLPYGRRTGVA
FT                   AVDRLNIVAHDKFQEIIDEANRGDSPIRLKQVILDAPSASDKKVSVQVSSGAAVRLGLS
FT                   TLTPTPLPKGEGLALPSPASGRGAGGEGPVFTTEAEKQAARAVMEVIGKYEVRRDLVPT
FT                   SSALLKPEVQQEILAEVAERLKPVQGNLLAGVDDATPALDLSSVVAKTTEIVVQQTIDI
FT                   PRIAVVPKGEVTTGFRPFTLDVSQLRLQPGEREIVGQMLRTNEQFTLAAEIGLKEQRPE
FT                   DYIVHALVDFDDIDYFTHADLLYDLAGQMVRHLQSYLSEAETVSVLDRDRRLIAREIHA
FT                   QMMAHFFEEATEFEVQVSRGFTELKPCNYTATAGQAPRHFRETVEDVGAIRQMLFGGFT
FT                   KCLYPLQKFDSDSERRFAVILERDASRWFKPAKGQFQIYYKLGTEQPEYIPDFVAETDT
FT                   TIFMVETKARADLDTQEVQAKAAAAVQWCGHASEYTASVQGKPWKYLLLPHDEVDESRR
FT                   LTDLLRFRITA"
FT   mobile_element  complement(28437..29826)
FT                   /mobile_element_type="insertion sequence:IS28"
FT   gene            complement(28538..29773)
FT                   /locus_tag="MCA0027"
FT   CDS_pept        complement(28538..29773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0027"
FT                   /product="ISMca5, transposase"
FT                   /note="identified by match to protein family HMM PF00872"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90713"
FT                   /db_xref="GOA:Q609L4"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q609L4"
FT                   /protein_id="AAU90713.1"
FT                   /translation="MPSKKKPAAAGMTALPSIPHELIEQLTGGATPMTAEQINATTMAL
FT                   KKALIERALGAELSYHLGYPPGSARPEDAANQRNGKSAKTVLTQDGPLRIEVPRDRAGS
FT                   FEPILIPKHERRFTGFDDKIVAMYARGMTVREIQGFLAEQYGTEVSPEFISCVTDEVMA
FT                   EVTAWQGRPLEPMYPVVFFDCLRVKIREDAVVRNKAIYLALGVLPDGTRDILGLWIENT
FT                   EGAKFWMKVFNDLKTRGVADILIAVTDGLKGIPEALGAVFPATTLQTCIVHLIRNSLDY
FT                   ASWKDRKALAAALKPIYTAPSAEAAAVELDALEAGPWGQKFPTVVATWRRAWDRVIPFF
FT                   AFSPAVRRVIYTTNAIESLHSQLRKIIKTRGHFPNDEAATKLLWLALRNITADWGRAAR
FT                   EWKDAMNQFAIA"
FT   gene            complement(29878..30168)
FT                   /locus_tag="MCA0028"
FT   CDS_pept        complement(29878..30168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0028"
FT                   /product="nucleotidyltransferase family protein"
FT                   /note="identified by similarity to GP:19913854; match to
FT                   protein family HMM PF01909"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90712"
FT                   /db_xref="GOA:Q60CT3"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CT3"
FT                   /protein_id="AAU90712.1"
FT                   /translation="MNRKDAMRKIAAAKPELQRRFGVTRLALFGSTARDEARADSDIDV
FT                   LVAFDGPASAARYFGVQFYLEDVLGSPVDLVTEKALRPALKTIIEAEVVDV"
FT   gene            complement(30165..30551)
FT                   /locus_tag="MCA0029"
FT   CDS_pept        complement(30165..30551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0029"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to OMNI:NMB1852; match to
FT                   protein family HMM PF04480"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90703"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CT2"
FT                   /protein_id="AAU90703.1"
FT                   /translation="MNQLERAKFLRANQTEADQQLWYHLRARRFMGLKFKRQKPIGSYI
FT                   ADFVCMEYGLVIEVDGGQHGGESDRRRDAWFREHGFTVLRFWNNEVLGETAAVLERIRV
FT                   EILALSPGPSPASGRGEKNQEAMA"
FT   gene            complement(30697..32350)
FT                   /pseudo
FT                   /locus_tag="MCA0030"
FT                   /note="DNA methyltransferase domain protein, truncation;
FT                   comparison of this gene to its homologs suggests this gene
FT                   has been truncated; identified by similarity to
FT                   OMNI:NTL01XF01969"
FT   mobile_element  32385..33564
FT                   /mobile_element_type="insertion sequence:IS30"
FT   gene            32445..32984
FT                   /locus_tag="MCA0031"
FT   CDS_pept        32445..32984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0031"
FT                   /product="ISMca6, transposase, OrfA"
FT                   /note="identified by similarity to OMNI:PG0277"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90851"
FT                   /db_xref="GOA:Q607Y9"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:Q607Y9"
FT                   /protein_id="AAU90851.1"
FT                   /translation="MSALKQSLLAIPDHRRAQGRLFDLPHMLLFSILAIMSGATSYRRI
FT                   HQFLHTHQAALNAAFGCRWRRTPAYSSIRYALQGLDVQALAPHFRAHAARLAEGAAVIA
FT                   LDGKTLRGSLDRFEDRKAAQVLSAFATEERIVLGQILIEDAGKDHEIQAAQRLIETLGL
FT                   SGRLYTLDALHLQKNG"
FT   gene            32956..33549
FT                   /locus_tag="MCA0032"
FT   CDS_pept        32956..33549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0032"
FT                   /product="ISMca6, transposase, OrfB"
FT                   /note="identified by similarity to OMNI:PG0277"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90850"
FT                   /db_xref="GOA:Q60CS8"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CS8"
FT                   /protein_id="AAU90850.1"
FT                   /translation="MPSTFKKTVETVLATGNDLLVQLKGNHPKLLAAVRTLCQSRAHAE
FT                   QSYTVDLGRRNRIEQRTVRLWPLPPGSGTDPWHDHFQTVIEGQRQIEVFNPYHRRFEPR
FT                   QESPAYYLATCTASAATLAQVIRGHWAIENRLHHVLDVSLGEDSSRIRRNPGVFALLRH
FT                   FALNLLRHNGQANIRSALYDNAICLHRLLAYDGI"
FT   gene            complement(33699..34586)
FT                   /locus_tag="MCA0033"
FT   CDS_pept        complement(33699..34586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0033"
FT                   /product="DNA-damage-inducible protein D"
FT                   /note="identified by similarity to SP:P23840"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90849"
FT                   /db_xref="GOA:Q60CS7"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CS7"
FT                   /protein_id="AAU90849.1"
FT                   /translation="MPKKTDIAIAGPSFEDLKQTNAHGAEYWSARELQPLLGYSQWRRF
FT                   EQAIERAITSCKESGNSPEHHFAGAGKPITGGKGAVQVVDDYHLSRFACYLIAQNGDPR
FT                   KPEIAQAQKYFAIQTRRQELSDQAAADLERLELRKQTAEEFKALSGAAQQAGVQSKMFG
FT                   VFHDAGYKGLYGGLGRDAIKQRKAIPDKDNLLDRMNATELAANQFRMTQTRDKLARDGV
FT                   RSQAQAIQTHEQVGREVRAAIQRIGGTLPEDIPAAEHIKEVEKRLKSATPRLTLDERDA
FT                   GGLTGGKPDKNETP"
FT   gene            complement(34606..35553)
FT                   /locus_tag="MCA0034"
FT   CDS_pept        complement(34606..35553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0034"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90848"
FT                   /db_xref="GOA:Q60CS6"
FT                   /db_xref="InterPro:IPR032359"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CS6"
FT                   /protein_id="AAU90848.1"
FT                   /translation="MSKPSPKAVLKTIKGYELDKWTATFWLVKRSMANREARYTVLRVN
FT                   TDAKLQKRLKGYITSQLQGKDFHLAEYDYSNADGDDTLFTIAADATDFPQVEKEINAGF
FT                   NNAIAKDYAELLNSWAYVIQIEQGNEKLFAWRKISTLTQPKKVESRRATFFVEHKLIDV
FT                   EDKEVFLIDPRFDFFVHDGTVFIANKREFETSMNFREGMKAKAAEVIQNFTDSGHFRHV
FT                   DLIQKYVGDNLHHLRKMASILKAGYYQQPDYIQRLIEVSKEEGWALKVENGQIVVEEDS
FT                   IELLLKLLNNDRLRSPINNETFDAAAKAPVKKSS"
FT   gene            complement(35550..36155)
FT                   /locus_tag="MCA0035"
FT   CDS_pept        complement(35550..36155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0035"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90847"
FT                   /db_xref="GOA:Q60CT1"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CT1"
FT                   /protein_id="AAU90847.1"
FT                   /translation="MSTPAVADPSLRLRPWASLVLFLSAYSPLMLILIIKDYDAVNPGW
FT                   LPQNPVFSGTLLLVAVFSSLAVLRSVKEIDGGLTVTVTKASNKSGDMFGYTIPYMLSFM
FT                   KVDLGDWQTIVSLVLFLGILFIMAYRTQTVFVNPILALAGYMLIDCTFRRGDKEIQAMV
FT                   VTRQPLAVGDTCRLERLSHYLYVAARDSSTPEEKRGKA"
FT   gene            complement(36152..37243)
FT                   /locus_tag="MCA0036"
FT   CDS_pept        complement(36152..37243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0036"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90846"
FT                   /db_xref="GOA:Q60CT0"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CT0"
FT                   /protein_id="AAU90846.1"
FT                   /translation="MDFERRIADIYQNCRNPDEIKASFEQLQLDLSSEINEAMVKTRQI
FT                   LLENFDEEVQDKLRVRAEDSRSARNRFERLLMDLTRAELAGCADFDDDGFNLRCEPDGI
FT                   EASGLSGIELGRYELPRRSGEAHLYRIHHPLAQWVTQQAKSRKLDVAKLMFDYDAYGTR
FT                   VSTLEPYRGKAGWLTCKLLIVEALGNQEQHLLVAATTTDGVVLAEDDPEKLLRLPATTR
FT                   AAGLFHDAGNAALAADLENRRTQLLREINQRNLGYFEQEVQKLDAWADDLKLGLEQEVR
FT                   EIDREIKEVRRTAATSPTLEEKLSWQKKQRELEGKRSKLRRELFLRQDEIEAQRNDLIS
FT                   QLEAQLQQQVEERTLFTVEWELT"
FT   gene            38085..39914
FT                   /gene="edd"
FT                   /locus_tag="MCA0037"
FT   CDS_pept        38085..39914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="edd"
FT                   /locus_tag="MCA0037"
FT                   /product="6-phosphogluconate dehydratase"
FT                   /EC_number="4.2.1.12"
FT                   /note="identified by similarity to SP:P25530; match to
FT                   protein family HMM PF00920; match to protein family HMM
FT                   TIGR01196"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90845"
FT                   /db_xref="GOA:Q60CU6"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004786"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CU6"
FT                   /protein_id="AAU90845.1"
FT                   /translation="MFLHQTLVDVTDRIRARSHDRRAAYLDLMHRARQKGVERSHIACT
FT                   NVAHAYAATPANDKLVLKAATVPNLGIVTAYNDMLSAHQPYERYPEIIKDEARRAGVTA
FT                   QVAGGVPAMCDGVTQGQTGMELSLFSRDVIALSTAVALSHRVFDANLYLGVCDKIVPGL
FT                   LIAALRFGHLPGVFVPAGPMVSGISNSEKAKVRQQFAEGKVGRDALLESEMASYHSAGT
FT                   CTFYGTANSNQMLLEIMGLQLPGSSFVNPGTPLRDALTRAATRVAVDLARDATAPALCH
FT                   IVDERVIVNAIVGLLATGGSTNHTIHLVAIARAAGIEVNWDDFNDLSAVVPLLARVYPN
FT                   GKADVNHFHAAGGMGFLVRELLDAGLLHEDVQTILGPGLRRWAEEPWLDNGTLAWRDAP
FT                   EKSHDPEVLAPAGEPFSPDGGLRLVTGNIGRGVIKVSAVAPENRVVRAPAIVFESQDEL
FT                   IAAFKRGELERDFVAVLRFQGPRANGMPELHQLTPALASLQDRGFKVALITDGRMSGAS
FT                   GKVPAAIHISPEAAMGGPLTLLRTGDTILLDAVRGKLEAEVPADRWALREPVTDDLSGN
FT                   RFGCGRELFSGFRHLADTPERGAFTFNFDDGVR"
FT   gene            39904..40569
FT                   /gene="eda"
FT                   /locus_tag="MCA0038"
FT   CDS_pept        39904..40569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eda"
FT                   /locus_tag="MCA0038"
FT                   /product="4-hydroxy-2-oxoglutarate
FT                   aldolase/2-deydro-3-deoxyphosphogluconate aldolase"
FT                   /EC_number="4.1.3.16"
FT                   /note="identified by similarity to SP:P10177; match to
FT                   protein family HMM PF01081; match to protein family HMM
FT                   TIGR01182"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90836"
FT                   /db_xref="GOA:Q60CU4"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CU4"
FT                   /protein_id="AAU90836.1"
FT                   /translation="MSARARSCNCKEKTMNLDQIIEATSVMPVMVVDRPEDAVPLARAL
FT                   VEGGIRVLEITLRTAAGLDAVKAIRREVPDAIVGVGTIATPAQLEASIAAGAQFGVSPG
FT                   TTPTLLKAIVDSRLPFFPGVATTSEVMQVLEGGLTVMKFFPAVAAGGVKMLESFRGPFP
FT                   QVRFCPTGGINAQNAPDFFKLPNVVCVGGSWLTPKDLVAAGNWAEITRLAREAAALKP"
FT   gene            40860..41498
FT                   /locus_tag="MCA0039"
FT   CDS_pept        40860..41498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0039"
FT                   /product="dihydroxyacetone phosphatase family protein"
FT                   /note="identified by similarity to OMNI:NTL02ML4093; match
FT                   to protein family HMM PF02734; match to protein family HMM
FT                   TIGR02365"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90835"
FT                   /db_xref="GOA:Q60CU3"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012737"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CU3"
FT                   /protein_id="AAU90835.1"
FT                   /translation="MPATPHLIPSVIQGAASAIQSHAEEVSALDQAIGDGDHVVNLQRG
FT                   LEALSQQAESLAALDWPAALQKIGMTLMASVGGASGSLYGTLFIAMGKAMKDREMNLAN
FT                   LAEAFGRGVEAMKARGKADRGEKTMLDVLIPVADVLKSAAEHAIAPGQLAEEVSRAAEA
FT                   GMESTRDMLATKGRASFLGERAIGHVDAGARSSQLMISAIAEVVAESAW"
FT   gene            complement(41511..42500)
FT                   /locus_tag="MCA0040"
FT   CDS_pept        complement(41511..42500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0040"
FT                   /product="dihydroxyacetone kinase family protein"
FT                   /note="identified by similarity to OMNI:NTL02ML4088; match
FT                   to protein family HMM PF02733; match to protein family HMM
FT                   TIGR02363"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90834"
FT                   /db_xref="GOA:Q60CU2"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR012736"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CU2"
FT                   /protein_id="AAU90834.1"
FT                   /translation="MKKFINTVEDFLDESLRGFALAHADIVDFSPEPRFVSRKAPARPG
FT                   KVALVSGGGSGHEPLHTGFVGLGMLDAACPGQVFTSPTPDQMLAAAQAVDHGGGVLFIV
FT                   KNYAGDVMNFEIAAEMLDIPHDSLLVHDDVSLPENRGMGRRGIAGTTVVEKIVGAAADA
FT                   GYDLAACKALGERVVHATASMGIALTSCTVPALGKPMFELGEREMEMGVGIHGERGRER
FT                   MALGSAGEIVDYIAAVIDEELKPRAGQPVLLHVNGFGGTPLIELHLVYGLAHRYWSGRG
FT                   VDIARSLVGNYTTSLDMAGCSLTLSLLDEEMLRLWDAPVHTAALRWGC"
FT   gene            complement(42530..43546)
FT                   /locus_tag="MCA0041"
FT   CDS_pept        complement(42530..43546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0041"
FT                   /product="oxidoreductase, Gfo/Idh/MocA family"
FT                   /note="identified by similarity to OMNI:NTL01BH3849; match
FT                   to protein family HMM PF01408; match to protein family HMM
FT                   PF02894"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90833"
FT                   /db_xref="GOA:Q60CU1"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CU1"
FT                   /protein_id="AAU90833.1"
FT                   /translation="MEIPTKLRWGILGAARVNERLMPTIVEASNSELVAIASRRPGAAA
FT                   ETLAKYAPHQQGVRCYDQPEVLLADDAVQAVYLPMANHEHAEWAVRALQAGKHVLCEKP
FT                   MALTAADIEAIATAARERGLTVMEGFMYRFHPQHARVQEIVRSGAIGEVRYARASYSFM
FT                   MRPARRYRLARDVRHGGGAMWDIGPYAVHSLRWCFEQDPVAVTAMAKYVESGADIATSG
FT                   VIDFGDGRRGHFDISFECARRSEYEITGTLGGVKCHTAWQNPGDIPVISWWTEDGRQCL
FT                   EQLPVANHFRLEIEHFADCVLNGKPPLLSLDDARTNCRTLVAALESAASGRTVRLDA"
FT   gene            43745..44251
FT                   /locus_tag="MCA0042"
FT   CDS_pept        43745..44251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0042"
FT                   /product="antioxidant, AhpC/Tsa family"
FT                   /note="identified by similarity to SP:Q9BGI1; match to
FT                   protein family HMM PF00578"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90832"
FT                   /db_xref="GOA:Q60CU0"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CU0"
FT                   /protein_id="AAU90832.1"
FT                   /translation="MTIRVGDRLPAGSLTECTEFDPATACPMNPRAVDVGEQARGKKLV
FT                   IFGVPGAFTPTCSVKHLPGFVANHDRLRAKGVDEIWCMAVNDGFVMAAWGREQKAGGKV
FT                   RMMADGSAEYAKKLGLERDLTANGMGIRCHRFAMIVDDGVVKYLGVEASGKFEVSNAEA
FT                   VLAHL"
FT   gene            44293..44721
FT                   /gene="rpiB"
FT                   /locus_tag="MCA0043"
FT   CDS_pept        44293..44721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiB"
FT                   /locus_tag="MCA0043"
FT                   /product="ribose 5-phosphate isomerase B"
FT                   /EC_number="5.3.1.6"
FT                   /note="identified by similarity to SP:P37351; match to
FT                   protein family HMM PF02502; match to protein family HMM
FT                   TIGR00689; match to protein family HMM TIGR01120"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90831"
FT                   /db_xref="GOA:Q60CT9"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CT9"
FT                   /protein_id="AAU90831.1"
FT                   /translation="MKIGIASDHAGFDYKERLRAWLASLGHEVVDYGCFSDERTDYPTW
FT                   IRPCAQAVAAGEVERGIVLGGSGNGEAIVANRVKGCRCGYCFNEETAYLTRWHNDANCI
FT                   AIGQRIVTLDMAKKIVETFLSTGFEGGRHIPRIVAIDA"
FT   gene            44934..45155
FT                   /locus_tag="MCA0044"
FT   CDS_pept        44934..45155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:17132485"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90830"
FT                   /db_xref="GOA:Q60CT8"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CT8"
FT                   /protein_id="AAU90830.1"
FT                   /translation="MFLKKKQNGHLVEILGLGDLFNPMHKMVPGRLHYGEELQDPEKFA
FT                   KSDLMFPSGEDLPRCWVDPHYRDSELKK"
FT   gene            complement(45165..45833)
FT                   /locus_tag="MCA0045"
FT   CDS_pept        complement(45165..45833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0045"
FT                   /product="endonuclease V"
FT                   /note="identified by similarity to SP:P32679; match to
FT                   protein family HMM PF04493"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90829"
FT                   /db_xref="GOA:Q60CT7"
FT                   /db_xref="InterPro:IPR007581"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60CT7"
FT                   /protein_id="AAU90829.1"
FT                   /translation="MGLALQHSHRWDLSPREAANLQTRLRPLVLAEDALPDEIRTVAGV
FT                   DVGFEDHGRITRAAVAVLDFPSLRPSDQAIVRRPTRFPYVPGLLSFRELPALLEALERL
FT                   NLLPGLILVDGHGYAHPRRFGIACHLGVLTGIPTIGVGKTRLVGTHGELAEDRGSWIPL
FT                   IDGDETVGAVVRTRRGVQPVYVSVGHRLSLPTAVDWVLRCTPRYRLPETTRQAHRLASA
FT                   "
FT   gene            complement(45837..46625)
FT                   /locus_tag="MCA0046"
FT   CDS_pept        complement(45837..46625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0046"
FT                   /product="MazG family protein"
FT                   /note="identified by similarity to OMNI:CC1747; match to
FT                   protein family HMM PF03819; match to protein family HMM
FT                   TIGR00444"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90819"
FT                   /db_xref="GOA:Q60CT6"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CT6"
FT                   /protein_id="AAU90819.1"
FT                   /translation="MQQTRRLLDIMARLRDPDTGCPWDLRQDFASLVPYTLEEAYEVAD
FT                   AIERGDFTDLRDELGDLLLQVAFHSRMAEERGLFDFEAVAAAIADKLERRHPHVFAGID
FT                   FASDAERLRHWETSKLEERSEKNGQTGGSVLEGVATALPALMEAHKLQKRAARHGFDWD
FT                   ASAAVLSKVREELDELEQAVASGDTAHVREEMGDLLFALVNLARHLDVDAETALREGNR
FT                   KFRRRFRFIEDCVSRSGKRLTDCTLAELDAFWDEAKRAGH"
FT   gene            complement(46628..47560)
FT                   /locus_tag="MCA0047"
FT   CDS_pept        complement(46628..47560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0047"
FT                   /product="carbohydrate kinase, PfkB family"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90818"
FT                   /db_xref="GOA:Q60CU5"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CU5"
FT                   /protein_id="AAU90818.1"
FT                   /translation="MSALICGSMAYDTIMVFQDRFKHHILPDQVHILNVSFLVPELRRE
FT                   YGGCAGNIAYNLKLLGHDPLPMATVGKDFGPYAQWLACCGIRRDYIRTVEDSYTAQAYI
FT                   TTDMDDNQITAFHPGAMSFSHLNDVPTDAGIRLGIVAPDGKDGMLQHARQFADAHIPFI
FT                   FDPGQGMPMFDGEELLKFVELANWVTLNDYEARLMQERTGLNPARLAERVDAVIVTRGA
FT                   GGSLIYAAGACHEIPAARPNAVLDPTGCGDAYRAGLIYGLLEDLDWVTTGRIASLMGAI
FT                   KVETAGTQNHSFSLEAFRERFRENFDYAF"
FT   gene            complement(47616..47978)
FT                   /gene="dgkA"
FT                   /locus_tag="MCA0048"
FT   CDS_pept        complement(47616..47978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgkA"
FT                   /locus_tag="MCA0048"
FT                   /product="diacylglycerol kinase"
FT                   /EC_number="2.7.1.107"
FT                   /note="identified by similarity to SP:P00556; match to
FT                   protein family HMM PF01219"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90817"
FT                   /db_xref="GOA:Q60CV3"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033718"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CV3"
FT                   /protein_id="AAU90817.1"
FT                   /translation="MAGQNLKGFARLYAAFINSLAGVRATWHHEEAFRQECWLTLAGVP
FT                   LGLWLGETGIERALLVGVLINVLIVELLNTAVEVTIDRIGIERNNLSGRAKDIGSAAVL
FT                   SSLVLAGSVWFLILIR"
FT   gene            48224..50446
FT                   /locus_tag="MCA0049"
FT   CDS_pept        48224..50446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0049"
FT                   /product="cellulose-binding domain protein"
FT                   /note="identified by match to protein family HMM PF00553"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90816"
FT                   /db_xref="GOA:Q60CV2"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CV2"
FT                   /protein_id="AAU90816.1"
FT                   /translation="MDTKHSGYFKNSLWLLVLGSCAWAASSVSAWAADGCSFEYIITSQ
FT                   AANTFSASVRVTNTGSALSGWTVAWNMPGGQKITRLWDGKWSQRLSAVTVRNLESNRKV
FT                   ASGGVIQFGFDATYSGVNGIPAAMTLNGAQCSSTPTPTPTPTPTPTPTPTPTPTPTPTP
FT                   TPGPAANPIGINITGLSYYGTEVPFLNLFKLSEPWLTQCDAYQDPNCSTFVEAGGSSWN
FT                   TREQAKLILDSNGYPRSLPDPAQGAASGTNYTSVATLVPTGLNSATPAGRFIVLYDGEG
FT                   TLAYGRGASRNASLSSPGRDVIDVSTDGIQTWIQVSIKATDPNKTGNHIRNLRLLQAGG
FT                   VCSNDPAAYCDPSAAQSGCASGGSCRSFEQVYPTQPFDPRFLRNLAGFKAVRFMAFQNT
FT                   NDSQVELWADRTLPDDVTWVSERGDGGPVEMAVALGNQLGADIWVNMPTHADDGYVRSF
FT                   ATLVKNTLAASRKVYVEYSNEAWNGAFSAGSWMENQALTRWAGASDTPFGKRLQWYGMR
FT                   TAQICDIWKAVWGASFSRVVCVLGAQAANPWTARQALDCPLWAAENGGASCVQHGIRAL
FT                   AIAPYFGYYLGLPENRTVVDAWTGQADGGLASLFAELLQGGSFVNGPAGGALEDARRQM
FT                   LQYKAVAAEYGLELVAYEGGQHLAGVGAVVDDNAVTDLFVAANRDGRMGPVYSRHLNDW
FT                   SAAGGGLYNLWNSVEPYSKWGAWGLLEYRDQGGAPKYDAVKSLLSP"
FT   mobile_element  50444..51785
FT                   /mobile_element_type="insertion sequence:IS12"
FT   gene            complement(50597..51697)
FT                   /locus_tag="MCA0050"
FT   CDS_pept        complement(50597..51697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0050"
FT                   /product="ISMca1, transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90815"
FT                   /db_xref="GOA:Q60CL0"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CL0"
FT                   /protein_id="AAU90815.1"
FT                   /translation="MRGTQNFQGAMFSYISLEERVPARHPLRKLRALVDALLASMSAEF
FT                   EAVYARRGRPSVPPEMLLKALLLQILFSIRSERLLVEAIDYNLLYRWFVGLNLEDKVWD
FT                   HSTFSANRQRLFNEDLARVFFERVKYTADWAKLIGDEHFSVDGTLIEAWASQKSFKRKD
FT                   ASGSDDGAPPQGRNPEVDFKGETRRNDTHASTTDADARLFKKAAGDKSRLCHMGHILMD
FT                   NRHGLVVDVEITHASGTAERQAALKMLQRQKRKAGRLTVGADKGYDCRAFVQGCRKLGI
FT                   TPHVAAKAKHSAIDGRTQRHEGYKVSLRVRKRIEEAFGWIKTVGGLAKTKLIGHAKLAG
FT                   QALMCFAAYNLVRMGSLGGWWDAHHA"
FT   gene            complement(51863..52246)
FT                   /gene="gcvH"
FT                   /locus_tag="MCA0051"
FT   CDS_pept        complement(51863..52246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvH"
FT                   /locus_tag="MCA0051"
FT                   /product="glycine cleavage system H protein"
FT                   /note="identified by similarity to SP:P23884; match to
FT                   protein family HMM PF01597; match to protein family HMM
FT                   TIGR00527"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90814"
FT                   /db_xref="GOA:Q60CU8"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60CU8"
FT                   /protein_id="AAU90814.1"
FT                   /translation="MSNLPAGLKYAKTHEWARLEADGTVKVGISDHAQEALGDLVYLEL
FT                   PAVGRRVHAGEACAVVESVKAAADVNSPLSGEIVARNEALADAPERVNQSPYEAWLFAV
FT                   RPDDIGEMDQLLDAEGYRTIAEE"
FT   gene            52436..53521
FT                   /locus_tag="MCA0052"
FT   CDS_pept        52436..53521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0052"
FT                   /product="mrP protein"
FT                   /note="identified by similarity to SP:P21590; match to
FT                   protein family HMM PF01883"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90813"
FT                   /db_xref="GOA:Q60CU7"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CU7"
FT                   /protein_id="AAU90813.1"
FT                   /translation="MSVTQADVEAALKNFVDPNLGVDWFAAKSVKKISVDGDRVSLRIA
FT                   LGYPAGSCRDELAQAAKAAIRAAVGAAEVEIDLVSEIVSHAVQKGLKPMPGVRNIIAVA
FT                   SGKGGVGKSTTAVNLALALAGEGARVGILDADIHGPSQPLMLGVSGRPETEGRKIHPIV
FT                   AHGLQSMSIGYLIDEDTPMIWRGPMVVGALQQLLNDTLWEDLDYLIVDLPPGTGDIQLS
FT                   LAQQIPVSGAVIVTTPQDIALLDAQKGLKMFEKVSIPVLGIIENMSVHVCSRCGHAEPI
FT                   FGEGGGEKMAQKYGTELLGQLPLDRSIREDADGGRPTVIAAPDSEPARMYRSIARKVAA
FT                   RLALKAKDYSGRFPTITVVNN"
FT   gene            53532..54098
FT                   /locus_tag="MCA0053"
FT   CDS_pept        53532..54098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0053"
FT                   /product="putative deoxycytidine triphosphate deaminase"
FT                   /note="identified by match to protein family HMM PF00692;
FT                   match to protein family HMM TIGR02274"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90812"
FT                   /db_xref="GOA:Q60CV1"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60CV1"
FT                   /protein_id="AAU90812.1"
FT                   /translation="MGIKSDRWIRKMAREHGMIEPFEPHQVRHGDCSSVISYGTSSYGY
FT                   DVRCSNEFKIFTNINSAIVDPKNFDQNSFVDLVSDVCIIPPNSFALARTVEYFRIPRDV
FT                   LTICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSNTTPLPAKIYANEGVAQVLFLGAD
FT                   DVCETSYRDRSGKYQGQTGVTLPKA"
FT   gene            54127..55407
FT                   /gene="hemL"
FT                   /locus_tag="MCA0054"
FT   CDS_pept        54127..55407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="MCA0054"
FT                   /product="glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /EC_number="5.4.3.8"
FT                   /note="identified by similarity to SP:P23893; match to
FT                   protein family HMM PF00202; match to protein family HMM
FT                   TIGR00713"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90803"
FT                   /db_xref="GOA:Q60CV0"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60CV0"
FT                   /protein_id="AAU90803.1"
FT                   /translation="MLDSTTLFADACRFIPGGVNSPVRAFRGVGGTPVFVDRAEGPYVY
FT                   GVDGKAYIDYVGSWGPMILGHAHPEVLTAVHAAVDRGLSYGAPTVAETAMAKTVCALMP
FT                   SLDRVRMVSSGTEATMSAIRLARGYTGRDKIVKFEGCYHGHSDSLLVKAGSGALTLGAP
FT                   SSPGVPANLAEHTLVLPYNDAAAVRDVFARHGAEIACIIVEPVAGNMNCVPPVPGFLET
FT                   LRDVCDASGAVLIFDEVMTGFRVALGGAQAHYGICPDLTTLGKVIGGGMPVGAFGGRLD
FT                   IMEQLAPVGQVYQAGTLSGNPVAMAAGLKTLELISQPKFFDELAEKTRHLAEGLRVRAE
FT                   QAGIPLCVNWVGGMFGLFFTEQQGVSRFDQVMACDQERFRRFFHGMLEEGVYLAPSAFE
FT                   AGFVSAAHDYQILDRTLTAAERVFAGL"
FT   gene            55404..57329
FT                   /locus_tag="MCA0055"
FT   CDS_pept        55404..57329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0055"
FT                   /product="DedA family protein"
FT                   /note="identified by match to protein family HMM PF00597"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90802"
FT                   /db_xref="GOA:Q60CQ0"
FT                   /db_xref="InterPro:IPR025902"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CQ0"
FT                   /protein_id="AAU90802.1"
FT                   /translation="MSLEAVHLWVGQHPHLAGLAVFAIVLAESLAVVGLLLPGTVLIFT
FT                   FGTLVGGGSMDFVSTYVWALSGALLGDGISFWLGWRHRQRIRTVWPFSRFPAVLERGAH
FT                   FFRRYGGHGVLFGRFFGAVRGIVPLVAGMAGMPAGRFVGYSAVAAALWVPVFLAPGVLF
FT                   GASLELASGTTARLVGLGLGLIALLWFAVWATVRVYAFLQPRARDLILLMFRIAGEHRL
FT                   LGRITLPLLDSERRDYGGLALVGGLIFAVVFALGRSLTVPPLPVSFAAWRTPAADYGFT
FT                   VLESLGSRETLLIGFGVLALWLGFQRWFVALAHWLIATVFALSLGWLGDHGFVLPPFDG
FT                   HVLRGGVASGFVAVLVAPVFRRVGGWVAYAAAAALVAALGFARIYLEHSEIPQVLFALA
FT                   IGLSWTVPLGIACRRHCEAKAASPAVAALVTVCLALVLAAAAVRHGPAEFMHAPLVRRM
FT                   TTAEWLADGWKRLPAYRLQPLGRPHQPLPIQWATSLNGARENLEKLGWRMAAPLSWQSA
FT                   LQWFNPRAKPEEWPVLARFNEDSEDALRMLRPEHGGRWTVLRLWPSRFVLAEDGAPLWV
FT                   GRIDRLEAVNRFGFLGYFREAGDSDRIDAAMLLAPERIPGLVATPVMRDPGSPAVLIRE
FT                   RWKPVP"
FT   gene            complement(57326..58582)
FT                   /gene="rho"
FT                   /locus_tag="MCA0056"
FT   CDS_pept        complement(57326..58582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="MCA0056"
FT                   /product="transcription termination factor Rho"
FT                   /note="identified by similarity to SP:P03002; match to
FT                   protein family HMM PF00006; match to protein family HMM
FT                   PF07497; match to protein family HMM PF07498; match to
FT                   protein family HMM TIGR00767"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90801"
FT                   /db_xref="GOA:Q60CP9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CP9"
FT                   /protein_id="AAU90801.1"
FT                   /translation="MNLTDLKRKPVSELIEIAESLDIEGVARTRKQDLIFSILKKLAKS
FT                   GEDIYGDGVLEILQDGFGFLRSPDSSFLAGPDDIYVSPSQIRRFSLRTGDTISGKIRPP
FT                   KDSERYFAMLKVEQINYEPPENAKHKILFSNLTPLFPVQRFVLELGNGTTEDLTARVID
FT                   LVAPIGKGQRGLIVSPPKAGKTMMLQNVAHSIAEKNPECYLIVLLIDERPEEVTEMQRS
FT                   VKGEVVSSTFDEPPARHVQVAEMVIEKAKRLVEHKRDVVILLDSITRLARAYNTVVPSS
FT                   GKVLTGGVDANALERPKRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIYEEFKGTGN
FT                   MELHLERKIAERRIYPAININRSGTRREEYLVDPDELQKSWILRKILQPMDEMAANEFL
FT                   LGKLKDSKTNREFFDMMKR"
FT   gene            complement(58769..59098)
FT                   /gene="trxA-1"
FT                   /locus_tag="MCA0057"
FT   CDS_pept        complement(58769..59098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA-1"
FT                   /locus_tag="MCA0057"
FT                   /product="thioredoxin"
FT                   /note="identified by similarity to SP:P00274; match to
FT                   protein family HMM PF00085; match to protein family HMM
FT                   TIGR01068"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90800"
FT                   /db_xref="GOA:Q60CP8"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CP8"
FT                   /protein_id="AAU90800.1"
FT                   /translation="MSSDKILHVTDAEFEDKVLKAPGPVLVDYWAEWCGPCKMIAPILD
FT                   EIAGEYEGRLTVAKLNIDDNPATPQRYGVRGIPTLMVFKGGEVVASKVGALTKSQLAAF
FT                   LEGNM"
FT   gene            complement(59262..60029)
FT                   /locus_tag="MCA0058"
FT   CDS_pept        complement(59262..60029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0058"
FT                   /product="putative 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase"
FT                   /note="identified by similarity to SP:Q59601; match to
FT                   protein family HMM PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90799"
FT                   /db_xref="GOA:Q60CP7"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CP7"
FT                   /protein_id="AAU90799.1"
FT                   /translation="MPRFRQAYRAVLVTAACLGGMAAVVLLFPPLRALGESRAQCLRDR
FT                   VQMAWFRTLLLILGVHVERRGRWNPDAPLWVANHISWLDIVVIGAQAPLTFISKQDVAG
FT                   WPVFGFLARRTGTLFLRRGDREDTQRLGERMTWLLRQKRTLLLFPEGTSSSGETVLRFH
FT                   PRLFQPAKRAGVAVQPVALAYRGDAGKIAPFVGEAAFLPHLLRMLGIPRTVAELSFGLA
FT                   IDSEHLNRDELAHAARQTVVGCLGKGETRRQVA"
FT   gene            complement(60004..60780)
FT                   /locus_tag="MCA0059"
FT   CDS_pept        complement(60004..60780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0059"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL03PA04351"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90798"
FT                   /db_xref="GOA:Q60CP6"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CP6"
FT                   /protein_id="AAU90798.1"
FT                   /translation="MGAPESRTSRPGRLTAFVARDEATIVAAQKLRYRVFAEEMGARLH
FT                   TPIDGLDIDEFDAYCDHLVVMDNRERRVIGSTRLLSDSQAKRLGRFYSEGEFSLSGVLA
FT                   LKGRFLEIGRTCVDPNYRGGAVIACLWGALSEYVTQGGFDHLMGCASIPPGPSGFAVDA
FT                   VYRNVGEGRLGPAELGVRPRHPVPAWKRCQRDESGVPPLLQAYLRLGAWVFGEPCWDED
FT                   FDVMDVFVLLKMERLQGRYERHFVGGERNAALQTGL"
FT   gene            complement(60908..61717)
FT                   /locus_tag="MCA0060"
FT   CDS_pept        complement(60908..61717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0060"
FT                   /product="putative general secretion pathway protein B"
FT                   /note="identified by similarity to OMNI:VC2444"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90797"
FT                   /db_xref="GOA:Q60CP5"
FT                   /db_xref="InterPro:IPR032389"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CP5"
FT                   /protein_id="AAU90797.1"
FT                   /translation="MSYILDALRKSERERKLSQAASLDSVIFSPEPVPGRPWLPWVLGV
FT                   VVVANVAALGYFLGLTSGSPPAPDAPASQSPPSLTREIPSMTAPVAATQPSPPPAATVP
FT                   PFARRLGGADAPPRGLHPHPAAPPAAVRPVGGKGPETETGEAAEEDAGDETMAGEIDDA
FT                   TEAEEEDPETEAPVRKAPPPAPATPAPRRDTVPLLSEMPPSFQSRVPQLKINLFAYGPH
FT                   PDDRFAVINMKRHSAGDTVAEGVRLESVDESSLTLVFEGQRFRLERP"
FT   gene            complement(61739..63388)
FT                   /locus_tag="MCA0061"
FT   CDS_pept        complement(61739..63388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0061"
FT                   /product="general secretion pathway protein A"
FT                   /note="identified by similarity to SP:P45754; match to
FT                   protein family HMM PF01471"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90796"
FT                   /db_xref="GOA:Q60CP4"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CP4"
FT                   /protein_id="AAU90796.1"
FT                   /translation="MPFDSDYHSRILPGRETMYTRFFRLTDAPFSIAPNPRFLYPSARH
FT                   REALAHLIYGIKEEGGGFVALTGEVGTGKTTLCRCLIEQLPENVDVALILNPRLDALEL
FT                   LAAVCDELHIGYPQAGASLKLLVDSLNEYLLTAHAKGRRTVLVIDEAQNLSFDVLEQIR
FT                   LLTNLETSERKLLQIILIGQPELTRLLEQKRLRQLAQRITARYHLTPLTRAETIDYIQH
FT                   RLSVSGCPAPLFTRPALAAVHRLSGGIPRLINIICDRALLGAYAQGKFQADRTTVRRAA
FT                   REVLPRNLHPRFLRRLLLGVAVVALSGAGIALIGRTPGGNTASSAQEAPATTPTAPPRA
FT                   APETVLPAAATGRARFEDLLKSKGRDESAAFDRLFALWRIEAGAGKPCATAERQGLRCL
FT                   SEDSGWPGLRPLNHPAVLEFALPGGEKRYGTLTGIAGDLATVEFGGEPATLPLTENLPF
FT                   WEGRFTLLWRPPAANVTVLRPGESSPAVKWLRQHFPAKKKPADPQRFDEALKAQVAAFQ
FT                   KQHGLIVDGTVGPHTFIRLLNETKGADAPHLE"
FT   gene            complement(63501..64397)
FT                   /locus_tag="MCA0062"
FT   CDS_pept        complement(63501..64397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0062"
FT                   /product="protoheme IX farnesyl transferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="identified by match to protein family HMM PF01040;
FT                   match to protein family HMM TIGR01473"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90787"
FT                   /db_xref="GOA:Q60CP3"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60CP3"
FT                   /protein_id="AAU90787.1"
FT                   /translation="MTTNSSGKPAGGISWRTYLALCKLKVVGHIVFTAIIGMFLAVPGV
FT                   PPLDTAFWASLGIGFAAASAAALNHFLDRHADAEMARTQNRPLPSGDIRPAQVVGFALV
FT                   LGIVAMAILIAFVNMLTAFLTFLSLIGYAVIYTVYLKRATPQNIVIGGAAGAAPPVLGW
FT                   CAVTGSVHPYALLLFLLIFVWTPPHFWAYAIAKRDDYAKVDIPMLPVTHGIAFTQLHIL
FT                   LYTILLFLAGLMPYVTGMSGEIYLAAALIFGGIFVYYAIRLKRKADPRLAMQTFAYSLV
FT                   YLVGIFSALLVDHYIVL"
FT   gene            64477..65856
FT                   /locus_tag="MCA0063"
FT   CDS_pept        64477..65856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0063"
FT                   /product="peptidase, M16 family"
FT                   /note="identified by match to protein family HMM PF00675;
FT                   match to protein family HMM PF05193"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90786"
FT                   /db_xref="GOA:Q60CP2"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CP2"
FT                   /protein_id="AAU90786.1"
FT                   /translation="MSIPRLGFLLMALPLAAPAAPPQVHEFTLANGLRVLVQEDHRAPV
FT                   AVSQVWYKVGSSYEYGGITGVSHMLEHMMFKGTKKHPPGEFSRIIAANGGSENAFTGQD
FT                   YTAYFQTLERSRLPVSLELEADRMRNLRLLQDEFVKEQQVVIEERRLRTEDQPHARMEE
FT                   HFHAVAFTDSPYRNPVIGWPEDVAGLTLDDLSAWYQRWYAPNNATLVVVGDVAPGEVFE
FT                   LARKHFGPLKPAKLPALKPQGEVPQLGLRRMVVKVPAKLPHLEMGYKVPSLKTAAAEWE
FT                   AYALEVAAGILDGGNSARLTSRLVRGRQIAAGVGAGYDLYARLSPLFSLEGTPAQGKTV
FT                   AELEAALLEEVRRLREEPVAEDELARVKAQVLASNVYQRDSVFYQAMQLGMAETVGLGW
FT                   RKVEEYVDKINAVTAEQVREVARKYLIDDGLTIAHLEPQPIPEGAKIQEGPEGMGGGHV
FT                   R"
FT   gene            65846..67171
FT                   /locus_tag="MCA0064"
FT   CDS_pept        65846..67171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0064"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05193"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90785"
FT                   /db_xref="GOA:Q60CP1"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CP1"
FT                   /protein_id="AAU90785.1"
FT                   /translation="MSVKRFAVVLLFVLLPLQGVFALPEIQTWTTANGARVYFARTQGL
FT                   PLLDVRVVFDAGSARDGGQFGLAALTSAVLDTGAGDWNADAIAQRLDGVGAVLGTGISR
FT                   DSASLSLRSLTQPNLLQPALETARVILAKPRFAAEDFEREKNRVLLALKQREESPADLA
FT                   GIAFFEAVYGDHPYAHPKDGHVATVEKLTRDDLEAFYRKFYVARNAVVALVGDIERAQA
FT                   EKIADDLVSALPPGEAAAPLPPVPMDQPAQTLRRAFPSEQTHVYSGQPGMRINDPDYFP
FT                   LYVGNHILGGSGLVSRISEEVREKRGLSYSAHSHFYPFRVEGPFLMGLQTRNEKADEAL
FT                   TVLLQTLRDFIAKGPSDKELDAAKKNIVGGFVLRLDSNQKLVEQIASMAFYGLPLDYLA
FT                   TYIPKIEAVTKDDVRRVWQARIHPDRLQTVLVGANSAAESAQ"
FT   gene            67161..67727
FT                   /locus_tag="MCA0065"
FT   CDS_pept        67161..67727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0065"
FT                   /product="putative methyltransferase"
FT                   /note="identified by match to protein family HMM PF03602;
FT                   match to protein family HMM TIGR00095"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90784"
FT                   /db_xref="GOA:Q60CP0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CP0"
FT                   /protein_id="AAU90784.1"
FT                   /translation="MRNELRIIGGLWRSRRIRFAPEPGLRPTPDRVRETVFNWLQQHIG
FT                   GAVCLDLYAGSGALGFEAASRGAARVIQVERNPRVCRVLKQSCAMLNAGQITVVCAETM
FT                   KFLSGRPEVFDLVFLDPPFRTGQVGPCCRKLEQGGWLKPGARIYVEAEAGPAPDGIPAN
FT                   WTLLREKASGDVAYRLYQRLEESPV"
FT   gene            67724..68212
FT                   /gene="coaD"
FT                   /locus_tag="MCA0066"
FT   CDS_pept        67724..68212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /locus_tag="MCA0066"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="identified by match to protein family HMM PF01467;
FT                   match to protein family HMM TIGR00125; match to protein
FT                   family HMM TIGR01510"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90783"
FT                   /db_xref="GOA:Q60CN9"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60CN9"
FT                   /protein_id="AAU90783.1"
FT                   /translation="MNVTAIYPGTFDPITLGHADLVGRASRIFDRVILAVAESKAKTPL
FT                   FDFGERLALAREAVAEMPNVEVVGFNSLLVDCARTHGATVILRGLRAVSDFEFEFQMAG
FT                   MNRSLGPEIETIFLTPGESYAFLSSSVIREIAKFGGDVSAFVPGHVRAALMRKFAGSG"
FT   gene            complement(68235..70733)
FT                   /gene="glgP-1"
FT                   /locus_tag="MCA0067"
FT   CDS_pept        complement(68235..70733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgP-1"
FT                   /locus_tag="MCA0067"
FT                   /product="glycogen phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="identified by similarity to SP:P11217; match to
FT                   protein family HMM PF00343; match to protein family HMM
FT                   TIGR02093"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90782"
FT                   /db_xref="GOA:Q60CN8"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CN8"
FT                   /protein_id="AAU90782.1"
FT                   /translation="MASKKSDPKKTAPAPDAPEHTRTGMSPEILKAAFIDNLTLAVGRP
FT                   LETAVPEDWYQAIALSVRDRIMQRWVRQFEKRNAPDVRQVAYLSAEFLPGPHLGNSLLN
FT                   LGITDNAREALAGQDLDLYIGLEEEPGLGNGGLGRLAACYLDSLATLRYPATGYGIRYE
FT                   FGIFDQAIKDGWQVETTDKWLLPGNVWEIKRPNFAQVVKIGGHTETFTDQHGAFRVRWI
FT                   PDRVVVGVPYDTPIVGYLSDSCVLLRLWSAEAAQSFDFADFNRGDYYGAVEEKVFSENI
FT                   SKVLYPNDEQLEGKRLRLEQQYFFVACSIKDMIRLCLRRGSTLERFHEMFCVQLNDTHP
FT                   AIAVAELMRQLVDKYAMPWERAWDITRRTFSYTNHTLLPEALEKWPLPLFGSVLPRHLE
FT                   IVYEINRRFLDEVRTRFPGDEDKIARLSIIDESGEKYVRMANLAMVGSHTVNGVAELHS
FT                   ELVKTQLFPDFHDLDPKRFQNVTNGVTPRRFLGLSNPGLTRLIDGCIGDSWLSDLDRLR
FT                   ELEAFAGDAGFQQDWMRIKLENKSRLARIIRDRTGVVVDPTSLFDIQVKRIHEYKRQHL
FT                   NVLHIITLYQRLKHDPRLQITPRTFLFGGKAAPGYYMAKLIIKLINAVADTVNQDPAVR
FT                   DLIKVVFLPDYNVKHAQNIYPAADLSEQISTAGKEASGTGNMKLSLNGALTIGTLDGAN
FT                   VEIREEVGAENFFLFGLTCEQAARLRADGYNPGDYCHGDPELRGVIELIDSGLFSHGDR
FT                   ELFRPLTAHLLERDDYLLMADYRPYVNCQQQVGHAYRDCQHWTRMSILNVARMGKFSSD
FT                   RAVREYAANIWKLKPFTPDP"
FT   gene            complement(70801..71184)
FT                   /locus_tag="MCA0068"
FT   CDS_pept        complement(70801..71184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0068"
FT                   /product="polyphosphate kinase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90781"
FT                   /db_xref="GOA:Q60CN7"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CN7"
FT                   /protein_id="AAU90781.1"
FT                   /translation="MLRMNPQRHPFPSICLNKRPVPFLPRLTAWLRLWERAGADEIYIG
FT                   SADWMTRNLDQRVEAVAPVEDPAAVRHLEQVLDFLLNDNRHAWDLQPDGRYLQRQPAEG
FT                   EPERAAQSLLMEGARLGGFQARS"
FT   gene            71264..71794
FT                   /locus_tag="MCA0069"
FT   CDS_pept        71264..71794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0069"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90780"
FT                   /db_xref="GOA:Q60CN6"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CN6"
FT                   /protein_id="AAU90780.1"
FT                   /translation="MRGMRSGEKRSGFYRLAVVAGMLAVCSHALAVPGKIVILRHGEKQ
FT                   DDCASCDVGRERSPALGVRYLGGNTADSVLPSEDPAALPAITLHTLETVSPVANIQGKP
FT                   VVTCSAVPLPDQSDGEKAPLLNKLARAAARDVLNDPPSNYRGKKPQVSLRQRVRGMDAV
FT                   VPAMPPPRSPRTA"
FT   gene            71806..73416
FT                   /locus_tag="MCA0070"
FT   CDS_pept        71806..73416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0070"
FT                   /product="Na/Pi-cotransporter family protein"
FT                   /note="identified by match to protein family HMM PF02690"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90771"
FT                   /db_xref="GOA:Q60CN5"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CN5"
FT                   /protein_id="AAU90771.1"
FT                   /translation="MESFEQLVLGLGLFFLSLRLIGQSLSELGGGGFRRAVEAATHIPP
FT                   LASMLGIMSGALTQSATAVTFILASMLGSGLIKPAAARLVVVWSNVGLTALAFLAAVDI
FT                   HPLVAYFVGGTGIALGSVRAKPWSTVAAALLGVGLLLFALENMGAGAAPLKNESWFRAG
FT                   LDTALASPWFAFACGFGAAALLQSNAGATMLVITLCGAGAMPASAALPMIYGTNLGAIP
FT                   LRAMLALGMQGDAVRLVRTEDLFCLASGLLMMALFMGEHFGVPLVGALVAELTASPPGQ
FT                   LAVAFLLSNLLPALALSPFLPACARLLDRFWPPAPEKALGEPAFLSSHALTDPPTALDL
FT                   LTKELGRLLGSVRVAPRRPDGRKPSADTDPDLLEPEFLRLAAAIESFCVKLALRDGLGP
FT                   AETARLYRFRTALALVRHVAEASAEFSTHLDALPGPVKVVAAPLRARLEHLLTLAVGAV
FT                   TTLDSAAIAEFHAQTRRHGEPVTALRQAYSDGVAALETEQSIEAGTLDTDFELCVWLLH
FT                   RFAKLLPDLAFRPMAHASG"
FT   gene            complement(73668..74252)
FT                   /locus_tag="MCA0071"
FT   CDS_pept        complement(73668..74252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0071"
FT                   /product="conserved hypothetical protein TIGR00296"
FT                   /note="identified by match to protein family HMM PF01871;
FT                   match to protein family HMM TIGR00296"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90770"
FT                   /db_xref="GOA:Q60CN4"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR023473"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="InterPro:IPR027623"
FT                   /db_xref="InterPro:IPR036071"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CN4"
FT                   /protein_id="AAU90770.1"
FT                   /translation="MSSNQGPCPLEPGHRRYLLDLARASIRHGLTTGSPLPVDLADLPS
FT                   RLKERRATFVTLKKDGALRGCIGCLEALKPLAVDVADNAFSAAFRDPRFPPVTADEIDG
FT                   LDIHVSLLTPPEPMSFVSERDLIGRLRAGIDGLILQEGPLRGTFLPSVWEALPRPEDFL
FT                   RQLKLKAGLPEDYWSDTLRISRYQVESIDQA"
FT   gene            complement(74221..75024)
FT                   /locus_tag="MCA0072"
FT   CDS_pept        complement(74221..75024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0072"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:O67039; match to
FT                   protein family HMM PF01875"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90769"
FT                   /db_xref="GOA:Q60CN3"
FT                   /db_xref="InterPro:IPR002737"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CN3"
FT                   /protein_id="AAU90769.1"
FT                   /translation="MRSVRAPAVAGLFYPADRRQLHALLQGFLGEAKTAGTPPKALIAP
FT                   HAGYVYSGPVAASAYALLKPLRHRIRRVVLLGPSHRIAFRGLALSSTQSFATPLGEIPL
FT                   DLEAQSVLAALPFVHVLDQAHVLEHSLEVQLPFLQEVLEDFKLVPIVVGDAVPGQVAEA
FT                   IDLVWGGDETLIVVSSDLSHYHDYATARRMDRATSDAIESLHPEEIGFEDACGRLPVAG
FT                   LLIAARRRGLSAKTVDLRNSGDTAGSKDSVVGYGAYVIEPGPLPA"
FT   gene            75126..76223
FT                   /locus_tag="MCA0073"
FT   CDS_pept        75126..76223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0073"
FT                   /product="putative pyruvate formate lyase-activating
FT                   enzyme"
FT                   /note="identified by similarity to OMNI:MT3225; match to
FT                   protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90768"
FT                   /db_xref="GOA:Q60CN2"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR027596"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CN2"
FT                   /protein_id="AAU90768.1"
FT                   /translation="MDTNIDAAEAFPTRFWHVLEDGRVQCDVCPRFCKLHEGQRGLCFV
FT                   RGNVGGKVVLLSYGRSSGFCVDPIEKKPLNHFLPGTPVFSFGTAGCNLACKFCQNWDIS
FT                   KSREMDSLLDRASPEAIARTAKALGCRSVAYTYNDPVIFHEYTIDTARACRELGIKSVA
FT                   VSAGYQCAEPRAEFYRHMDAANIDLKAFTEDFYHRICGGHLQPVLETLEYIKHETQVWL
FT                   EITTLLIPDENDSERELEALTQWVVEKLGPDVPLHFSAFHPDWKMLNKSATPPATLLEA
FT                   RRIAMKNGVRYAYVGNIHHKEGDSTYCHHCGRMLIGRDWYELSEWNLTPEGRCNRCGTP
FT                   CAGVFESAPGDWGAKRMPVSMAGRV"
FT   gene            76264..76875
FT                   /gene="gst"
FT                   /locus_tag="MCA0074"
FT   CDS_pept        76264..76875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gst"
FT                   /locus_tag="MCA0074"
FT                   /product="glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /note="identified by similarity to SP:P39100; match to
FT                   protein family HMM PF00043; match to protein family HMM
FT                   PF02798"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90767"
FT                   /db_xref="GOA:Q60CN1"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="PDB:3UAP"
FT                   /db_xref="PDB:3UAR"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CN1"
FT                   /protein_id="AAU90767.1"
FT                   /translation="MKLYYFPGACSLAPHIVLREAGLDFELENVDLGTKKTGSGADFLQ
FT                   VNPKGYVPALQLDDGQVLTEDQVILQYLADLKPESGLMPPSGTFERYRLLEWLAFISTE
FT                   IHKTFGPFWNPESPEASKQIALGLLSRRLDYVEDRLEAGGPWLMGDRYSVADAYLSTVL
FT                   GWCEYLKIDLSKWPRILAYLERNQARPAVQAAMKAEGLIQ"
FT   gene            76932..77942
FT                   /locus_tag="MCA0075"
FT   CDS_pept        76932..77942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0075"
FT                   /product="lipase family protein"
FT                   /note="identified by match to protein family HMM PF01764"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90766"
FT                   /db_xref="GOA:Q60CN0"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CN0"
FT                   /protein_id="AAU90766.1"
FT                   /translation="MSTFDRGFARLLLEICRYTYAKAFALAPEEGDALQWIEQQGGKPD
FT                   PASLEPIRGGDTSVACVFRYPDKNVVAYMGTKTEFDNAVNAKDSIEDWLNNFRAAPVPF
FT                   KLGKEHLGLDKEVELPGRVHAGFLSELKAVQAKVIDVLSKNGGKDKPLYLTGHSQGGAE
FT                   ATLATVALLAGGFKVAATYTFAAPRAGDRTFADAVPAEFPFHRIEFGDDIVPHVPPTLL
FT                   SRWVKTLVTVPRHLPLKRFGVPVKVNEFLELSVHDLGYVGVGRLCYGNHESGQLHVDMS
FT                   VRQEASLFLGRLTRLLRHPEHWAEHHHLAGTRAEVSAGKKGNYTALVSDFPIVEG"
FT   gene            78087..79778
FT                   /locus_tag="MCA0076"
FT   CDS_pept        78087..79778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0076"
FT                   /product="patatin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90765"
FT                   /db_xref="GOA:Q60CM9"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CM9"
FT                   /protein_id="AAU90765.1"
FT                   /translation="MAELDLLRHVQMLSTVSGGSIIGAMYYLKVKQLLEHERTDGVIPS
FT                   TPGAYVKIVQELETEFLKGVQTNLRVRALLNPIKNAKMFISDDYSRSDRMSELYNETFY
FT                   RPIQRPGKETLRDWLQDALSLKDCRDIFLKDLKIVPKGERPGFDVALHNRDAEHKIPVL
FT                   NINATTLNSGDNWVFTASYVGVASSERYPRISFANPNDPGLSPEQNKKRAAILNKLTLS
FT                   DAVAASACVPALFAPFAIHDLYGEKDVIELVDGGVFDNQGLTALTDGKCTHIICSDASG
FT                   QLCHDRSPASGMASVFMRSNDVLMKRVRDLIVRELEMKEGGKTVDARFWHLREGFGGTP
FT                   YFRSLSPPPDSSDYNQTGADNGQIFLLSAIRTDLDAFADIEANALMYDGYCLCDRFLNQ
FT                   SEGLKNPPSLPWGFYSVMTSPTLDSCRLTHCLAVGGDMFFKVFRLTDTKGKLLGAGLGL
FT                   VVLLSIWAFVYEALTVYADRIQGALAAPGWTAAVVVFGMAGWTLMKKLPHPVQHWQKWL
FT                   AEGVRTVRTGNVLGLVYPLAIVGSLVSIAAFFYLKVINPRYLKLGR"
FT   gene            79817..80146
FT                   /locus_tag="MCA0077"
FT   CDS_pept        79817..80146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0077"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:17427297"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90764"
FT                   /db_xref="GOA:Q60CM8"
FT                   /db_xref="InterPro:IPR014991"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CM8"
FT                   /protein_id="AAU90764.1"
FT                   /translation="MLITFESKVGRVTMFGDVALHLLRMMGNTGTVPGALLARDIPVAL
FT                   EKLEQGLAAEAAPVSTSSEDEEEERQEKPNLRVRAFPLIGLLKDSLKHGCDLLWEQEGK
FT                   APLKF"
FT   gene            complement(80931..84017)
FT                   /locus_tag="MCA0079"
FT   CDS_pept        complement(80931..84017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0079"
FT                   /product="AcrB/AcrD/AcrF family protein"
FT                   /note="identified by match to protein family HMM PF00873"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90755"
FT                   /db_xref="GOA:Q60CM7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CM7"
FT                   /protein_id="AAU90755.1"
FT                   /translation="MLGALVRFAVCRSGVVIALAVLLAAYGLYRAATAKLDIFPEFSAK
FT                   RVVVQTEAPGLTTRQVEILLTLPIERKLAGIVGLETLRSESIQGLSVVTAVFAEETDIY
FT                   RDRQLVSERLALLAGQLPEGAGTPVLVPLSSSSATVQTFGLTSETLGPMELRTLADWVM
FT                   TPRLLAVPGVADVNVFGGAVQQLQVEVDPARLKRFGLDLNAVSLAVRQSFRTQGAGFVE
FT                   NENQRLALQVTGLPLGPESLGNVILNRSPGAVLKLRDVGTVRFGPRPPIGAAAVNGAAG
FT                   IVMMVIGQYGANTLEVSRGVERGLAELAPMLAARGATLHPRLFRPADYIERALDNLGAH
FT                   LLAGGLLVMAVLYAFLYDLRTALISAVAIPLSLLGAFVVLQAFGVSLNLMVLGGLAIAL
FT                   GEVVDDAIIDTENIFRRLRENRATAAPRPALTVVYEASLEVRGSVVYASFIVALVFLPL
FT                   LGLGGVAGRLFAPLGYAYIIAILISLATALTVTPALCVALLTGSKEAAETPPLIRWLQP
FT                   LYGRWLRWAARQPARLAAGSLAACLLATALAPGLGGDFLPHLREGHYIVHTTSLPGTSL
FT                   QESLRLGGLVVREILRIPGVESVSQWAGRAERGADTYGSHYSEYEVRLQPMSGSGQQKV
FT                   LERLRGLLEGFPGIRAEVNTFLTERVNETISGYTSPVAVNLYGDDLDLLDRKARELADE
FT                   IGRMAGATDVQLRSPPGSPLAEIRLRPDQLQVWGLRPGDVMDAVDTAFAGRTVGHFPLG
FT                   QRIVETSVILRPDLRQSLDSLRELPLKSQDGTLVSLGEVAEISETGDRYNILHRGGRRI
FT                   QTVTAGVEGRDLASFVEELRARLDAVLGRSTGVYAEITGAAMEQGVARRELIARACLAG
FT                   GGVLVLTYLAIGRLRHTAIVLANLPFSLAGGVLAAGISGASLSVGALVGFVTLFGITVR
FT                   NTIMLLSHYRHLVERERQTWNLDTAVRGAQERLPSILMTALVTALAMLPIASGSDDPGL
FT                   EIMGPMAAIIIGGLLSSTCLNLALLPAMLLRWGGSFENR"
FT   gene            complement(84017..84919)
FT                   /locus_tag="MCA0080"
FT   CDS_pept        complement(84017..84919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0080"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90754"
FT                   /db_xref="GOA:Q60CM6"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CM6"
FT                   /protein_id="AAU90754.1"
FT                   /translation="MQQTGVVLEPARQRLAGIETRILDAVEYRPETRSLGRIVDLQPLL
FT                   ELRSRYRAAQAEAKITDAALRLARKNRDRLASLHSEAIVATRELIHAESQLAADEARAV
FT                   TARQHVRELQEEGLQAWGTELFQAAVAGDSRLFDDLLQRRRVLLLVTLHHGQALPADAA
FT                   RIMVAREGDRQAAQPAELVSAAPKTDDIVQGETWFFHTDARKLRTGMRIEAWIPASAEK
FT                   LSGVVIPRSAQIWHEGRPWVYLRIGADRFVRRPIDAHRDYGDAWFVDEGIEPGASLVTR
FT                   GAQLLLSEEQRHAIPEEDD"
FT   gene            85182..85664
FT                   /gene="slyD"
FT                   /locus_tag="MCA0081"
FT   CDS_pept        85182..85664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slyD"
FT                   /locus_tag="MCA0081"
FT                   /product="peptidyl-prolyl cis-trans isomerase, FKBP-type"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by similarity to SP:P30856; match to
FT                   protein family HMM PF00254"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90753"
FT                   /db_xref="GOA:Q60CM5"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CM5"
FT                   /protein_id="AAU90753.1"
FT                   /translation="MQISPHKVVLIHYTLTNDEGDVLDSSSADEPLAYIHGMGNIIAGL
FT                   EDALTGRVVGDSFNVTIPPEEAYGLHDENLVQAVPRHAFEGVDEILPGMQFHAESNEGM
FT                   QIVTVLEVLEDEVVLDGNHPMAGMTLHFNVEVAGIRDATPEELEHGHVHGPGGHHH"
FT   gene            complement(85707..87020)
FT                   /locus_tag="MCA0082"
FT   CDS_pept        complement(85707..87020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0082"
FT                   /product="MiaB-like tRNA modifying enzyme YliG"
FT                   /note="identified by match to protein family HMM PF00919;
FT                   match to protein family HMM PF04055; match to protein
FT                   family HMM TIGR00089; match to protein family HMM
FT                   TIGR01125"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90752"
FT                   /db_xref="GOA:Q60CM4"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60CM4"
FT                   /protein_id="AAU90752.1"
FT                   /translation="MKLPRIGFISLGCPKALVDSERIITQLRAEGYAIVPTYQDADLVV
FT                   VNTCGFIDAAVEESLEAIGEAVAENGKVIVTGCLGERPEEIQARHPAVLKVTGAHAYEE
FT                   VMNAVHEHLPPLHDPFMDLVPPQGVRLTPRHYAYLKISEGCNHRCSFCIIPALRGDLVS
FT                   RPIGEVMTEAERLVAAGVKEILVVSQDTSAYGADLGYRTGFWGGRPLRTRFQELARALG
FT                   DLGVWIRLHYVYPYPHVDEVIPLMAEGRLLPYLDIPFQHASARVLKAMKRPAATENILA
FT                   AIRRWREVCPELTLRSTFIVGFPGETEDEFRELLDFLEEARLDRVGCFEYSPVKGAAAN
FT                   ALPDPVPAEVKAERHARLMEVQERISAARLRTRIGRTETVLVDEVVEEGAVARRRADAP
FT                   EIDGQVFIDGATHLEVGEFVEATFEDADAHDLWARLAD"
FT   gene            87198..88115
FT                   /locus_tag="MCA0083"
FT   CDS_pept        87198..88115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0083"
FT                   /product="methyltransferase, UbiE/COQ5 family"
FT                   /note="identified by similarity to OMNI:NTL01SS01907"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90751"
FT                   /db_xref="GOA:Q60CM3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CM3"
FT                   /protein_id="AAU90751.1"
FT                   /translation="MYYLEPNKDYRNDSLRKGAEFSEAEIRIDTARHYDDCYWDYRTAW
FT                   FDNENLALHYGYWEEGIKTHSQALINKNRIMAAIAGIEAGDHVLDAGCGIGGSSIWLAK
FT                   HVGARATGITVSEQQVEHARRNARRHGVADKTEFQVADFCQTPFPDAVFDVVWAVESSC
FT                   YATDKRDFFREAYRVLKPGGTLIACDGYAARREFDEAEWRAVMDCLNGWAVPNLSTVEE
FT                   FHAGMEECGFREIHVTEATRETLPSSRRMYLTARWTAPMQWIMHWLGLRKKAQTANYKV
FT                   ALAQWKVFSEGMVRYCIFRAEKPV"
FT   gene            88186..89226
FT                   /locus_tag="MCA0084"
FT   CDS_pept        88186..89226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0084"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90750"
FT                   /db_xref="GOA:Q60CM2"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CM2"
FT                   /protein_id="AAU90750.1"
FT                   /translation="MNRPFPPSIAFRKAWLAGFLLLAASPVRAGLTAGQLIDQVGISQA
FT                   DVARLQKGEIVSYSVVETGSKSLATGIAMYLKTAPARIVEVVRRGELAARDPDVTARGV
FT                   VPSGAGVEAFAKFAYGRAQVDEARDLLNVRPGSGFNLSAEEIAGFAALKASLASDDDET
FT                   VAEAVSRQYRSVLAARLRAYRSKGLAGMAAYERGDGDKADPAAELTDAIRASKLLGDRF
FT                   PGLQKALLGYPAEMPAGAEDSFIWLNRMVQGRPTPILVHRIIHAGNDGALLLQSAFYVG
FT                   HSYDVSQTLAGTVPYLDGALVFYSVRSSTDQVTGLGEALKHSIGRGQMEKEMIEKFRAL
FT                   KASVKG"
FT   gene            89266..89619
FT                   /locus_tag="MCA0085"
FT   CDS_pept        89266..89619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0085"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90749"
FT                   /db_xref="GOA:Q60CM1"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CM1"
FT                   /protein_id="AAU90749.1"
FT                   /translation="MNEAAANLSGFPKEYAFLLLGTGLGFFLGWLVSRIGGPGRTAPGR
FT                   TAGGAGIPSDAQPVDVVVNGKMVRLPSDTAAEIRRLIRDGNPGGAVNRLREVTGLRPAE
FT                   AKAVIDSLARIAD"
FT   gene            complement(89664..90116)
FT                   /gene="pilE"
FT                   /locus_tag="MCA0086"
FT   CDS_pept        complement(89664..90116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilE"
FT                   /locus_tag="MCA0086"
FT                   /product="type 4 fimbrial biogenesis protein PilE"
FT                   /note="identified by similarity to OMNI:NTL03PA04557; match
FT                   to protein family HMM PF00114; match to protein family HMM
FT                   PF07963; match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90748"
FT                   /db_xref="GOA:Q60CM0"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR031982"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CM0"
FT                   /protein_id="AAU90748.1"
FT                   /translation="MAEPNGKVSITPARRAAEGRGFSLLELMITVAIIGILATVAYPSY
FT                   KEHIVRTRRADGKAALLRAAAREEQYFMDNKTYTSDVTRLGFASNGKSDEGHYVISVTA
FT                   ADANGFTLQATPQSPHTDALCGNLTLNSLGVKGKSGSGSVADCWNW"
FT   gene            complement(90123..93521)
FT                   /locus_tag="MCA0087"
FT   CDS_pept        complement(90123..93521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0087"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90740"
FT                   /db_xref="InterPro:IPR008707"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CL9"
FT                   /protein_id="AAU90740.1"
FT                   /translation="MKIQPAIMVLSIAAPFCAGQADDTDIYFAGGGSLGGKPLVMFSLD
FT                   YRSNLGALVCQGTGEDDEHDDHRYDHQEDDDDEHGDDCHSLRTTVSPSSGTTYLPPSGD
FT                   VTHFDLIRGALRKAMDDLGTELATVRVGLMINHADSTTGQCGAGPSGQCSNGAYVLRGF
FT                   STDKARFHDALARIPVPQGNLAHDFQGKELYFELFRYLTGQAIFNGHKGWQDYGDSNRN
FT                   DNLDVDNPGTSFDDRLLKWDSGIENGTNYVSPLVDNCSKVFMINFMFQVSNKDNDSDAA
FT                   IRQSKDSGGMNGLNPGTSNSAFANVIRWMRDADLADGTYGSAGNLEDVQNVTSYFFVAP
FT                   TNINTTTNGYAVAGGTNNALPLSTDPTVLIASLKEVFKEVLSVSTTFVSAASPVNVFNR
FT                   TESLNHAFFSIFQPEQAPRWNGNLKRLKLASDPTTHRLQVLDASSPPIEAISPIDGRIK
FT                   HEALTYWTSASGFDVQTYADTGKGEVVGKDGRSVGRGGGGQRIPGFLTNSPGDSNSTSG
FT                   ARKLYTEPDSLSNGTATALRALNADSTTAAALWNTLRLNGAKSGEVWSDAASYGTASSD
FT                   DQATAVKLLKFARGQDANDEDGDGNYTEAHPWASPANQAKRKWLMADPLHSAAVPLNYG
FT                   ARSGYSRDVQDVRILVSGNDGFLHMFRNSASGGTTTETPSGVEDWAFIPRRLLGNLKPL
FT                   SDNGAATPHVYGLDGTAAVYVNDMNRDGTVNGADQVIAFIGMRRGGKGYYALDITDPDT
FT                   PRMLWTIEKNDASGNFNELGYTFSDPTIAQLDWGEGRKPVLIFGGGYGTRKDEASAANA
FT                   RNAATGTDDTEGNAIYIVNAKTGALVWKAVKGSGASSATTFQHAGLADSIPSKVTAVDT
FT                   DDNGMVDRLYVGDTGGVLWRADLAYVQPDGTTSYNEPAHWTLTPVLSVGRHAGQPDRRF
FT                   FHRPDFVPSPAGSSRFDAVLIGSGDREHPLDTNVQNQFYMFKDTYVASGSPPTGPVKTL
FT                   ADLDNLTSSTTVHPDKSGWYIDIGSSASGEKVLSSPLTYNGSVYFSTYAPQGGSVSGQC
FT                   GPNEGESLTYVIRLADAAGVFNFNAATPANERFTVTGRGLPSDPVTVAVNGKLYVTAGN
FT                   LPANPDLSNPVGNSGINRLYWYEKE"
FT   gene            complement(93547..94095)
FT                   /locus_tag="MCA0088"
FT   CDS_pept        complement(93547..94095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0088"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90739"
FT                   /db_xref="GOA:Q60CL8"
FT                   /db_xref="InterPro:IPR025746"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CL8"
FT                   /protein_id="AAU90739.1"
FT                   /translation="MARKRSTQNGAALVVGLLFTIVLTMLGIAAIHSSSTSVRMARNAE
FT                   ARINGLQQAQAAADYVAAEAIDLNLDRMGNNVRCTASYPYGTCNGLSLPALPSPLTTPP
FT                   VHVRVRGSIAFGSSRREEGNKVFERVIESDYDGAPAGSSADATRAGVVSAVRGTLVSSG
FT                   SVRYDSETPDPTPTPAPTS"
FT   gene            complement(94123..95196)
FT                   /locus_tag="MCA0089"
FT   CDS_pept        complement(94123..95196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0089"
FT                   /product="pilin-like protein"
FT                   /note="identified by similarity to GP:17429699"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90738"
FT                   /db_xref="GOA:Q60CL7"
FT                   /db_xref="InterPro:IPR032092"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CL7"
FT                   /protein_id="AAU90738.1"
FT                   /translation="MGFSTVELLISMVLGLLVVGAIGSLFVQHKTNYRQNEQFALMQEN
FT                   GRFTLNLLASDLALAGFWGGADCNDLSRCPSASAISVQNDCGTNWTTTTTSSSPATHYL
FT                   MAPSADSIPADWPCFNSNDYLKPGTNLLALRHAEGKPVYCQTGEDKRNDRFAGLIYLRT
FT                   SGSNGNLVKLPVSTATPPEPPDCPVSSSSAAYWRYVVHVYYISRGYTARQCASKPTDPR
FT                   CAPRLIRKTLGRQTGNPIIFESDDGGEIAEGIEYFHIEFGIDDGDGNMTDESCDMDGIP
FT                   ERYLSTREDYAAITPDELDCAISARVHVLVRSMEPDSSYTDDKTYTFGSVTLGPFGDHF
FT                   RRKVFTTTVQLRNQQYH"
FT   gene            complement(95226..95816)
FT                   /locus_tag="MCA0090"
FT   CDS_pept        complement(95226..95816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0090"
FT                   /product="putative type IV fimbrial biogenesis protein
FT                   PilV"
FT                   /note="identified by similarity to OMNI:NTL03PA04552; match
FT                   to protein family HMM PF07963; match to protein family HMM
FT                   TIGR02523; match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90737"
FT                   /db_xref="GOA:Q60CL6"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013362"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CL6"
FT                   /protein_id="AAU90737.1"
FT                   /translation="MNRSHPNGFTLIEVLVSVFIFAVALLGLAALQIAARKAAFESAQR
FT                   SLAAAIGQDVLERMRLNTEALSGYTGTLNANTTFSDSLDCAGPANLAVCDRRDFQRSLL
FT                   GTAETTGTGTNVSKTGGLANPTLCVTSSNAGGSGQYTVTIVWRGREPALPEAGSENASD
FT                   TCGNGQYGTNNEYRRIFRISTYICREGVSGGCI"
FT   gene            complement(95813..96361)
FT                   /locus_tag="MCA0091"
FT   CDS_pept        complement(95813..96361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0091"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GP:17431765; match to
FT                   protein family HMM PF07963; match to protein family HMM
FT                   TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90736"
FT                   /db_xref="GOA:Q60CL5"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CL5"
FT                   /protein_id="AAU90736.1"
FT                   /translation="MRRTAAFTLIELMIGIALAAVLLTVGIPGFRDLILDNRMAAQINS
FT                   LVADLSYARSEAVKRNSEVTVCKRNTAGTACDDSKNWTDGWIVVAGTTVLRVHDPVSSS
FT                   LTMTIKYTGSNRVVYGGKGFLSGVNNGTFIFCDSRGYTKARGLVLAMTGRLRTTRDDDG
FT                   NQIQEKGSNGVNLSESDCQ"
FT   gene            complement(96425..97483)
FT                   /locus_tag="MCA0092"
FT   CDS_pept        complement(96425..97483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0092"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:P32066"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90735"
FT                   /db_xref="GOA:Q60CL4"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR011224"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040739"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60CL4"
FT                   /protein_id="AAU90735.1"
FT                   /translation="MTSPSSILLYCRRGFEKECAAEILVQTQAAGISGHVRAKENSAYV
FT                   VFVAHEPEILANRAARLRFDALIFARQRIFASGPLADLPVDDRITPLLDTAAGLQRRYS
FT                   TLWLETADTNEAKELAAFTRKFERPFAAAAAGLLGGGPQAPRLHVFFLTSTAAYLGYTL
FT                   PDDSAPWPCGIPRLKLPRSAPSRSTLKLEEAFLVFVDRPETMLRPGMSAVDLGAAPGGW
FT                   TWQLVRRHIRTTAVDNGNLDPALLDSGLVTHLRTDGFRFRPSRPVDWLVCDMVEQPSRI
FT                   ARLVADWAADGAFRYAVFNLKLPMNRRYEEVERCRGLIEERLAAQGVSHRLRFRQLYHD
FT                   REEVTGFLELVS"
FT   gene            97563..98783
FT                   /locus_tag="MCA0093"
FT   CDS_pept        97563..98783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0093"
FT                   /product="ABC transporter, ATP-binding family protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90734"
FT                   /db_xref="GOA:Q60CL3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CL3"
FT                   /protein_id="AAU90734.1"
FT                   /translation="MSFPRILAHRLGKKFSRSLGHSLWHRTQDLGRRLIGRRPTPVLRA
FT                   GEFWAVRDVSLEVAAGECLGLVGPNGAGKSTLLRMLGREYRPDAGRIELRGAVKSLIRL
FT                   GHGLQPMYSGRENVYLKCAELGLSKREIDARLDEIVAFAELEAVLERPVKHYSDGMYAR
FT                   LEFAIATCMPVDILLIDEVLAVGDVAFQLRCLERLQTLKREGSALVFVSHSEMNVLHVA
FT                   DRCLLLFDGQTVVEGRPEAVFGKYYEAVGYLNRDLKSLGVLPTRPPDVSAGLDFSGSAD
FT                   EPLQANPGQPLAFELEYRAERDFEAVDLRLEFWNTAGLFAASTLTPADSRPCLAGGRGR
FT                   LRVELPFLGLDAGIYDVAVSAKAGGRDLAYRGKARRVQVLQTAYDRPAGFGVMEAHIWT
FT                   APSGRPS"
FT   gene            98827..99231
FT                   /locus_tag="MCA0094"
FT   CDS_pept        98827..99231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0094"
FT                   /product="Mov34/MPN/PAD-1 family protein"
FT                   /note="identified by match to protein family HMM PF01398"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90733"
FT                   /db_xref="GOA:Q60CL2"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CL2"
FT                   /protein_id="AAU90733.1"
FT                   /translation="MIPRCLINQILRLAQASPEREVCGLVGAAAGRRMRCYPVPNVAER
FT                   PECRFLLDPKGQIDALRAMRERGEELFAIFHSHPTAAAIPSPADLEFAAYPEALHLIVS
FT                   LGTKGVLEMRGFRIGSSSRPREVELLLAPE"
FT   gene            complement(99236..101890)
FT                   /locus_tag="MCA0095"
FT   CDS_pept        complement(99236..101890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0095"
FT                   /product="cation-transporting ATPase, E1-E2 family"
FT                   /note="identified by similarity to SP:P37278; match to
FT                   protein family HMM PF00122; match to protein family HMM
FT                   PF00689; match to protein family HMM PF00690; match to
FT                   protein family HMM PF00702; match to protein family HMM
FT                   TIGR01494"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90725"
FT                   /db_xref="GOA:Q60CL1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CL1"
FT                   /protein_id="AAU90725.1"
FT                   /translation="MKRKHHATRKPHPPAHWHLLEPWQITAWLKVDPQKGLSQREAEQR
FT                   LAERGPNLIIEQRPRGPLAMLLGQFADFMIGVLMLAGIVSGLVGEIADTVTIVVIIILN
FT                   AAIGFVQEYRAERAIAALKSMAAPLARVVRDGQHHELPAHELVPGDLVLLEAGNIVPAD
FT                   IRLLDTAQFRVEEAALTGESQPVGKSTEAIRNPDAALGDRRNMVYKGTVVTYGRGLGSV
FT                   IATGMETELGKIAQLLREEKESRTPLQNRLAQLGKRLALLVLAICAIIFVVGLLRGEQP
FT                   ILMFLTAVSLAVAAIPEALPAVATVSLALGARKMIRQHVLIRRLPAVETLGSVTYICSD
FT                   KTGTLTQNRMRAEAFYADGRPGPELPEPMLRAMALNNDVRVDKEGRLLGDPTETALYEA
FT                   AAAAGHSGIDLAASCPRTAEIPFDSERKLMTTLHREGEGLVAYTKGAPEMLLPRCRTVW
FT                   RIQGPVPIQSDELHEIAERMAAEGLRVMALAFREWPEPPAELSPETVETGLCFLGFVGL
FT                   MDPPRPEAAEAVALCKTAGIKPVMITGDHPATARTIALRLGIADEDAPVLTGEELARLS
FT                   LAEFEKRVEEIRVYARVAPEQKIKIVRALQDKGEFVAMTGDGVNDAPALKCANIGVAMG
FT                   KSGTDVAREASHMILLDDNFASIVAAVREGRRIFDNIRKFIKYTMTSNSAEIWTLFLAP
FT                   FLMLPIPLLPIHILWINLVTDGLPGLALAVEPQERGIMQRPPRPPQESIFAHGMWQHIL
FT                   WIGLLMGGVSLLSQAWAYHTGSAHWQSMVFTVLTLSQMGHVLAVRSERESFFALGFFSN
FT                   KPLLGAVLLTFLLQMAVLYIPALHPIFRTEALEPHELAACLVLSTLVFWAVELEKWMRR
FT                   RGWIYREDRQTAA"
FT   mobile_element  101916..103257
FT                   /mobile_element_type="insertion sequence:IS03"
FT   gene            102004..103104
FT                   /locus_tag="MCA0096"
FT   CDS_pept        102004..103104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0096"
FT                   /product="ISMca1, transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90724"
FT                   /db_xref="GOA:Q60CL0"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CL0"
FT                   /protein_id="AAU90724.1"
FT                   /translation="MRGTQNFQGAMFSYISLEERVPARHPLRKLRALVDALLASMSAEF
FT                   EAVYARRGRPSVPPEMLLKALLLQILFSIRSERLLVEAIDYNLLYRWFVGLNLEDKVWD
FT                   HSTFSANRQRLFNEDLARVFFERVKYTADWAKLIGDEHFSVDGTLIEAWASQKSFKRKD
FT                   ASGSDDGAPPQGRNPEVDFKGETRRNDTHASTTDADARLFKKAAGDKSRLCHMGHILMD
FT                   NRHGLVVDVEITHASGTAERQAALKMLQRQKRKAGRLTVGADKGYDCRAFVQGCRKLGI
FT                   TPHVAAKAKHSAIDGRTQRHEGYKVSLRVRKRIEEAFGWIKTVGGLAKTKLIGHAKLAG
FT                   QALMCFAAYNLVRMGSLGGWWDAHHA"
FT   gene            complement(103385..104815)
FT                   /gene="gatB"
FT                   /locus_tag="MCA0097"
FT   CDS_pept        complement(103385..104815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="MCA0097"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by similarity to OMNI:NTL03PA04485; match
FT                   to protein family HMM PF01162; match to protein family HMM
FT                   PF02637; match to protein family HMM PF02934; match to
FT                   protein family HMM TIGR00133"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90723"
FT                   /db_xref="GOA:Q60CK9"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60CK9"
FT                   /protein_id="AAU90723.1"
FT                   /translation="MEWETVIGLEIHAQLATRSKIFSGAPTAYGAEPNTQACAIDLGLP
FT                   GVLPVLNREAVRMAVKFGLAIGAEIAPVSVFARKNYFYPDLPKGYQISQYDLPVVARGK
FT                   LSINVDGKALTIGITRAHLEEDAGKSLHEDFHGYTGIDLNRAGTPLLEIVSEPDLRSAK
FT                   EAVAYMKKLHALVRYLEICDGNMQEGSFRCDANVSVRPKGQTKFGTRAEIKNLNSFRFV
FT                   EKAINHEIARQIEILEGGGEVIQETRLYDSVKDETRSMRSKEEANDYRYFPDPDLLPLE
FT                   ISSGFIEEVKATLPELPDAKRDRFKAQYGLSDYDAEVLTASREMADFYETVVREAAGDP
FT                   KLCANWVMVELSGLLNKDGLEITASKIDAAGLASLVRRIADATISGKIAKQVLETMWNE
FT                   GGSADDIIERQGLKQITDTGAIESIIDQIIAANPEQLAQYRAGKDKLFGFFVGQAMKAT
FT                   QGKANPAQLNELLKKKLQ"
FT   gene            complement(104842..106299)
FT                   /gene="gatA"
FT                   /locus_tag="MCA0098"
FT   CDS_pept        complement(104842..106299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="MCA0098"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by similarity to SP:O06491; match to
FT                   protein family HMM PF01425; match to protein family HMM
FT                   TIGR00132"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90722"
FT                   /db_xref="GOA:Q60CK8"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60CK8"
FT                   /protein_id="AAU90722.1"
FT                   /translation="MHRKTLAELAAGLERREFSSVELTQAHLARIERLDPALNSFITTT
FT                   PEIALAQARAADERLAKGEAGPLTGIPIAQKDIFCTKGVRTSCGSRMLDSFVSPYDACV
FT                   VERFNAAGAVMLGKLNMDEFAMGSSNETSYYGPVKNPWNTATVPGGSSGGSAAAVAARL
FT                   VPGATGTDTGGSIRQPAAFCGITGLKPTYGRVSRWGMIAFASSLDQAGPMARTAEDCAI
FT                   MLQIMAGFDERDSTCVDRPVPDYRAALGNDLDGLRIGLPKEFFGEGLDPAIAGLIHAAV
FT                   DEYRRLGAIVREISLPNMHLSVPAYYVVAPAECSSNLARFDGVRFGHRCENPTDLADLY
FT                   TRSRGEGFGAEVKRRILIGTYALSAGYYDAYYLKAQKIRRLISEDFRRAFEEVDVIMGP
FT                   TAPSVAFEFGAKSADPIAMYLSDIYTIAVNLAGLPGMSIPVGFSNGLPVGMQIIGGYFS
FT                   EDRLLNVAHRYQQATDWHTRTPAGIAD"
FT   gene            complement(106353..106640)
FT                   /gene="gatC"
FT                   /locus_tag="MCA0099"
FT   CDS_pept        complement(106353..106640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="MCA0099"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by similarity to SP:O06492; match to
FT                   protein family HMM PF02686; match to protein family HMM
FT                   TIGR00135"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90721"
FT                   /db_xref="GOA:Q60CK7"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60CK7"
FT                   /protein_id="AAU90721.1"
FT                   /translation="MSLSAAEVNKIAWLARLAIDDDKVEAYARDLSQILGFVEQLGSVD
FT                   TSRVAPMAHPLDEAQRLRPDDVTETDQRALFQAHAPLVEAGLYLVPKVIE"
FT   gene            106745..107788
FT                   /gene="mreB"
FT                   /locus_tag="MCA0100"
FT   CDS_pept        106745..107788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreB"
FT                   /locus_tag="MCA0100"
FT                   /product="rod shape-determining protein MreB"
FT                   /note="identified by similarity to SP:P13519; match to
FT                   protein family HMM PF06723; match to protein family HMM
FT                   TIGR00904"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90720"
FT                   /db_xref="GOA:Q60CK6"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CK6"
FT                   /protein_id="AAU90720.1"
FT                   /translation="MFKRLRGYFSNDLSIDLGTANTLIYIRGQGIVLNEPSVVAIREDK
FT                   NRGAKSIAAVGSAAKSMLGRTPGNITAIRPMKDGVIADFTLTEKMLQYFIHKVHPNRLL
FT                   RPSPRVLICVPCGSTQVERKAIKDSAEGAGAREVYLIEEPIAAAVGAGLPVSEARGSMV
FT                   IDIGGGTSEVAIISLNGVVYAASVRIGGDRLDEAIMNYVRRNFGTLIGEATAERIKHEI
FT                   GSAYPGSEVKEIAVMGRNLAEGIPRSFTLNSNEILEALQEPLAGVVEAVKQALEQTPPE
FT                   LGADVAERGIVLTGGGALLKDIDRLIAEETGLPVVVAEDPLTCVARGGGKVLELLDRKG
FT                   GTPFFLE"
FT   gene            107807..108709
FT                   /gene="mreC"
FT                   /locus_tag="MCA0101"
FT   CDS_pept        107807..108709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreC"
FT                   /locus_tag="MCA0101"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="identified by similarity to SP:P16926; match to
FT                   protein family HMM PF04085; match to protein family HMM
FT                   TIGR00219"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90719"
FT                   /db_xref="GOA:Q60CK5"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CK5"
FT                   /protein_id="AAU90719.1"
FT                   /translation="MIREGRAIKLAFTKKPAQNFRLLVFAVVSLVLLAADRRGAIGALR
FT                   GGLDAAVYPLQQFVSAPVRFAEWLRENVSGYASLLEENQRLKEESLRLEARLAKFSALE
FT                   QENIRLRALLGASIKIGEHFLIAELLSINLVPYEHLVLANKGSNIGVHVGQPVFDARGV
FT                   VGQVLRVSPVSAEVMLITDPNHAIPVQVERNGLRTIAVGTGRIDRLILPYLSGSADIRE
FT                   GDRLVTSGMGGVFPAGYPVATVVDISNTGSSLAKVSAEPVAPLDRIREVLLVWTRSDVQ
FT                   TRDETGESPSGAAAPHVAH"
FT   gene            108696..109187
FT                   /gene="mreD"
FT                   /locus_tag="MCA0102"
FT   CDS_pept        108696..109187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreD"
FT                   /locus_tag="MCA0102"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="identified by similarity to SP:P16927; match to
FT                   protein family HMM PF04093"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90711"
FT                   /db_xref="GOA:Q60CK4"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CK4"
FT                   /protein_id="AAU90711.1"
FT                   /translation="MWRTRRTPSRILIFASLAAAMAMRIVPLPQDWALWNPDWILLVLI
FT                   YWAVMAPDRVGVGTAWLTGLLADALTGRLLGQDALAYSVVIYVGVRFHRRFRVYSMVQQ
FT                   VLAVVLLLGLGLLLTLWTRHIRGLASAPEGYWFAALSGGLVWPWVRVALDGLRRRYGAA
FT                   "
FT   gene            109218..111053
FT                   /gene="mrdA"
FT                   /locus_tag="MCA0103"
FT   CDS_pept        109218..111053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrdA"
FT                   /locus_tag="MCA0103"
FT                   /product="penicillin-binding protein 2"
FT                   /note="identified by similarity to SP:P08150; match to
FT                   protein family HMM PF00905; match to protein family HMM
FT                   PF03717"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90710"
FT                   /db_xref="GOA:Q60CK3"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CK3"
FT                   /protein_id="AAU90710.1"
FT                   /translation="MNIRAARRFQNDVRVFQSRIAFSVVLLLLAVAALVVRLVYLQIVG
FT                   HEHYATLSQDNRVKIAPLPPTRGVIYDRNGEVLADNVPSYSLELVPERIDDLDATLAEL
FT                   QTLLGLSDEDVRRFRKLRSQHKSFESIPLKMRLDEEQIARFAVKQPFFPGVQIAVRMIR
FT                   TYPYAELTAHAVGYVSRISEADLKTLDPSLYSGTYHIGKSGIEKTYETLLHGRTGHQEL
FT                   ETNVQGRSIGVLNTVPPIPGADLRLSLDITLQRAAVDALGDYNGAVVAMEPATGRVLAF
FT                   VSKPSFDPNPFVYGIPKADYDRLQASPDRPLYNRALRGVYPPGSTVKPFEGLAGLEVGD
FT                   LAADRKVSCPGYFQLPNSSHQYRDWRKGGHGAVDLKSAITQSCDVYFYKLALSLGIDKL
FT                   SEFMGRFGFGTRTGIDIPGELPGVYPSKEWKKKRSKYPWFPGETVITGIGQGYVGVTPV
FT                   QLARATAILANRGRVVTPRLLDGVQGGAGAAPEERRREELAIAPEHWDTVIQAMIDVVH
FT                   SPRGTAKSIAGGLAYHVAGKTGTAQVFSVAQGQKYRESEVSKEMRDHALFIAFAPAEQP
FT                   RIAVAVIAEHGGHGGSVAAPVARAVMERYLSGSAP"
FT   gene            111050..112183
FT                   /gene="rodA"
FT                   /locus_tag="MCA0104"
FT   CDS_pept        111050..112183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rodA"
FT                   /locus_tag="MCA0104"
FT                   /product="rod shape-determining protein RodA"
FT                   /note="identified by similarity to SP:P15035; match to
FT                   protein family HMM PF01098; match to protein family HMM
FT                   TIGR02210"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90709"
FT                   /db_xref="GOA:Q60CK2"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CK2"
FT                   /protein_id="AAU90709.1"
FT                   /translation="MRYDPGLAGFSAGETRFERIMKRIHIDIPLFAGLVTLSGVALVIL
FT                   YSASAQSFDVLLRQGIRLLLAMAVMLAIAQIHPRHFRFYSPLLWGVGVLLLAAVLVMGE
FT                   IGKGAQRWLDLGVVRFQPSEILKLAVPMTVAWYLSECPVPPAFRHVAVAGVFIAIPVGL
FT                   IAKQPDLGTAILVGAAGAVAVFLAGIRWLYLLVLGGAGAGLLPVVWHFLHDYQRDRVLM
FT                   FLNPEADALGRGYHIIQSKIAIGSGGFYGKGWLQGSQAQLEFLPEKSTDFIFAVVAEEF
FT                   GLLGCLGLLAIYLFIIGRCIHISLQAQDAYTRLLSGALTLTFFVYVFVNTGMVVGILPV
FT                   VGVPLPLVSYGGTSMVTLLAGFGILMSVQTHRKLLPG"
FT   gene            112342..113520
FT                   /locus_tag="MCA0105"
FT   CDS_pept        112342..113520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0105"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /note="identified by similarity to SP:P08506; match to
FT                   protein family HMM PF00144; match to protein family HMM
FT                   PF00768; match to protein family HMM PF07943"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90708"
FT                   /db_xref="GOA:Q60CK1"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CK1"
FT                   /protein_id="AAU90708.1"
FT                   /translation="MNVKALLIHARWHVSLSLVLLAGWCLPLRAEPPLIPAPPELPAKA
FT                   YLLQDFYSGRVLAERNADERLEPASLTKVMTAYILFRELAQGHVKLEDMVTVSEKAWRT
FT                   EGSRMFAQVGAQISVENLLKGMIVQSGNDASVALAEHVAGDEAVFAQLMNQNAERLGMT
FT                   NTHFKNSMGLPDPDHYTTARDLATLTRAMIKEFPQYYPWHAIKEFVFNDIKQVNRNRLL
FT                   WRDPSVDGVKTGHTEGAGYCLITSAVRDGDRMVSVVLGTKSDTDRANANQALLNYGFRF
FT                   FETKPVHKGGEELAKARIWKGEQTEVPVGVDEDLYATFPRGQFQNLKTAMEVDADAMAP
FT                   VRKGDRLGSIRVTFNNETIIQRDLVALQEVPEGGIFRRALDHVLLWLKRRQG"
FT   gene            113538..114389
FT                   /locus_tag="MCA0106"
FT   CDS_pept        113538..114389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0106"
FT                   /product="putative D-amino acid aminotransferase"
FT                   /note="identified by similarity to SP:P54692; match to
FT                   protein family HMM PF01063"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90707"
FT                   /db_xref="GOA:Q60CK0"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CK0"
FT                   /protein_id="AAU90707.1"
FT                   /translation="MNGPLVYLNGEFLPLDQARVSVLDRGFLFGDGVYEVIPVYGGRPL
FT                   RLEEHLRRLDDSLRGIRMTSPLMRSEWSEIIGRLIDGVDDQSVYVQVTRGVGPARDHSI
FT                   PVGVRPTVFAMASPITPVPVTGVRAITLEDIRWRWCNIKAITLLPNVLLRQQAVDRGCA
FT                   EAVLVREGHVTEGTASNVFAVVGGTIVTPPKGPELLPGITRDLVLELVRAEGLPARERA
FT                   ISLEEFSGAEEIWITSSTREVLPVVELDGRPVGRGSPGPVWERVSALYQDFKRRLKRGI
FT                   TA"
FT   gene            114386..114649
FT                   /locus_tag="MCA0107"
FT   CDS_pept        114386..114649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0107"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:17427335; match to
FT                   protein family HMM PF04359"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90706"
FT                   /db_xref="GOA:Q60CJ9"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CJ9"
FT                   /protein_id="AAU90706.1"
FT                   /translation="MSLDALLEFPCEFPIKVFGPAEGDFAASVEAAVRLAAPELEELGV
FT                   AVRASGGGRFVAVTVTFIASSQAQIEAIYQRIGTLPGVLMVL"
FT   gene            114744..116189
FT                   /gene="mgtE"
FT                   /locus_tag="MCA0108"
FT   CDS_pept        114744..116189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtE"
FT                   /locus_tag="MCA0108"
FT                   /product="magnesium transporter"
FT                   /note="identified by similarity to OMNI:NTL03PA00914; match
FT                   to protein family HMM PF00571; match to protein family HMM
FT                   PF01769; match to protein family HMM PF03448; match to
FT                   protein family HMM TIGR00400"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90702"
FT                   /db_xref="GOA:Q60CJ8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CJ8"
FT                   /protein_id="AAU90702.1"
FT                   /translation="MSDSIIETSDERLRRLVREVVDLLEKQKLEETILQHQPMSRHELI
FT                   ENLMHKQHQVALRQKLDSLHAADIAYVLESLPQAQRLAVWAQVDPEMDGEILLHVSDAV
FT                   RESLISDMDRDELLHATEQLDTDEIADLAPDLPEEVMQELLKSLNDQTRAQLESVLSYE
FT                   EDTVAAIMDFGMVAIREDTTLGVVLRYLRQRGDLPENTDKLFVVDKQGVLRGVLSLKRL
FT                   LLRSPEARVADVMSRDVVMFHLDDDASVAARAFERYGLLSVPVVDDQQRLVGRVSIDAI
FT                   VDYIRHESDEEALAQAGLLQEEDLFAGIWKSVKNRWVWLGINLLTAFASTRVIDLFDDT
FT                   ISRVVALASLMPIVAGIGGNTGTQTSTLIVRSLALGLVDSSNVRRLVFKEIAIGLINGI
FT                   VWGSVIGVLTYALYRDPKLASVMAAAMTLNLLVAAVTGLFVPLIRARLDLDPAIGTSVL
FT                   LTAITDGMGFFIFLGLATLFLLN"
FT   gene            116196..116819
FT                   /gene="lipB"
FT                   /locus_tag="MCA0109"
FT   CDS_pept        116196..116819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="MCA0109"
FT                   /product="lipoate-protein ligase B"
FT                   /note="identified by similarity to SP:Q9PDV9; match to
FT                   protein family HMM PF03099; match to protein family HMM
FT                   TIGR00214"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90701"
FT                   /db_xref="GOA:Q60CJ7"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60CJ7"
FT                   /protein_id="AAU90701.1"
FT                   /translation="MAFLVRMLGRADYEPVWRAMQEFTGQRADDTADELWLVEHPPVYT
FT                   LGMNGDPAHILDAGGVPVVRTDRGGQVTYHGPGQLVLYTLVDLQRRKLGVRRMVSALEQ
FT                   AVIGLLRQYGLEARARGDAPGVYVDGAKIASLGLRVRRGCCYHGVALNVCPELEAFDRI
FT                   HPCGHAGLAVTRLTDLGVEAQVFEPAAALVRELMVQLGDEEIAA"
FT   gene            116816..117784
FT                   /gene="lipA"
FT                   /locus_tag="MCA0110"
FT   CDS_pept        116816..117784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /locus_tag="MCA0110"
FT                   /product="lipoic acid synthetase"
FT                   /note="identified by similarity to SP:P25845; match to
FT                   protein family HMM PF04055; match to protein family HMM
FT                   TIGR00510"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90700"
FT                   /db_xref="GOA:Q60CJ6"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60CJ6"
FT                   /protein_id="AAU90700.1"
FT                   /translation="MKTLDENQAPSRQTPESHRRGAEKLSRIPVKVEPGAPLRKPDWIR
FT                   VRAGSGDEVRRVKRLLRERGLHSVCEEAACPNLAECFGHGTATFMILGDICTRRCPFCD
FT                   VAHGRPAPPDPAEPERLAETIALLRLRYVVITSVDRDDLRDGGAAHFAACIRALRTRSP
FT                   ALSVEILTPDFRGRMEIALDLLAADPPDVFNHNIETVPRLYRQARPGADYRQSLELLAR
FT                   FRDKVPGVPTKSGLMLGLGETLDEVREALRDLRGHGCEMLTLGQYLQPSRDHLPVVRYV
FT                   PPAEFDELAGYARELGFASVASAPLVRSSYHADQQAAIIGR"
FT   gene            117877..118479
FT                   /locus_tag="MCA0111"
FT   CDS_pept        117877..118479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:MT0787"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90699"
FT                   /db_xref="GOA:Q60CJ5"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CJ5"
FT                   /protein_id="AAU90699.1"
FT                   /translation="MPAYPRAELEEMVARWLAANRDAERAGDWIRSLGAMYTEDAEYGW
FT                   NMGPDQEFLARGRQQIMEWALGFHMEGFEQWRYPYDHVVIDDAQGEVIGFWRQVSPARR
FT                   PDGSHYEVAGLGGSWFRYGGDYQWSWQRDFFDLGNVKALFMELAANGQLDAPVRRKIAR
FT                   LAKGQAMPGVHPLHPAPGLLAKLKGYYAMARIVLSGG"
FT   gene            118557..119105
FT                   /gene="ppa"
FT                   /locus_tag="MCA0112"
FT   CDS_pept        118557..119105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppa"
FT                   /locus_tag="MCA0112"
FT                   /product="inorganic pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="identified by similarity to SP:P17288; match to
FT                   protein family HMM PF00719"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90698"
FT                   /db_xref="GOA:Q60CJ4"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CJ4"
FT                   /protein_id="AAU90698.1"
FT                   /translation="MALMKVSSGRQVPEDIHVVIEIPAFSDPVKYEVDKETGALFVDRF
FT                   MGTAMQYPCNYGYVPHSLSEDGDPVDVLVIAPCRLLSGSVVRCRPIGVLKMEDEAGSDA
FT                   KVLAVPVDKLSSLYSKVKSYRDVPEPQLAQIAHFFEHYKDLEPGKWVKINGWGDIDEAR
FT                   REITGSIERYNQAKEKPYF"
FT   gene            complement(119053..119595)
FT                   /gene="hoxW"
FT                   /locus_tag="MCA0113"
FT   CDS_pept        complement(119053..119595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hoxW"
FT                   /locus_tag="MCA0113"
FT                   /product="HoxW protein"
FT                   /note="identified by similarity to GP:1313919"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90697"
FT                   /db_xref="GOA:Q60CJ3"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CJ3"
FT                   /protein_id="AAU90697.1"
FT                   /translation="MAGLLVFGYGNPSRGDDALGPLFLEALQIRLASSPGVDIEFLQDF
FT                   QLQIEHALDLAGRDRVLFVDAHVGCPPPFRFERLVPQRDGSYTTHAVSPQALLEVYRRI
FT                   NRDEPPPAYLLSIRGERFDLGDALSRSAESNLESALRFAEVLIGATPGTAWDALCPRGE
FT                   IRNTAFPWPGCSARCCR"
FT   gene            complement(119597..121081)
FT                   /locus_tag="MCA0114"
FT   CDS_pept        complement(119597..121081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0114"
FT                   /product="NAD-reducing hydrogenase, beta subunit"
FT                   /EC_number="1.12.1.2"
FT                   /note="identified by similarity to SP:P22320; match to
FT                   protein family HMM PF00374"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90679"
FT                   /db_xref="GOA:Q60CJ2"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CJ2"
FT                   /protein_id="AAU90679.1"
FT                   /translation="MYDHLETAENPENLKRVVIDPVTRVEGHGKVTLLLDDDDHVRQAR
FT                   LHIVEFRGFERFIQGRPYWELPVLVQRLCGICPVSHHLAAAKAIDQIVGVDRLTPAAEK
FT                   LRRLMHFGQFLQSHALHFFHLATPDLLLGFDSPAGRRNIFEVLKEYPDVGLEGVRMRKY
FT                   GQEVIRVISGKRIHGSASIPGGMNKALTCEERDFLRQDIDEVLGWCRNALALIRRIYLA
FT                   NREHHERFGLIRSNFMGLIRDDGAFEIYHGGLRAKDASGRTIFDKLDYRGYTGILREEV
FT                   RSWSYMKFPYIEALGKENGWYRVGPLARINNCDFIPTPLAEEARQDFLAHGAGGPVHGS
FT                   LAFHWARMIETLHCAESIRELLDDPELLGTDLVVHGERRPEGIGVIEAPRGTLFHHYQV
FT                   DENDLVTRANLIVSTTQNNQAMNESIRQVAAEYLDGQTITEGLLNHIEVAIRAYDPCLS
FT                   CATHALGRMPLVVELTNAGGRMLDRLHRRADGTVSR"
FT   gene            complement(121147..122544)
FT                   /gene="hemN"
FT                   /locus_tag="MCA0115"
FT   CDS_pept        complement(121147..122544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemN"
FT                   /locus_tag="MCA0115"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /EC_number="1.-.-.-"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM PF06969; match to protein
FT                   family HMM TIGR00538"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90678"
FT                   /db_xref="GOA:Q60CJ1"
FT                   /db_xref="InterPro:IPR004558"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CJ1"
FT                   /protein_id="AAU90678.1"
FT                   /translation="MNRQNTALRVEWDPALIRKYDRSGPRYTSYPTADRFVPDFNAARY
FT                   EEWLHRRAAEANPSPLSLYFHIPFCQTVCFYCACNKIVTANREHAGKYIDYLEKEIELQ
FT                   ARHLGPHREVRQLHWGGGTPTFLNHAQMRRLMEATREHFELAEGEYSIEIDPRKVDAAT
FT                   IALLREIGFNRMSLGVQDFDPAVQKAVNRIQSEEETLRVLTAARAEGFCSVSIDLIYGL
FT                   PKQSVSGFRHTLDRILAADPDRISLYNYAHLPHLFKPQRQIRDEDLPSADTKLEILQDA
FT                   VAHLTGAGYVYIGMDHFAKADNELNLAQREGRLQRNFQGYSTHADCDMVALGVTAIGKV
FT                   GPTYSQNFRTLEDYYARLDQGVLPVMRGLECDDDDLLRRAVIQALMCQFELDFVRLGRQ
FT                   HGVDFPRYFAAELDDLEPMAADGLLELGPDRLTVTPKGRFLIRNIAMAFDRYLRQDRER
FT                   RAYSKVI"
FT   gene            122641..123078
FT                   /locus_tag="MCA0116"
FT   CDS_pept        122641..123078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0116"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:19914581; match to
FT                   protein family HMM PF06803"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90676"
FT                   /db_xref="GOA:Q60CJ0"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CJ0"
FT                   /protein_id="AAU90676.1"
FT                   /translation="MILTEKTVQDSVAFVKARSKANEYAGDPGKLASLLDRASKKAEAK
FT                   KGPLSEVRDSLMACLRLLRACAQKRYSLPWQSLGLIVAAVVYFVMPVDLIPDFILSLGF
FT                   ADDAALLAWTFRQVKSDLEDFRRWELEQAESEAPGDVAEAS"
FT   gene            123087..123560
FT                   /locus_tag="MCA0117"
FT   CDS_pept        123087..123560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0117"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:VC1575"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90677"
FT                   /db_xref="GOA:Q60CI9"
FT                   /db_xref="InterPro:IPR021125"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CI9"
FT                   /protein_id="AAU90677.1"
FT                   /translation="MHGVRVVAAMEAAKGIVVLLAGFGVVELLHHGLEPVVDELVRHTH
FT                   LNPASRYPRIFLDLLKNLSDQRLWALAALAFGYAMLRCIEAYGLWRGRRWAEWFGVASG
FT                   GIYVPFELYELAEGVSWLKLATLAVNLAVVGYLAYALWAGSRLPPQPVSSSLE"
FT   gene            complement(123533..124576)
FT                   /locus_tag="MCA0118"
FT   CDS_pept        complement(123533..124576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0118"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90675"
FT                   /db_xref="GOA:Q60CI8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR017832"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CI8"
FT                   /protein_id="AAU90675.1"
FT                   /translation="MLRSSPGGHFYDLGDVTVVIPARDEAGVIGQTLAALKEQGGGLRV
FT                   VLVDDGSTDGTGEAAGRVEGLDLTLLRNESLPPGWSGKLWALEQGVARVGTEYTVLLDA
FT                   DILLQPGVLGVLREKMRSEGIQFASLMASLRMENFWERLLMPAFVYFFKMLYPFALSNS
FT                   PDRRFAAAAGGCIMLETRLLERIGGFAAIHGALIDDCTLAKKVKATGARTWIGLSRSVV
FT                   SLRRYDTLADVWDMIARTAFTQLRYSAWLLALCTLLMLILFWLPAAGLFASDEGVTLAA
FT                   AWAVLLMAGTYMPTLRFYGRSAAWGLLMPVIAGAYLAMTWSSALRYWRGERSRWKGRVY
FT                   SSEDDTG"
FT   gene            complement(124746..125204)
FT                   /locus_tag="MCA0119"
FT   CDS_pept        complement(124746..125204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0119"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90674"
FT                   /db_xref="GOA:Q60CI7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CI7"
FT                   /protein_id="AAU90674.1"
FT                   /translation="MDILIRPAETRDIEAMVELLGTLFSIEADFTFDPDRQRRGLALLI
FT                   GSSADRVLVAECEGRVIGMCSVQTLISTAEGGPVGLVEDMVVAREFRGKGIGRRLLGEI
FT                   ERWAADAGLTRLQLLADRTNEPALTFYGRRGWERTALIGLRKMLRDAD"
FT   gene            125396..126508
FT                   /locus_tag="MCA0120"
FT   CDS_pept        125396..126508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0120"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF01594"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90673"
FT                   /db_xref="GOA:Q60CI6"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CI6"
FT                   /protein_id="AAU90673.1"
FT                   /translation="MLEKLISHRLIDLFIRVGLIGFLVIYCYQIFKPFIGLMLWSVILA
FT                   VAFHPMHASLARRMGDKQGRAATVLVLAILLCVLVPTALLAVSFADSATDLVRQVRDGS
FT                   LKVPAPRAFVAEWPLLGDKLYALWSAAHEDIGSVAARFEPKIRTVTKEILGYAASAGSA
FT                   VLKFMVSLVLAGVWMAYASSGHAAARAIANRMAGPGQGDALVRLSTTTIRAVAQGVIGI
FT                   ACIQALLLGAGFILVGVPAAGVLALLVLLLGIMQVPALLISLPTVIYVFMTDDSTIVAI
FT                   MFAIYTIVAGSVDNILKPFMLGRGVDAPMPVILLGALGGMATGGIIGLFLGSVMLALGY
FT                   QLFMAWVYDDTGLGGSRATGGQESRDSPLE"
FT   gene            complement(126518..128167)
FT                   /locus_tag="MCA0121"
FT   CDS_pept        complement(126518..128167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0121"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90672"
FT                   /db_xref="InterPro:IPR007505"
FT                   /db_xref="InterPro:IPR018633"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CI5"
FT                   /protein_id="AAU90672.1"
FT                   /translation="MGETFFCRASRAVLITGEGNFPGLDENGWETLEDCAGVIEIDEWQ
FT                   TAYLRFYGEEPAQFSRCLNAVGAGRFERLPHHALPTYRINFQNHVGQSSLAGFRVKVVH
FT                   RKITEEHFNAMLDFLCDQYATLIFSLRQIAGVHWRKDRAGRDNPYLQYLLIRRHLLHGR
FT                   PDLDGIAVLVHRAMHERMVSTVEETSIDRVRDLDSAAAMTLLSRPAAWGRLETGHPLKD
FT                   TALARSVFQRAGRRLFPGRVRSRRRHATVDTPENRFVKFFLTRLEQRLAQIKAMLGEGG
FT                   GTFLHPEMGDEIGRLERCLDRFLDGPRWREVGELRHIPARSTVLQRRAGYRELFRLFAL
FT                   LQQASRHDANLLDFTALVEIKDAPLLYEYWCFFQVKQRLDARFGLPRRASIIAEAQPEE
FT                   DALREGLRLDYGRGIALYYNATCAARSSGRLSSYSNDLRPDIILSDGDRLLILDAKYRG
FT                   EASGDTGIESPNPADIDKMHTYREAIRNVWGAFVLYPGEKPEIHPAFTARGDSRYEGVG
FT                   ALVLAPDILSGEVDGSDEIERLISEFLERRKS"
FT   gene            complement(128160..129140)
FT                   /locus_tag="MCA0122"
FT   CDS_pept        complement(128160..129140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0122"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:9106685"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90662"
FT                   /db_xref="GOA:Q60CI4"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CI4"
FT                   /protein_id="AAU90662.1"
FT                   /translation="MNRTERFYKIDRMLHERKLVPKGAFLEALGVSDATFKRDIEYMRE
FT                   RLNAPIVWDREARGYRFEPGDGPPYELPGLWFSAAELYALLAAQNLLEDIEPGFLAAHV
FT                   APLKSRLAALLESGGHPAAEVARRVKLVSLARRPVEPRFFNEVAQALLQRHQLEISAWN
FT                   RRRDEVNVRIVSPQRLVHYRDNWYLDAWCHWRDGLRSFSLDTLRQVRALSTSAHEIPDE
FT                   ELERQYTSSYGIFSGETRHWAVLRFVPERARWVRNECWHRDQQGELLPDGSYRLRIPYA
FT                   VEAELAMDVLRHGADVIVEAPESLRQCVRDEAWALWQNHRAPGDG"
FT   gene            complement(129258..129545)
FT                   /locus_tag="MCA0123"
FT   CDS_pept        complement(129258..129545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0123"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90661"
FT                   /db_xref="GOA:Q60CI3"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CI3"
FT                   /protein_id="AAU90661.1"
FT                   /translation="MKRACWILYLSLLEGCAHLPNGEIDYKGSFEKSMEYLGMAIWAPI
FT                   VVPSLLIAYTKTTGPVNTNCWKSGGRLICNSQGFINGSYYSGTRTYRFDR"
FT   gene            complement(129689..129907)
FT                   /locus_tag="MCA0124"
FT   CDS_pept        complement(129689..129907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0124"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90660"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CI2"
FT                   /protein_id="AAU90660.1"
FT                   /translation="MERVGAEHLEDAIDIQILQKVLPKFHGTQGKLEEPLNRLNEFCET
FT                   EGFARSAKKLQRMLKDLSEQGYCSFIA"
FT   gene            complement(129888..130016)
FT                   /locus_tag="MCA0125"
FT   CDS_pept        complement(129888..130016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0125"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90659"
FT                   /db_xref="GOA:Q60CI1"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CI1"
FT                   /protein_id="AAU90659.1"
FT                   /translation="MVGQEIRKASKVYCVNLRLYCTNCGIVKNQVQPSARGGAGRR"
FT   gene            complement(131324..131806)
FT                   /locus_tag="MCA0126"
FT   CDS_pept        complement(131324..131806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0126"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90658"
FT                   /db_xref="GOA:Q60CI0"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CI0"
FT                   /protein_id="AAU90658.1"
FT                   /translation="MKRTTLLLTTALTSFGASGADKAIATFALTFRLDTSTYTDVVVID
FT                   QNDSDGEYSGYDAKSGRQVWAVKNGPMLCASVVDKPIYGVSYCFPYGKKFSAKAFVIHT
FT                   LCDDGVVLDYCTGLPVTATVTRTKNATSAAQAMSEEEIESEEQKKILELRERLPWK"
FT   gene            132057..133697
FT                   /locus_tag="MCA0127"
FT   CDS_pept        132057..133697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0127"
FT                   /product="ABC transporter, ATP-binding family protein"
FT                   /note="identified by similarity to SP:P75790; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90657"
FT                   /db_xref="GOA:Q60CH9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CH9"
FT                   /protein_id="AAU90657.1"
FT                   /translation="MPVGATPSHSFLSVIILISTANVTMQFGVKPLFENVSVKFGEGNR
FT                   YGLIGANGCGKSTFMKILGGDLEPTAGNVSLDLNVRLGKLRQDQFAFEDQRVLDVVMMG
FT                   HTEMWAAMSERDAIYANPDASEDDYMRAAELEAAFAEYDGYTAEARAGELLLGVGIPLE
FT                   QHDGPMSAVAPGWKLRVLLAQALFSNPDILLLDEPTNNLDINTIRWLENVLNARNSTMI
FT                   IISHDRHFLNSVCTHMADMDYGELRIYPGNYDDYMIASTQARERQLAENAKKKAQIAEL
FT                   QAFVSRFSANASKARQATSRARQIEKIKLEDIKPSSRVNPFIRFNQDRKLHRLALEVEG
FT                   LAKGYGEEPLFQGLNLMVEAGERVAVIGPNGIGKTTLLRCLVGDLEADAGQVKWAENAS
FT                   LGYFAQDHAADFAEDISLLDWMGRWKREADDEQTVRGTLGRLLFSQDEIKKSVKVLSGG
FT                   EQGRMLFGKLILRQPNVMVLDEPTNHLDMESIESLNTALEHYPGTLIFVSHDREFVSSL
FT                   ATRIIELTPQGVVNYRGTYDEYLQSQGLE"
FT   gene            133709..134128
FT                   /locus_tag="MCA0128"
FT   CDS_pept        133709..134128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0128"
FT                   /product="peptidyl-tRNA hydrolase domain protein"
FT                   /note="identified by similarity to GP:17133833; match to
FT                   protein family HMM PF00472"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90656"
FT                   /db_xref="GOA:Q60CH8"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CH8"
FT                   /protein_id="AAU90656.1"
FT                   /translation="MARLIVNALVSVPLAEIEIGFVRSGGAGGQNVNKLATAAHLRFDI
FT                   AASSLPETCKTRLLDHRDRRMTAEGIIVIKAQRFGTQEKNREDALARLRGLILQALAQR
FT                   RPRKPTRPTLAAKKKRLDEKTRHGEIKRLRRRIGD"
FT   gene            complement(134125..135210)
FT                   /gene="apbE"
FT                   /locus_tag="MCA0129"
FT   CDS_pept        complement(134125..135210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apbE"
FT                   /locus_tag="MCA0129"
FT                   /product="thiamin biosynthesis lipoprotein ApbE"
FT                   /note="identified by similarity to SP:P41780; match to
FT                   protein family HMM PF02424"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90655"
FT                   /db_xref="GOA:Q60CH7"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CH7"
FT                   /protein_id="AAU90655.1"
FT                   /translation="MTLPILRRFGGLLLGATLVACQTGEDETLLSGDVQGTTYHIKMVL
FT                   DGLPADQTELKQAVDAVYDDIDLKLSNYREDSEISRINRAATTDWLTVSPEIAELVDIA
FT                   RQVHDKTDGCYDLTVKPLFDLWGFSRHQTRVPTDAEIAAVLPHIGMDKLEVDVPGRRLR
FT                   KKDPALRIDLSSIAQGYTVGRVAGLLEAKGIQNYLVEVGGEMQVKGRKANGKPWRVAVE
FT                   KPTPYTREVERILDVHQTEGTAIMTSGTYRNFFEEGGKTYSHILDPRTGRPVDHHLLST
FT                   TVLHPDPTWADAWSTALLCLGEQKGYAIAERERLKALLIYGENGGLKERFTPAFGAEMP
FT                   MATRPASPLSTRAPAAVTETR"
FT   gene            complement(135314..135628)
FT                   /locus_tag="MCA0130"
FT   CDS_pept        complement(135314..135628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0130"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90646"
FT                   /db_xref="GOA:Q60CH6"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CH6"
FT                   /protein_id="AAU90646.1"
FT                   /translation="MPHFPTVAGAPHPTSRNPNMLPKVLIVLVLVVIVASLGSALFYLV
FT                   KDGDRRSPRTVRALTVRIGLSIALFLALLLGYALGFLRPHGLRPNAPAQTPAPAAANPR
FT                   "
FT   gene            135692..136360
FT                   /locus_tag="MCA0131"
FT   CDS_pept        135692..136360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0131"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL03PA00111"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90645"
FT                   /db_xref="GOA:Q60CH5"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CH5"
FT                   /protein_id="AAU90645.1"
FT                   /translation="MLGAWQLNRAAEKRALLAQLASQSVEPPLRLDSPAGQAGPPRYRR
FT                   VALKGEYDAGHQFLLDNQIHGGKAGYHVLTPLRLAGSDLGVLVNRGWIPAGADRRRLPE
FT                   LPIRTLAVELTGMVERFPAVGWKLKGAEIPAPGWPAMVQVVERQALERRLGYRLLPYQV
FT                   LLDQGEAEGFVRDWKPANVDPDQSTGYAIQWFSFAAIALGLFLRHGFRMGAAQDPDLSR
FT                   "
FT   gene            136367..136987
FT                   /locus_tag="MCA0132"
FT   CDS_pept        136367..136987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0132"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL03PA00112"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90644"
FT                   /db_xref="GOA:Q60CH4"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CH4"
FT                   /protein_id="AAU90644.1"
FT                   /translation="MNPLTAMALTPTQRRNQRTIIIIALICIVPFAAAWYFARHPQWVM
FT                   GDLGNVGHLITPAIPLDYGELLAAPVTSSESMAQLRGRWIVLSVADGPCAEVCRQNLYK
FT                   TRQMRLMLNKEIPRVRRLLLLTDPGAADALADWLRQDEFLAVAGLAPTLREKLEKAVGG
FT                   PLQPGQILLLDPLGNLMMYYDADFDPYGVLKDLKHLLRASQIG"
FT   gene            136994..139009
FT                   /gene="ftsY"
FT                   /locus_tag="MCA0133"
FT   CDS_pept        136994..139009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="MCA0133"
FT                   /product="cytochrome oxidase assembly family protein/cell
FT                   division protein FtsY"
FT                   /note="identified by match to protein family HMM PF00448;
FT                   match to protein family HMM PF02628; match to protein
FT                   family HMM PF02881; match to protein family HMM PF03929;
FT                   match to protein family HMM TIGR00064"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90643"
FT                   /db_xref="GOA:Q60CH3"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CH3"
FT                   /protein_id="AAU90643.1"
FT                   /translation="MAYNFRTTTMFRKLTFLGLILLFGALLIGAFLRIADAGLGCPAWP
FT                   GCYGAPVADEQSAAMMAAVGGKALKWLWLGWVHRYLGGAFGILALVLMAMIGWLPAHRG
FT                   RAALLAAALLLLAAGQAGLGLWGHYAAPMPLVSAAHLFTGFLTLGCAYWLYLAVKAEVD
FT                   ERAVRGAPGLRFLARLGLALLLAEIALGGWTEAQRAGLACPDFPTCLGQPWPELDWRRA
FT                   FTLWPNVAADYAGGVLPVEARAAIHFAHRLGAVAVFLVLSLLAMGASSNRNAAPISKPA
FT                   VLLSFLLLLQVGLGVLSVLLRLPVAVAVAHQAVAALLLLNVVHINVYLRRRLPEAAAVP
FT                   AEVPVRPPVAAVPPPPAPENLFERLRGQLGKTRSSLTGLLSALGRGRIDRALLDEIEEQ
FT                   LLMADVGVPVTREIIADLGSDLDRQEPADGRALRDRLRGRLLDIVRPCSVPLVIPPEVR
FT                   PFVILVVGVNGVGKTTTIGKLAKRLQNEGHSVMLAAGDTFRAAAVEQLQTWGERNKIAV
FT                   IAQHSGADSASVIYDAVEAARARGVDILIADTAGRLHTKSNLMEELSKIKRIIGRLDET
FT                   APHEVLLVLDAGTGQNALSQARLFNEAVGLTGLVLTKLDGTAKGGVIFALARQFGIPIR
FT                   FIGIGEGIDDLRDFDAVQFIDALFAEEETSGTTRLH"
FT   gene            139014..139676
FT                   /gene="ftsE"
FT                   /locus_tag="MCA0134"
FT   CDS_pept        139014..139676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="MCA0134"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="identified by similarity to SP:P10115; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90642"
FT                   /db_xref="GOA:Q60CH2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CH2"
FT                   /protein_id="AAU90642.1"
FT                   /translation="MLEFKEVYKRYPEFGEALHDVSFHIGRGERVFLTGHSGAGKSTLL
FT                   KLVAVIERATRGQIVLDGRNITRASNREIPYIRRKLGLIFQDYKLLYDRSVFDNVALPL
FT                   VIAGFNPGEVSRRVRAALGKVGLLSKEKRLPQTLSGGEQQRVGIARAIVHKPDFILADE
FT                   PTGNLDPEAAREVMDIFRDFNDLGVTLLIASHDEQLISRCGGRVLRLQRGSLSEVGA"
FT   gene            139769..140671
FT                   /locus_tag="MCA0135"
FT   CDS_pept        139769..140671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0135"
FT                   /product="putative protein insertion permease FtsX"
FT                   /note="identified by similarity to SP:P10122; match to
FT                   protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90641"
FT                   /db_xref="GOA:Q60CH1"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CH1"
FT                   /protein_id="AAU90641.1"
FT                   /translation="MVSHLHTAKEALRRMRRTPFAMALTLLVIAATLALPTSFHVLVKN
FT                   LRMVGGDLEATNEISLYLKPDLSNDAGRRLAERLKNHAQIAETRLVTKEAGIEQLKTYS
FT                   GFGEALSALNFNPLPVVIGIRPKDSLTQPEQVERLVAELKALPEVDLVQSDIQWMHRLH
FT                   ALLQVAERSFGVLGALLAAAVVFIIGNTIRLELYGRREEIVVQKLLGATDRFIRRPFLY
FT                   TGFWYGFLGSLGAWIVVGVMLLIVRAPIHQLNVLYGSDFTLAFLGFQETMALVGIACFL
FT                   GVAGAFAVLIQHLRDVRPE"
FT   gene            140773..141633
FT                   /gene="rpoH"
FT                   /locus_tag="MCA0136"
FT   CDS_pept        140773..141633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH"
FT                   /locus_tag="MCA0136"
FT                   /product="RNA polymerase sigma-32 factor"
FT                   /note="identified by similarity to SP:P00580; match to
FT                   protein family HMM PF04542; match to protein family HMM
FT                   PF04545; match to protein family HMM TIGR02392"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90640"
FT                   /db_xref="GOA:Q60CH0"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CH0"
FT                   /protein_id="AAU90640.1"
FT                   /translation="MTYELTLPTHLPLGSIDDYFAAVNRLPRLDADEERELAIRFRDEQ
FT                   DLEAARRLVLANLRFVAYIARGYLGYGLPLADLIQEGNIGLMKAVKRYDPDVGVRLVSF
FT                   AVHWIRAEIHEFIIQNWRIVKIATTKAQRKLFFNLRKMKNRLGWLTPEEAAAVAAELGV
FT                   DVEDVYKMENRLNNPDMALEAHGEDDGDDRESHAPIHYLQQEGGDPALLIEHSEWENRQ
FT                   QEKLQEAIGQLDERSRDIVASRWLSEDKLTLHDLAARYNVSAERIRQLESSAMKKLRNA
FT                   LADAA"
FT   gene            complement(141683..142552)
FT                   /gene="metF"
FT                   /locus_tag="MCA0137"
FT   CDS_pept        complement(141683..142552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /locus_tag="MCA0137"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /note="identified by similarity to SP:P00394; match to
FT                   protein family HMM PF02219; match to protein family HMM
FT                   TIGR00676"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90632"
FT                   /db_xref="GOA:Q60CG9"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CG9"
FT                   /protein_id="AAU90632.1"
FT                   /translation="MGSAMKTQLKYPREFSFEFFPPKTEEATENLRRTLTKLAPLKPRF
FT                   CSVTFGAGGSTREKTFETALEIQQTTGIECAPHLSCIASTRRSIREILEAYRSHGIRHI
FT                   VALRGDMPSGMLSAGEFRHANELVEFIRSETGNHFHIEVACYPEVHPQAASAESDLKNF
FT                   KRKVDAGADSAITQYFYNPEAYFRFVDDCERLGIDIPIVPGIMPITNHSQLVRFSDLCG
FT                   ADIPRWIRKRLEAFGDDRKAIRTFGLEVVTELCRRLLEQGAPGLHFYTLNRAEACLEVW
FT                   KALGLEPA"
FT   gene            complement(142710..144128)
FT                   /gene="ahcY"
FT                   /locus_tag="MCA0138"
FT   CDS_pept        complement(142710..144128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahcY"
FT                   /locus_tag="MCA0138"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="identified by similarity to SP:O50562; match to
FT                   protein family HMM PF00670; match to protein family HMM
FT                   PF05221; match to protein family HMM TIGR00936"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90631"
FT                   /db_xref="GOA:Q60CG8"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60CG8"
FT                   /protein_id="AAU90631.1"
FT                   /translation="MNAVANAASFDDHKVADLSLAGWGRKEIAIAETEMPGLMAIREEY
FT                   RAAQPLKGARIAGSLHMTIQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAIAADGIP
FT                   VFAYKGESLDDYWEYTHRILEWPGDVGPNMILDDGGDATLLVTLGARAEKDASLLANPT
FT                   CEEEEVLFAAIRKRLAAKPGWYSRIQAGIKGVTEETTTGVHRLYEMQAKGRLPFPAINV
FT                   NDSVTKSKFDNLYGCRESLVDGIKRATDVMIAGKIAVVLGYGDVGKGCAQSLRGLGATV
FT                   WITEIDPICALQAAMEGYRVVTMDEACDKADIFVTATGNVGVITHDHMVKMKDQAIVCN
FT                   IGHFDSEIEVAAMRQYTWENIKPQVDHIVLPNGRRIILLAEGRLVNLGCATGHPSFVMS
FT                   NSFTNQTLAQIELFCHGAKYENKVYVLPKHLDEKVARLHLKKIGARLTELSDEQAAYIG
FT                   VPKEGPYKPDHYRY"
FT   gene            complement(144326..145495)
FT                   /gene="metK-1"
FT                   /locus_tag="MCA0139"
FT   CDS_pept        complement(144326..145495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK-1"
FT                   /locus_tag="MCA0139"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="identified by match to protein family HMM PF00438;
FT                   match to protein family HMM PF02772; match to protein
FT                   family HMM PF02773; match to protein family HMM TIGR01034"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90630"
FT                   /db_xref="GOA:Q60CG7"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60CG7"
FT                   /protein_id="AAU90630.1"
FT                   /translation="MSNSFIFTSESVSEGHPDKIADQVSDAVLDAILAQDPKARVAVET
FT                   LVKTGMVVLAGEVTTSAWVDTEELVRKVVHEIGYDNPEIGFDWQSCAVLTAIGKQSPDI
FT                   AMGVDEFDDHEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKHKVLPWLR
FT                   PDAKSQVTFRYEEGKPVAVDAVVLSTQHAPDVAQKDIREAVMEEIIYHVLPREWLHKDT
FT                   KYFINPTGSFVIGGPVGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYMGR
FT                   YVAKNIVAAGLAERCEIQVSYAIGVAEPTSISIETFGTGRIAEETLVKLVREHFDLRPK
FT                   GLITMLDLLRPIYRPTAAYGHFGRTEGTFTWERTDKADLLREAAGLPIA"
FT   gene            145748..146482
FT                   /locus_tag="MCA0140"
FT   CDS_pept        145748..146482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0140"
FT                   /product="glycosyl transferase, group 2 family"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90629"
FT                   /db_xref="GOA:Q60CG6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CG6"
FT                   /protein_id="AAU90629.1"
FT                   /translation="MNLESITVVLPTRNEAGNIGAFLASLPQAVHLIVVDASEDETPDI
FT                   IQRERPARTQVLRRRSTITQARQLGAEAALTDWLLFTDADIVFPDGYFDALERVMDAAV
FT                   VYGPKLSRDRFAAYYRWFGYGQQCSHWLGIPAATGSNLLVRKDALIAVGGFDPALVCNE
FT                   DSELVWRIKRAGYRIRFEPSLPVYARDHRRLDSGLWRKTCHSVFRCALLYWDLMPARWR
FT                   GADWGYWSPQQSGRAPGVSRVE"
FT   gene            146679..147149
FT                   /locus_tag="MCA0141"
FT   CDS_pept        146679..147149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0141"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:17430491; match to
FT                   protein family HMM PF01161; match to protein family HMM
FT                   TIGR00481"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90628"
FT                   /db_xref="GOA:Q60CG5"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CG5"
FT                   /protein_id="AAU90628.1"
FT                   /translation="MALIITSEAFPPNGEIPRKYTCDGGDVSPPLTWSGLPPGTRSLAL
FT                   IVDDPDAPDPRAPRMTWVHWVLYNLPPEAPGLPEAVQALPAGTLQGLNDWKRTGYGGPC
FT                   PPIGRHRYFHKLYALDTVLPDLHRPDKAKLEQAMTGHVLGQAELIGIYQRAR"
FT   gene            147294..148376
FT                   /gene="cax-1"
FT                   /locus_tag="MCA0142"
FT   CDS_pept        147294..148376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cax-1"
FT                   /locus_tag="MCA0142"
FT                   /product="calcium/proton exchanger"
FT                   /note="identified by match to protein family HMM PF01699;
FT                   match to protein family HMM TIGR00378"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90627"
FT                   /db_xref="GOA:Q60CG4"
FT                   /db_xref="InterPro:IPR004713"
FT                   /db_xref="InterPro:IPR004798"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CG4"
FT                   /protein_id="AAU90627.1"
FT                   /translation="MRVGKFEVDHMALLLVFVPVSIVLEWVHADPVWIFAASALAIVPL
FT                   AGQMGKATEYLAEHLGSGLGGLLNASFGNAAELIIGFFALRAGLIDVVKASITGSIIGN
FT                   ILLVLGASVVVGGLKHETQYFNRTAAGLGVTLAALSAIALVVPAIFHLVVQGHPEPHER
FT                   ELSLEIALVLFVTYILSLVFTLRTHRHLYVGESSEETDEALGVGAWSMRKSLLILLVAT
FT                   ALVAWMSELLVGAVEHAAHDLGMTNVFIGVILVAIVGNAAEHSTAVMMAAKNHMDLAMN
FT                   IAIGSSIQIALFVAPLLVFAGHVMGQPMDLVFSTFEVVAVAIAVAAVVLIAMDGESNWM
FT                   EGVNLLAVYVILAIAFYFLP"
FT   gene            148339..149970
FT                   /gene="mdoG-1"
FT                   /locus_tag="MCA0143"
FT   CDS_pept        148339..149970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdoG-1"
FT                   /locus_tag="MCA0143"
FT                   /product="periplasmic glucans biosynthesis protein MdoG"
FT                   /note="identified by similarity to SP:P33136; match to
FT                   protein family HMM PF04349; match to protein family HMM
FT                   TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90626"
FT                   /db_xref="GOA:Q60CG3"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007444"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014438"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CG3"
FT                   /protein_id="AAU90626.1"
FT                   /translation="MSSSPLLSIFFRRAELLMIGKTSRRDFMRLGAKLGLAAPFLAGVG
FT                   RSWAEPKGLKFSPSLPFSYEMLVKRAEALASRPYSPPPAVSEVVRKLDYEAWGQIRFRT
FT                   EDALFAEGPSIYPVTFFHLGQFFQKPVKIHVVEDGKARQIYYSAEYFDMPGDSPARQMP
FT                   ERSGFAGFRLQEARTRSDWRTQDWIAYLGASYFRAIGALNQYGLSARGIVIDAAEPTPE
FT                   EFPDFTEFYIEGAAAETDPVIICALLDGPSVTGAYRFLTWRKEGVVQEVEAAVFLRRNV
FT                   KRLGLAPLTSMYWFSESEKRRLEDWRPEVHDSDGLAIWTGTGERIWRPLINQPYAVTSS
FT                   FVDHDPKGFGLLQRDRVFENYLDGVNYERRPSLWVEPLGGWGEGAVQLVELPTDDEIHD
FT                   NIGVYWRPAAAPKAGSSYRLRYRLHWQADEPYPAAVARCVATRIGRGGQPGKPRPRGVY
FT                   KFAVEFAGAALEPLWGDTVKAAPVVTASSGAIQGAFIEPIPHTRRWRAIFDLIPDGTAP
FT                   VELRLYIQGNGDALTETWLYQFRPPA"
FT   gene            150561..151805
FT                   /locus_tag="MCA0145"
FT   CDS_pept        150561..151805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0145"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90619"
FT                   /db_xref="GOA:Q60CG2"
FT                   /db_xref="InterPro:IPR018759"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CG2"
FT                   /protein_id="AAU90619.1"
FT                   /translation="MVPDPAGAFRLLLRCCLVCATGPAWAVADRTDWFQPFVSNTFTYD
FT                   SNVFRLPSSLTAAEANALIDNVSKGGSKADFVNRISAGAKVNWYSGPHRVNMNLGVDDN
FT                   IFVRNTALQNLSTLNEASWIWDVSRAWSTQAGAEYQQYLNAFGNYVIPRKDMLTNMAYF
FT                   GKVKYQFSPDLRAGIGVRWDEISHSVRNRRQNDVQELSETVELVYQNATRNSAGIEYRH
FT                   GAGFYPQRNPAKFSFDQYEVNSLKFVGGYMFSVKTRFDGYVGYLAQTFAQAPWFDYSGC
FT                   IWRMGVEWLPTDKTSVKISGWQNLEAYQDVASSYFVGNGVKLLSKWEASRKVEVAGEFS
FT                   WESRNYVGGGGANSSGTPVSRRVDDFFAAQAGFTYRPVDYVDIFLTYRYEKRKVNRVFF
FT                   NYEYDGIALGVALRF"
FT   gene            151827..152975
FT                   /locus_tag="MCA0146"
FT   CDS_pept        151827..152975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0146"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90618"
FT                   /db_xref="GOA:Q60CG1"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CG1"
FT                   /protein_id="AAU90618.1"
FT                   /translation="MCIGSGAAGSPSDIKKPSVLLMASNTPFQYRVLRCAAQAGASVFI
FT                   LGSKRAKFLALSRYCKGFVPYPRDFVEEDSTELVCIVNDLIYKLGIDYVIPGCGDTTRL
FT                   LGEIGSRLHARCFPVPPPSVFDTLNDKSKFASLCLDLGMPHPASVLLAGPAELKSMYDS
FT                   GQLHFPLIAKPVDAYGSEGVVKLEALSVQVNLDKIDYSPILLQEFVEGEDVCISLFCVQ
FT                   GVCKRQVVYKRKRGISFIEHDSLSDLAQAVARHLNFDGVICFDARLAPDGKSVYLIECN
FT                   PRFWYNMDFAMVAGVNFVGLGIDPVGHESRAATKKAFSSPYSLALKVFTPWRINAQDVA
FT                   MFRYWLADPIPFLWIEIWLGLPGLIAGKATRAVRSIKQRFWC"
FT   gene            153160..154554
FT                   /locus_tag="MCA0147"
FT   CDS_pept        153160..154554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0147"
FT                   /product="putative polysaccharide biosythesis protein"
FT                   /note="identified by similarity to GP:4972659; match to
FT                   protein family HMM PF02397"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90617"
FT                   /db_xref="GOA:Q60CG0"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017473"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CG0"
FT                   /protein_id="AAU90617.1"
FT                   /translation="MNQTGAPSVFESPLVFLLKTLFAPVVASGVFLASLRFEGYPLEGA
FT                   NILMFFLVFIVVSHTFKVTRLNDRLTARSFFETAFDTMARWIFTLAVVALLTYVAGIED
FT                   FLDEPGFVVWAGATPFILLFGQLAVGPMVRIYFRRYGGHRKAVIVGVTEMGVKLAEAIG
FT                   SHAFLRTDVLGFFEDRPADRTADPGDLPVLGRTADLPAFLRQHEVHAVYITLPIARQPR
FT                   ILELLDNLKDSTVSVYFVPDLFMTDLLQARWDTLAGIPVMAVCESPFIGIRGLSKRLMD
FT                   IVGATVALVLLAPVMLVIALAVRLSSPGPVLFKQRRYGEPIFVYKFRSMTVCEDGGTVT
FT                   QAKQGDARVTPLGAILRRTSLDELPQFLNVLQGTMSLVGPRPHAVAHNELYRGLIKGYM
FT                   VRHKVKPGITGWAQVNGLRGETETVEKMAARIRYDLEYLRNWSLWLDMWILLKTVGVVL
FT                   KQKNAY"
FT   gene            154610..155443
FT                   /locus_tag="MCA0148"
FT   CDS_pept        154610..155443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0148"
FT                   /product="putative capsular polysaccharide export protein"
FT                   /note="identified by similarity to SP:Q46629; match to
FT                   protein family HMM PF02563"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90616"
FT                   /db_xref="GOA:Q60CF9"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR017478"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CF9"
FT                   /protein_id="AAU90616.1"
FT                   /translation="MPGKISSGVKAAWCRIALVMGLMAGWGAVAGDAPLHEAGDYRLGP
FT                   GDVVRISVFNYPELAIETRISQTGNITFPLTGPIAIGDLTAAEAEGRIAGKLRQGGYIS
FT                   DPHVTVVVSQFKAREVAVMGQVRNPGKYPIERQSRVLDMLAAAGGVTTADAGDTATLLR
FT                   ANGEKLVIDLNALFEGSPGQNPEVAAGDTLFVPKAPQFYVYGEVQRPGAYRLQRGMTVS
FT                   QAISAAGGLTPRGTDTWPAPIVKRRDANGVEQETTVDGSYALQPDDVLYLRERWF"
FT   gene            155447..156865
FT                   /locus_tag="MCA0149"
FT   CDS_pept        155447..156865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0149"
FT                   /product="chain length determinant protein"
FT                   /note="identified by match to protein family HMM PF02706"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90615"
FT                   /db_xref="GOA:Q60CF8"
FT                   /db_xref="InterPro:IPR017468"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CF8"
FT                   /protein_id="AAU90615.1"
FT                   /translation="MSANRLILIFLAHWRVFGWTLAVTVLTTLVASAAMSKTYTASTTV
FT                   VIDYKGGDPLTGSAFPSDLMAGYLATQVDIIGSHAVAARVADALKLSEVPAYRDRFEKV
FT                   ARKTGSRAVFRDWAADKLLEDLDVSPSRESDVITISFAASDPLFAADVADAFAQTSIRA
FT                   NVELKLEPLKRQAAWFDEQVLALRSALEKAQAELSSYQIAHGVLAAGDKLDVETAHLSD
FT                   LSAQLAAAKGQMYDGEARVQQVRAAARGGVDALPDLLQNPALQALKAELARAEARLAEV
FT                   GSRYDWNHPQRRAVAAEVASLRQRLAAEVANATGAIERAAELARQRVADLERAVVEQRK
FT                   RILALGAEQDKLSVLKREVENAQRVYDAALQRASQLQLESRLEGTNIVVLSPAVPPLKP
FT                   SKPKVALNLALSVILGSGLGLAFVLLFEFKDRRIRSAEDVIDELGLPLLAEMPPERTAW
FT                   PRFFRLAAPSALKG"
FT   gene            156890..157759
FT                   /locus_tag="MCA0150"
FT   CDS_pept        156890..157759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0150"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90614"
FT                   /db_xref="GOA:Q60CF7"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR017479"
FT                   /db_xref="InterPro:IPR017746"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CF7"
FT                   /protein_id="AAU90614.1"
FT                   /translation="MKNLPSSEGPALPRSDVQLGQLLLHAGKLSEKDIEAIGVKQKEDG
FT                   LRFGEAALRLGLIGEDDLRQALARQFAHPCLPESDTSVDAELIAAFCPPGPEGEALRDL
FT                   RSILMLRWFGGHRRLLALTSGRPGEGCGRLAANLAVVFSQLGERILLIDANLREPELHR
FT                   LFKLCGDPGLSGVLAGRHSPEKAISSIPALGDLSVLPAGAPPPNPQELLSRASFIRLLD
FT                   AAAEQYDIVLLNTPPALQSADARIVATRAAGCIIVVRRDATRLGDAAALRDQLSGAGVE
FT                   VLGAVLTS"
FT   gene            157813..159324
FT                   /locus_tag="MCA0151"
FT   CDS_pept        157813..159324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0151"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90613"
FT                   /db_xref="GOA:Q60CF6"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CF6"
FT                   /protein_id="AAU90613.1"
FT                   /translation="MLAYRPWEIGLVTAVAVFAGWLASISQPIVLAVFVGGFVSVFLLS
FT                   RIDFAVWLLLAGTLVVNGAVLLMFPRMTKISWALSMLGFFLLAAGLFPLFLGRWRERVR
FT                   LPGFLTLFLALVALSAGTSLLGQGPALEILAGVKRSYQMLGLALVLATAPVTAVWRRHF
FT                   HGWGGFLLSAAVLQLPVALYERIVLVPLRVGMGGGIVPIDIVAGTFEPNFEGGGENGTM
FT                   VIFLVACLAYVLTAWRERVLSTLWAAAFAVELGVPLFLGETKIALVLLPMMFLLVFSRE
FT                   IRRNPAVAAAALTTGVLLTGVLAWLYFSVFSIQGKSPEQMVQNTIDYNFGSAGYYGNKA
FT                   SLNRTTVLTFWFHEHGLHNPAETLFGHGMGASYAGAGTLVEGHLNRKYPGMAINLNTAS
FT                   TLLWDSGAIGAAMFLGVLITAWRASGRLLSRCDDGAERGRLVALRVCLAANVFSLWYSN
FT                   SLMNSPSHELLFAFTLGYLAWLVRANPLPQNFPQRHEHQTAVSHA"
FT   gene            159293..160504
FT                   /locus_tag="MCA0152"
FT   CDS_pept        159293..160504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0152"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90612"
FT                   /db_xref="GOA:Q60CF5"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CF5"
FT                   /protein_id="AAU90612.1"
FT                   /translation="MNIRLLYLTREPFPTFRVDVATLFGRYLPRFGVYSDIVAVREGDG
FT                   GECAWEAGRAFTRLARGRGGRIRARLMLALDLFRLVRADHAAVQVRDRIFGALLGLWAA
FT                   RLRGKPFYYWMSFPFPDYWLERGSPDPSGLAGPGRRLLFRLRGRLSSWLLYRLVLPAAD
FT                   HVFVQSDAMRTMLESHGLPAARMTPVPMGATIPERIEDIPPVDDPRLAGRRVVVYLGAL
FT                   ERARRSEVMIEAMAGVRREFPQALLVFVGDAEDPGERLWFDALVRELGLQDHVLFTGWL
FT                   PAEQARRYLRTAEIGLSPCARTPSLEVASPTKVIEYMAWGVPVVANDLPDQAYLIGETG
FT                   GGLCVPLTPEGFAAGILQLLRDPAAARRMGEAGRRAIPGLRSYEVIARSLAEKYRQLAG
FT                   GVAQ"
FT   gene            160501..162054
FT                   /locus_tag="MCA0153"
FT   CDS_pept        160501..162054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0153"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90603"
FT                   /db_xref="GOA:Q60CF4"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CF4"
FT                   /protein_id="AAU90603.1"
FT                   /translation="MSGSGNPYGGVALRRGALAYLAGRAVSALLTFSAFTLAARVLPLD
FT                   AYGTYMAALAAMETGLAFSTPGLDWVTARILPEYRMHAAGRAIVSIICRLAGIQMAFYS
FT                   CAGMMLYFDAEQVASLLRMEAAAPVLSLAGAVLAVEGFGRLYREQMLGALMRQGAAQSA
FT                   QVVRSGTLAFLLASDWFAGREIAALDAVRYELMAACGSTALGAVLLLRETWSLRHRVAP
FT                   SGDWTPPRRKQLFKLAVNTYVSYLLAFAYGSQMLTLIVARILGADAAAVFGFSTNFSDQ
FT                   VRRYLPTDLLRSVIQPTLIAFFSRRRDFGGFMLRVGLWFKSSMVLLMPVVLYFIVFGGM
FT                   GATLVGGERFQEAGSVIALMLVGTALTILRRVVELSCNVVLATDLYVRWGFWLLAVPAV
FT                   AVFLLTSGGSLTELIVLIIAAEAFFNFGIILALRRRGYPFELAWGGMLRLAAWYGVGVG
FT                   ALVWSAPLIRFDMPTSIAVCLLLGAVGTLVAKPLSAAEGRLVSGWSPRGARLLSRIPAA
FT                   "
FT   gene            162081..163163
FT                   /locus_tag="MCA0154"
FT   CDS_pept        162081..163163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0154"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /note="identified by similarity to OMNI:VC0925; match to
FT                   protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90602"
FT                   /db_xref="GOA:Q60CF3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CF3"
FT                   /protein_id="AAU90602.1"
FT                   /translation="MRRVLMIGPGTNGGIAAVVDACLEPEFVSHWRIERLCSYEGPALP
FT                   TQLRVMAAAGIRLLTRLLARRLAIVHAHSASRGSFWRKSVLCALADLFGVPYVFHVHSG
FT                   EFGVFYGSECGPAAKWWIRRTLRRAACVIALTEAWSKLLLAIEPRASVRVIGNPVRVPD
FT                   VLPAEGGSGRPQVLFLGRLREKKGVFDLVRAIPLVLKRVPDAVFTLAGDGETEAVRRLA
FT                   LELGVSDAVRLPGWIRGADKDAELSAARVLALPSYFEGLPVCILEAMAAGVPVVATPVG
FT                   GIPELLGEGECGLLVPPGDVQALAESLVVALEDTGLRRRLRESAFHRAVDYHAIRGVLR
FT                   QLDAVYRSVTAAGRADAAGR"
FT   gene            163290..164384
FT                   /locus_tag="MCA0155"
FT   CDS_pept        163290..164384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0155"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90601"
FT                   /db_xref="GOA:Q60CF2"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CF2"
FT                   /protein_id="AAU90601.1"
FT                   /translation="MGGKFDSLFSGSAASPQRRIFRRIAGVLAFIVLASSLQAATAAKV
FT                   KSSKVRATPTPKPTATPTPAPTPTPVSSPTPTPTPAPGATITGSVFVAMEPYDIIVGNQ
FT                   VQHISLSGKSFTFDFGGSVPFVNPNIGIADFDTINYWDSAAGKAKVINGWTITDAGISG
FT                   RVFKTNGYTAIGYKAGDGVVEGALRTQLNSYYVPSRRRFVWDLCVRFGGADLTKPWTFM
FT                   PRDSHPGLIWQIKPDGSPPSIGMVVDTDPTNSQRLAIHIDGSIGPELKHERLGMITGLL
FT                   PQQDINIVIDAYLDDRPIASGGQGYFKAWINGTLVANAVGATLVPNASSPHYWSMAMYL
FT                   YNDTTPLQFDYFGYWKRARMIVPN"
FT   gene            164427..165388
FT                   /pseudo
FT                   /locus_tag="MCA0156"
FT                   /note="putative glycosyl transferase, authentic frameshift;
FT                   this gene contains a frame shift which is not the result of
FT                   sequencing error; identified by similarity to GP:2454554"
FT   gene            complement(165395..169414)
FT                   /locus_tag="MCA0157"
FT   CDS_pept        complement(165395..169414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0157"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90600"
FT                   /db_xref="GOA:Q60CF1"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CF1"
FT                   /protein_id="AAU90600.1"
FT                   /translation="MVRHIAFWVLLACAVPAWSGPPNPPDVPEALKPWIPWALHGHETD
FT                   ACPHLLEQPGEHRCAWPGELDLELHERGGSFRSRWRSFTDVWVPLPGDPQSWPLAVEMD
FT                   GKPATVSARNAVPGVRLPPGAHTIAGRFAWATLPDTLRLPGETGLVRLSVDGRATAFPF
FT                   VDEQGQIWLRKPPEGSAPETSPLRLEVVRLLRDAVPMEISTRLELDVSGEAREVLLEGS
FT                   VLPGFVPLSLDSPLPARIDPDGRLRLQLRPGHWKVGLTSRATRDLREIALPVFAAPWPG
FT                   EELWSFAADRSIRVVEVSGAPPVDPRLTQLPEEYRTLPTYAMVPGTALRLDQVRRGDPE
FT                   PEPDALHIRRTLWLDFSGQGLTILDDISGRVSRSWRLDAAPTMVPGRVTVDGQPQTITR
FT                   LEAGPGGVEIRRGELNLQAESRWEAGMSSLPATGWNADFVSAAAELHLPPGWRLFAAPG
FT                   ADHAPDSWVGRWSLLDLFLVLITALAAARLWGWPAGTVTLLTLALTWHEPDAPQSVWLW
FT                   LLGVTALSRVIPPGSFASALRVVRMIVLAALAIASLPFAVQQLRLSLYPQLEPHALSFD
FT                   YGDRAAEPEAGAPAAPAAALQQKSGSLAEPHTPPPAGLTRTIDPEALAQTGPGLPQWDW
FT                   NLIALNWNGPVLAEQELRLLLIPPWANRGLNVSRVALLAVTVLLLLGWRTKPGVSGLIL
FT                   LPLALFAAPDGHAAEFPPPALLDELRMRILAAPECGTECAQIQRMKLRLGRGELAMTLE
FT                   AHAEDRVAIPLPVRSAQWIPSSIRVDGAPPTGPYADPAGTLWLMLDPGIHRVDLSGPLP
FT                   NLPSIDLPLPLRPYRVDVDSEGWEIVGVDPNGRPESQLQLVRKSSGTSPEPRGDDAPLP
FT                   VFLTVERTLRLGLDWRVATRVARLSPSDAPVALTIPLLPGEAVISPGIATENGSVRIHL
FT                   PPGIVDASWESTLDRTGSLELRAPQTDDWTEIWRLDTSPVWHVETSGIPVVHHQDAGGN
FT                   WLPEWRPWPGETVTLQISRPPPLPGNALTIESSTLETRPGGRATDSELALSIRSAKGGQ
FT                   HSVTLPEGAELQSAEIDGTAQPIRQNGRAVAVPLHPGEQTVRLAWRIPAGIGLRTVAPA
FT                   VDLGSASTNSRTGIELGQDRWILLVGGPPWGPSVLFWGTLGVIVVAAFALGTWLNRLPL
FT                   EIRHWLLLLIGLSQVPLLASLVVAGWIVALNWRRSANMPLKPEHFNLVQTGLAILTVLA
FT                   LSILLSAVHRGLLGLPDMGITGYDSNAYRLNWYTDRSGPMLPRPWVISVPLFAYRLLML
FT                   AWALWLAYALLDWLRWGWGCFATGGLWRQSPKRETASAEPPRTADATGSTDPWQA"
FT   gene            complement(169485..170849)
FT                   /gene="mpl"
FT                   /locus_tag="MCA0158"
FT   CDS_pept        complement(169485..170849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpl"
FT                   /locus_tag="MCA0158"
FT                   /product="UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate
FT                   ligase"
FT                   /note="identified by similarity to SP:P37773; match to
FT                   protein family HMM PF01225; match to protein family HMM
FT                   PF02875; match to protein family HMM TIGR01081"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90599"
FT                   /db_xref="GOA:Q60CF0"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005757"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CF0"
FT                   /protein_id="AAU90599.1"
FT                   /translation="MRIHILGICGTFMGGLAIMARQLGHTVTGSDQNVYPPMSTLLEQQ
FT                   GIDLCNGYSPDNLHPVPDLVIIGNALSRGNPEVEAVLNMGLAYTSGAQWLYNHVLKGRW
FT                   VLAVAGTHGKTTTSSMLAWILEHDGHKPGFLIGGVPLNFGISARIGEGRFVVVEADEYD
FT                   TAFFDKRSKFVHYRPRTTILNNLEYDHADIFPDLAAIQRQFHHLVRSVPGNGLLVVPER
FT                   DENLAEVLRMGCWTPVEKTALGPDTAADWQAHPLAEDGSRFDVVFRGKRQGTIHWQLSG
FT                   RHNMLNALSAIAAAHHAGIEPAAAISALSRFQSVKRRLEVRAEVRGITLYDDFAHHPTA
FT                   IATTLEGLRARVDGARVIAVVEPRSNTMRMGVHADTLAASLAPADLAILYQAPDLGWDL
FT                   AKVSSASDRIVTCDSIGAIVERLRQECRAGDHVVFMSNGSFGGVHEKTEAALRET"
FT   gene            171127..171963
FT                   /gene="apaH"
FT                   /locus_tag="MCA0159"
FT   CDS_pept        171127..171963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaH"
FT                   /locus_tag="MCA0159"
FT                   /product="bis(5'-nucleosyl)-tetraphosphatase, symmetrical"
FT                   /EC_number="3.6.1.41"
FT                   /note="identified by similarity to SP:P05637; match to
FT                   protein family HMM PF00149; match to protein family HMM
FT                   TIGR00668"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90598"
FT                   /db_xref="GOA:Q60CE9"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60CE9"
FT                   /protein_id="AAU90598.1"
FT                   /translation="MAIYAIGDVQGCYAELRRLLELIRFDPAKDRLLFTGDLVNRGPQS
FT                   LETLRFIRGLGPAAATVLGNHDLHLLAVACGVSRVKHKDTFGDVLEAADRDELLAWLRT
FT                   RPLVHREGSYCLVHAGIPPAWNAETAMARAGEVETVLAAGDITGFCRQMYGDKPDLWSD
FT                   DLAGWDRLRFITNALTRMRYCDRTGRLDFRQKGAPGRQPASLVPWFDVPDRVPPGATIV
FT                   FGHWSTLGYFAGKDCYCLDTGCLWGGELTALKLDGTLERYAVPSLHGGYQKPTLAK"
FT   gene            complement(172102..172326)
FT                   /locus_tag="MCA0160"
FT   CDS_pept        complement(172102..172326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0160"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90588"
FT                   /db_xref="GOA:Q60CE8"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CE8"
FT                   /protein_id="AAU90588.1"
FT                   /translation="MSTLAQYSVTKTIRGVTMNDAKEEKDYFWFYIAGLVIAVVVTLAM
FT                   VKSSEHGKYVTAAKAIEEDAANSAYKHAP"
FT   gene            complement(172400..173236)
FT                   /locus_tag="MCA0161"
FT   CDS_pept        complement(172400..173236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0161"
FT                   /product="putative hydrogenase expression/formation
FT                   protein"
FT                   /note="identified by similarity to SP:P19932; match to
FT                   protein family HMM PF04809"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90587"
FT                   /db_xref="GOA:Q60CE7"
FT                   /db_xref="InterPro:IPR006894"
FT                   /db_xref="InterPro:IPR038527"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CE7"
FT                   /protein_id="AAU90587.1"
FT                   /translation="MQDKFAFIATGNTPLFRLHDDPECTCPPMPEAMATFTPPPLHALS
FT                   RDETGEGCAVLQKVIERLGGAPGIVDLAPCDPAARRFVDEVLGEGEVLIRIVTPRDRVT
FT                   IRESVFAGVWRVQHRIDGELRRDDLETGPVPEAVYGWAERLTVDGPPHRPQSFPEGLMN
FT                   APALLTEIFDHSADCPNDRPHVINLSLLPLTPEDSKFLIDTLGTAGLSVLSRGYGDCRV
FT                   TLTRLPNVWWVQYFNSPGQLILNTLEITRLPAVVAAAPEDLEDSRERIAEALAQLK"
FT   gene            complement(173279..173884)
FT                   /locus_tag="MCA0162"
FT   CDS_pept        complement(173279..173884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0162"
FT                   /product="hydrogenase expression/formation protein"
FT                   /note="identified by similarity to SP:Q03004; match to
FT                   protein family HMM PF01750; match to protein family HMM
FT                   TIGR00072; match to protein family HMM TIGR00140; match to
FT                   protein family HMM TIGR00141"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90586"
FT                   /db_xref="GOA:G1UBC5"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR004419"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:G1UBC5"
FT                   /protein_id="AAU90586.1"
FT                   /translation="MPPRVLILGIGNLLWADEGFGVRVAQALQRDYVFPENVTVMDGGT
FT                   QGLALIPYVQESDVLIIADAVDFGLAPASLVEARDEDVPAYLHSGKTSLHQVSFQEVLA
FT                   LCKLMGQGPERLHLVGVQPVDMEDYGGSLTPPVKAQLEPAIARILAVCAELGLAGWRRP
FT                   KGNCTADALDMTQYERQRPSAEEACRIGDARFLPGDPR"
FT   gene            complement(173889..174575)
FT                   /locus_tag="MCA0163"
FT   CDS_pept        complement(173889..174575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0163"
FT                   /product="nickel-iron hydrogenase, small subunit"
FT                   /EC_number="1.12.7.2"
FT                   /note="identified by similarity to SP:Q43953; match to
FT                   protein family HMM PF01292; match to protein family HMM
FT                   TIGR02125"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90585"
FT                   /db_xref="GOA:G1UBD6"
FT                   /db_xref="InterPro:IPR000516"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:G1UBD6"
FT                   /protein_id="AAU90585.1"
FT                   /translation="MASIETFDRPVYVYEKPVRLWHWINALGIVVLAVTGYLIAWPPVV
FT                   TAGEASDHYLTGYVRFVHFSAGYVLAVGLIGRAYWALVGNRYARELFAPRLHDVHWWQA
FT                   LLHEVRWYLFLVEEPGKHAGHNPLAGLAMFLFYVLGSLFMITTGFALYGEGLGAGSWAA
FT                   NAFGWVLPALGGSQQVHSLHHLGMWYLVIFTLIHVYVAVREQHLSRQSVITTMIDGWRV
FT                   WKDDRP"
FT   gene            complement(174586..175164)
FT                   /locus_tag="MCA0164"
FT   CDS_pept        complement(174586..175164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0164"
FT                   /product="nickel-iron hydrogenase, accessory protein"
FT                   /note="identified by similarity to GP:19421553; match to
FT                   protein family HMM PF04955"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90584"
FT                   /db_xref="GOA:G1UBD3"
FT                   /db_xref="InterPro:IPR007038"
FT                   /db_xref="UniProtKB/TrEMBL:G1UBD3"
FT                   /protein_id="AAU90584.1"
FT                   /translation="MHPVRWFGTASLLALSPVALAHTGMHPVAGFVSGFSHPFFGTDHL
FT                   LAMIAVGLWAVTVAPRRVWLLPLAFMAVMDLGGWLGTAGIPLAYTETGIAASVVLLGLL
FT                   VAGKVRLSQFTALSLVGLFALFHGHAHGTEISADAERWTYAAGFITATGLLHLVGVILG
FT                   GWLLPKPAWYRGCGAAMGAMGLALLTQAL"
FT   gene            complement(175203..176996)
FT                   /locus_tag="MCA0165"
FT   CDS_pept        complement(175203..176996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0165"
FT                   /product="nickel-iron hydrogenase, large subunit"
FT                   /EC_number="1.12.7.2"
FT                   /note="identified by similarity to SP:P18636; match to
FT                   protein family HMM PF00374"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90583"
FT                   /db_xref="GOA:G1UBD7"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:G1UBD7"
FT                   /protein_id="AAU90583.1"
FT                   /translation="MTAIQTPNGFTLNDAGKRIVVDPVTRIEGHMRCEVNVDDDNIIRN
FT                   AVSSGTMWRGLEVILKGRDPRDAWAFTERICGVCTGTHALTSVRAVEDALGIAIPENAN
FT                   SIRNIMQLTLQAHDHLVHFYHLHALDWVDVVNALKADPKATSELAQRISPWPKSSPGYF
FT                   HDIASRLKKFVESGQLGPFGNGYWGNPAYRLPPEANLMAVAHYLEALDFQKEIVKIHTV
FT                   YGGKNPHPNWLVGGVPCAINVDGVGAVGAVNMERLNLVSSIIDQTIEFIEQVYLPDLQA
FT                   IAGFYKDWLYGGGLSATNVLSYGDIPEKANDRSVNNLLLPHGAIINGNLKEVHEVDLKD
FT                   PEQIQEFVTHSWYKYDDEGRGLHPFDGVTQPNFALGRNTKGTRTHIENLDESAKYSWIK
FT                   APRWRGHAMEVGPLARYIVGYAKGIPEIKEPVDKLLTDLGLPLTALFSTLGRTAARGLE
FT                   AQYCAHLMRHFQDKLVSNIKAGDLATANTAKWEPDTWPKEAMGAGTTEAPRGALGHWIK
FT                   IKDGKIDNYQCIVPTTWNGSPRDPKGNIGAFEASLMNTKVENPDQPLEILRTLHSFDPC
FT                   LACSTHVMDKDGREVTRARVR"
FT   gene            complement(177012..178100)
FT                   /locus_tag="MCA0166"
FT   CDS_pept        complement(177012..178100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0166"
FT                   /product="nickel-iron hydrogenase, small subunit"
FT                   /EC_number="1.12.7.2"
FT                   /note="identified by similarity to SP:P21950; match to
FT                   protein family HMM PF01058; match to protein family HMM
FT                   TIGR00391; match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90582"
FT                   /db_xref="GOA:Q60CE2"
FT                   /db_xref="InterPro:IPR001821"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027394"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="InterPro:IPR037148"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CE2"
FT                   /protein_id="AAU90582.1"
FT                   /translation="MATTARPDTFYDVMRRQGVTRRSFLKFCGLTASALALGPEFIGTI
FT                   AHAMETKPRTPVLWLHGLECTCCSESFIRSAHPLAKDVVLSMLSLDYDDTLMAAAGFQA
FT                   EAMLEDTMQKYKGRYILAVEGNPPLNEDGMFCIVGGKPFIERLRYAAKDAAAVIAWGSC
FT                   ASNGCVQAARPNPTQATPIHKVITDKPIIKVPGCPPIAEVMTGVVTYMLAFDKIPELDA
FT                   QGRPKMFYGQRIHDKCYRRPHFDAGQFVEQWDDEAARKGYCLYKVGCKGPTTYNACSTV
FT                   RWNNGVSFPIQSGHGCIGCSEENFWDKGSFYDRVTELNVFGVEANADKVGLVAAGAVGA
FT                   GIAAHAAISIAKKKDHEKETQE"
FT   gene            complement(178279..178866)
FT                   /locus_tag="MCA0167"
FT   CDS_pept        complement(178279..178866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0167"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:7380649; match to
FT                   protein family HMM PF04367"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90572"
FT                   /db_xref="GOA:Q60CE1"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CE1"
FT                   /protein_id="AAU90572.1"
FT                   /translation="MKQSAQRILHYFLIGVLGVLPIVIVLQVVIYVENLLRDFVVSFFS
FT                   SYRNLFIPSVMFTAAVLFLTYFGYLLQHGKAHLLYFVEKLVIRIPLLGTLYRVTQKLVN
FT                   IFRGDGSTKLREVVYIEYPKEGLWVPAFVTNRIGDRYVIYVPTSPNPTSGFTVILHESR
FT                   IKRSHMTIEEASSFVISLGVDMPRPDETAGLR"
FT   gene            179106..179753
FT                   /locus_tag="MCA0168"
FT   CDS_pept        179106..179753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0168"
FT                   /product="ABC transporter, ATP-binding family protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90571"
FT                   /db_xref="GOA:Q60CE0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CE0"
FT                   /protein_id="AAU90571.1"
FT                   /translation="MTGLVRFDRVSVAVQGRTILRALSFDIREGEKAVFKGKSGSGKST
FT                   VLKTLLGVYPVADGEVRFAGRLLDRDTVSAIRACAAYIGQEPVLGADTVREALLLPFGF
FT                   KAHRGKAPSTGRLAEILGRLGLAPLILDQHCSRISGGEKQRIAVARAQLLGKRLYLLDE
FT                   VTSALDPESKRAVQDFFSDPALTVLSVAHDPDWIARCDTVFELQDGRLTAAG"
FT   gene            179753..180544
FT                   /locus_tag="MCA0169"
FT   CDS_pept        179753..180544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0169"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="identified by similarity to GP:4980689; match to
FT                   protein family HMM PF03649; match to protein family HMM
FT                   TIGR00245"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90570"
FT                   /db_xref="GOA:Q60CD9"
FT                   /db_xref="InterPro:IPR005226"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CD9"
FT                   /protein_id="AAU90570.1"
FT                   /translation="MDTVDISPTRMMLLYGIAVLPWLLLWSAGLHLARELWLSIVRMSV
FT                   QLALVGIYLKYLFEINAPALNVLWIVVMLVVADFTILRRAGLRIRHFFLSTLAAIVAGT
FT                   AFSVAYLLLLVIRPEPIYDARYLVPLAGMILGNCLQGNVIGLERFYSAIRKNENEYLTY
FT                   LLLGATRREAVRPYFREALKASVNPTLASMATLGLVSLPGMMTGQILGGSEPWVAVKYQ
FT                   IAIMLCIFASMSLAAVLNLSLSLRFAFDEFGVLREAVFRRH"
FT   gene            complement(180589..181929)
FT                   /locus_tag="MCA0170"
FT   CDS_pept        complement(180589..181929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0170"
FT                   /product="fatty acid desaturase family protein"
FT                   /note="identified by similarity to OMNI:NTL03PA00287; match
FT                   to protein family HMM PF00487"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90569"
FT                   /db_xref="GOA:Q60CD8"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CD8"
FT                   /protein_id="AAU90569.1"
FT                   /translation="MRNLSRRIQSHQIRLRPPPFGAKRPVRRSESTSPPPRRRLIVGKR
FT                   NRSAQVQYSMSHGLTHLSFWPLLFATLALTHVTIVSVTIFLHRHQAHRALSLHPLASHF
FT                   FRFWLWLTTATVTKEWVSIHRKHHARCETPDDPHSPQCLGIFTVLLRGWMLYRKEARNT
FT                   ATLAQFGNGTPDDWLERKLYSRFPDLGITLMLALNLLLFGIGGLGVWAVQMLWIPFWAA
FT                   GVVNGLGHHLGYRNFETPDASTNLWPIGFIIGGEELHNNHHAYPASAKFSSRRWEIDIG
FT                   WLYIRLMTLLKLAKIRNMPPKTIIHTAEPSVDMDTVKAVLRNRAHVLSLYGRRVIVPVL
FT                   RSEQAKSPKAGRRLLRQTRPLLLREYIKADPAAWHNFSRMLEDSQTLATIFQFKQQLKA
FT                   VWTDSFTSHEERLERLRAWCLQAKQSDLPWLQHFADTLSGYRLQPAH"
FT   gene            complement(181951..182469)
FT                   /locus_tag="MCA0171"
FT   CDS_pept        complement(181951..182469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0171"
FT                   /product="putative lipoprotein"
FT                   /note="identified by similarity to GP:17427325"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90568"
FT                   /db_xref="GOA:Q60CD7"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CD7"
FT                   /protein_id="AAU90568.1"
FT                   /translation="MRRLSWTLMLSLATSACSLLPERPPQPALHDFGAAGAAAPAPWSS
FT                   VDVDAPEWLRNDRLQYRLLYAKPTELRSYTLDRWIAPPSELLEQRLKAGRSANGYRLHI
FT                   ELQAFEQVFERPGSSHVMIRLRAETPADTETFQFDQPTASPDAAGAVQAFAQAVDRAVA
FT                   QLRAWRPAN"
FT   gene            complement(182469..183383)
FT                   /locus_tag="MCA0172"
FT   CDS_pept        complement(182469..183383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0172"
FT                   /product="Mce family protein"
FT                   /note="identified by similarity to GP:17427324; match to
FT                   protein family HMM PF02470"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90567"
FT                   /db_xref="GOA:Q60CD6"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CD6"
FT                   /protein_id="AAU90567.1"
FT                   /translation="MVRETYALLTGLFVVILGSALIGIALVLGDYGTERDVYVVSTQGA
FT                   VSGLNPESLVIFRGVRAGKVASISFAPHDPRTILVRIEVDKGLPITRGTYATLRVQPLT
FT                   GLAQIDLSDEGNDPEPLRTDPRNPANIPLRPSLLDKLTGSGSDILTQIAQLTSRLNALL
FT                   DDGNRQRIAHTLESLDTAADELVRLERYIEEGLERIPILDGRLRQALADHSAMARDVRE
FT                   TSRQVRALSESAQKVVDIGAAASDTLIRSRLPELDALIDDAAHTAASLRRLSKTLERDP
FT                   QTLLLGPAPGLPGPGEPGFQEPK"
FT   gene            complement(183385..184155)
FT                   /locus_tag="MCA0173"
FT   CDS_pept        complement(183385..184155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0173"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to OMNI:NTL01SM01832; match
FT                   to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90566"
FT                   /db_xref="GOA:Q60CD5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CD5"
FT                   /protein_id="AAU90566.1"
FT                   /translation="MTDGEVIRMAHVWTRFGENLVHRDISLSLGRGQILGVVGASGCGK
FT                   TVLMREMIGLQTPTQGQVWLLGESLAEADARRKQQLRNRCGVLFQGGALFSALSVFDNI
FT                   AFPLRELKTLDEELIARLVCMKLAMVGLGETDALLMPAELSGGMVKRAALARALIMEPE
FT                   VLFLDEPTSGLDPVLGEEFVGLLGQLHRELGFTVVMVTHDLDTLSDLCTCVAVLAGQQL
FT                   VSYGTLDDAIACAHPFARDFFHGKRAQRILGRSD"
FT   gene            complement(184152..185372)
FT                   /locus_tag="MCA0174"
FT   CDS_pept        complement(184152..185372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0174"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="gene cluster is evidence for assignment as ABC
FT                   transporter subunit; identified by match to protein family
FT                   HMM PF02405"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90565"
FT                   /db_xref="GOA:Q60CD4"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CD4"
FT                   /protein_id="AAU90565.1"
FT                   /translation="MRSMIVQVRHPEKRPRPFRQARRNMLASQSSAETSALPPLSPPEF
FT                   AVEDGTAVVHGHWNLRGLIAASPDLRERLCRAARRPDLEWDLRGVNVLDSAGAFVLWQA
FT                   WGERLPERIALRHEQQSAFRRWQTGGIPAVRDGRRPPVPIRRRIIAAIAGLGSHLLAVL
FT                   ALLGQLILDLAHLARHPADIPWREISATIHETGGRALGITALVGFLIGVVVSYLSSLQL
FT                   KTFGAQVYIVNILGMSIIRELGPLLAAILVAGRSGSSMTARIGVMRVTQELDALAAMGI
FT                   SQSLRLILPKVVALVVALPLLVVWTDVVALAGGAVSAHLELEIGYHQFFQKLPSAVPVA
FT                   NFAIGLGKAAVFGLFVALIACHYGLRIAPNTESLGNETTNSVVVSITLVILVDAVFAIL
FT                   FRSVGIR"
FT   gene            185402..185557
FT                   /locus_tag="MCA0175"
FT   CDS_pept        185402..185557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0175"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90556"
FT                   /db_xref="GOA:Q60CD3"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CD3"
FT                   /protein_id="AAU90556.1"
FT                   /translation="MNPSRWKCIFVLLLLTLLGVGPMPITSIIGIYVVVARPRWFRDLV
FT                   RRVYDE"
FT   gene            complement(185617..187227)
FT                   /locus_tag="MCA0176"
FT   CDS_pept        complement(185617..187227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0176"
FT                   /product="outer membrane efflux protein"
FT                   /note="identified by similarity to GP:17431587; match to
FT                   protein family HMM PF02321; match to protein family HMM
FT                   TIGR01845"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90555"
FT                   /db_xref="GOA:Q60CD2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CD2"
FT                   /protein_id="AAU90555.1"
FT                   /translation="MGSRMKPAASRIFRTRMRRSSLIPLILHLSACVDGPAVDLAPPYE
FT                   PAQFVVPDSWHGSSPFVEAKPSDGELRPDWWKLFNDPVLTQLEEQAMAANADLQAAAER
FT                   FVQARDMMMKVRSRLIPQFGLEFGASDNRQSVNTLFRAPNAPIEQSDYYSGGLASWEPD
FT                   FWSAIRNRIRAEIYQAEQRAAEYGLARLSLQAEIATDYFTLRGYDAQDSVYKQSIAYYK
FT                   KSLEIVDAQYKGAIVPQLDVARAEYLLHSTEAKELDIQGRRQVTEHAIAILVNKAPAAF
FT                   SIAPVDELPSPEFTIPQTIPATLLERRPDIAQMERQMAQANRAIGIARAAFFPNVVFKA
FT                   SGGYENGSMNLIALANSYWSYGASVSIPLFQGGLRRAQLQQSWSAYRETEDKYRATVLN
FT                   AFREVENGLSLTNRLSVAADRQDEAVKAALKTQNLTMELYLGGLITSLDLIYAQINTLT
FT                   ARIDAVVLKTERLKNTIALIRALGGGWNRKQLPADDQIQPFGVFEEYGNAGKPAPAGGI
FT                   DVPADDNRLNNDLTRPFKQ"
FT   gene            complement(187233..188453)
FT                   /locus_tag="MCA0177"
FT   CDS_pept        complement(187233..188453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0177"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:17432073; match to
FT                   protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90554"
FT                   /db_xref="GOA:Q60CD1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CD1"
FT                   /protein_id="AAU90554.1"
FT                   /translation="MPKILREPRIALAILLCVVYVGYQFYQRKRDADALREETLREAVP
FT                   TVAITHARPIAPTATISLPGNIDAWYQAPIYAQIPGYVKMWYKDYGARVKQGEVLAEIS
FT                   QPTLDAEFSQAKADLESQRAKYNLALVSLKRWLALRESHAVSEQSISVQEANERSEAAQ
FT                   VKAAENNVNNFLAKMRFKTIVAPYDGVVTQRNVNVGDYINKDGYISSTNGNTVSNLFSV
FT                   ADIHKMRLFISVPSTLAEILKPGLTADVVVPQYTNRHFTANFLTAANGIDPNTRTIVTE
FT                   FTIDNEDGALWPGSYATVTLTVPNDTHILSIPASALVFQEANTQVAVVTDDDRIHFKPI
FT                   QVSKILDGTVEFTEGVTPNERIVNNPSAALLEGDKVRIVKPAPGYDLSGEDGPPGLQEA
FT                   ASPTAGQ"
FT   gene            complement(188453..191623)
FT                   /locus_tag="MCA0178"
FT   CDS_pept        complement(188453..191623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0178"
FT                   /product="AcrB/AcrD/AcrF family protein"
FT                   /note="identified by match to protein family HMM PF00873"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90553"
FT                   /db_xref="GOA:Q60CD0"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CD0"
FT                   /protein_id="AAU90553.1"
FT                   /translation="MNQIVLIALRRPYTFVVLSILIVLFGILSVLKTATDVFPPIKIPV
FT                   VSVVWSYAGLLPQDVSGRITYYYERALTSTVEGIARIESNSYYGISIINIYLQPDTNLA
FT                   GAEAEITAISQTVVKQLPPDISPPLIMRLEASSVPVAMLQVTSDTLSPSELYNLAYARI
FT                   RTLLVTIPGAILPQPYGGKPQQLLVSLDKQKLLAHNITATDVHNAFGDQSIVLPAGDMK
FT                   IKQTDWMVQTNATPMQIEDFNNIPIKRVDATNSTIYLRDVADVQIAGPPQINAVLVEGK
FT                   QAVMIVVMKSGNASTLDVVDGIKKMIPRIEQIVPEGVKIKLLNDASIFVKDSIKDVLHE
FT                   MGTAALLTGLVVLLFLGSWRPTVIIATSIPLAILTSLICLHLLGESINIMTLGGLALAV
FT                   GILVDDATVMIENIDTHLEMGKPLETAIIDAANQIVVPTLVATLCIVTVWFPLFELSGV
FT                   SGYLFAPMAEAVIFAMLASFILSRTLVPTMAKYVLVAHDAPHSAHHAAQPPGFLSRFQQ
FT                   GFERGFDRFRENYKARLEQAIAHRGAFIRTFLAFAVGSLVLYYFNGRDFFPEIKSGTIQ
FT                   MHMRAPLGTRIEVAGRIASLVSNDIANLLPGQVEGVVSNCGLPIGPHNLAFIPTPTIGS
FT                   QDCDLTISLKNEASPVWDYRRILRKGLRERYPGTEFTFQPADLTAKILNFGSPSPIDVR
FT                   INGTEMEANYEYARRLASELRKISGASDVTIQQTMRTPTLNVNGNRSLGLGIDLTLKDI
FT                   TDNLLMSTSGSQQVDQVFWLDHKTGLSYQVNIYLPQPQLASINDLLTIPVDKGDMNPSG
FT                   KGMQLLGNVASLSVSGTPGVVTHMDIMPVFDIYVSAEGRDLGGVLADVEKAVENMEKEL
FT                   PRGTQVDIKGQAETMASAYFELLAGLVAAIVLVYLLLVINFQSWLDPFIIITALPGALA
FT                   GIAWSLFITHTNISVPALTGAIMSMGTATANSILVVSYARERFEVHGDALKAAVEAGYA
FT                   RIRPVLMTASAMIIGMLPMSLSNSQNAPLGRAVMGGLMLATFATLLFVPCVYAMIYSKR
FT                   TASRKEKS"
FT   gene            191804..192571
FT                   /locus_tag="MCA0179"
FT   CDS_pept        191804..192571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0179"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90552"
FT                   /db_xref="GOA:Q60CC9"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CC9"
FT                   /protein_id="AAU90552.1"
FT                   /translation="MGRGSFAAGVVDRLPPTVQVWVRGRRADAGGVGTIMAGPPFGSEG
FT                   WPPPYTPSGWSSCSRMMLTAQIKVPESGAFPWHCLERQADGPGLGQKAAERSRCILPQR
FT                   PLACQGGLMPCPFGGRDATSSTIGQDAPAPRRSGFPDGARPRSGSIGGCRLFRGPVLQP
FT                   LGPRQPHLRQRGENHHRRGQTVADAADHGQPGEDGEELGQPPRQDVDDEEGEGRGDEDQ
FT                   LPFPREFGQAENPAHEHEDEGDAKQMDVRDAGQ"
FT   gene            193094..193498
FT                   /locus_tag="MCA0180"
FT   CDS_pept        193094..193498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0180"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90551"
FT                   /db_xref="GOA:Q60CC8"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CC8"
FT                   /protein_id="AAU90551.1"
FT                   /translation="MKCSVAFSRPLRPFGRRLAASADKLLCCHRPGAVCGDAGGLTGSG
FT                   EGTMNLKEEMEKFRDGLLQQRDEIVVQLDLARMNIRDEWEKAEEQLEELKARVARAADE
FT                   AKDASEDVWAGVQVLGEEIRNAYERIKNKL"
FT   gene            complement(193505..193699)
FT                   /locus_tag="MCA0181"
FT   CDS_pept        complement(193505..193699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0181"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90550"
FT                   /db_xref="GOA:Q60CC7"
FT                   /db_xref="InterPro:IPR007423"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CC7"
FT                   /protein_id="AAU90550.1"
FT                   /translation="MTVKLADKLSAFWRTLRTATGDDAYERYLEHWRRHHDGEGQPLSR
FT                   KAFFRAEQQRRWSGVRRCC"
FT   gene            complement(193696..195099)
FT                   /locus_tag="MCA0182"
FT   CDS_pept        complement(193696..195099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0182"
FT                   /product="oxidoreductase, FAD-binding"
FT                   /note="identified by match to protein family HMM PF01565;
FT                   match to protein family HMM PF02913"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90549"
FT                   /db_xref="GOA:Q60CC6"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CC6"
FT                   /protein_id="AAU90549.1"
FT                   /translation="MAVSEEFLRELEKLFPPGSRHTDPAECWAYGYDNSKRQALPDAVV
FT                   FPRSHEDVVALVRLCNRHRIPLTARGRGTGTTGATVPVAGGVVASLERMSRIIEISPDN
FT                   RFAVVEPGVTNQALQDAVRPDGFFWPPDPTSAEFCSIGGNLAYNSAGPRAVKYGTPREN
FT                   TLGLRAVTGAGEELRCGVYTTKGVVGYDLTRLIIGSEGTLAIITEATLKLTPLPSAKRT
FT                   LRAIYVDVASAARAIARIMAQPVIPCALEFIDGNAIALVRRYAAVDLPEDAAALLMIEV
FT                   DGSPESLDAAVESLRAAATLEGLVEFRAARTAGEVEALWSIRKALSPSLRKVAPKKLNE
FT                   DVVVPVTELPALIAGLDELSRRHAIPIVNFGHAGNGNIHVNLLFDPDRADENERAHACL
FT                   HEMFTLVLKLRGTLSGEHGVGIEKRDYVGEELDRTSLALMHAIKRQFDPNGILNPGKSI
FT                   PAEDPSPPA"
FT   gene            complement(195116..195703)
FT                   /gene="gmhA"
FT                   /locus_tag="MCA0183"
FT   CDS_pept        complement(195116..195703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmhA"
FT                   /locus_tag="MCA0183"
FT                   /product="phosphoheptose isomerase"
FT                   /note="identified by similarity to SP:P51001; match to
FT                   protein family HMM PF01380; match to protein family HMM
FT                   TIGR00441"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90548"
FT                   /db_xref="GOA:Q60CC5"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60CC5"
FT                   /protein_id="AAU90548.2"
FT                   /translation="MNPHERIERHFSAHIEAAQEALTMLGDAIEIAAAKLAHCLLSDGK
FT                   ILCCGNGGSAAQAQHFSSEMLNRFERERPGLPAVALTTDTSTLTSIANDYHFDEVFAKQ
FT                   VRALGHAGDILVIYSTSGISPSVLSAAVAAQDRDMSIIALNGRDGGTLAPLLRDTDVEI
FT                   RVTAPSTARIQEIHLLITHCLCDLVDHQLFGE"
FT   gene            complement(195700..196071)
FT                   /locus_tag="MCA0184"
FT   CDS_pept        complement(195700..196071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0184"
FT                   /product="conserved hypothetical protein TIGR00252"
FT                   /note="identified by similarity to GP:17430288; match to
FT                   protein family HMM PF02021; match to protein family HMM
FT                   TIGR00252"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90540"
FT                   /db_xref="GOA:Q60CC4"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60CC4"
FT                   /protein_id="AAU90540.1"
FT                   /translation="MAVSGSHRPLTGPQAESWTAEYLTARGLRLIERNYRCRLGEIDLV
FT                   MAEGATLVFVEVRYRSGKRYGGALASVDRHKCRRLLATAQHYMVEHRVTGAVRLDVVAV
FT                   SPGAAGPQAEWIRNAIEAQ"
FT   gene            complement(196071..197948)
FT                   /locus_tag="MCA0185"
FT   CDS_pept        complement(196071..197948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0185"
FT                   /product="putative lipoprotein"
FT                   /note="identified by similarity to OMNI:NTL03PA04424; match
FT                   to protein family HMM PF04348"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90705"
FT                   /db_xref="GOA:Q60CC3"
FT                   /db_xref="InterPro:IPR007443"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CC3"
FT                   /protein_id="AAU90705.1"
FT                   /translation="MRIVTRVAALAITAALAGCTSLKPAANDPAARLSAEAQTRLRAGD
FT                   FSGAGQLYEKAGGISNVPDYFRLRAADAYLRAGDSATSRRVLGSVDPRRLDADDHILYG
FT                   LLNARIDLNAGRAREAMAKLDSLDYSQMTLAQKGHYHTLRASAYNQLGNMVESARERIA
FT                   AGPLLSSPEAVQKNNEAIFDALSRVPDPVLEQQSEAATGVFEGWVALARAVRQTTPDQR
FT                   AQAIAEWNARYPSHPARGAFADSLMRRSDRAAAEPPTTAMPAAETSATVQITPLAEPGG
FT                   SRSAPVVAVLLPLSGTYAAPAQAIRTGIDAAHDADTAQNKPALRFYDTQAGDVPALYRK
FT                   ALAEGATQVIGPLLKEDVAALANIGDMATPVLALNENPGVSADRLFQFGLTPEQEVEQV
FT                   AASARMDNRHTALMIAPSSAYGQRVANHFSDYWRQTGGRIAAAKTYTAGGNDYSTLLED
FT                   VALLVGQGGQTTPVPYENVADFIFLAADEHDGRIIKPYLESLGVDLPVYAMSSLYSGEP
FT                   DPGLGRELNGVVFCDIPWLLDETAGDALSERALEAKVVQTPQDYRRLIAMGIDAYRLAG
FT                   RLDELHSGGRFEGATGILTVGEGNRIHRQLSCARFEGNSPRLIGRAPSL"
FT   gene            197976..198851
FT                   /locus_tag="MCA0186"
FT   CDS_pept        197976..198851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0186"
FT                   /product="conserved hypothetical protein TIGR00096"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90704"
FT                   /db_xref="GOA:Q60CC2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CC2"
FT                   /protein_id="AAU90704.1"
FT                   /translation="MQASERINGVLYLVATPIGNLGDISFRAVEILKTVDLIAAEDTRH
FT                   SRPLLDRYGIERPLFALHEHNEQQASDRLMDRLKNGQRVALISDAGTPLINDPGFPLVS
FT                   RARAAGIIVTPVPGACALVAALSASGLSTARFAFEGFAPRTGAARRRRFESLVADERTL
FT                   VFYEASHRIRDCIADVATVFPGDRRVVVARELTKLHESFLGAPAADMPALMDQAPENSK
FT                   GEFVVVIEGAKPEPTQTGPSVEAVRVLKLLLEECSVKSATGLAARITGARREDLYRVAL
FT                   ELQRAGRDGS"
FT   gene            198875..199819
FT                   /locus_tag="MCA0187"
FT   CDS_pept        198875..199819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0187"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01SM00894; match
FT                   to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90696"
FT                   /db_xref="GOA:Q60CC1"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CC1"
FT                   /protein_id="AAU90696.1"
FT                   /translation="MLKRILASGLALAGINAIARRVHRKGVTVLMYHGVMEDDIVLAEG
FT                   DWLQVRASEFRSQMQHLCRHYRVVPLERAWEEDDGGRPRVALTFDDGYANNFRVAFPVL
FT                   REFGFAATVFLVTGAIGSRRLFWFDRLQLALGGRVAPAALRRIKEDIKANVHPDAIDDA
FT                   VDALLRESPSAGALPEEAVEAYRPLSEEEIREMAASGLVRFGSHTHRHEILPRLSQAEA
FT                   ERTLQQSLEILQTLPGYGGYFCFPNGGWRPEHLPLCRRLGFEGAVLTRPGVWKEPGDRF
FT                   TIPRFGIGRGADGATFAATVSGILPRFQRMLRR"
FT   gene            complement(199830..200285)
FT                   /locus_tag="MCA0188"
FT   CDS_pept        complement(199830..200285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0188"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01EC04037"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90695"
FT                   /db_xref="GOA:Q60CC0"
FT                   /db_xref="InterPro:IPR025294"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CC0"
FT                   /protein_id="AAU90695.1"
FT                   /translation="MQGRSQHSADHLHKQSTPCLAVGGPCMHKCARLVLICSAVLAGCS
FT                   ANPLLPEARAVRIVTSEPAGCEYLGEVTGNQGNFFTGDFTSNANLETGARNGMKNEAAR
FT                   LGANTVLLLTSRAGETGSMRISNGSGSGHVAETNVTYSGIAYKCPGR"
FT   gene            200374..200450
FT                   /locus_tag="MCA_tRNA-Arg-1"
FT   tRNA            200374..200450
FT                   /locus_tag="MCA_tRNA-Arg-1"
FT                   /product="tRNA-Arg"
FT   gene            201156..201560
FT                   /locus_tag="MCA0189"
FT   CDS_pept        201156..201560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0189"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90694"
FT                   /db_xref="GOA:Q60CB9"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CB9"
FT                   /protein_id="AAU90694.1"
FT                   /translation="MNGLHGVDRPAMRAAPGFDGPFEFRAGQVFDDDARAVLLETDGYR
FT                   TPQGPQFVGKGLEARDHDIGQIGLACSLMLGRCGARGGLFERPASEEAVKLLAPVHYHR
FT                   DLRRQPVAFHGSAGRFQNENLYCRKERGDR"
FT   gene            complement(201762..201935)
FT                   /locus_tag="MCA0190"
FT   CDS_pept        complement(201762..201935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0190"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90693"
FT                   /db_xref="GOA:Q60CB8"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CB8"
FT                   /protein_id="AAU90693.1"
FT                   /translation="MDMEDSQIFATRCQESASVTACEGINGQTDPEPLLSASLPASAPS
FT                   CRRQSTRPHSQR"
FT   gene            203115..203288
FT                   /locus_tag="MCA0192"
FT   CDS_pept        203115..203288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0192"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90692"
FT                   /db_xref="GOA:Q60CB7"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CB7"
FT                   /protein_id="AAU90692.1"
FT                   /translation="MISPGVFGGTENGGLARRRFRIGVDHAAPGNRSGKRLRKNRYLAS
FT                   IVGRRRRCSGPG"
FT   gene            complement(203337..203693)
FT                   /locus_tag="MCA0193"
FT   CDS_pept        complement(203337..203693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0193"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90691"
FT                   /db_xref="GOA:Q60CB6"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CB6"
FT                   /protein_id="AAU90691.1"
FT                   /translation="MFNHRKHILEIFVHCSFPPHGIDSQPVILKLVRGREVRRMNTVQA
FT                   IPLFSQAFQDVSSYIASIRAPYTLQDIQGFNTAYKRAYPSLSREEKRRIEAFVDTMIER
FT                   VAQKELASKIFGVV"
FT   gene            complement(203782..203961)
FT                   /locus_tag="MCA0194"
FT   CDS_pept        complement(203782..203961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0194"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90690"
FT                   /db_xref="GOA:Q60CB5"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CB5"
FT                   /protein_id="AAU90690.1"
FT                   /translation="MSGSRIVNTFPRSSSRQKKAPAANDAAGVPRGAFLSQTHHKEKRR
FT                   SGQETRPELAEHRD"
FT   gene            complement(203966..205396)
FT                   /locus_tag="MCA0195"
FT   CDS_pept        complement(203966..205396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0195"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:18893765; match to
FT                   protein family HMM PF01139"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90689"
FT                   /db_xref="GOA:Q60CB4"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CB4"
FT                   /protein_id="AAU90689.1"
FT                   /translation="MNIDRLERLDACTWRLNPERGMRVPVILYGDEALIRAMDDKVLEQ
FT                   AANVAGLPGIVQASYAMPDAHWGYGFPIGGVAAFDAGAGGVVSAGGVGFDVSCGVRTLL
FT                   TGLKRPAIEPVKTLLADTLYADIPVGLGSHGKIRLDAQGLDAMLKGGAQWAVEQGWGEA
FT                   RDLTRIEEHGRMEGARPENVSARAKERQRAEMGTLGSGNHYLEVQEVTEIFDAGSAQTF
FT                   GISEGDVVVSIHCGSRGLGHQIGTEYLRLMQGAAKQHGIALPDRELACAPIESEVGQDY
FT                   LGAMRAAINCALANRQILTHLTRQVFARVLPAARLELLYDVSHNTCKFEEHLVEGKRRR
FT                   LHVHRKGATRAYGPGHPDLPPAFAETGQPVLIGGSMGTASYILAGTSGSETLSFASACH
FT                   GAGRSMSRHQATRTWQGREVIDQLAERGILIRSPSYRGVAEEAPGAYKDVHAVVQSSDR
FT                   AGLARLVARLEPIICIKG"
FT   gene            complement(205411..205842)
FT                   /locus_tag="MCA0196"
FT   CDS_pept        complement(205411..205842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0196"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:18893692; match to
FT                   protein family HMM PF01951"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90688"
FT                   /db_xref="GOA:Q60CB3"
FT                   /db_xref="InterPro:IPR002804"
FT                   /db_xref="InterPro:IPR023572"
FT                   /db_xref="InterPro:IPR036820"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CB3"
FT                   /protein_id="AAU90688.1"
FT                   /translation="MKDYDSPHWEHFEHMADIGVRGFGATPEEAFAQAALALSAVICDP
FT                   ASVREMEKVEVECEAADLELALADWLNALIYEMAVRHMVFGRFQVDIAGGRLKGIAWGE
FT                   PLDPLRHRPAVEIKGATYTELEVEREAGGRWRAQCVVDV"
FT   gene            205955..206404
FT                   /locus_tag="MCA0197"
FT   CDS_pept        205955..206404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0197"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL02SS0707; match
FT                   to protein family HMM PF01864"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90687"
FT                   /db_xref="GOA:Q60CB2"
FT                   /db_xref="InterPro:IPR032690"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CB2"
FT                   /protein_id="AAU90687.1"
FT                   /translation="MVANGMPILLRKLLGERFGWPVDGGRRFPDGRPWFGPSKTWRGVV
FT                   CGIGAAAVAAPLLGLPWEVGALVGAASLAGDLLSSFLKRRLGIGPSGMALGLDQVPESL
FT                   LPLLAVRERFGLEWRYMVWFVIVFIVLELALSVILYRLRIRNRPY"
FT   gene            complement(206364..207377)
FT                   /locus_tag="MCA0198"
FT   CDS_pept        complement(206364..207377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0198"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90686"
FT                   /db_xref="GOA:Q60CB1"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CB1"
FT                   /protein_id="AAU90686.1"
FT                   /translation="MTGHRPACPPIPADVYTRLERRIGRCHLNQRLGIEHDFEARIFGQ
FT                   GRTFFHIENWNRLHTLLRRLLKLSLLYRPGQRAARRIEIRRNEFTLPHLPEAFEGYTLL
FT                   HISDLHLDMAGDLPDALIRAIGQAGHYDACVLTGDFRARTFGPYRGAIDGLAQVRTHID
FT                   KPVFAILGNHDTIRMTPEIEDLGIGVLLNEAREIRQDGASIFLAGVDDPHYYRADNIEK
FT                   AADPIPQGAVSILLSHSPELYRHAAYADFDIMLCGHTHGGQICLPGGIALTLNARCPRA
FT                   FGRGYWRYHRMQGYTSAGSGVSILDIRLNCPPEITLHRLSRHRLSKGGCECGGGKG"
FT   gene            complement(207374..207688)
FT                   /locus_tag="MCA0199"
FT   CDS_pept        complement(207374..207688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0199"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90685"
FT                   /db_xref="GOA:Q60CB0"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CB0"
FT                   /protein_id="AAU90685.1"
FT                   /translation="MDRLIADLQKTIQALETLSTTKPALAEQSDELLDQLFQQKIDLVA
FT                   ASLNADAPTYQQALQAISTAAGKVEKLAKNPTDATDTFKSVENAIARLARLLDQVVHTP
FT                   "
FT   gene            207834..208223
FT                   /locus_tag="MCA0200"
FT   CDS_pept        207834..208223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0200"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:15020688"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90684"
FT                   /db_xref="GOA:Q60CA9"
FT                   /db_xref="InterPro:IPR025984"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CA9"
FT                   /protein_id="AAU90684.1"
FT                   /translation="MNLPEIQQRLRDFAAERHWDRFHTPKNLVMALAVESAELMEHFQW
FT                   LSPEQSLDVQSDADLRQAVAEELADVAIYLIRLADKLGIDLEIAIQDKMQRNADKYPVY
FT                   LARGNAVKYNRRKTPSEERNQEAGT"
FT   gene            208220..208843
FT                   /locus_tag="MCA0201"
FT   CDS_pept        208220..208843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0201"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:15979675; match to
FT                   protein family HMM PF04356"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90683"
FT                   /db_xref="GOA:Q60CA8"
FT                   /db_xref="InterPro:IPR007451"
FT                   /db_xref="InterPro:IPR035932"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60CA8"
FT                   /protein_id="AAU90683.1"
FT                   /translation="MIKTLDNQVIALAGLAQATHLVRQIAQRGSADAGDMEAVVRSVFA
FT                   IDADDVPSVYGGVDKIKTGLQILDRQLAGFEPPDAELARYGATLILLERKLVSAPRLLE
FT                   TLRTGIEQVKEQAEYFGELNDTVYANLADLYQRTVSQLRPRVMVNGQPSHLTNSTNANR
FT                   IRALLLAGIRSVVLWRQCGGERWKLLFQRSAMRKEARRLLQSSQ"
FT   gene            complement(208872..209183)
FT                   /locus_tag="MCA0202"
FT   CDS_pept        complement(208872..209183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0202"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL02ML3042; match
FT                   to protein family HMM PF05169; match to protein family HMM
FT                   TIGR02174"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90682"
FT                   /db_xref="GOA:Q60CA7"
FT                   /db_xref="InterPro:IPR011893"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CA7"
FT                   /protein_id="AAU90682.1"
FT                   /translation="MNNRVEILYCTQCRWLLRATWMTQELLTTFDQEIGELTLKPGTGG
FT                   LFEVWVNGKRIWSRKEQGGFPEISELKRLVRDEVAPGRDLGHADQKGKTGASPAPAEP"
FT   gene            complement(209180..209413)
FT                   /locus_tag="MCA0203"
FT   CDS_pept        complement(209180..209413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0203"
FT                   /product="conserved hypothetical protein, internal
FT                   deletion"
FT                   /note="identified by similarity to SP:P20190"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90681"
FT                   /db_xref="GOA:Q60CA6"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CA6"
FT                   /protein_id="AAU90681.1"
FT                   /translation="MVHKSAVAGRPCPERDKRDPLAVEEAGGDRERAVPRLDDTSPANV
FT                   GKISRHRLEPAATDQAPPPAHDPDFNKLRETP"
FT   gene            209618..211186
FT                   /locus_tag="MCA0204"
FT   CDS_pept        209618..211186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0204"
FT                   /product="nitrogenase cofactor biosynthesis protein NifB"
FT                   /note="identified by similarity to SP:P27714; match to
FT                   protein family HMM PF02579; match to protein family HMM
FT                   PF04055; match to protein family HMM TIGR01290"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90680"
FT                   /db_xref="GOA:Q60CA5"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR005980"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034165"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CA5"
FT                   /protein_id="AAU90680.1"
FT                   /translation="MQTVQNHTGAESAGLNAAVNVDEIMQKVAEHKGCGTSGGSGKASC
FT                   GSGAGANDLPPEIWEKVKNHPCYSEEAHHHYARMHVAVAPACNIQCNYCNRKYDCANES
FT                   RPGVVSEKLTPEQAAKKVLAVASTIPQMTVLGIAGPGDPLANPEKTFKTFELVAKHAPD
FT                   IKLCVSTNGLALPDHVERLSQYNIDHVTITINMIDPEVGAKIYPWIYYKKKRYTGVEAA
FT                   KILSDRQLQGLEMLTERGILSKINSVMIPGINDEHLVEVNKAVKSRGAFLHNIMPLISA
FT                   PEHGTVFGLTGQRGPTAQELKALQDKCEGEMNMMRHCRQCRADAVGLLGEDRSAEFTTD
FT                   KIMAMEVNYDLDARKAYQEAVEKERQAVVAAKQEELQTLAGAHSDIKMLIAVATKGGGK
FT                   VNEHFGHASEFQIYELSTAGAKFVGHRRVDLYCQGGYGEEDALGTVIRAINDCHAVFVA
FT                   KIGGCPKSDLKAAGIDPVDQYAGQFIEQSAIAYFKEYLDKVASGEIEHVAKGDAVIRQG
FT                   ALIAA"
FT   gene            211303..211527
FT                   /locus_tag="MCA0205"
FT   CDS_pept        211303..211527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0205"
FT                   /product="ferredoxin, 4Fe-4S"
FT                   /note="identified by similarity to GP:1518927; match to
FT                   protein family HMM PF00037"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90671"
FT                   /db_xref="GOA:Q60CA4"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CA4"
FT                   /protein_id="AAU90671.1"
FT                   /translation="MAYKIVEENCTGCCACEPECPNQAISETSNGLFVIDPAKCTECIG
FT                   HYDEPQCVAVCPIDLTCIIDENYPRYEAA"
FT   gene            211539..211922
FT                   /locus_tag="MCA0206"
FT   CDS_pept        211539..211922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0206"
FT                   /product="HesB/YadR/YfhF family protein"
FT                   /note="identified by match to protein family HMM PF01521;
FT                   match to protein family HMM TIGR00049"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90670"
FT                   /db_xref="GOA:Q60CA3"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CA3"
FT                   /protein_id="AAU90670.1"
FT                   /translation="MDLTITPSAEKFIQRMVRFGGAGPDAGFRLVVSPGGCSGLASEFS
FT                   IEAAPLPGDAVVTVQGLKLFLPAESRLLLQGVTMDFKDTPLQSGLVFIDPKATGCGSCG
FT                   SSVSAPVPGEGSAGISGIPIKSV"
FT   gene            211941..212474
FT                   /locus_tag="MCA0207"
FT   CDS_pept        211941..212474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0207"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:142364; match to
FT                   protein family HMM PF00515; match to protein family HMM
FT                   PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90669"
FT                   /db_xref="GOA:Q60CA2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CA2"
FT                   /protein_id="AAU90669.1"
FT                   /translation="MARSAVLEPAPILGDSGAECLGEGLPAEAERHLRLAGQNYHRDEV
FT                   ALGHLRAAWEHAPGHAAVYIGKYRFYFYKNRLAEALETAKECLVKAALDNGMSPDWREA
FT                   RPEDADFSSFEAVLPRFFLFTLKGYAYLQMRLGNLEEGRAAVEKLLELDPTDKLGGRVL
FT                   MGVLERQANGDDEE"
FT   gene            212455..213246
FT                   /locus_tag="MCA0208"
FT   CDS_pept        212455..213246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0208"
FT                   /product="leucine rich repeat domain protein"
FT                   /note="identified by match to protein family HMM PF01816"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90668"
FT                   /db_xref="GOA:Q60CA1"
FT                   /db_xref="InterPro:IPR004830"
FT                   /db_xref="InterPro:IPR008665"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CA1"
FT                   /protein_id="AAU90668.1"
FT                   /translation="MGTTRSEIEEARDWQGNLLDCSRCEQREGLTEGRCHLGHACVHDR
FT                   YARRIDRFFRWNPDLAKSYLEHPYFETRAVAAKHVELFYLPRLVADPDETVRQSVAQRL
FT                   PVRSKPFEILRHDPHRDVRVRVAERLEPRDLATMIGDTDYFVRQIVARRLPPGLLVKMI
FT                   HDPDPEVRKVVAQRIAPEWLPTLAADTEMPVRLAAVRRMDNKQLRQFVKDPDWRLRYEV
FT                   AGRLELADLEPLRADPEPAVRELVAQRLNRPRGEGVWPEAC"
FT   gene            213268..213588
FT                   /locus_tag="MCA0209"
FT   CDS_pept        213268..213588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0209"
FT                   /product="nifZ protein"
FT                   /note="identified by similarity to SP:P08533; match to
FT                   protein family HMM PF04319"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90667"
FT                   /db_xref="GOA:Q60CA0"
FT                   /db_xref="InterPro:IPR007415"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CA0"
FT                   /protein_id="AAU90667.1"
FT                   /translation="MGDISRDSDSMELNDPPKFNFGEKVRSKKVVRNDGTFTGAEIGEV
FT                   LVKKGEVGYVKSINTFLQQFYIYAVDFPDRGYAVGMKGRELESVDNPPPSKQDAEPRGE
FT                   TA"
FT   gene            213585..213854
FT                   /locus_tag="MCA0210"
FT   CDS_pept        213585..213854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0210"
FT                   /product="putative nifZ protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90666"
FT                   /db_xref="GOA:Q60C99"
FT                   /db_xref="InterPro:IPR007415"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C99"
FT                   /protein_id="AAU90666.1"
FT                   /translation="MIDQRAPIYQWGQKVSTEVDIFNDGSYPDHEPEALLVAAGTEGEI
FT                   VQIGHHEEANIPVYLVEFPGGYVIGCFEEELRSERKSVQVAGLL"
FT   gene            213900..214244
FT                   /locus_tag="MCA0211"
FT   CDS_pept        213900..214244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0211"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:12620472"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90665"
FT                   /db_xref="GOA:Q60C98"
FT                   /db_xref="InterPro:IPR021388"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C98"
FT                   /protein_id="AAU90665.1"
FT                   /translation="MGSIQAIANTQPNELDLKRIERAIQARKRYRYVTPEVHPTEDGYL
FT                   IQSSCCSRNIDPNGGVIDIARLEFKPSRGCWWLYHKDHAIGHWIMHGEYRSLQQILALL
FT                   NEDPNRRFWQ"
FT   gene            214241..215389
FT                   /gene="nifS"
FT                   /locus_tag="MCA0212"
FT   CDS_pept        214241..215389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifS"
FT                   /locus_tag="MCA0212"
FT                   /product="cysteine desulfurase"
FT                   /note="identified by similarity to SP:Q43884; match to
FT                   protein family HMM PF00266"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90664"
FT                   /db_xref="GOA:Q60C97"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C97"
FT                   /protein_id="AAU90664.1"
FT                   /translation="MSETSIYLDNNATTRPAPECVAAMMACLQMHYGNPSSKHRLGEAA
FT                   KMEVIAARARLAALLGASPAEIVFTSGGTESIQQAIRGALALAADKRRVVTSAVEHPAT
FT                   LLLLEHLEAQGLEVIRLPVDRQGRLDLAMLDAALTPDTGLLSLMWANNETGVLFPIAEA
FT                   AALAASRGVLFHCDAVQAVGKLPIDLRLVPLDFLSLSGHKLHGPKGIGALFVRKGRKLP
FT                   PLLLGHQERGRRGSTENVVGIVGLGVAAELAAEHLASGIDAVARLRDRLESRLLAALPG
FT                   ASVNGAGAPRVAGTSSFNLGNVEAELVLDKLDRAGVCASAGAACSAGGTEPSHVLTAMG
FT                   LGKEGALATLRFSLSRYTTVAEVDAVCGLLPGIVRSLLAEAA"
FT   gene            215448..215666
FT                   /locus_tag="MCA0213"
FT   CDS_pept        215448..215666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0213"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL02ML4553; match
FT                   to protein family HMM PF06988"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90663"
FT                   /db_xref="GOA:Q60C96"
FT                   /db_xref="InterPro:IPR009727"
FT                   /db_xref="InterPro:IPR024044"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C96"
FT                   /protein_id="AAU90663.1"
FT                   /translation="MKVMIRRNAAGELSAYVPKKDLEEPIVSQEKPEMWGGTVTLANGW
FT                   QLVLPEMAEGTTLPITVDARKLAGSDD"
FT   gene            215669..215947
FT                   /locus_tag="MCA0214"
FT   CDS_pept        215669..215947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0214"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:551688"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90654"
FT                   /db_xref="GOA:Q60C95"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C95"
FT                   /protein_id="AAU90654.1"
FT                   /translation="MALTTEALERIRSQLGTAATAAEQVSALRRAFPGLSVTRCDAGDI
FT                   DTETPVLETTRFNLYLLDAADHCARVTADLSRATGLILAEKPKGAAP"
FT   gene            215944..217098
FT                   /locus_tag="MCA0215"
FT   CDS_pept        215944..217098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0215"
FT                   /product="aminotransferase, DegT/DnrJ/EryC1/StrS family"
FT                   /note="identified by match to protein family HMM PF01041"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90653"
FT                   /db_xref="GOA:Q60C94"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C94"
FT                   /protein_id="AAU90653.1"
FT                   /translation="MSVQPSILFSDPDMSLAELEAVEEVLKSPRLSAGSVVEDFEAAFA
FT                   EYLGRKHAVAVSSATMGLLLALRAYGIGPGDEVIAPPFGFRETAHAITLAGAKPVFVDI
FT                   DYWTCTLVPDKAAAAVTPQTKAILAGNVNGHPALWAQLRALADECGLILIEDSSEAIGS
FT                   RYQGRLVGSFGDCSIFDFTQPSALTTGEGGMVVTDDGNLALRLRGYRNRRLDERNSVVL
FT                   GDSPPYRAEMSDINAALGLAQLERLDGILERRKDVEAYYDAFMQSFEGIKPAYQAPEVD
FT                   ELHWMVYLVHLGTRFTRSSRDVVIQDLATAEVESVAFCSPLHTQRHYLDLGYRKGQFFV
FT                   TEKLADRAIALPFHCHLTEDQIGFIVQTAKDSSVNVGAGAAIYL"
FT   gene            217110..217451
FT                   /locus_tag="MCA0216"
FT   CDS_pept        217110..217451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0216"
FT                   /product="putative ferredoxin, 2Fe-2S"
FT                   /note="identified by similarity to SP:P25528; match to
FT                   protein family HMM PF00111"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90652"
FT                   /db_xref="GOA:Q60C93"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C93"
FT                   /protein_id="AAU90652.1"
FT                   /translation="MSGYLRTGIRRNAKVCVTVLPSGKTVEISSGSRLLDAVLLTGDAI
FT                   VPRCGGHARCGECHVLVRYGGRGLSKIRPDEREKLENMRGTETLSRLSCQAVLGSREIT
FT                   IELMFQKRG"
FT   gene            217457..217687
FT                   /locus_tag="MCA0217"
FT   CDS_pept        217457..217687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0217"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90651"
FT                   /db_xref="GOA:Q60C92"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C92"
FT                   /protein_id="AAU90651.1"
FT                   /translation="MTTPEKIESLIHVRFAPNGTVMEIGERPPGVEAQTWFNYLSQNTS
FT                   NCYQALAGGRGMFRLPRPQVDALKAALSSAG"
FT   gene            217693..218535
FT                   /locus_tag="MCA0218"
FT   CDS_pept        217693..218535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0218"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:7407093"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90650"
FT                   /db_xref="GOA:Q60C91"
FT                   /db_xref="InterPro:IPR039444"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C91"
FT                   /protein_id="AAU90650.1"
FT                   /translation="MTATIPTEIQAGLAGGQVIPYLGPGVLDLDGCSAVPSAPETLVEL
FT                   ITAKVTVPHKIRRNLTAAGQYIENFKHRKTLVGLLKEAFAAAPAPNGLHRYLAGQPLPL
FT                   IVDAWYDASMAAALAGRSDFGQVQGVSRAEHFGEWVHYFHADGSPAAEADAANWNLLLY
FT                   KPLGGIAPAANFILSDSDYVEVLTEIDIQTPIPEPVKQIRSGRHFLFLGCRFRTQLERT
FT                   YARQIMKRSSDLHWAVLPDEPTRNEERFLAEQRIRRIDLPLGDFVRRLAGAAAARQAA"
FT   gene            complement(218574..219392)
FT                   /locus_tag="MCA0219"
FT   CDS_pept        complement(218574..219392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0219"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01XF02028; match
FT                   to protein family HMM PF03692"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90649"
FT                   /db_xref="GOA:Q60C90"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C90"
FT                   /protein_id="AAU90649.1"
FT                   /translation="MVINRQSGYHGQTATTFCGADPEMAGHDGGDSGPLSFFKAQHRAF
FT                   AETLKTRQGSGGLVDGLLLQAWDSFDRNVDIQAEGQPPLACHKGCATCCTLRVTATAPE
FT                   VLMIDRYVRWSDGRFKSIGIDLPARIADADAQTRGLDEAQRVALRLRCPYIQNGICLIY
FT                   QVRPLACRGHASYDVHACVEAAAGRAGEIPYSEPHRVVRSLVQNALQSSLRDAGLAFRL
FT                   YELNHAVCIALRNEDCCREWLSGTDVFAPAAVTEVAADEMARVYDAIRAS"
FT   gene            219564..219779
FT                   /locus_tag="MCA0220"
FT   CDS_pept        219564..219779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0220"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01ATC0362"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90648"
FT                   /db_xref="GOA:Q60C89"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C89"
FT                   /protein_id="AAU90648.1"
FT                   /translation="MLEDDEEGPEISLDRFEDPGNDPNQSLEECLAMLADRLMKEQGIS
FT                   ASRPEAEFAWVQPKTGVNVHSGVQAH"
FT   gene            219939..220514
FT                   /locus_tag="MCA0221"
FT   CDS_pept        219939..220514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0221"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GP:17135185"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90647"
FT                   /db_xref="GOA:Q60C88"
FT                   /db_xref="InterPro:IPR032093"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C88"
FT                   /protein_id="AAU90647.1"
FT                   /translation="MIAAAASHPHTAFRSGCRKNSVQTLVPALVLALAGCASVNAENSV
FT                   PQMEQGIQIGDPAPGRAVIWSRADRPARMMVEYAFSADFAGSKTVRGPYALEGTDYTAR
FT                   QELTGLPAGRDVYVKVWFEDLTNARSRSEPVTGHFHTIGRRDDIRFVWGGDTAGQGWGI
FT                   NSAFGGMKIYETMRRVKPRFFIHSGDTV"
FT   gene            complement(220563..222152)
FT                   /locus_tag="MCA0222"
FT   CDS_pept        complement(220563..222152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0222"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:2983454"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90639"
FT                   /db_xref="GOA:Q60C87"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C87"
FT                   /protein_id="AAU90639.1"
FT                   /translation="MNDGDSRRIFAYHERTKHRLERYAAGPETLDWSAQPDPFRTFEGT
FT                   DRIRLPLLADRLDTSYPDLHRPGAVPPRALTLDSVGLLLELSLALSAWKEYGPDRWSLR
FT                   CNPSSGNLHPTEGYVVCQNLDGLDDGIYHYLSRDHALECRARATPDTADGPSRLLIGLS
FT                   SIHWREAWKYGERAFRYCQLDTGHAIGALRYAAAALGWGLRRVEMADAGVTARLLGLDR
FT                   ASEFAGAEGEEAELLLEVFIEPAPPLPPPVFGNLKWAGKANVLDPHPMYHWPVIDEVAD
FT                   ASRGSVQATPSPPETDYPPRADLPAVAAAAVIRQRRSAQRFDRRFELVRNDFYALLDAL
FT                   LARPCAPWDVWDLTPALHPVLFVHRVTGLAPGLYALPRSRDAETKLRAALRPDFAWTRP
FT                   SDCPRHLPLFLLAEGGCGPLARTVCCHQAIAADSAFALGMLAEFEGILNAAPWRYRQLH
FT                   WEAGLLGQALYLEAEARGLRGTGIGCYFDDAFHELLGLSGKAFQSLYHFTVGRPLDDPR
FT                   ITTEAPYPRNRA"
FT   gene            complement(222149..222586)
FT                   /locus_tag="MCA0223"
FT   CDS_pept        complement(222149..222586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0223"
FT                   /product="nitrogenase-associated protein"
FT                   /note="identified by similarity to GP:862325; match to
FT                   protein family HMM PF03960; match to protein family HMM
FT                   TIGR01616"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90638"
FT                   /db_xref="InterPro:IPR006503"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C86"
FT                   /protein_id="AAU90638.1"
FT                   /translation="MARVHFYEKPGCANNARQKQMLREAGHELIVHDLLATPWRAGELR
FT                   LFFGDRPVAEWFNRAAPRVKAGEIVPESLDAEEAIASMLADPLLIRRPLMRVGERREVG
FT                   FDPETIRAWIGLGSSRQTADADPESCRRPHPCPALEDSIGR"
FT   gene            complement(222594..222845)
FT                   /locus_tag="MCA0224"
FT   CDS_pept        complement(222594..222845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0224"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90637"
FT                   /db_xref="GOA:Q60C85"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C85"
FT                   /protein_id="AAU90637.1"
FT                   /translation="MTYQVIKSALKLCQGTRKSSGEPCNGTLYTCKTCGATGCKQSRDD
FT                   LCSDQAFNVLEHCLKCGAIGQAEAIAPGDYRPHQAWAS"
FT   gene            complement(222898..223224)
FT                   /locus_tag="MCA0225"
FT   CDS_pept        complement(222898..223224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0225"
FT                   /product="Rieske 2Fe-2S family protein"
FT                   /note="identified by similarity to GP:1754625; match to
FT                   protein family HMM PF00355"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90636"
FT                   /db_xref="GOA:Q60C84"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C84"
FT                   /protein_id="AAU90636.1"
FT                   /translation="MFTKACDESEPREGKYEVVAVNRTLMLVVWPSGGRPRAFQGMCPH
FT                   AREPLADARFDGRTLTCAHHDWEFDSDGGCIKGKRCTLAEYPLKIENGEVLIDTDGVSA
FT                   NYLS"
FT   gene            complement(223279..223865)
FT                   /pseudo
FT                   /locus_tag="MCA0226"
FT                   /note="conserved hypothetical protein, authentic
FT                   frameshift; this gene contains a frame shift which is not
FT                   the result of sequencing error; identified by similarity to
FT                   GP:12620463"
FT   mobile_element  223875..225216
FT                   /mobile_element_type="insertion sequence:IS02"
FT   gene            223963..225063
FT                   /locus_tag="MCA0227"
FT   CDS_pept        223963..225063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0227"
FT                   /product="ISMca1, transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90635"
FT                   /db_xref="GOA:Q60CL0"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CL0"
FT                   /protein_id="AAU90635.1"
FT                   /translation="MRGTQNFQGAMFSYISLEERVPARHPLRKLRALVDALLASMSAEF
FT                   EAVYARRGRPSVPPEMLLKALLLQILFSIRSERLLVEAIDYNLLYRWFVGLNLEDKVWD
FT                   HSTFSANRQRLFNEDLARVFFERVKYTADWAKLIGDEHFSVDGTLIEAWASQKSFKRKD
FT                   ASGSDDGAPPQGRNPEVDFKGETRRNDTHASTTDADARLFKKAAGDKSRLCHMGHILMD
FT                   NRHGLVVDVEITHASGTAERQAALKMLQRQKRKAGRLTVGADKGYDCRAFVQGCRKLGI
FT                   TPHVAAKAKHSAIDGRTQRHEGYKVSLRVRKRIEEAFGWIKTVGGLAKTKLIGHAKLAG
FT                   QALMCFAAYNLVRMGSLGGWWDAHHA"
FT   gene            complement(225302..225727)
FT                   /locus_tag="MCA0228"
FT   CDS_pept        complement(225302..225727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0228"
FT                   /product="response regulator"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90634"
FT                   /db_xref="GOA:Q60C82"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C82"
FT                   /protein_id="AAU90634.1"
FT                   /translation="MQIGVDTERAVDDRRVFVVDDDEITRAALQFMLHDEIETHELGSL
FT                   EAAYAKALDWKPAVLLLGLGVVRSRGIDVLAEIRARLEDIRIIVVADAATDPLAQECLK
FT                   QGANSLLTKPLTIEKARQKVDMQLGRKVRLAVPVVVT"
FT   gene            226242..227123
FT                   /gene="nifH"
FT                   /locus_tag="MCA0229"
FT   CDS_pept        226242..227123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifH"
FT                   /locus_tag="MCA0229"
FT                   /product="nitrogenase iron protein"
FT                   /EC_number="1.18.6.1"
FT                   /note="identified by match to protein family HMM PF00142;
FT                   match to protein family HMM TIGR01287"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90633"
FT                   /db_xref="GOA:Q60C81"
FT                   /db_xref="InterPro:IPR000392"
FT                   /db_xref="InterPro:IPR005977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030655"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C81"
FT                   /protein_id="AAU90633.1"
FT                   /translation="MSSLRQIAFYGKGGIGKSTTSQNTLAALAEMGQKILIVGCDPKAD
FT                   STRLILHAKAQDTILSLAADAGSVEDLELEDVMKVGFRDIRCVESGGPEPGVGCAGRGV
FT                   ITSINFLEEEGAYDGIDYVSYDVLGDVVCGGFAMPIRENKAQEIYIVMSGEMMAMYAAN
FT                   NISKGILKYANSGGVRLGGLICNERKTDKELELAESLAKKLGTQLIYFVPRDNIVQHAE
FT                   LRRMTVIEYAPDSVQAGHYRNLAQKIHANSGNGIIPTPITMDELEDLLMEHGVMAQVDE
FT                   SQVGKTAAELAA"
FT   gene            227222..228682
FT                   /gene="nifD"
FT                   /locus_tag="MCA0230"
FT   CDS_pept        227222..228682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifD"
FT                   /locus_tag="MCA0230"
FT                   /product="nitrogenase molybdenum-iron protein alpha chain"
FT                   /EC_number="1.18.6.1"
FT                   /note="identified by similarity to SP:P06120; match to
FT                   protein family HMM PF00148; match to protein family HMM
FT                   TIGR01282; match to protein family HMM TIGR01862"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90625"
FT                   /db_xref="GOA:Q60C80"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005972"
FT                   /db_xref="InterPro:IPR010143"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C80"
FT                   /protein_id="AAU90625.1"
FT                   /translation="MSLTVEQVKQRNKDLIKEVLEVYPDKTAKRRAKHLGTFEEGKPDC
FT                   GVKSNIKSIPGVMTIRGCAYAGSKGVVWGPIKDMIHISHGPVGCGQYSWASRRNYYIGT
FT                   TGIDTFVTMQFTSDFQEKDIVFGGDKKLEKIIDEIEELFPLNHGITVQSECPIGLIGDD
FT                   IEAVSKKKSKEYSGKTIVPVRCEGFRGVSQSLGHHIANDAVRDWVFDKAGDKHPEFQST
FT                   PYDVAIIGDYNIGGDAWSSRILLEEMGLRVIAQWSGDGTLAELENTPKAKLNVLHCYRS
FT                   MNYISRHLEEKYGVPWVEYNFFGPTKIAESLRKIASFFDDKIKEGAERVIAKYQPLMDA
FT                   VIAKYRPRLEGKKVMLFVGGLRPRHVIGAYEDLGMEIVGTGYEFGHNDDYQRTTHYVKD
FT                   GTLIYDDVTGYEFEKFVEAIQPDLVGSGIKEKYVFQKMGVPFRQMHSWDYSGPYHGYDG
FT                   FAIFARDMDMAINNPVWGMTKAPWKSAA"
FT   gene            228789..230348
FT                   /gene="nifK"
FT                   /locus_tag="MCA0231"
FT   CDS_pept        228789..230348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifK"
FT                   /locus_tag="MCA0231"
FT                   /product="nitrogenase molybdenum-iron protein beta chain"
FT                   /EC_number="1.18.6.1"
FT                   /note="identified by similarity to SP:P20621; match to
FT                   protein family HMM PF00148; match to protein family HMM
FT                   TIGR01286"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90624"
FT                   /db_xref="GOA:Q60C79"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005976"
FT                   /db_xref="InterPro:IPR024564"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C79"
FT                   /protein_id="AAU90624.1"
FT                   /translation="MSQNAEKVLDHFNLFREPEYINLFESKRKEFEFMPPDQQVEEVRE
FT                   WAKTEEYKEKNFAREALVVNPAKACQPLGAVFAAVGFEGTIPFVHGSQGCVAYYRSHFS
FT                   RHFKEPTSCVSSSMTEDAAVFGGLNNMIDGLANTYNMYKPKMIAVSTTCMAEVIGDDLN
FT                   AFIKTSKEKGSIPADFDVPFAHTPAFVGSHITGYDNVMKGILQHFWDGKSGTVEPLVRQ
FT                   PNESINFLGGFDGYTVGNLREIKRIFNLFGIDYTIIGDNSDVWDTPTDGEFRMYDGGTT
FT                   LEQAANALHAKATISMQEFCTEKTLPFIAEHGQEVVALNHPIGVKGTDRFLMEISRLTG
FT                   KPIPVELEKERGRLVDAIADSTAHIHGQKFAIYGDPDLCYGLAEFLLELGAEPTHVLAT
FT                   NGGKAWETKMQALFDSSPFGKNCKVYPGRDLWHMRSLLFTEPVDFLIGNTYGKYLERDT
FT                   GTPLIRIGFPIFDRHHKHRYPVWGYQGGLNVLVWILDRMFEAIDANTNIPAKTDYSFDI
FT                   IR"
FT   gene            230591..230959
FT                   /locus_tag="MCA0232"
FT   CDS_pept        230591..230959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0232"
FT                   /product="ferredoxin, 2Fe-2S"
FT                   /note="identified by similarity to SP:P37097; match to
FT                   protein family HMM PF00111"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90623"
FT                   /db_xref="GOA:Q60C78"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C78"
FT                   /protein_id="AAU90623.1"
FT                   /translation="MANVTFSSPLLPKDVTVYAVAGDTHTLLKVAQKNKIPLPFECEDG
FT                   NCGSCVMEVVSLSDKPFMAQDLTEKERATLVAAGKLSKAEIEEAVVNDRPPRYRLACQY
FT                   IVRDEDILVRFSGEPGVV"
FT   gene            231399..233081
FT                   /gene="nifE"
FT                   /locus_tag="MCA0233"
FT   CDS_pept        231399..233081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifE"
FT                   /locus_tag="MCA0233"
FT                   /product="nitrogenase iron-molybdenum cofactor biosynthesis
FT                   protein nifE"
FT                   /note="identified by similarity to SP:P26506; match to
FT                   protein family HMM PF00148; match to protein family HMM
FT                   PF04324; match to protein family HMM TIGR01283"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90622"
FT                   /db_xref="GOA:Q60C77"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005973"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="InterPro:IPR042459"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C77"
FT                   /protein_id="AAU90622.1"
FT                   /translation="MSSLSSKIQDVFNEPGCGKNQGKSEKERKKGCTKQLQPGGAAGGC
FT                   AFDGAKIALQPITDVAHLVHGPIACEGNSWDNRGSKSSGSNLWRTGFTTDINETDVVFG
FT                   GEKRLYKSIKEIVEKYDPPAVFVYQTCVPAMIGDDIEAVCKAASKKFGKPVIPVNSPGF
FT                   VGPKNLGNKLAGEAILDHVIGTEEPSYTTPYDINIIGEYNLSGELWQVKPLLDELGIRI
FT                   LCCISGDAKYRDVACSHRARAAMMVCSKSMINIARKMEERYGIPFFEGSFYGIGDTSDA
FT                   LREIARLLIERGAPAELMERTEALIAREEARAWAAIEPYKKRLTGKKVLLITGGVKSWS
FT                   VVAALQESGMEVVGTSVKKSTKEDKERIKEIMGEDAHMIDDMTPREMYKMLKEAKADIM
FT                   LSGGRSQFVALKAKMPWLDINQERHHAYMGYVGMVELVKEIDKALFNPVWEQVRKRAPW
FT                   EETTWEERADAALAAEAAALAADPELARAQRRAARICKCKAVDRGAIEDAILAYGLESV
FT                   EAVTERTHAGSGCTGCTGTIAGILDGIEDWRPAPSAEPAKRAA"
FT   gene            233089..234462
FT                   /gene="nifN"
FT                   /locus_tag="MCA0234"
FT   CDS_pept        233089..234462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifN"
FT                   /locus_tag="MCA0234"
FT                   /product="nitrogenase molybdenum-iron cofactor biosynthesis
FT                   protein NifN"
FT                   /note="identified by similarity to SP:P26507; match to
FT                   protein family HMM PF00148; match to protein family HMM
FT                   TIGR01285"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90621"
FT                   /db_xref="GOA:Q60C76"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005975"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C76"
FT                   /protein_id="AAU90621.1"
FT                   /translation="MAKVTHSQKSCTVNPLKMSQPIGSALAFMGLKNCMPLFHGSQGCT
FT                   SFGLVLFVRHFKEAIPLQTTAMSEVATVLGGLENVEQAILTIANRQRPAIIGISSTGVT
FT                   ETKGDDVDGYLKLIREKHPELDHIKLVYVSTPDFKDAFQDGWAKTVTRMVEQLVEPVPA
FT                   DTVRDPAKVNLLPGAHVTPGDLDELRDLIEAFGLEPVILPDLSGSLDGHVPDDFTPTTI
FT                   GGISLEEIAGMGRSRHTIAVGEQMRPAAEALEKKTGVPYTLFDRLTGLEANDGFIALLA
FT                   GLSGRPVPNKIKRQRSQLVDAMLDGHFHFGGKRIAIGAEPDLLWTLSGWFHEMGAEVAA
FT                   AVTTTESPLLERIATDEVLLGDLEDLEARAAGCDLLVTHSHGRQAAERLAIPFYRIGIP
FT                   MFDRLGAAHQTIVGYRGTRDLIFEIGNLFIASGHEPTPETWAYPEETGHVGEKTLAAH"
FT   gene            234506..234931
FT                   /locus_tag="MCA0235"
FT   CDS_pept        234506..234931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0235"
FT                   /product="nitrogenase molybdenum-iron protein NifX"
FT                   /note="identified by similarity to SP:P19078; match to
FT                   protein family HMM PF02579"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90620"
FT                   /db_xref="GOA:Q60C75"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR013480"
FT                   /db_xref="InterPro:IPR034169"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C75"
FT                   /protein_id="AAU90620.1"
FT                   /translation="MKVAFATQDLKRVDAHFGWAKNIAVYELSAEGADFVEAIQFEGDL
FT                   QEDGNEDKLAPKLEAIKDCAILYVAAIGGSGAARVVAQGIHPIKVPQPEPIAELLDKLR
FT                   DVLRGNPPPWLRKVLAKENKGRERSFDFEDDEEVQHG"
FT   gene            234945..235403
FT                   /locus_tag="MCA0236"
FT   CDS_pept        234945..235403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0236"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:12620458; match to
FT                   protein family HMM PF03270"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90611"
FT                   /db_xref="GOA:Q60C74"
FT                   /db_xref="InterPro:IPR004952"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C74"
FT                   /protein_id="AAU90611.1"
FT                   /translation="MAEVPASPMESAFIKELVKQWRAQDSYGTWEGKSDEQLLDPYILD
FT                   KEKRASIPIIGDPDPETLWRLELFYNAVGLSIERATKVMVTPMMKMSHEGFGRMVLIAG
FT                   RLIVVNKQLRDVHRFGFPSMEKLAEEGEKLVNAGVEMIRRYPDVANYS"
FT   gene            235418..235609
FT                   /locus_tag="MCA0237"
FT   CDS_pept        235418..235609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0237"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:Q44148; match to
FT                   protein family HMM PF05082"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90610"
FT                   /db_xref="GOA:Q60C73"
FT                   /db_xref="InterPro:IPR007774"
FT                   /db_xref="InterPro:IPR029012"
FT                   /db_xref="PDB:2JS5"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C73"
FT                   /protein_id="AAU90610.1"
FT                   /translation="MSEGAEELKAKLKKLNAQATALKMDLHDLAEDLPTGWNRIMEVAE
FT                   KTYEAYRQLDEFRKSTAS"
FT   gene            235620..235928
FT                   /locus_tag="MCA0238"
FT   CDS_pept        235620..235928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0238"
FT                   /product="ferredoxin, 4Fe-4S"
FT                   /note="identified by similarity to SP:P46036; match to
FT                   protein family HMM PF00037"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90609"
FT                   /db_xref="GOA:Q60C72"
FT                   /db_xref="InterPro:IPR014283"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C72"
FT                   /protein_id="AAU90609.1"
FT                   /translation="MSEFSVTLPSGKVWVPKFVGEINQDKCIGCGRCYKVCGREVLEMV
FT                   GINEDGEAVAISAGEDDDDDEYDKKVMSIANADNCIGCESCAKICPKQCYTHVPLAA"
FT   gene            235978..236571
FT                   /locus_tag="MCA0239"
FT   CDS_pept        235978..236571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0239"
FT                   /product="putative nitrogen fixation protein nifQ"
FT                   /note="identified by similarity to SP:P11068; match to
FT                   protein family HMM PF04891"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90608"
FT                   /db_xref="GOA:Q60C71"
FT                   /db_xref="InterPro:IPR006975"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C71"
FT                   /protein_id="AAU90608.1"
FT                   /translation="MLARNDVFSHDPLLAYAENPSDPLTLAFASAIELARSSSRLAGRG
FT                   CFGLDPTEFCTLLDRYFPGARGVYVKPAGGAGRAPADEFDSLLGLLLEHCRGDAVESRW
FT                   LAHAIAACCLGDDHLWQDMGLADRKTLSDLLARHFPALYARNDGGMRWKKFFYKQLCER
FT                   EGAHVCRSPTCAECDEYANCFGPEEDDAWQPVKR"
FT   gene            236550..237620
FT                   /locus_tag="MCA0240"
FT   CDS_pept        236550..237620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0240"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL03PA00760; match
FT                   to protein family HMM PF01571"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90607"
FT                   /db_xref="GOA:Q60C70"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C70"
FT                   /protein_id="AAU90607.1"
FT                   /translation="MAAGEALKGQMPGCAAVNAPAEWVDFLDRRGASGGEGAELALGGD
FT                   LIADLSHFGLIEVKGEDAGKFLGSMLTGDVRLVSETLGQFTSWCDGKGRIQATFWLFKR
FT                   GGAYYLLLPEALLPGVITRLKMFLLRTKATITDASGTLARIGLSGAGIADTLGSALPEP
FT                   RGGTMSVGDCTLLALGCEPRPRWLAVGTSPAVSALWNKAAASARPAGAGAWALLDILAG
FT                   IPYVTTETAGEFIPQMLDLEALGGLSYKKGCYPGQEVIARLHYRGQLKRKVFLAHADCP
FT                   EVPAPGTRLHRPGFDESVGLVVSAAKDGREYPVTMLAVVVLERKAQGDIRLGSADGPLL
FT                   VFADQDDDPPHSDAGC"
FT   gene            237673..238053
FT                   /locus_tag="MCA0241"
FT   CDS_pept        237673..238053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0241"
FT                   /product="apaG protein"
FT                   /note="identified by similarity to SP:Q56017; match to
FT                   protein family HMM PF04379"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90606"
FT                   /db_xref="GOA:Q60C69"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60C69"
FT                   /protein_id="AAU90606.1"
FT                   /translation="MRRKPYELKVEVKAVYLREHSRPDAHQYTFAYTVTMENTGTVPAK
FT                   LLGRRWIITDANGKTVEVVGEGVVGEHPYLRPGEAFEYTSAATIATPVGSMHGSYQLIA
FT                   DDGMPFEAPIAAFSLAIPRRLH"
FT   gene            238108..238728
FT                   /gene="clpP-1"
FT                   /locus_tag="MCA0242"
FT   CDS_pept        238108..238728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP-1"
FT                   /locus_tag="MCA0242"
FT                   /product="ATP-dependent Clp protease, proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /note="identified by match to protein family HMM PF00574;
FT                   match to protein family HMM TIGR00493"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90605"
FT                   /db_xref="GOA:Q60C68"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60C68"
FT                   /protein_id="AAU90605.1"
FT                   /translation="MDYATRAAGGLVPVVIEQSARGERAFDIYSRLLKERVIFLVGQVE
FT                   DYMANLVIAQLLFLESENPDKDIHLYINSPGGLVTAGLAIYDTMQFIKPDVSTLCVGQA
FT                   ASMGALLLAGGAAGKRYCLPHSRIMIHQPLGGFQGQASDIDIHAREILAVRDRLNKILA
FT                   HHTGQPIEKIQIDTDRDNFMGGNDAVEYGLIDKVLVSRASGAA"
FT   gene            238818..240086
FT                   /gene="clpX-1"
FT                   /locus_tag="MCA0243"
FT   CDS_pept        238818..240086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX-1"
FT                   /locus_tag="MCA0243"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpX"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF06689; match to protein
FT                   family HMM PF07724; match to protein family HMM TIGR00382"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90604"
FT                   /db_xref="GOA:Q60C67"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60C67"
FT                   /protein_id="AAU90604.1"
FT                   /translation="MNEDRKNRESGKLLYCSFCGKSQHEVRKLIAGPAVFVCDECVELC
FT                   NDIIREDLQGSEAGGVEGLPKPKEMKAILDQYVIGQDKAKRILSVAVYNHYKRLKARTF
FT                   RNDVELAKSNVLLIGPTGSGKTLLAETLARVLDVPFTIADATTLTEAGYVGEDVENIIQ
FT                   KLLLACDYDVEKAEQGIVYIDEIDKISRKADSPSITRDVSGEGVQQALLKLMEGTVASV
FT                   PPQGGRKHPQQEFLQVNTANILFICGGAFAGLDKTIRSRSERSGIGFSAEVKSKEENTN
FT                   VGEILAGVEAEDLIRYGLIPEFIGRLPVVATLEELDEAALVRILIEPKNALVKQYARLF
FT                   EMEGCELEILPEALGAIARRAMERKTGARGLRTIIEHALLDTMYELPSAEDVGKVVVDA
FT                   KVIRGETEPHRVYRSVERQRVSA"
FT   gene            240724..240927
FT                   /locus_tag="MCA0245"
FT   CDS_pept        240724..240927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0245"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90597"
FT                   /db_xref="GOA:Q60C66"
FT                   /db_xref="InterPro:IPR015278"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C66"
FT                   /protein_id="AAU90597.1"
FT                   /translation="MDRDGNPRLDGKGRPRLIESKYGASTTWMGKLPYRVNAGRHGGCP
FT                   VLAVGITPELMTDREEYDREHA"
FT   gene            240908..241558
FT                   /locus_tag="MCA0246"
FT   CDS_pept        240908..241558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0246"
FT                   /product="adenine-specific DNA methyltransferase"
FT                   /note="identified by similarity to GP:17135818; match to
FT                   protein family HMM PF05063"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90596"
FT                   /db_xref="GOA:Q60C65"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007757"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C65"
FT                   /protein_id="AAU90596.1"
FT                   /translation="MTENTLDPAADLLERLGDKRFRTILADPPWQFQNRTGKMAPEHKR
FT                   LNRYGTMSLEAIAGLPVERLTADTAHLYLWVPNALLLEGLKVMEAWGFTYKTNLVWHKI
FT                   RKDGGPDGRGVGFYFRNVTELVLFGVRGKNARTLAAGRRQVNFLATRKREHSRKPDEMY
FT                   GIIESCSPGPYLELFARGARDRWSVWGNEADENYYPRWNTYANHSQAEICPFE"
FT   gene            241910..243121
FT                   /gene="iscS"
FT                   /locus_tag="MCA0247"
FT   CDS_pept        241910..243121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iscS"
FT                   /locus_tag="MCA0247"
FT                   /product="cysteine desulfurase"
FT                   /note="identified by similarity to SP:P39171; match to
FT                   protein family HMM PF00266; match to protein family HMM
FT                   TIGR02006"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90595"
FT                   /db_xref="GOA:Q60C64"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60C64"
FT                   /protein_id="AAU90595.1"
FT                   /translation="MKLPVYLDYSATTPVDPRVAEKMIPFLTENFGNPASRSHTFGWTA
FT                   EQAVENAREEVAKLVNADPREIVWTSGATESDNLAIKGAAEFYQTKGRHLITVKTEHKA
FT                   VLDTMRELESSGFEVTYLEPMANGLLDLDAFRAAIRPDTVLASVMQVNNEIGVIQDIAA
FT                   IGGICREHGVIFHVDAAQATGKVEIDLEQLPVDLMSFSAHKTYGPKGIGALYVRRKPRI
FT                   RLKAQMHGGGHERGLRSGTLATHQIVGMGEAFRIAREEMAAENERIRRLRDRLLAGLAD
FT                   MEEVFINGDLEQRVPHNLNISFNYVEGESLMMAIKDLAVSSGSACTSASLEPSYVLRAL
FT                   GRSDELAHSSIRFTLGRYTTAEDVDFAISLIKDKVARLREISPLWEMYKDGIDLNTVQW
FT                   AAAH"
FT   gene            243163..243582
FT                   /locus_tag="MCA0248"
FT   CDS_pept        243163..243582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0248"
FT                   /product="NifU family protein"
FT                   /note="identified by similarity to SP:P77310; match to
FT                   protein family HMM PF01592; match to protein family HMM
FT                   TIGR01999"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90594"
FT                   /db_xref="GOA:Q60C63"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR011339"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C63"
FT                   /protein_id="AAU90594.1"
FT                   /translation="MAYSDKVIDHYENPRNVGSFDKDEDGVGTGVVGAPACGDVMKLQI
FT                   KINEEGVIEDAKFKTYGCGSAIASSSLVTEWVKGKTVDEALAIKNSDIAEALALPPVKI
FT                   HCSVLAEDAIKAAVSDYKAKLGVADDGYEIRKSAA"
FT   gene            243608..243994
FT                   /locus_tag="MCA0249"
FT   CDS_pept        243608..243994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0249"
FT                   /product="HesB/YadR/YfhF family protein"
FT                   /note="identified by similarity to GP:17427504; match to
FT                   protein family HMM PF01521; match to protein family HMM
FT                   TIGR00049"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90593"
FT                   /db_xref="GOA:Q60C62"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60C62"
FT                   /protein_id="AAU90593.1"
FT                   /translation="MTSIVDLTPSEPALIFTGNAAAKVSELIAEEGNPALKLRVYVSGG
FT                   GCSGMQYGFAFEEAVNEDDTTVEKDGVVLLVDPTSLQYLQGAEIDYQEGLEGSRFVIKN
FT                   PNATSSCSCGSSFSVDGGASCSSH"
FT   gene            244021..244344
FT                   /locus_tag="MCA0250"
FT   CDS_pept        244021..244344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0250"
FT                   /product="HesB/YadR/YfhF family protein"
FT                   /note="identified by similarity to GP:2271523; match to
FT                   protein family HMM PF01521; match to protein family HMM
FT                   TIGR00049; match to protein family HMM TIGR02011"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90592"
FT                   /db_xref="GOA:Q60C61"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR011302"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C61"
FT                   /protein_id="AAU90592.1"
FT                   /translation="MAVTLTQKAAAQVQKHLAARGTGVGLRVAVKTSGCSGLAYALEFV
FT                   DEPAPEDQRFESHGVTVLVDPKSLVYLEGTELDFVREGLNEGFKFNNPNVKNECGCGES
FT                   FNV"
FT   gene            244356..244889
FT                   /gene="hscB"
FT                   /locus_tag="MCA0251"
FT   CDS_pept        244356..244889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hscB"
FT                   /locus_tag="MCA0251"
FT                   /product="co-chaperone Hsc20"
FT                   /note="identified by match to protein family HMM PF00226;
FT                   match to protein family HMM PF07743; match to protein
FT                   family HMM TIGR00714"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90591"
FT                   /db_xref="GOA:Q60C60"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004640"
FT                   /db_xref="InterPro:IPR009073"
FT                   /db_xref="InterPro:IPR036386"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60C60"
FT                   /protein_id="AAU90591.1"
FT                   /translation="MSEMAPRNYFEFFQLPEMFRLDQSVLDSHYLELQARVHPDKAAHL
FT                   SDVEKRLSLQWATFANEAYQTLKRPLERARYLLRIHGVDTREEDNTAMPAEFLLEQIEW
FT                   REEMQDAIAGRSEAALDRLGFRLKKEMDHLIESLGAMLDVQQSHPDAAVLVRQLAFLEK
FT                   LKRDLDQAHALLED"
FT   gene            244889..246748
FT                   /gene="hscA"
FT                   /locus_tag="MCA0252"
FT   CDS_pept        244889..246748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hscA"
FT                   /locus_tag="MCA0252"
FT                   /product="chaperone protein HscA"
FT                   /note="identified by similarity to SP:P36541; match to
FT                   protein family HMM PF00012; match to protein family HMM
FT                   TIGR01991"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90590"
FT                   /db_xref="GOA:Q60C59"
FT                   /db_xref="InterPro:IPR010236"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="InterPro:IPR042039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60C59"
FT                   /protein_id="AAU90590.1"
FT                   /translation="MLLQISEPGAGVKPQRRLAVGIDLGTTHSLVATVRDEQTVVLGDA
FT                   QGRVLLPSVVRYLGAGAIEVGYEAKARQAEDPENTFVSVKRYMGRGLGDLASHHGAPYR
FT                   FVEGEGMVQFDTRAGRISPVQVSAEILKVLRDRAVAELGGELAGAVITVPAYFDEAQRQ
FT                   ATKDAAKLAGLEVFRLLNEPTAAAVAYGLDNAAEGVYAVYDLGGGTFDISVLKLTRGVF
FT                   EVLATNGDPALGGDDFDRAVYDWLLAQSGLNGLSSSDASLLLTASRAAKERLSEQTEAT
FT                   VDTMLSDGSRIVATLSRDTFAELTAGLVKKTLTPVRKALRDAGLAIDDIKGVVLVGGAT
FT                   RMPCIREAVAEFFQQTPLTDLDPDKVVALGAAMQANLLAGNRAGGDWLLLDVIPLSLGI
FT                   ETLGGLCEKIVPRNTTIPVARAQEFTTWKDGQTAMSIHVVQGERELVSECRSLARFELR
FT                   GIPPMAAGAARIRVTYQVDADGLLNVTAAEQTSGVEARIEVKPSYGLSDAEVARMIEDS
FT                   YLHARDDLEARRLQEQKVEAARLIEATESALTEDGGLLTEQELEVLVKGLQVLKGAMEG
FT                   SDWQAIKNAADALNEASTEFAGRRMDHSIKAALTGQKLESLGV"
FT   gene            246751..247089
FT                   /locus_tag="MCA0253"
FT   CDS_pept        246751..247089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0253"
FT                   /product="ferredoxin, 2Fe-2S"
FT                   /note="identified by similarity to SP:P25528; match to
FT                   protein family HMM PF00111; match to protein family HMM
FT                   TIGR02007"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90589"
FT                   /db_xref="GOA:Q60C58"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR011536"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR018298"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C58"
FT                   /protein_id="AAU90589.1"
FT                   /translation="MPQIKVLPHAELCPEGAVIKASYGQSICDALLHGGIGIEHACEMA
FT                   CACSTCHVIVREGYESLNPADDAEDDMLDRAWGLEPHSRLACQAVVSKADLVIELPRYS
FT                   RNLAKELK"
FT   gene            247098..248252
FT                   /gene="nifV"
FT                   /locus_tag="MCA0254"
FT   CDS_pept        247098..248252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifV"
FT                   /locus_tag="MCA0254"
FT                   /product="homocitrate synthase"
FT                   /note="identified by similarity to SP:P05342; match to
FT                   protein family HMM PF00682"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90581"
FT                   /db_xref="GOA:Q60C57"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR013477"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C57"
FT                   /protein_id="AAU90581.1"
FT                   /translation="MVAQRVTINDTTLRDGEQTAGVAFTAEEKLSIARALARAGVPEME
FT                   VGIPVMGAEEQEVIRAIAGLGLSARLMVWGRMCERDLAAAADCGADRVNLSIPVSDIHL
FT                   RHKVNRTREWVLASIDRFVKRGLDAGLEVCVGCEDASRADPDFMLQVAEAAQRAGARRI
FT                   RFADTLGLLEPMSTFERIRRLAVATDLEIEMHAHNDFGLATANTLMAVQAGASHVNTTV
FT                   NGLGERAGNAAIEETVMALHQLYGIDTGIAVDHFPEISGLVAAASGRPVAANKSIVGEA
FT                   VFTHEAGIHVDGLLKNLINYQGVDPKDLGREHRLVLGKHSGTHAVKRSFRQLGIELSET
FT                   DAGRLLKRIRIHASQTKRPPSETELKLFYAETSVSSQPRPGLFG"
FT   gene            248299..248637
FT                   /locus_tag="MCA0255"
FT   CDS_pept        248299..248637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0255"
FT                   /product="nitrogen fixation protein NifW"
FT                   /note="identified by similarity to SP:P26481; match to
FT                   protein family HMM PF03206"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90580"
FT                   /db_xref="GOA:Q60C56"
FT                   /db_xref="InterPro:IPR004893"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60C56"
FT                   /protein_id="AAU90580.1"
FT                   /translation="MNPVLQRLQSFSAAEEFLDFFGVEYEPSVVHVNRLHILKRFNQYL
FT                   NRSPVPDDMDEVTAMATCKALLKQAHDDFVKSTAAQEKVFKVFQDQDGKSISLDSLKAS
FT                   LATRGQRA"
FT   gene            248741..249067
FT                   /locus_tag="MCA0256"
FT   CDS_pept        248741..249067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0256"
FT                   /product="ferredoxin, 2Fe-2S"
FT                   /note="identified by similarity to SP:O66511"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90579"
FT                   /db_xref="GOA:Q60C55"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C55"
FT                   /protein_id="AAU90579.1"
FT                   /translation="MPKPSKHVFVCAQTRPPGHPRGSCGQLGSTAVFQTFMQQFEAGQL
FT                   YGQFALTSTGCLGTCDLGPTVLVYPEGVMYSKVSPADVSEIIEEHLKNGRPVERLLAPA
FT                   ALWS"
FT   gene            249081..249569
FT                   /locus_tag="MCA0257"
FT   CDS_pept        249081..249569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0257"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:17131609"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90578"
FT                   /db_xref="GOA:Q60C54"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C54"
FT                   /protein_id="AAU90578.1"
FT                   /translation="MTASADPLRSFYAGEVPAQVGVLLEQAMRAYADTEQAEAYLRQAH
FT                   AAAPEALSVYFSMYKFYFYKGRLADAERVVRMALEAAALQGGFPNDIEALTPATVDWQR
FT                   YDAPQHFYLFSLKALAFIRLRRGDREDCERLLAKLGELDRTDSVGASVIRAFADGSAA"
FT   gene            249610..249933
FT                   /locus_tag="MCA0258"
FT   CDS_pept        249610..249933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0258"
FT                   /product="ferredoxin, 2Fe-2S"
FT                   /note="identified by similarity to SP:P25528; match to
FT                   protein family HMM PF00111"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90577"
FT                   /db_xref="GOA:Q60C53"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C53"
FT                   /protein_id="AAU90577.1"
FT                   /translation="MRGRHMSILTIQPSGKTVETREGASLLELIMEAGEAIMHKCGGNA
FT                   QCGSCHIFVQAGRKSVSRIGAEENARLDTIVGVGSKSRLACQAKVTGEEDITVELLGFA
FT                   SGL"
FT   gene            250085..250417
FT                   /locus_tag="MCA0259"
FT   CDS_pept        250085..250417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0259"
FT                   /product="glutaredoxin-related protein"
FT                   /note="identified by similarity to GP:19880969; match to
FT                   protein family HMM TIGR00365"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90576"
FT                   /db_xref="GOA:Q60C52"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C52"
FT                   /protein_id="AAU90576.1"
FT                   /translation="MSTIEDTIRDQIAKHPVLLYMKGVPEMPQCGFSAKAVSCLQAAGV
FT                   PFAYVNVLAAPSIRETLPSVSQWPTFPQLFVGGELVGGSDIVSELAASGELKTLLEAAA
FT                   AGQAQG"
FT   gene            250423..250671
FT                   /locus_tag="MCA0260"
FT   CDS_pept        250423..250671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0260"
FT                   /product="putative toluene-tolerance protein"
FT                   /note="identified by match to protein family HMM PF01722"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90575"
FT                   /db_xref="GOA:Q60C51"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C51"
FT                   /protein_id="AAU90575.1"
FT                   /translation="MEIDEVRTLIEAGIPGCEVRVEGEGCNFSVVVIGEAFEGLSPVKR
FT                   QQRVLATVSEPLSTGALHAISMKVYTPAEWSRQAGSA"
FT   gene            250692..250925
FT                   /locus_tag="MCA0261"
FT   CDS_pept        250692..250925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0261"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:TM1186"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90574"
FT                   /db_xref="GOA:Q60C50"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C50"
FT                   /protein_id="AAU90574.1"
FT                   /translation="MPLYDFHCRDCGQTTELLIKASDTPLCPHCGSGAMEKQLAQIAPH
FT                   MKTPGLIQKARAQAAREGHFSNYKPSERPRLK"
FT   gene            250992..252668
FT                   /locus_tag="MCA0262"
FT   CDS_pept        250992..252668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0262"
FT                   /product="ATPase, AAA family"
FT                   /note="identified by match to protein family HMM PF00004"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90539"
FT                   /db_xref="GOA:Q60C49"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C49"
FT                   /protein_id="AAU90539.1"
FT                   /translation="MVTEFPRLAGLQDQLRFGNKAEIAFAQLENAEVNFLRNLYEEAGP
FT                   DLKQRAVQIAVLQKALNDDGVRFEANELEQAVPAIARYLATDAIRGWVFTANVTNRPLP
FT                   YVVTRLDYIPESNDETGKIIIELKANAKGSLATVALRITASDVAGRTVGEIFAAKGFLK
FT                   ETPALIDDYDRITARYFERRARYGAQFAGQGVGFYAEDPAATHRDTDWSRKDVVVLSSG
FT                   GGSARLVNDEGILTQRALTLDATGDILGPYLRKAAKSNRYDAEDEVQELQDAMPEGLFT
FT                   QLPVHPYILMFHLELHHYLWVHVEDIAPYEYRPDLKRKLVLPEEQTDLIDILTAEMDVL
FT                   MDDIVAGKSGGTTVLCAGPPGVGKTLTAEVYSEIIRRPLYRVHSGQLGLNVAAMETSLK
FT                   DVLTRAQRWGAVMLIDEADVYIKRRDDDITMNAVVGVFLRVLEYFNGLLFLTTNRVDDI
FT                   DEAIVSRCIALIKFHPPEREDRCKIWRVMTEQFALAVDEALIGQLADAFPAATGRDIKG
FT                   LAKLVAKYCSHKQAAPSLEVFKRCSIFRGMDLGMAEGDRDG"
FT   gene            252934..253611
FT                   /locus_tag="MCA0263"
FT   CDS_pept        252934..253611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0263"
FT                   /product="fumarylacetoacetate hydrolase family protein"
FT                   /note="identified by similarity to OMNI:NTL01BM1881; match
FT                   to protein family HMM PF01557"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90538"
FT                   /db_xref="GOA:Q60C48"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C48"
FT                   /protein_id="AAU90538.1"
FT                   /translation="MNYAFPPAPVITLDAMSSRPFPVRRIFCLAHNYPESGREAVKPAE
FT                   PGFFLKPAGAILQNNAVLPYPPGTGALCPEAEMVVALHKGGRNIPADRVDHEYMFGYAV
FT                   GLDMTLRDALDHAIAQGLPWDKAKSFDHSSPCSAITPEFYAGNIASGRIELKVNGEVRQ
FT                   SGNVADMLWKVPETVHYLSTRMELFPGDLIYTGSSGLAGPVFQGDVIEATVAGLEPLII
FT                   TIG"
FT   gene            253623..253862
FT                   /locus_tag="MCA0264"
FT   CDS_pept        253623..253862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0264"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90537"
FT                   /db_xref="GOA:Q60C47"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C47"
FT                   /protein_id="AAU90537.1"
FT                   /translation="MQVTTILVDGVPRAVVRPNDRKDLARFLRNGRAYFTADTPDAELS
FT                   HRPADEAEAARWRSAYRLHLAWGGSEEWFFGVPL"
FT   gene            complement(253921..254304)
FT                   /locus_tag="MCA0265"
FT   CDS_pept        complement(253921..254304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0265"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90536"
FT                   /db_xref="GOA:Q60C46"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C46"
FT                   /protein_id="AAU90536.1"
FT                   /translation="MSQADGYHLFARLRPNRKLDVDGAAQPAQGHRAEGGFFGLVPDQA
FT                   QQGFFAVEQFVLLQFGHGKLAGQRVRLVAGEHLARRRDAVGNLVFRREGSVLALDGDDE
FT                   RHGSLQSNLRKCSGISVCISLGK"
FT   gene            254445..254816
FT                   /locus_tag="MCA0266"
FT   CDS_pept        254445..254816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0266"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90535"
FT                   /db_xref="GOA:Q60C45"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C45"
FT                   /protein_id="AAU90535.1"
FT                   /translation="MIFTVTSPRRLLEAAGLTPQSPEAGASHGPIFELAEKHGWDTDLY
FT                   RADDLLGEGVYDPEPVSEFEACVATLAEGLHACRVYLSDESATRALYGDPFYQGREGFP
FT                   AHMALREQLIALEVISDDL"
FT   gene            254833..254997
FT                   /locus_tag="MCA0267"
FT   CDS_pept        254833..254997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0267"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90534"
FT                   /db_xref="GOA:Q60C44"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C44"
FT                   /protein_id="AAU90534.1"
FT                   /translation="MTVEQLIRALLEMPREAVVLYEGDAGYARVGGIDLQRNGNGVPDE
FT                   VILSPDMSE"
FT   gene            255158..256453
FT                   /gene="amt-1"
FT                   /locus_tag="MCA0268"
FT   CDS_pept        255158..256453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amt-1"
FT                   /locus_tag="MCA0268"
FT                   /product="ammonium transporter"
FT                   /note="identified by match to protein family HMM PF00909;
FT                   match to protein family HMM TIGR00836"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90533"
FT                   /db_xref="GOA:Q60C43"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C43"
FT                   /protein_id="AAU90533.1"
FT                   /translation="MGQGPKFFGFSLLGCLLVARPLEAAELEAADTAWILTSTGFAWFM
FT                   TVPGLALLYAGLVRTKNVLSVLAQCFAVAALVSLVWMGAGYSLALGGGESSSPWLGGTS
FT                   RLFLHGLTADSAVGPVSEAAYCIYHLGFAVLAPTVMVGGFAERMKFSAMLWFTTLWMLL
FT                   VYAPVCHWLWGGGWLARLGAADFSGGVVVHATAGVSALTAAWLVGPRRGFPDALMPPHN
FT                   LTLTAAGAGMLWIGWHGFSAGSALITNGAAALSMLNTHLAASAGAMVWMVAEWWRFGRP
FT                   TLLGLVTGMIAGLVALSPAAGYLGPQGAVIVGGAGGLACFFAIPWIRRRLEIDDAMDVF
FT                   PVHAAGALLGVLLTPLVAGGAWGGSGFPGDLGVGQRIGVQLVAIAAAGVWSGTVSYFIL
FT                   KGLNRWPGLRVGPDEETEGLDLSSHNGKGYYF"
FT   gene            complement(256499..256948)
FT                   /locus_tag="MCA0269"
FT   CDS_pept        complement(256499..256948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0269"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to OMNI:NTL02SA0423"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90532"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C42"
FT                   /protein_id="AAU90532.1"
FT                   /translation="MTEQEQKQLGNTLRGIADQLRGAMNADDFRDYMLSFLFLRYLSDN
FT                   YEAAAKKELGTDYPKLAADDRRAPLVVWYEENPTDIAEFEKLMRRREDRDGRSAAQRVS
FT                   PGTGAAVATVGRAGLTGKGHPLDSPDPGARLNQAKYPFFPLTAAQ"
FT   gene            complement(256945..257352)
FT                   /locus_tag="MCA0270"
FT   CDS_pept        complement(256945..257352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0270"
FT                   /product="nucleotidyltransferase domain protein"
FT                   /note="identified by similarity to SP:P43933; match to
FT                   protein family HMM PF01909"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90515"
FT                   /db_xref="GOA:Q60C41"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C41"
FT                   /protein_id="AAU90515.1"
FT                   /translation="MSDDFGLSAEALEIVRGILNTAGDRIERVAVFGSRAAGRYKPNSD
FT                   LDLVLYGSADDAVCDRLWTLFQESRLPFSVDIKSYGDIQHPPLRAHIDQTARTLFVRKD
FT                   TDLTLFRPDTPAALQSLVANEHSADKQETSS"
FT   gene            complement(257349..257768)
FT                   /locus_tag="MCA0271"
FT   CDS_pept        complement(257349..257768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0271"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM TIGR01987"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90514"
FT                   /db_xref="InterPro:IPR010235"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C40"
FT                   /protein_id="AAU90514.1"
FT                   /translation="MTDTTPRWHYRFDNYRRAFSLLREAMEQERPLTQLEKEGVIQRFE
FT                   YTMELAWKTLKDYLESENVVFDQITPRAVIRRAFEAGVIRQGEAWQNALDARNRMSHTY
FT                   NFETFERVIDDIRSSYLAAFDELYEFLLAKRAEGS"
FT   gene            complement(257817..258197)
FT                   /locus_tag="MCA0272"
FT   CDS_pept        complement(257817..258197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0272"
FT                   /product="type I restriction-modification system, S subunit
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90513"
FT                   /db_xref="GOA:Q60C39"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C39"
FT                   /protein_id="AAU90513.1"
FT                   /translation="MAGDMVFADASEDIADIGKAIEIIDAGNVPLVSGLHKILARPNKG
FT                   SMALGFGAYLFSSEGVRKQIQREAQGAKVLGLSATRLGNVKLYYPSRRDEQKKSPTASP
FT                   PSTTSSPPRPRSSTRSRPTRKG"
FT   gene            complement(258264..258413)
FT                   /locus_tag="MCA0273"
FT   CDS_pept        complement(258264..258413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0273"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90512"
FT                   /protein_id="AAU90512.1"
FT                   /translation="MQEKLNLSKAMLSFLKERAGEKFTARQIAEWVFSTYPEECQAKKA
FT                   RSSC"
FT   gene            complement(258432..261440)
FT                   /locus_tag="MCA0274"
FT   CDS_pept        complement(258432..261440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0274"
FT                   /product="putative type I restriction-modification system,
FT                   R subunit"
FT                   /note="identified by similarity to OMNI:NTL01XF02722; match
FT                   to protein family HMM PF00270; match to protein family HMM
FT                   PF04313; match to protein family HMM PF04851"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90511"
FT                   /db_xref="GOA:Q60C37"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C37"
FT                   /protein_id="AAU90511.1"
FT                   /translation="MSTTDTSEKGLEALIVRDLVASGYVQGHAADYNRDVALDVTQLLA
FT                   FLRATQPKVVETLNLGAEGIQRTQFLHRLQGEITKRGVVDCLRRGVSHGPVHVDLYKLL
FT                   PTPGNAAAAEAFGKNIFSVTRQVRYSNDESQRALDMVIFINGLPVLTFELKNSLTKQTV
FT                   ADAIVQYQTDRNPDELLFQLGRCVAHMAVDDAEVRFCTHLTGKTSWFLPFNQGWNSGAG
FT                   NPPNPHGLKTDYLWKQVLVKESLANIIENYAQLVEEEAEDANGRKRKTRKQIFPRYHQL
FT                   RTVRALLRRSQADGVGKRYLIQHSAGSGKSNTIAWLAHQLVELKTAADAGQAQFDSVIV
FT                   ITDRRALDTQIARTIRSYDHVASIYGHSESAEELRTFLRRGKKIIVTTVQKFPFILDEL
FT                   GDLGDKKFALLIDEAHSSQGGKTTAKMHLALSGQAAEGGEDEEEESVEDKVNALIESRK
FT                   MLANASYYAFTATPKTKTLELFGERQVVGDTVQFRSPEELTYTTKQAIQEGFILDVIAN
FT                   YTPVSSFYHIAKTVEHDPEVDKAKALKKIRRYVESHDKAIRRKAEIMVDHFIEQVIGAK
FT                   KIGGKARAMIVCNGIARAIDYFREVSDYLREIKSPYKAIVAYSGDFEVGGVKKTEADLN
FT                   GFPSKDIPAKLRQDPYRFLIVANKFVTGFDEPLLHTMYVDKPLAGVLAVQTLSRLNRAH
FT                   PQKADTFVLDFADNAEAVKAAFQEYYRATIQEGETDPNKLHDLKSDLDAQQVYSWQQVE
FT                   DLVAQYLGGAERDQLDPILDACVAEYVEKLSEDDQVKFKGKAKAFVRSYGFLAAILPYG
FT                   HPAWEKLSIFLNFLIPKLPAPKEEDLSKGVLEAIDMDSYRAQAQASMRMAMDDADAFVE
FT                   PPPPGGSGGSGEPELDRLSNIIKQFNDLFGNIEWHDADKIRKVVTEEIPARVAQDKAYQ
FT                   NAQANSGKQNARLEHDKALNRVVLELLDDHTELFKQFSDNPNFKRWLADMVFDSTYRPG
FT                   QKPSVPPQSGAQA"
FT   gene            complement(261427..262587)
FT                   /locus_tag="MCA0275"
FT   CDS_pept        complement(261427..262587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0275"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90510"
FT                   /db_xref="GOA:Q60C36"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C36"
FT                   /protein_id="AAU90510.1"
FT                   /translation="MTDLDAPFAPDWVSPPGDTIADVLEERGWTQAELARRLGYTEKHV
FT                   SQLINGKAAITEDTASRLERVLGSTAGFWLRKEATYRERLERQQFAQRCAGWVGWLERL
FT                   PIKELMAQGVVAKARLVEKNKPALVEACLRFFGVASPEEWEGVYVADLKAQYRRSRAEQ
FT                   SDLAAIATWLRLGEKQAEGWDALKYDRARFEKALGQIRHLTTQPPQVFEPQMKRLLRDA
FT                   GVTLALVPAIPRAHVSGVARWLSPSRPLIQLSLYGKSNDRFWFTFFHEAAHILLHGTSA
FT                   QGRKAVFLDDPDGGTSTDDCEHEANQWAADFLIPPQYRQRLVKLGSHAAAIRAFAGELS
FT                   IHPGIVVGRLQHEGIVPYASPLNALKVSFRWADPKPDAKGEPDEHD"
FT   gene            complement(262580..262909)
FT                   /locus_tag="MCA0276"
FT   CDS_pept        complement(262580..262909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0276"
FT                   /product="putative killer suppression protein HigA"
FT                   /note="identified by similarity to GP:4098979"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90509"
FT                   /db_xref="GOA:Q60C35"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C35"
FT                   /protein_id="AAU90509.1"
FT                   /translation="MEIRFRDKKVRLLCESQATAVKKLGDACARKLRARLDDLEHAASV
FT                   AELVAGNPHPLTGDRSGEYAVNLAGGWRLTFSPANDPVPRHADGGINWRAVTIVCIEFI
FT                   GDYHD"
FT   gene            complement(263017..264441)
FT                   /locus_tag="MCA0277"
FT   CDS_pept        complement(263017..264441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0277"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:9187842"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90501"
FT                   /db_xref="GOA:Q60C34"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C34"
FT                   /protein_id="AAU90501.1"
FT                   /translation="MAVESTYPNYQPTRSRWVPRVPEHWSLLRAKNFLREIDDRSKTGE
FT                   ETLLSMRMQRGLVPHNDVSVKRIAPENLIGYKKVQPNELVLNRMQAGNAMFFRSRQSGL
FT                   VSPDYAVFRLLRDDNPEYLGHLFRSWPMRGLFRSESKGLGTGTSGFLRLYSDRFASLEI
FT                   PLPPRPEQDQIVAYLRAQDAHIARYILAKRELIKLLTEQKLTIIDHAVTRGLDPNVRLK
FT                   PSGIQWLGEVPEHWEVASIKHIADVRFSGVDKHSNDDETPVRLCNYTDVYKNERITADM
FT                   DLMRATATAAEIARLTLKAGDVILTKDSETPDDIGVPAWVPEDLPGVVCAYHLGLLRPV
FT                   PQRVLGEFLFRSIGSTRTAQQFHVLATGVTRFALGKHDVKNAIIALPPVEEQQAICRWI
FT                   VEECQPLDEAIARAEEEIQLIREYRDRLIADVVTGQIDVRGWRPGPDDVVSDEELAALG
FT                   DDEADLGEDEPGDDGE"
FT   gene            complement(264441..266813)
FT                   /locus_tag="MCA0278"
FT   CDS_pept        complement(264441..266813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0278"
FT                   /product="type I restriction-modification system, M
FT                   subunit"
FT                   /note="identified by similarity to OMNI:NTL03PA02735; match
FT                   to protein family HMM PF02384; match to protein family HMM
FT                   PF02506"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90500"
FT                   /db_xref="GOA:Q60C33"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C33"
FT                   /protein_id="AAU90500.1"
FT                   /translation="MKSGKVQDQSQIKWISDFIWNIADNRLRDVYVRGKYRDVILPFTV
FT                   LRRLDAVLEETKQKVLERKRFLDKNNVAEQDGALRMAAGQAFYNVSEFTLAKLKASSQG
FT                   QRLREDFIAYLDGFSPNVQEILTKFKFRDQIQTLVDAHVLGYLIEDFLDPEINLSPLPV
FT                   KDADGRIKLPALDNHGMGTVFEELIRRFNEENNEEAGEHFTPRDVVRLMAKLMFMPVAD
FT                   QIQSGTYLLYDGACGTGGMLTVAEETLRELAEEQGKEVSIHLFGQEINPETYAICKADL
FT                   LLKGEGDEAEHIVGGADKSTLSNDQFRSREFDFMISNPPYGKSWKTDLDRMGGKKGFND
FT                   PRFIVSHSGDPEFKLITRSSDGQLMFLVNKLQKMKQHSPLGSRIAIVHNGSALFTGDAG
FT                   QGESNIRRWILENDWCEAIIALPLNIFYNTGIATYIWVLTNRKAKHRKGRVQLIDATRW
FT                   FQPLRRNLGKKNCELSEADIQRILDLYLGQPQNTPECKWFDNADFGYWKITVERPLRLK
FT                   SQLTRRAIETLRFASGDEALRAEIWAKYGDKLYAEFSKLKPEIEAWLKGDTGEDDDEPE
FT                   GDEDEGAPAKKAVPEKRRKKLLDVSTWQRDKTLIELALLAQQELGDGVFDDHNDFRARF
FT                   EAAMAKHGKKLAAAEKKAIFKAVSWRDETAPPVIAKRTKLKKDEPFEPGLDGVYLEVAG
FT                   KDRFLVEYEPDADLRDTEQVPLKEPGGIDAFFRREVLPHAPDAWIARDKTQIGYEISFA
FT                   RYFYKPAPLRTLDEIRADILRLEQQTEGLLQKIVGGA"
FT   gene            complement(266810..267079)
FT                   /locus_tag="MCA0279"
FT   CDS_pept        complement(266810..267079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0279"
FT                   /product="DNA binding domain, excisionase family"
FT                   /note="identified by similarity to GP:2764916; match to
FT                   protein family HMM TIGR01764"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90499"
FT                   /db_xref="GOA:Q60C32"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C32"
FT                   /protein_id="AAU90499.1"
FT                   /translation="MPDEEVMKEDAGEIFTLDEVAAYLKVGKRTVYRLAAAKKIPAFKV
FT                   GGTWRFRRQEIDQWITEQTEKGWQGREDYHASPGPVSSEQKKTV"
FT   gene            267166..267378
FT                   /locus_tag="MCA0280"
FT   CDS_pept        267166..267378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0280"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90498"
FT                   /db_xref="GOA:Q60C31"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C31"
FT                   /protein_id="AAU90498.1"
FT                   /translation="MIDPASQAQLKEAIADCIGTDQGVLDALREEIRPLKGATRRIQPR
FT                   ATTSISLVGTDGGNNQLQFDPFLIQ"
FT   mobile_element  complement(267376..268684)
FT                   /mobile_element_type="insertion sequence:IS22"
FT   gene            complement(267415..268290)
FT                   /locus_tag="MCA0281"
FT   CDS_pept        complement(267415..268290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0281"
FT                   /product="ISMca2, transposase, OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90497"
FT                   /db_xref="GOA:Q60AF5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q60AF5"
FT                   /protein_id="AAU90497.1"
FT                   /translation="MKRRYPVSVSCEVLQVSASGYFNWLRRQEDGQGRSDPTQRHSDEA
FT                   LLAHIRAIHAEVKGEYGWPRMHKELVARGIRVGKERVRRLMQQHGIHARNKPKFVVTTD
FT                   SRHSLPVAPDLVQRRFNPEAPHRLWSGDITYIATDEGWLYLAAVIDLFGRQVVGWSLQE
FT                   RMHTALVKDALAMAWWRRRPPPGLIFHSDRGSQYGSHEFQQALRDWGMRSSMSRKGNCW
FT                   DNAPTESFWGRLKTASVHGHQFATREQARQAVLDWVAFYNHRRLHSSLGYLSPMQFEQR
FT                   WYEAQRKNAA"
FT   gene            complement(268287..268649)
FT                   /locus_tag="MCA0282"
FT   CDS_pept        complement(268287..268649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0282"
FT                   /product="ISMca2, transposase, OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90496"
FT                   /db_xref="GOA:Q60C29"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C29"
FT                   /protein_id="AAU90496.1"
FT                   /translation="MLKMSTRTEAMSDKQVRAQYTREFKLEAVRQVRAGQAIAGVAKVL
FT                   GIPKASLGNGVRLAAKGALGGSGGSDKADRVSPEQMEIARLRAEVARLRMERDIAKKAA
FT                   AYFAQDTLRGTPGLTQ"
FT   gene            complement(268869..269183)
FT                   /locus_tag="MCA0283"
FT   CDS_pept        complement(268869..269183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0283"
FT                   /product="putative nitrogen regulatory protein P-II"
FT                   /note="identified by match to protein family HMM PF00543"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90495"
FT                   /db_xref="GOA:Q60C28"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C28"
FT                   /protein_id="AAU90495.1"
FT                   /translation="MKLVTAIVPSRKLDEAREALLETGATGLTISRILGEACERHAPRA
FT                   DDCSFKLEILATERMAGAVVESLIGILGPKAAEDARILVFEPEQAVRIRTQESGEAAVG
FT                   "
FT   gene            complement(269243..270799)
FT                   /locus_tag="MCA0284"
FT   CDS_pept        complement(269243..270799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0284"
FT                   /product="outer membrane efflux family protein"
FT                   /note="identified by match to protein family HMM PF02321;
FT                   match to protein family HMM TIGR01845"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90494"
FT                   /db_xref="GOA:Q60C27"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C27"
FT                   /protein_id="AAU90494.1"
FT                   /translation="MRITLYDSARVLLLRLALAAGLGLLLDGCNKIGPDFHRPEIKLTD
FT                   TWLDAPKKAAKAGDFRNWWKLFNDPVLDRLIEKAYRQNLDVQKAAIRIYQARAQLGIAK
FT                   GYLFPQKQNVGMDTFYERISEYSPYYQGSDFHTFTYFQTGFDAMWELDIWGRFRRGIDA
FT                   AGAELAASTLQYDDMVVTLTAEVAAAYVQIRTFNQRLALAKGNADLQERSFRVAESQFR
FT                   NGLSTELDMQQAKALHQATLAEIANLEVGLRQSKNALSVLLGMQPSHLEKELGPDSDIP
FT                   AARSEIAMGIPTDILRRRPDVRAQEYKAASQCAQIGIAESELLPRLSLVGTVGFNSGSV
FT                   DGLDVANAISPSGLAGKFGPTVIWPIFQYGRLTNNVRVQDAKFQELLTDYRSTVLRALR
FT                   EVEDAIIAFKKAEERVASLSDGVRASQRAAELALRQYQNGLEDYTRVLNSELFLVQQQD
FT                   RLTASRGDVARSVIAMYKALGGGWEIREGRELLPPGVKKEMRERTDWSDLLEEPVGKGI
FT                   D"
FT   gene            complement(270838..273285)
FT                   /locus_tag="MCA0285"
FT   CDS_pept        complement(270838..273285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0285"
FT                   /product="PBS lyase HEAT-like repeat domain protein"
FT                   /note="identified by match to protein family HMM PF02828"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90484"
FT                   /db_xref="GOA:Q60C26"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C26"
FT                   /protein_id="AAU90484.1"
FT                   /translation="MLLTAVAGFLVAISLNLFLYRLMQGRGNTIVRLYRTVLLLLAGLG
FT                   LVAEALGSELNPYLVMLCFTFGLAFLTLETLAAGFWGKIGYGSLTVAHLFLGGYLYTMT
FT                   QVPYGDRPFAALSANQPKPLSDADFREEWIAGLPLGSAAGTSVPTAPTPAGTPPRPADN
FT                   VRISLSWSDVEPLMAHDSHVRDVLIALREKQERDLSEMLASLNQIAVNSTGMRRHAVHR
FT                   DNVENLLHDGAISEARYHTILETWRLTDRDEQAFRSKQAEELFHVMLQLLEDREVDETH
FT                   KVELIDFMVDRFSSDVRLVKPLINLYEALDSEYPRQKRLNHEFLSLYLQKRNAILRGFA
FT                   RIGQPGLQPLLDYRKKTISEIRYSQARLDRFLEQTFGQRVRPLYGPVEPIAVKDFLNRE
FT                   KYPPLGKLSGAAYEQDYLRHSLIRIGLENRVPAAGQPVMGLAAADYAKIVQAFEEGLPD
FT                   AVDAMVIDENPAVRGNLAWYLAERKDPYTLPLIFELMQDSHPEVRRLAAIAVGNFKIID
FT                   MQSANDRKFTEIVRMLVNYRTNADTFARVFALYALATVGDRQKALYVLDLIFNDGATVH
FT                   SVMGQAAPAWKSEEEKAAVQSLIEILGETPEEPYVKTEALKVLLAMESQESVGILLHYL
FT                   NHIYESTHGRPSLLRYVVPHMTLPQEAENVEDVVDYLAARYRANPEHLQQPLKALRAYL
FT                   GSAYGNHRSGEFFQFLKFLAAYDSREYEAYLKQTQEHVLLMRMLEYVKSTYGFWLVFWP
FT                   LSLLILIVVQYGLGLSPRFARADGGGAATRPNRRANPAADIRNRRQAPAAAVVPIKIGS
FT                   GKS"
FT   gene            complement(273318..277352)
FT                   /locus_tag="MCA0286"
FT   CDS_pept        complement(273318..277352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0286"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90483"
FT                   /db_xref="GOA:Q60C25"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C25"
FT                   /protein_id="AAU90483.1"
FT                   /translation="MTGSIVPASRAKPRVLLELMLAPLRFTNALALVIHGLGHALALFA
FT                   VTRDPSAFSATTILEGISFRHLGRSLLPFGPIPQLSSHSPRIPASSCEGWRCRAVAAAG
FT                   TVANLLALAAASRCLESFDGIVAVLGWTCFCVSSILAMLSVPDVLAVVRGSTPYWACGP
FT                   AFAVRCNLQGEENDPLLISDRLREMARILAREASTRGGQSAGFSVLVDKGGAQSVIFDK
FT                   VVKGKRDDIVGVLSGRLDGLLEKAGREGYRRPPDFEAILLHLRYATGGATHWHNAQPHW
FT                   YEYYDSMMHHRVEGQTLVSQPGEVFNMIAHNGDMDGVYLEFTVDGEKRRHFFTQQEARG
FT                   VFLNMMPRTSSRGDSDSRSVAEWVDFIYTQGLSYKALRYAYFTAALDYNRDIAGGNFNL
FT                   DLLLRWAEATDLALLNLRKELGQRALAAPARSLADLSAESRQRLREVLTREVGTALEAD
FT                   VLPGFLATFEEAFCHHDLTWVMRTASRDLVGEFALMVCSTLEPRMGVFSLTQAFSLGHN
FT                   RTRGEIFGSAEPLGVTSALHQGEPDDDALQIYLEDGQYATIEYRAASPSEFIRIYDRAK
FT                   VGDDFLQAPRPSPKALQPGAEQRAAGVRSNWFAVNDNAKISRIHQLPAPGNAVEKDLRE
FT                   IPFVLKRVLDSFEPGGENHATMNHFGELLFQNLLNPNRDPRMHDLVLYGVDFNQDLLNE
FT                   FAIALHSVLPGLRIRAENSGNVLKEMKRTQREGIGCYGPSTVFLGVSNSAQTQSTLAVV
FT                   RKARDLVGAERCFVLSQSFLNSMTEALGQGYQPDDPILPNTFVNLSHLSPDGTSGRRRA
FT                   EAATIVVVATQAVLTEILIHLARKAIEAYSTLSREVLTGQSGDFELRSDLQMSDIKAFR
FT                   EFQAAVYGVDIPNRVGCNAAGERIDSPDTEALNREAAARAENQVEFVRSYAIFAAYIVI
FT                   ATVFGVPVFGLLFSPFDFLAGVGLAAHVLDAALFLTALWLIHLGVRRWQGRPVFERIGA
FT                   RAEVYIDRKYIARIVERYNATLFSNMPAFLTPFFYWADTVRDALHRYGIRAHRGVVTIH
FT                   RLPDERMGIEEANNAAEENMVYAQLGGIRFNGGQPQSRDKVRQGSCYVSASRPYQTVLS
FT                   DSLAGLRAKYDGKLSPEVFRLVNRRLIDLCDGLITEFVIGFRRKEIVNRALWDVIRWIP
FT                   GASLVYEVFLRNGLDLTNLAGEADTANQAQIQSTKHPVSPLDIHTRTMVPRSTFDALRT
FT                   EEQAPDDSFAVLVFSEHHLALHLNRHAMLEQPQGRVQEVILKPGRGSERGRLISETGDA
FT                   AAGEFVGTLDRIDGEPCLVIRNKTADLRMAVLLGSLNPEQRHYLLHHYHLGSPSHLEAA
FT                   A"
FT   gene            complement(277683..278945)
FT                   /locus_tag="MCA0287"
FT   CDS_pept        complement(277683..278945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0287"
FT                   /product="ferredoxin, 4Fe-4S"
FT                   /note="identified by similarity to SP:P13034; match to
FT                   protein family HMM PF00037"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90482"
FT                   /db_xref="GOA:Q60C24"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C24"
FT                   /protein_id="AAU90482.1"
FT                   /translation="MCPSFRVTRDAAHSTHHRAQTLKAALNGEYGPQPFVGPELDAAMD
FT                   LCVGCKGCKRECPNGVDMALLRIEALAQRWKQLGGVPLRERLLAHIPHWAGKLARLNWL
FT                   VRLRARMPLLARLGERWIGIAAKRSLPLSAPMAFLATAPTEPVGNADGREVVLLVDTFS
FT                   NHFEPETAQAALDVLTAAGYRVHVARPLTGERPLCCGRTFLSHGLIEQARTEAGRMVEA
FT                   LRPYAERGLPVLGLEPSCLLMLRDEYYALGLGEAVAAVAKSALLLEEFLAREHDAKRLE
FT                   LPLRPLPQARALVHGHCHQKAFGAMKSMRKVLSLVPELQAELVESSCCGMAGAFGLEAE
FT                   HYEVSMQMAELALLPRIRETDKNTLLIANGVSCRHQIRDGAGREGLHLARVLKAALAGG
FT                   GSGTGKANAQPACPGSFSDRP"
FT   gene            complement(279347..279439)
FT                   /locus_tag="MCA_tRNA-Ser-1"
FT   tRNA            complement(279347..279439)
FT                   /locus_tag="MCA_tRNA-Ser-1"
FT                   /product="tRNA-Ser"
FT   gene            279607..280839
FT                   /locus_tag="MCA0288"
FT   CDS_pept        279607..280839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0288"
FT                   /product="transglycosylase SLT domain protein"
FT                   /note="identified by match to protein family HMM PF01464"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90481"
FT                   /db_xref="GOA:Q60C23"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C23"
FT                   /protein_id="AAU90481.1"
FT                   /translation="MLLVSQLYGCGDPLPEQRKLSHFDRIKAAGELRVLVRDKRFASSR
FT                   PASGTAGFERDLLHGFASHLGVRLRFIPANARPVTERLLRGEADFAAMPSRSVAGEVLP
FT                   TGGPPPFAGVTPVGGWVGALAGGLKGMARNSAQKFNPRMAFAEYSPRRVHTLKWAFPEN
FT                   AGVRGPRALAWMFAEPEGDHLAMMAEHFLRDMCERKGLDPLLDRHFGHNEGADPALDRN
FT                   LRESYGRQLGKYRRTFVEAAARHGLDWRLLAAVAFQESRWDGHAVSAEGVRGMMMLTGA
FT                   TARELGVDRNNPGQSIHGGARYLKAVWSRLPEEIAEPDRTWFALSAYNLGPGRVETARR
FT                   LAKKLGRDPNKWAEVKKTLPLVGAGRSGGRFRHPSARGKLTVQYVNRVRHYYDLLVRLS
FT                   EKKRSGPSGRG"
FT   gene            complement(280836..281249)
FT                   /gene="yfhC"
FT                   /locus_tag="MCA0289"
FT   CDS_pept        complement(280836..281249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfhC"
FT                   /locus_tag="MCA0289"
FT                   /product="zinc-binding domain protein"
FT                   /note="identified by match to protein family HMM PF00383"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90480"
FT                   /db_xref="GOA:Q60C22"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C22"
FT                   /protein_id="AAU90480.1"
FT                   /translation="MLARTAETAGEVPIGAVLVKNGEILGEGHNQPISTHDPTAHAEIV
FT                   ALRAAGARLGNYRLVDTTLYVTLEPCAMCMGAILHARVGRLVFGAADPRRGAAISALRL
FT                   NEAEFMNHRVELLEGVLAEECSQLLRDFFRNRR"
FT   gene            complement(281291..282865)
FT                   /gene="guaA"
FT                   /locus_tag="MCA0290"
FT   CDS_pept        complement(281291..282865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="MCA0290"
FT                   /product="GMP synthase"
FT                   /EC_number="6.3.5.2"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF00958; match to protein
FT                   family HMM TIGR00884; match to protein family HMM
FT                   TIGR00888"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90479"
FT                   /db_xref="GOA:Q60C21"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60C21"
FT                   /protein_id="AAU90479.1"
FT                   /translation="MTDIHAQKILILDFGSQYTQLIARRVRELGVYSEIHPYDCGDDFI
FT                   TEFAPQGIILSGGPESVTGTGTPRAPASVFTLGVPVLGICYGMQTMAAQLGGKVEAVEH
FT                   REFGYAQVRAHGHSQLLNGIEDHTTPEGHGLLDVWMSHGDQVVGLPPGFKLIASTESAP
FT                   IAGMADEERRFYALQFHPEVTHTRQGKRILERFVRKLCQCEARWTTGNIVEDAITRVRN
FT                   RIGAERVVLGLSGGVDSSVVAALLQHAIGEQLTCVFVDTGLLRLNEGDQVMATFAEHMG
FT                   VRVIRVNAEERFLQALQGIADPEDKRKIIGRLFVEIFDEEAAKIEDARWLAQGTIYPDV
FT                   IESAGSKTGKAHVIKSHHNVGGLPETMKLQLVEPLRELFKDEVRQIGLELGLPYEMVYR
FT                   HPFPGPGLGVRILGEVRKEYADLLRRADAIFIEELYRHDLYDKVSQAFAVFLPVKSVGV
FT                   MGDGRRYDYVVALRAVETIDFMTARWAHLPYDFLDLVSRRIINEIPGISRVTYDISGKP
FT                   PATIEWE"
FT   gene            complement(282887..284350)
FT                   /gene="guaB"
FT                   /locus_tag="MCA0291"
FT   CDS_pept        complement(282887..284350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="MCA0291"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="identified by match to protein family HMM PF00478;
FT                   match to protein family HMM PF00571; match to protein
FT                   family HMM TIGR01302"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90478"
FT                   /db_xref="GOA:Q60C20"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C20"
FT                   /protein_id="AAU90478.1"
FT                   /translation="MRIEQEALTFDDVLLVPAYSNVLPRDVSLTTRLTRAIPLNIPLLS
FT                   AAMDTVTEARLAITIAQEGGIGIIHKNMTTERQAAEVRSVKKYESGVIKEPITVPPTAT
FT                   IREVMELTRARNISGVPVVDGGELVGIVTSRDLRFETRYEEPVTRAMTPKERLVTVQEG
FT                   SSKEEAIRLLHQHRIEKVLIVNEAFQLRGMITVKDIQKSKDYPQACKDEFERLRVGAAV
FT                   GTGAGTEERVEALVEAGVDVIVVDTAHGHSQGVLDRVRWVKTHFPQVQVIGGNIATGAA
FT                   ARALAEAGADAVKVGIGPGSICTTRIIAGVGVPQITAVANVAQALAGTGIPVIADGGIR
FT                   YSGDVAKAIAAGAHCVMIGGLFAGTEESPGEVELYQGRSYKAYRGMGSMGAMAQQQGSS
FT                   DRYFQDSTEAEKLVPEGIEGRVPHKGSLVAILHQLVGGVRASMGYTGCRTIEEMREHAR
FT                   FVRVTTAGMRESHVHDVTITKEAPNYRLD"
FT   gene            complement(284463..285371)
FT                   /locus_tag="MCA0292"
FT   CDS_pept        complement(284463..285371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0292"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL02ML5888"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90477"
FT                   /db_xref="GOA:Q60C19"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C19"
FT                   /protein_id="AAU90477.1"
FT                   /translation="MWDFNLLSATRTLEKSMAFVLHRWLIYLGVGLAYIFGAIIGAGTT
FT                   IGIGSLSSNPTAFAGTGAWIGMGVVGWILYKFRNGFLTGVQARNAALLGAEALREPVPK
FT                   GKAQIDYARRRVAERLPPPPALSPLIAAIRSVASALPGWKEPAPQTLPQRWLLQAKGLL
FT                   VTTETLTLLGYHFAQPANSFARSARDGLLLLAAHLPTILRNRLYLSGFGWLGCFAAFPV
FT                   LLAAIQGILAGLPLDPGIWPYVFAFLLAWTIKAAFLDAIAMAAMLDLFLKLPAPENGSE
FT                   LSDALARDFPAFAGICAQTDI"
FT   gene            complement(285423..287555)
FT                   /locus_tag="MCA0293"
FT   CDS_pept        complement(285423..287555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0293"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL03PA04929; match
FT                   to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90468"
FT                   /db_xref="GOA:Q60C18"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013704"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR022946"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR024560"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C18"
FT                   /protein_id="AAU90468.1"
FT                   /translation="MQQARDIFSYRKFWASRFGIAPQLPLSRADMEQLGWDACDIVLVT
FT                   GDAYVDHPSFGMALIGRLLEAQGFRVAILAQPDWHSAEPFKEFGRPNLFFGVTGGNMDS
FT                   MVNRYTSDRRIRSNDAYTPDGAADRRPDRCVLVYAQRCREAYKDVPIVLGGIEASLRRT
FT                   AHYDYWSDKVRRSVLVDAKADLLVYGNGERQVVEIAHRLAGGEPVSALTDIRGTAYLRR
FT                   TPAAGWREIDSTQIDRLGAISAVPDPYRESPAGCAPPAPEPRALVHFTPPARGRSNTVI
FT                   RLPAFEAVHDDPVLYAHASRVLHQETNPHNARALVQRHGAIDVWLNPPALPLTTREMDR
FT                   VYGLPYSRLPHRSYGDARIPAFEMIQHSVTIMRGCFGGCTFCSITEHEGRIIQSRSEES
FT                   ILREIEVIRDTSPAFTGVISDLGGPTANMYRLACKSRAIEASCRRPSCVYPGICKNLGT
FT                   DHGPLIRLYRRARQLPGIKKILIGSGLRYDLAVRSPEYVKELVTHHVGGYLKIAPEHTE
FT                   PGPLSKMMKPGIGTYDRFKAMFDQYSREAGKEQYLIPYFIAAHPGTTDEDMLNLALWLK
FT                   KNGFRADQVQAFLPSPMAVATAMYHSRKNPLHRVSRTSETVETPRKLTQRRLHKAFLRY
FT                   HDPENWPLLREALKRMGRTDLIGNGKHHLIPAWQPQKPGTAETVTHHGTRPFRTRHAVL
FT                   PLRARKPAGRKLKKGR"
FT   gene            complement(287634..288080)
FT                   /locus_tag="MCA0294"
FT   CDS_pept        complement(287634..288080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0294"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90467"
FT                   /db_xref="GOA:Q60C17"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C17"
FT                   /protein_id="AAU90467.1"
FT                   /translation="MALFVPVSPPPPSGGIGHPPILVCITTDSLLRSRFDALRRSPARL
FT                   HANTRRRLSMPPDNRTGMEKQEKKRAALRWGKTAIGGRWGLVAWGISGASAMAVAVWGL
FT                   QTVAIPLIMLKTASWGIWGFGVFRESRAHLKQAGHDGKSVPPRD"
FT   gene            complement(288174..288935)
FT                   /gene="pmoC3"
FT                   /locus_tag="MCA0295"
FT   CDS_pept        complement(288174..288935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmoC3"
FT                   /locus_tag="MCA0295"
FT                   /product="methane monooxygenase, C subunit"
FT                   /EC_number="1.14.13.25"
FT                   /note="identified by similarity to GP:14456716; match to
FT                   protein family HMM PF04896"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90466"
FT                   /db_xref="GOA:Q60C16"
FT                   /db_xref="InterPro:IPR006980"
FT                   /db_xref="InterPro:IPR023349"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C16"
FT                   /protein_id="AAU90466.1"
FT                   /translation="MATTTAGGIAAIDRPLLDKKWLVFAIGIYTVFYLWVRWYEGVYGW
FT                   SAGLDSFAPEFETYWMNFLYTEIVLEIVTASILWGYLWKTRDRNLAALTPREELRRNFT
FT                   HLVWLVAYAWAIYWGASYFTEQDGTWHQTIVRDTDFTPSHIIEFYLSYPIYIITGFAAF
FT                   IYAKTRLPFFAKGISLPYLVLVVGPFMILPNVGLNEWGHTFWFMEELFVAPLHYGFVIF
FT                   GWLALAVMGTLTQTFYSFSHLFERDLCPDIR"
FT   gene            289074..291248
FT                   /gene="glgX"
FT                   /locus_tag="MCA0296"
FT   CDS_pept        289074..291248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgX"
FT                   /locus_tag="MCA0296"
FT                   /product="glycogen debranching enzyme GlgX"
FT                   /EC_number="3.2.1.-"
FT                   /note="identified by match to protein family HMM PF00128;
FT                   match to protein family HMM PF02922; match to protein
FT                   family HMM TIGR02100"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90465"
FT                   /db_xref="GOA:Q60C15"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C15"
FT                   /protein_id="AAU90465.1"
FT                   /translation="MRKVDDTLPARRVFLGVLRIGPGRGPAAMTVPAKFDYSTGSPLPL
FT                   GVHFQGTDANFALFSRHGSRVRLLLFADPSHTRPHQVIDLDPHHHRTGDIWHVAVHGAH
FT                   RGLAYAFQVDGPHEPHLGHRFDPQAVLLDPYATALVTPEHWEFSGAAVGGPEGVVAKAL
FT                   VTADHFDWGHDRPLKHHWSELVIYEAHVRGLSIHPSSAVRHPGTYLGVIDKIPYFKRLG
FT                   ITALELMPLQAFNPYEVTRYNPVTGERLRNYWGYNTIAFQAPHAGYGTGAYPGCQVEEF
FT                   KRMVKALHEADIEVLLDVVFNHTAEGDETGPILNFRGLDNSIYYLLEEDRRHYRNYSGC
FT                   GNTVNCNHPVVRSYILDCLRYWVVEMHVDGFRFDLASILGRDRNGHLVPNPPLLELIAE
FT                   DPILRDVKLIAEAWDAGGAYLVGRFPGERWCEWNGVYRDDVRRYWRGDPGMAGAFASRL
FT                   CGSADIYEHSGKAPVNSINFVTCHDGFTLNDLVSYACKHNSANGEDNRDGSDHNFSANY
FT                   GCEGPTGDHGINAVRRRQMKNLMASLLLSRGVPMILGGDEFCRTQRGNNNAYCQDNEIS
FT                   WFDWRLLDENRSFFEFVRKMIAFRARHPVLSREQFYRPEDILWFSPAGGQPDWQADAAL
FT                   GCCIRAVGGEEQPLCLLFNPTAEGLCFRLPDTLRGGVWIKAVDTAVESPCDICELEGGS
FT                   PLPDQRRLFLPDRSLVVLVEGAATAAAARA"
FT   gene            complement(291249..292061)
FT                   /locus_tag="MCA0297"
FT   CDS_pept        complement(291249..292061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0297"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01SMB00167"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90464"
FT                   /db_xref="GOA:Q60C14"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR014880"
FT                   /db_xref="InterPro:IPR030831"
FT                   /db_xref="InterPro:IPR032711"
FT                   /db_xref="InterPro:IPR038162"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C14"
FT                   /protein_id="AAU90464.1"
FT                   /translation="MQTGILPRIWLLVTGIALSTLVQATDPQDEGAWTGALRAQYFGDR
FT                   PIEEGNGVIELTAPYRAEDPALVPIQITGKIPQTAEKYIRRITLIIDNNPVPFAASFDL
FT                   TPASGKADLAMRVRVNSYTHVRAIAETSDGKLYMSKAFVKASGGCSAPLGADLDAAMAR
FT                   LGKMKFRMDGDKAVLGQPNAVQLLVSHPNITGLQMDQISRLIKPAHYVEEVKVSFDGTP
FT                   VLTARTDIAISADPNFRFYFVPDKAGELKAEIRDNLGKTFTASQTVTD"
FT   gene            complement(292103..293152)
FT                   /locus_tag="MCA0298"
FT   CDS_pept        complement(292103..293152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0298"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="identified by similarity to OMNI:NTL01SMB00168;
FT                   match to protein family HMM PF00753; match to protein
FT                   family HMM PF02184"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90463"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR030829"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C13"
FT                   /protein_id="AAU90463.1"
FT                   /translation="MRVNSPRPTRQGTVEDHGAERDNARTSFPGIVHSCRGHPVPPRFI
FT                   RTVGWALCGLWWGLAAAQSDLELREIAPGIFVHQGRHELPDTHNRGEIANIGFIVGERC
FT                   VAVIDSGGSPEQGRALKAAIAVHTPLPVCYVINTHVHPDHIYGNRAFKAPGVSFIGHHK
FT                   LAQAMALRAPYYIDKAARDLGYTLTAEDFVPPDQPVEESMELDLGNRTLRLTAHGPAHT
FT                   DNDLSVYDAKTATLWAADLLFMGHLPVVDGSLTGWLKEIDRLKAVPARLAIPGHGPAVA
FT                   DWPQAAAAEERYLNGLATEVRAAIRQHRTMEQAMETVGTSMRDEWRLFDEFNKRNVSTA
FT                   FAALEWEDD"
FT   gene            293402..295261
FT                   /locus_tag="MCA0299"
FT   CDS_pept        293402..295261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0299"
FT                   /product="putative methanol dehydrogenase protein, large
FT                   subunit"
FT                   /note="identified by similarity to SP:P15279; match to
FT                   protein family HMM PF01011"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90462"
FT                   /db_xref="GOA:Q60C12"
FT                   /db_xref="InterPro:IPR001479"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017512"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C12"
FT                   /protein_id="AAU90462.1"
FT                   /translation="MKKPVKSWLIASSIASLLAVPGVSFANAEVEALTKDPKNFATWGG
FT                   NYAGTRYSTLDQINFKNAKHLQPVWTFSTGMLRGHEGGPLVVNDVIYIHTGYPHKVYAL
FT                   DQATQSVIWEYVYAPDKGTDQSQVISVMCCDVVNRGLAYGDGKIFLAQGDATLVALDAK
FT                   TGKIVWKVKNGDPKTGMTATNAPLVVKDKVLTGISGGEFGVRGFLAAYNIKDGSLVWKK
FT                   YSMGPDDEVGLDPEHTMTWTDGKMAPVGKDSSLKTWQGDQWKIGGGTTWGWYSYDPDLN
FT                   LVYYGSGNPSTWNPVQRPGDNKWSMTIWARDVDTGEAKWVYQMTPHDEWDYDGINEMML
FT                   IDQEMTAKDGSKHSKLLTHFDRNGFGYTLDRVTGELLVAEKFDKAVNWATHVDMKTGRP
FT                   QVNPKYSTQHGGQDVDTKGICPSAMGAKNEPPVTYSPRTKLIYIPGNHTCMNYEPFEVE
FT                   YTAGQPYVGATLNIFPARANVKTGEKESSNHMGSFTAWDPTTGTIAWQFDEPFSLWSGM
FT                   VSTAGDIVIYGTLEGYLKVRDAKTGEELYRFKTPSGIIGNVSTWTYNGKQYIGVLSGIG
FT                   GWAGVGMAAGLEGDTEGLGAVGAYKGLSSHTKLGGVFTVFALP"
FT   gene            295433..296287
FT                   /locus_tag="MCA0300"
FT   CDS_pept        295433..296287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0300"
FT                   /product="MxaJ protein"
FT                   /note="identified by similarity to GP:1657793"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90454"
FT                   /db_xref="GOA:Q60C11"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR022448"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C11"
FT                   /protein_id="AAU90454.1"
FT                   /translation="MMKKTGLISAGIAWLLTAGTAQAASDAFKVCADPNNPPYSDQKGG
FT                   GFENKIAELFAGELDKKLVYTWFPQRMGFIRNTLKAKEPESEDYKCDVVMGLPTGFDQA
FT                   ATTKPYYRSTYALVYVKKKGWDDVHSAAALDTLPPERKAKLRIAMFDGSPATTWMLKHN
FT                   LVEQGVPYQSMTADAAVNTTQTVEKELLAGNIDMAIVWGPMAGYLVYHNKPGTFALIPM
FT                   QSEEGVRFDYAMSMGVRIPDKARKEQLEALIDKKAPEIEALLRKYHVPLLDKDGKLLTP
FT                   AEE"
FT   gene            complement(296343..297833)
FT                   /gene="lysS"
FT                   /locus_tag="MCA0301"
FT   CDS_pept        complement(296343..297833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="MCA0301"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="identified by similarity to SP:P14825; match to
FT                   protein family HMM PF00152; match to protein family HMM
FT                   PF01336; match to protein family HMM TIGR00499"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90453"
FT                   /db_xref="GOA:Q60C10"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C10"
FT                   /protein_id="AAU90453.1"
FT                   /translation="MSELQDENKLVALRREKLGKLRQTGVAFPNDFRRDALAAELRARY
FT                   GDETAEALEETAVSVKLAGRLMGKRIMGKASFAHIQDMSGRIQIFLQRDGLAEGVYEEF
FT                   KSWDIGDVIGVEGTVFRTKTGELSVKASNIRLLTKSLRPLPEKFHGLTDAETRYRQRYL
FT                   DLLMNEESRRVFQLRSAIVRYIRDFLSERGFIEAETPMMQVIPGGARAKPFVTHHNALG
FT                   LDLYLRIAPELYLKRLVVGGFEKVFEINRSFRNEGLSTRHNPEFTMIEFYQAYADYRDL
FT                   MDLTETLMRGIAQNLLGGTVVTHQGKDYDLGRPFRRMTVLESIIHYNPDIRAEDLAERE
FT                   SAAAIAAGLGIPVAAGDGLGKIQTEIFEKTVEDRLDEPTFITAYPAEVSPLARRNDENP
FT                   FITDRFEFFVGGRELANGFSELNDPEDQAERFRKQVEDKAAGDEEAMHYDADYIRALEY
FT                   GLPPTAGEGIGIDRLVMFFTDSPSIRDVILFPHMRPES"
FT   gene            complement(297838..298936)
FT                   /gene="prfB"
FT                   /locus_tag="MCA0302"
FT   CDS_pept        complement(join(297838..298860,298862..298936))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /gene="prfB"
FT                   /locus_tag="MCA0302"
FT                   /product="peptide chain release factor 2, programmed
FT                   frameshift"
FT                   /note="identified by similarity to SP:P07012; match to
FT                   protein family HMM PF00472; match to protein family HMM
FT                   PF03462; match to protein family HMM TIGR00020"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90452"
FT                   /db_xref="GOA:Q60C09"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C09"
FT                   /protein_id="AAU90452.1"
FT                   /translation="MRELNPLYNQIKDLKSRQDALRGYLDFDTKQERLTEVLRELEDPR
FT                   IWDNPERAQALGKERTQLEGVVNRLNEIAAGIDDAAELLQLAVEEDDEDSVESVAADLA
FT                   HYESVVAEMEFRRMFSGEMDPNNAFLDIQAGSGGTEAQDWAQMLERMYLRWGERKGFKT
FT                   ELVEESPGEVAGIKSATIRFEGEYAYGWLRTETGVHRLVRKSPFDSGNRRHTSFSSVFV
FT                   SPEIDDNIDIDINPADLRTDVYRASGAGGQHVNRTESAVRITHLPTGIVVQCQNQRSQH
FT                   ANRDWCMKQLRAKLYELEMQKRNTEKQKLEDSKSDIGWGSQIRSYVLDQSRIKDLRTNV
FT                   ETGNPQAVLDGDLDMFIEASLKSGL"
FT   gene            complement(299025..299537)
FT                   /locus_tag="MCA0303"
FT   CDS_pept        complement(299025..299537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0303"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF05229"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90451"
FT                   /db_xref="GOA:Q60C08"
FT                   /db_xref="InterPro:IPR007893"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C08"
FT                   /protein_id="AAU90451.1"
FT                   /translation="MKHDIRASRQWRAAAMTFSLLACPKISDADPYQCDIGNISVPHAV
FT                   YDPTDSNPNSSGVGTVGITCHLKNAKQTQQVQYTIALSRGSSGSYNPRRMSGGRGSLGY
FT                   NLYLDAARVTIWGDGSGGTFPLRGTLLLNPTTPVQQVIHNIYGLIPPLQDVYAGTYTDT
FT                   VTITLTY"
FT   gene            complement(299534..301900)
FT                   /locus_tag="MCA0304"
FT   CDS_pept        complement(299534..301900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0304"
FT                   /product="fimbrial biogenesis protein"
FT                   /note="identified by similarity to SP:P30130; match to
FT                   protein family HMM PF00577"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90450"
FT                   /db_xref="GOA:Q60C07"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C07"
FT                   /protein_id="AAU90450.1"
FT                   /translation="MPIAGRSREEAELQYAASDSLSVTAVVRPPSPGGTAQPPEDREEH
FT                   LLAVELNGETVSEGTLVLRGQDGSLYVPEEAIESWRMELPAANTLAHDGRDYRALANPG
FT                   IIEARIDDTRQTLVLRVEPSLLAGTVVEAGTRLAQPKAERASFAGFLNYDFNIMHSRQG
FT                   DFQGGALELGISNRYGLATSAFLARHSSGQGGSETQFTRLYTTWIMDDPANMASLQLGD
FT                   NIVRPWQRGYQARFAGIQYATNFGLQPRFYRYPQPAVTGSLTEASSLDIFLNGALVDQQ
FT                   NLPAGPFQIRDLPAANGSGEIRVVARDLLGREQVITQPFYVGSSMLREGLVDFSYEAGF
FT                   LRRYYGTDSMSYGAPFGSATYRRGLNSWLTGELHGQVVRDQVAVATGGSFLIGTYGVVD
FT                   AAAGISAGRGWGGLGGLGFLHQGETLSYGASSYFASQAFTQLGIEQGQFAPKQLSDAFC
FT                   GFTLTSGSSVSLRYGSANYFDRPHVDTYVANYTQNLWGGLTLSLAAVYTRSDFEGAQVA
FT                   AIFTLPLGERTYATANARATRTQGGPTQLEFDAQYTHTPGWGPGWGYRLDAGTNDRQAA
FT                   QLTAQTAFGLFSAEVAHLQGDFAERAFGSGGIGLIEGHPFLSRQIQDGFAIAKVGDYKD
FT                   VRVYADNQLIGRTDEEGYVVLPRLRAYDVNNVQVEGEDLPMDAQVGTLALPVTPYFRSG
FT                   VVVDFPIRRSRGATLTILLEDGQPIPAGATVTVEGVADVFPVGMDGEVYLTGLSPRNEM
FT                   KVEWNGKRCTIVADYPESAEILPDLGKFVCAGVHR"
FT   gene            complement(301941..302672)
FT                   /locus_tag="MCA0305"
FT   CDS_pept        complement(301941..302672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0305"
FT                   /product="putative chaperone protein pmfD"
FT                   /note="identified by similarity to SP:P53520"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90449"
FT                   /db_xref="GOA:Q60C06"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C06"
FT                   /protein_id="AAU90449.1"
FT                   /translation="MNLFAWAAGRHLPILAALLLLPFRLGAGQFDVSPTRIELTAAKPT
FT                   AAVTLKNESGDKLVIQNSIVSWTREGKEDRYAPTKDLIVTPPITTVPPGGSQVLRVGLR
FT                   RPVDPRRELAYRLFVQEVPPPPQTGFTGVQIALRLSLPLLVQPATPASPRIAWSGTKRP
FT                   DGGLEITARNEGSALLSVDELSIRATAGKPQGQGPVSIFPGGRQSWVFPGEVLGSESGT
FT                   AHVRASTSAGVIEGDVDVEGP"
FT   gene            complement(302701..303246)
FT                   /locus_tag="MCA0306"
FT   CDS_pept        complement(302701..303246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0306"
FT                   /product="putative spore coat protein, late developmental"
FT                   /note="identified by similarity to SP:P27755; match to
FT                   protein family HMM PF05229"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90448"
FT                   /db_xref="GOA:Q60C05"
FT                   /db_xref="InterPro:IPR007893"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C05"
FT                   /protein_id="AAU90448.1"
FT                   /translation="MNALVSKHRISRRTAGFVGLTAAIVLVADAGTAMAAGTETASLGI
FT                   SATVANTCKIESTSNVNFTTYDPTSTTDTATNSGQIRVKCTKGSTSTIYMGAGTASGAT
FT                   CSGTPIRKMANGADLLTYNLYQNNGYTTVWGCDSSNQYSYTASNNGWQNLTVYGVIPAG
FT                   QDVPAGSYTDTVTVTVNF"
FT   mobile_element  303400..304741
FT                   /mobile_element_type="insertion sequence:IS01"
FT   gene            303488..304588
FT                   /locus_tag="MCA0307"
FT   CDS_pept        303488..304588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0307"
FT                   /product="ISMca1, transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90447"
FT                   /db_xref="GOA:Q60CL0"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:Q60CL0"
FT                   /protein_id="AAU90447.1"
FT                   /translation="MRGTQNFQGAMFSYISLEERVPARHPLRKLRALVDALLASMSAEF
FT                   EAVYARRGRPSVPPEMLLKALLLQILFSIRSERLLVEAIDYNLLYRWFVGLNLEDKVWD
FT                   HSTFSANRQRLFNEDLARVFFERVKYTADWAKLIGDEHFSVDGTLIEAWASQKSFKRKD
FT                   ASGSDDGAPPQGRNPEVDFKGETRRNDTHASTTDADARLFKKAAGDKSRLCHMGHILMD
FT                   NRHGLVVDVEITHASGTAERQAALKMLQRQKRKAGRLTVGADKGYDCRAFVQGCRKLGI
FT                   TPHVAAKAKHSAIDGRTQRHEGYKVSLRVRKRIEEAFGWIKTVGGLAKTKLIGHAKLAG
FT                   QALMCFAAYNLVRMGSLGGWWDAHHA"
FT   gene            305275..305991
FT                   /locus_tag="MCA0309"
FT   CDS_pept        305275..305991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0309"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:9950618; match to
FT                   protein family HMM PF01243"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90438"
FT                   /db_xref="GOA:Q60C03"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C03"
FT                   /protein_id="AAU90438.1"
FT                   /translation="MVESDEIGTEARALLNQAYDGVLSTHSADVPGYPFGSVMPYCLDR
FT                   EGVPVIYIANIAQHTRNIQANPKVSLIVLDRSVGDVQTNGRLTLLADAQPVSEDDEDAV
FT                   GRYFSFFPDARRFHRTHSFAFYRLVPVRLRYIGGFGRIHWLSPERVLRPNPFRTEEERA
FT                   MLEHMNTDHRQALRRYCEVAGVAVDTGCEPAMVGIDREGFQLRVGSRVIRFVFPSPVST
FT                   PAEVRAALVAMARLGQ"
FT   gene            complement(305998..306705)
FT                   /locus_tag="MCA0310"
FT   CDS_pept        complement(305998..306705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0310"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to OMNI:NTL01AT1832"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90437"
FT                   /db_xref="GOA:Q60C02"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR011969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C02"
FT                   /protein_id="AAU90437.1"
FT                   /translation="MIAGTACPQAAKPFLLACMTVGLWPAAAEAAGLADQLQGLATESG
FT                   FAIEGLERLSDEPARRAEGSVKDRLQTLLQGYNYVLAESRPGNIERLVITGIARSGGRP
FT                   PPSSTIPTLRVGAHHQVEALLVGPNGVPQTVSVLVDTGASTVVLPTSMITSLGFDAATL
FT                   SAGVSQTASGRVHTKTGVLPSVTVGPASAENVAVSFIADKRLNGAMLLGMSFLNRFRVT
FT                   IDDEHNEIVLLAK"
FT   gene            complement(306856..307128)
FT                   /locus_tag="MCA0311"
FT   CDS_pept        complement(306856..307128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0311"
FT                   /product="putative lipoprotein"
FT                   /note="identified by similarity to OMNI:NTL03PA05109"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90436"
FT                   /db_xref="GOA:Q60C01"
FT                   /db_xref="InterPro:IPR024418"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C01"
FT                   /protein_id="AAU90436.1"
FT                   /translation="MKQRLRGMTRTLLPAAIGLILAACENKVTRENYDKLAIGMEYSKV
FT                   VELLGEPENCQSVVSVKSCVWGKTPKTISVQFVGEKILFYSNTGL"
FT   gene            307286..307984
FT                   /locus_tag="MCA0312"
FT   CDS_pept        307286..307984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0312"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL03PA04496; match
FT                   to protein family HMM PF04402"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90435"
FT                   /db_xref="GOA:Q60C00"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:Q60C00"
FT                   /protein_id="AAU90435.1"
FT                   /translation="MNARIRMSGFLLAMAALSAVQADEQTPLTYDRIDLASEARGDVEN
FT                   DILVAVLSSEMDGPKAAALAAEVNKTIAKAVERIKQQSEIKVQTAGYQTSPIYQKERIG
FT                   GWRVKQSIRLESTDAAKLGGLLGELQQQLHLESIDYETSPQRRKEAENGLIKEALGAFR
FT                   QRAELLTRELGRSRYRIVALRVDTGGVPVRPMAPGIRAMAAEAAAPVPIEAGTQRIEVN
FT                   VSGTIELQAD"
FT   gene            308027..309016
FT                   /locus_tag="MCA0313"
FT   CDS_pept        308027..309016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0313"
FT                   /product="putative hflK protein"
FT                   /note="identified by similarity to SP:P25662; match to
FT                   protein family HMM PF01145; match to protein family HMM
FT                   TIGR01933"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90434"
FT                   /db_xref="GOA:Q60BZ9"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BZ9"
FT                   /protein_id="AAU90434.1"
FT                   /translation="MENSNSPWGRIARPLPGSLPASPARIVLIVLALMGLWTAYYTIPA
FT                   ESEGVVLRFGKYIHKVPPGLHFKLPYGIDGVIAVPTQRQLKLEFGFFSPGATNPDQAGL
FT                   EPGKERSMVTGDLNAALVEWIVQYRITEPQDYLFAVRDPGQTLRDISESVMRAVVGDRT
FT                   VDEIITIGRQEIEDTSLQRMRALAELYHLGVFISQVQLKNVNPPEPVQPSFNEVNRAQQ
FT                   DRENAINLANGDYNKAVPRARGEADQQIRAAEGYRFKRINEAEGDVAAFSAVLEQYVKA
FT                   PEVTRMRLYLETMGEVLPQAKQSIVVDDTVQQILPMLPLSTAMPEEKR"
FT   gene            309013..309975
FT                   /locus_tag="MCA0314"
FT   CDS_pept        309013..309975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0314"
FT                   /product="putative hflC protein"
FT                   /note="identified by similarity to SP:P25661; match to
FT                   protein family HMM PF01145; match to protein family HMM
FT                   TIGR01932"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90433"
FT                   /db_xref="GOA:Q60BZ8"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BZ8"
FT                   /protein_id="AAU90433.1"
FT                   /translation="MIAARHRVSLVAALVLLALYLSAYTVDQTEQVIVTQFGRPVGEPI
FT                   TEPGLHFKLPFVQQVNRFDKRYLAWDGPMVEMSTKDKTYLQVDTFARWRITDAMRYYLR
FT                   LRDERSAQSRLEDILGSETRTAIARHELIEVVRSDKERQPLRDEGLAAQLPEGGLRPIR
FT                   VGRQQIEKDVFESAAPKLAEFGIELLDVRFKRLNYNPEVLERIHQRMISERLQIAQRFR
FT                   SEGEGEAARIAGNKERDINEIASTAYKRVQEIVGEADARATEIYAKAYTQSPEAAEFYR
FT                   FLKSMETYRRIIDRDATLVLSTRSDLFSLLKRIETERKP"
FT   gene            complement(310065..310457)
FT                   /locus_tag="MCA0315"
FT   CDS_pept        complement(310065..310457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0315"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90432"
FT                   /db_xref="GOA:Q60BZ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BZ7"
FT                   /protein_id="AAU90432.1"
FT                   /translation="MNNVVTNTLKLGLFLAMTFGTAARADDFDQLKATTPSERAAAQTE
FT                   YMKNHLGLTDAQMPKIAAINQKYAEQMEPVIKGADGGLGKMLKAQAIQENKDAELRQIL
FT                   TPDQFERFASSKDEMREAVKRVLRKE"
FT   gene            310664..311194
FT                   /locus_tag="MCA0316"
FT   CDS_pept        310664..311194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0316"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90431"
FT                   /db_xref="GOA:Q60BZ6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BZ6"
FT                   /protein_id="AAU90431.1"
FT                   /translation="MEQGYHGTGLQDILHSVGVPKGSFYNYFTSKEEFGAEVIRHYIEP
FT                   FILQLDGHLRNSALNGAQALQAYFHTLIGEAARRQFKGGCLLGNLMGEIGDTSDTCREA
FT                   LREALHRYRDKLAQGIARAQSEGAFRRDRTAEDLADCLVDAWQGALLRMKVEQSVRPLE
FT                   ECCRNLLEGYFRA"
FT   gene            311255..312634
FT                   /locus_tag="MCA0317"
FT   CDS_pept        311255..312634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0317"
FT                   /product="selenium-binding family protein"
FT                   /note="identified by similarity to SP:Q63836"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90430"
FT                   /db_xref="GOA:Q60BZ5"
FT                   /db_xref="InterPro:IPR008826"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BZ5"
FT                   /protein_id="AAU90430.1"
FT                   /translation="MKRFIVSGPSMHFALRALVSGLALALAAPAGVRADETCASPYMKK
FT                   ITGQEDYVYVWTLGAEGVGDEQDKLVTVDANPKSPQYGKVVNTLSVGGRNEAHHSDFTD
FT                   DRRYLWAGGLDTSKIFVFDVHSDPARPVLSKTITDFVEKSGGVVGPHTLYALPGRMLIT
FT                   GLSNNKDHGGRTALVEYTNAGEYVATHWIPTDGDLRGAIKTGKYADGYDYDVRALPRKN
FT                   LLVTSSFTGWNNYMMDFGKMLADPEAMKHFGNTVVTWDLHTKQPKKVFDVPGAPLEIRC
FT                   AWGEAHNYCFTSTALTSQLWLIYEDGEGEWQAKAVADIGEPAKVPLPVDISISNDDSRL
FT                   WVNTFMDGKTRLFDISDPHHPRQVYEKTIGAQVNMVSSSWDGQRLYYTSSLLANWDKKG
FT                   KDDEQFLKLYYWDGKELKEQFAIDFYAEKLGRPHQMRFGARALYAGPAGDGNRLVQARV
FT                   E"
FT   gene            312660..314540
FT                   /locus_tag="MCA0318"
FT   CDS_pept        312660..314540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0318"
FT                   /product="putative SCO1/SenC family protein/methylamine
FT                   utilization protein MauG"
FT                   /note="identified by similarity to SP:Q49128; match to
FT                   protein family HMM PF03150"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90421"
FT                   /db_xref="GOA:Q60BZ4"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BZ4"
FT                   /protein_id="AAU90421.1"
FT                   /translation="MNLVPLPCRLLACLLPALLSAAPVLAGGLAPGYRNLPFSAPEPGS
FT                   YELPVLGTAADGVVLDSDGRPLRLHALYDGRIVLLGFIYSTCDDVNGCPLATVVFQKLR
FT                   NALKSEPEPAGRLRLLTLSFDPEHDTPEAMRRYGEGFRDGGVDWHFLTTRSEAELQPIL
FT                   EAYGQSVQKEYDAAGRSTGKYSHLLRVFLIDGQKRIRNVYTVSVLHPDLVLADVKTLLQ
FT                   EVPVPVGGQAASPPLRAGDDKTGYASPAYETHALALDARRGRPADLFQRAQRPVLGLPK
FT                   LPVPADDPLTPAKIALGRKLFYDRRLSLNQTFSCAMCHIPEQGFTSQEQATATGIEGRT
FT                   VRRNAPTLYNVAYLTKLFHDGRESSLENQVWGPFLAANEMGNPSVGFVLDRIESLPDYR
FT                   GLFEQAFGRGPGMETVGQALACYERVLVSGDSPFDRWRYGHESGALSEAARKGFELFTG
FT                   KAGCAACHTVGDRHALFTDDALHNTGVGYRASMDKTPAARRVQVAPGVSFEVDAKTFAQ
FT                   VAEPVPGDLGRYEITQNPADRWKYRTPTLRNVALTAPYMHNGVFASLREVVEFYNRGGE
FT                   PNENLDPLIRPLGLSAQEVDALVEFLSSLTGGDNQTLVSDAFAAPVGNGR"
FT   gene            complement(314929..316158)
FT                   /locus_tag="MCA0320"
FT   CDS_pept        complement(314929..316158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0320"
FT                   /product="putative ampG protein"
FT                   /note="identified by similarity to SP:P36670; match to
FT                   protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90420"
FT                   /db_xref="GOA:Q60BZ3"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BZ3"
FT                   /protein_id="AAU90420.1"
FT                   /translation="MTSPSEPIARRILSGRMLAAFAMGFYGGAPLLLTGSVLLAWMEER
FT                   GIDLTTIGLFALVGLPYTLKFLWAPVFDRFHWPRLGRRRGWLLLTQLLLAVSIGSLAVY
FT                   GPGASALVLAGLALAVAFFSASQDTLIDAYRRESLHDREQGLGASLYVNGYRLGMLLAS
FT                   GGGLILADWIGFSDMYGLMAALMATGMLVTLLLPEAAAGEAHPNSLKDAVVLPFVEFFR
FT                   RSEAVWILLFILLYKLGDTVAGQMTTPFYLEMGFSKTEIGAVVKLFGFWATVLGGLAGG
FT                   ALILRYGIYRTLWQFGLLQLLSTAAFAVLVHTGPQLPALTAVISFENLSAGMGTAAFVA
FT                   FMANQTDRRFTATQYALLSSLMGVPRVIAAAPSGWLATTVGWQNFFILCALFAIPGLLV
FT                   LPRFRTWLAD"
FT   gene            complement(316142..316915)
FT                   /gene="xth-1"
FT                   /locus_tag="MCA0321"
FT   CDS_pept        complement(316142..316915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xth-1"
FT                   /locus_tag="MCA0321"
FT                   /product="exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /note="identified by similarity to SP:P37454; match to
FT                   protein family HMM PF03372; match to protein family HMM
FT                   TIGR00195; match to protein family HMM TIGR00633"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90419"
FT                   /db_xref="GOA:Q60BZ2"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BZ2"
FT                   /protein_id="AAU90419.1"
FT                   /translation="MRIITLNVNGIRSAARKGFFDWLPKQNADIVCLQEIKAQTTQLND
FT                   ELFWPESYACYYLEAEKKGYSGVALYARKEPDDVIQGLGWDDMDTEARYLEARFGELSV
FT                   VSLYIPSGSSSEQRQAVKFGFLDRFLPFLDDCARSGRQYIFCGDWNIAHKPIDLKNWRS
FT                   NQKNSGFLPEERAWLDRVFEEAGWVDAFRAVNPEPEQYTWWSNRGQAWAKNVGWRIDYQ
FT                   VVSPGLRELIRSAAIYKEERFSDHAPLIIDYDLTL"
FT   gene            317030..317233
FT                   /gene="rpmE"
FT                   /locus_tag="MCA0322"
FT   CDS_pept        317030..317233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="MCA0322"
FT                   /product="ribosomal protein L31"
FT                   /note="identified by similarity to SP:P02432; match to
FT                   protein family HMM PF01197; match to protein family HMM
FT                   TIGR00105"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90418"
FT                   /db_xref="GOA:Q60BZ1"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BZ1"
FT                   /protein_id="AAU90418.1"
FT                   /translation="MKPDIHPDYTTVTVSCSCGNTFETRSTIGKDFHVEVCSACHPFYT
FT                   GKQKIVDTAGRVDKFRRKYGRG"
FT   gene            complement(317269..317880)
FT                   /locus_tag="MCA0323"
FT   CDS_pept        complement(317269..317880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0323"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GP:17429805"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90417"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BZ0"
FT                   /protein_id="AAU90417.1"
FT                   /translation="MRTRQKTRSHLAWAAARLMAEQGIDDPQQALNKAAARLGQTDRRQ
FT                   LPEPDEVDAALIEYNRLFRPARQSAELDRQRVLALEAMEFLAEFDPRLTGAALDGTAGR
FT                   HSSITLQVFADAPEEVMRKLLDAHVPFRETSCRCRLRGENTTLPALSFYVDETPMDLCI
FT                   FPATAAGRAAAAGNREGGASIRELRTLLGRAAGTENGETD"
FT   gene            complement(317896..320388)
FT                   /gene="mrcA"
FT                   /locus_tag="MCA0324"
FT   CDS_pept        complement(317896..320388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcA"
FT                   /locus_tag="MCA0324"
FT                   /product="penicillin-binding protein 1A"
FT                   /note="identified by similarity to SP:P02918; match to
FT                   protein family HMM PF00905; match to protein family HMM
FT                   PF00912; match to protein family HMM TIGR02074"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90416"
FT                   /db_xref="GOA:Q60BY9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BY9"
FT                   /protein_id="AAU90416.1"
FT                   /translation="MAIFSRKTRRPRYWLMTLEVLLVAILVIALGLFGLYRHLEPQLPD
FT                   IAILKEVRYQIPMSVYSRDGKLIAQFGEKKRSPVAIGSVPQDLIHAFIAAEDDRFYDHV
FT                   GVDYQGILRAVLTFARTGEKRQGGSTITMQVARNFFLSSEKTFLRKIKEIMLAIRIDSE
FT                   LSKDQILELYLNKIYFGQHAYGIEAAAQVYYGKHVGELTLGEMAMIAGLPKAPSAFNPV
FT                   ANPERAQTRRNYVLRRMRKLRFITDEVYQRALNEPITARIHTRLIELDAPYVAEMVRAE
FT                   MYQQYGDDAYESGYAVYTTIDSHAQRTAESALQSGLRAYDERHGYRKAKVHIDLKQLKA
FT                   KSAWNQILEDQGPAGDTVPALVLTATDTTAGLYTVNHGEPELSYDAVRWARPFISVDAH
FT                   GVPPRSVKEVLKPGDVIRIRKNADGRWVLTQIPKVQGALVELDADSGAIIAVAGGFDYR
FT                   LSKFNRASQGQRQPGSGFKPVVYSAALDSGFTPASVVNDSPVSFPDPASPGGIWRPHNY
FT                   SMKYAGPTPLREALAKSRNMVSIRLLRAVGLPKVIELAEKFGFTPDELPRSYTLALGSG
FT                   TASPLRMAQVYAVFANGGYRVDPYLISRIETQNGRLLYQATPAIACLDCADGKSTANRA
FT                   KRVISEEVHYMMHSMLQDVVRRGTATKALELGRSDLAGKTGTTNQYRDAWFNGYVPGLV
FT                   TVAWVGFDSYQTLGDKETGGQTALPIWMEFMKEMLRDVPERKFPQPAGIMAARIDPATG
FT                   NRLPASVPGGIVELVPRPTPQPGFDAAAEEPEVAAPASQSDASGARAPESIPPEEEEIG
FT                   EAPPAQPAETPKPMESLF"
FT   gene            320584..321726
FT                   /gene="pilM"
FT                   /locus_tag="MCA0325"
FT   CDS_pept        320584..321726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilM"
FT                   /locus_tag="MCA0325"
FT                   /product="type 4 fimbrial biogenesis protein PilM"
FT                   /note="identified by similarity to OMNI:NTL03PA05045; match
FT                   to protein family HMM TIGR01175"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90415"
FT                   /db_xref="GOA:Q60BY8"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BY8"
FT                   /protein_id="AAU90415.1"
FT                   /translation="MNYQRCRFPVACCGFPSSVPFSGDMSAMWGLGRKKPLLLGIDISA
FT                   AAVKLLELSRKNGGYQVESYGVVPLPRNTVVDNTLAEPDNVSAAVRAVVKQSGTALRHA
FT                   VVAVPGSVVITKRIALPANLEGDELEAQIELEADQYIPHAREEVSLDFEVLGKNPKNPD
FT                   LLDVLLVATRRENVEDRVSVLENAGLGVEIVDVESYAIERAFELVRDQLPPLLRDRAVA
FT                   VADVGAMATTLNVIHGGSIIYTREQGFGGMQLTDEIQRRYGLTYEEAGLAKKEGSLPGN
FT                   YAEEVLEPFKHALVQQISRSFQFYLSSTAQRGFDAVVLAGGCAMIPGIDRYVEAALQVP
FT                   TVIANPFRHMSFSGRVRQERLSYDSSALMLACGLALRSFD"
FT   gene            321696..322331
FT                   /gene="pilN"
FT                   /locus_tag="MCA0326"
FT   CDS_pept        321696..322331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilN"
FT                   /locus_tag="MCA0326"
FT                   /product="type 4 fimbrial biogenesis protein PilN"
FT                   /note="identified by similarity to OMNI:NTL03PA05044; match
FT                   to protein family HMM PF05137"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90414"
FT                   /db_xref="GOA:Q60BY7"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BY7"
FT                   /protein_id="AAU90414.1"
FT                   /translation="MRPGTAEFRLMARINLLPWRAALRRERQKEFALWTGLGLALTAAM
FT                   MLLIRTQISAAMDTQNRRNQYLEGEIGALERQIAEIRDLEAKKSRLVAKMEIIQQLQLS
FT                   RPEEVHLFDEIARTVPEGVSLRDLTQEERAITVNGFAQSNARVSAYMRNLEGSEWLYDP
FT                   VLEVIENKQDAQGRGKEREKGSRFTLRMKQGPRGRTGEESLPGGKAAP"
FT   gene            322328..322966
FT                   /gene="pilO"
FT                   /locus_tag="MCA0327"
FT   CDS_pept        322328..322966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilO"
FT                   /locus_tag="MCA0327"
FT                   /product="type 4 fimbrial biogenesis protein PilO"
FT                   /note="identified by similarity to OMNI:NTL03PA05043; match
FT                   to protein family HMM PF04350"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90404"
FT                   /db_xref="GOA:Q60BY6"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BY6"
FT                   /protein_id="AAU90404.1"
FT                   /translation="MNLAKINWDLEYAGSWPTPVKLAVIAVLSTVLAGVWYYLDTRTQL
FT                   AGLEDQQRREQELKETFEIKQKKAVNLEEYKLQLADIEKTFGDLLRQLPDRTQVPDLLV
FT                   DVSQTGLASGLEFELFKPGGEVSKEFYAELPIEIRVVGTYMEFGAFVSGLASLPRIVTV
FT                   HNVKIVSRSADGAGPKPGEAELVMTALVKTYRYLDDGAVPSSPADRGRR"
FT   gene            322966..323508
FT                   /gene="pilP"
FT                   /locus_tag="MCA0328"
FT   CDS_pept        322966..323508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilP"
FT                   /locus_tag="MCA0328"
FT                   /product="type 4 fimbrial biogenesis protein PilP"
FT                   /note="identified by similarity to OMNI:NTL03PA05042; match
FT                   to protein family HMM PF04351"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90403"
FT                   /db_xref="GOA:Q60BY5"
FT                   /db_xref="InterPro:IPR007446"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BY5"
FT                   /protein_id="AAU90403.1"
FT                   /translation="MMVRAKYAWAPAVLVCLSGCAEDELADLRSYVADVKARQKITIEP
FT                   LPEIRTVSPFLFNPAGLHDPFKSIEKPDDAGTAAADNGIRPDLSRQKEQLESYELDTLR
FT                   MVGTVRMSGIMWALVRAADGTIHRVRTGNHMGRNFGRITRISENGVELVEIVPDAQGGW
FT                   LERITTMTLIEAGGDKK"
FT   gene            323495..325684
FT                   /gene="pilQ"
FT                   /locus_tag="MCA0329"
FT   CDS_pept        323495..325684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilQ"
FT                   /locus_tag="MCA0329"
FT                   /product="fimbrial assembly protein PilQ"
FT                   /note="identified by similarity to SP:P34750; match to
FT                   protein family HMM PF00263; match to protein family HMM
FT                   PF03958; match to protein family HMM PF07660; match to
FT                   protein family HMM TIGR02515"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90402"
FT                   /db_xref="GOA:Q60BY4"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BY4"
FT                   /protein_id="AAU90402.1"
FT                   /translation="MTKNEEGRVRRFVIRYVGSGRVPPCWIAGIFALCWGGVALAGGVA
FT                   LQSVDFTALPSENFQLRLGFDGPVPEPRSFTTEHPARIALDLAGVRSDLDKKPIPVHQA
FT                   GVETVQAIAAGGRTRVILNLATAVPYTTRVAGRFLYVTLQSGKAGSRADDSASAPVVVT
FT                   ERPVVGGPQVESIDFRRGEKGEGRLLVALSDPNSLINLREEGRSVVADLPGTSLPGRLA
FT                   RRLEVIDFATPVKWVEAMPVGRGARLLITPVSDEYDYSSYQSGKLLTVELRPLSRAEKE
FT                   EAKKRRLVFAGERLSLNFQDIPVRNVLQILADFTNLNIVASDSVQGSVTLRLNEVPWDE
FT                   ALDLVLKAKGLGKRQEANSNVIRVAPLDEINRSERDELEALKVVEDLEPLRTEIIQINY
FT                   TKADDIKKVIMGTTEKAEKAITRPEALTGGPGVTSTEAYDVTQSILSSRGNVTTDPRTN
FT                   QLIVQDTPRNLERIRDLVRQLDKPVRQVMIESRVVIANVDFLRELGAKLDFRPKNLTAA
FT                   ERLNPTGSMADLGVDLAKLTTLSPYGTAQYVVSMGDYLLDLELSAAQKEGRGEIVANPR
FT                   VLTADQSKAKIMQGVELPYQITQQGTGGGIPVQNVAFKPAVLELDVTPHITPDDHILMD
FT                   LMVKKDDKGELAPNGNFAIEKREIDTVAQVANGETVVLGGVYEGTRRNNTDKVPFFGDL
FT                   PGIGFMFRRNAVEDRKKELLIFITPKIVKQTSMTP"
FT   gene            325746..326285
FT                   /gene="aroK"
FT                   /locus_tag="MCA0330"
FT   CDS_pept        325746..326285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="MCA0330"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="identified by similarity to SP:P24167; match to
FT                   protein family HMM PF01202"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90401"
FT                   /db_xref="GOA:Q60BY3"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BY3"
FT                   /protein_id="AAU90401.1"
FT                   /translation="MRNRRNIFLIGPMGAGKTTVGRLLARALGMEFWDSDKEIERRTGV
FT                   TVPMIFEYEGEAGFRRRESEVIADLTGKERIVLATGGGSVLAAENREHLAARGLVIYLQ
FT                   CSVQKQLERTHKDMNRPLLQTENPRQRLEELLRVRDPIYRELADYVVDTGQHSSRSAVR
FT                   RIINAYEKSGTRLRTE"
FT   gene            326282..327361
FT                   /gene="aroB"
FT                   /locus_tag="MCA0331"
FT   CDS_pept        326282..327361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroB"
FT                   /locus_tag="MCA0331"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="identified by similarity to SP:P07639; match to
FT                   protein family HMM PF01761; match to protein family HMM
FT                   TIGR01357"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90400"
FT                   /db_xref="GOA:Q60BY2"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BY2"
FT                   /protein_id="AAU90400.1"
FT                   /translation="MKTLHVELGERGYPIYIGRGLLGHPDLIQAHLPGGQVLVVTNEVV
FT                   APLYLDRMLASLAGKDTGSVVLPDGEAHKTLDSAMAVFDALLARRFGRNAAIVALGGGV
FT                   IGDLAGFAAACYQRGVPFIQVPTTLLSQVDSSVGGKTAVNHPRGKNMIGAFYQPRCVLA
FT                   DTDTLDTLPDRELSAGLAEVIKYGFIRDPEFLAWLEANVERLLQRDPEALAYAIERSCI
FT                   NKAEIVAEDETETGVRATLNLGHTFGHAIETGMGYGVCLHGEAVAIGMCQAADLSRRLG
FT                   WIGDDEVARVIRLLERARLPVVPPRELDADAFLEHMAVDKKNVDGGLRLVLLKSLGEAT
FT                   LPVAVDAGLLRATLECYGR"
FT   gene            327389..328441
FT                   /gene="hemE"
FT                   /locus_tag="MCA0332"
FT   CDS_pept        327389..328441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /locus_tag="MCA0332"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="identified by match to protein family HMM PF01208;
FT                   match to protein family HMM TIGR01464"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90399"
FT                   /db_xref="GOA:Q60BY1"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BY1"
FT                   /protein_id="AAU90399.1"
FT                   /translation="MTHCFIRALLRQPVERTPVWMMRQAGRYLPEYREVRERAGSFMNL
FT                   CTSPELACEVTLQPLERYRLDAAILFSDILTVPDAMGLGLEFVEGEGPRFRNPIRGAAD
FT                   IHRLGVPDPEAELAYVPAAVRLIKQRLGDRAPLIGFSGSPWTLATYMVEGGSSREFRKV
FT                   KCLMYEEPALMHELLEKLADAVALYLNAQIAAGVDAVMVFDTWGGNLDTEHYLAFSLRY
FT                   AERVRQQLRLTGRGRIPAIFFTKGGGQWLEAMADAGYDALGLDWTTDIGSARQRVGDRV
FT                   ALQGNLDPVALYARPEIIRGEVRKILERYGRGSGHVFNLGHGVTPDIKPEHVGAMIEAV
FT                   HEFSPAFHRT"
FT   gene            328446..329015
FT                   /locus_tag="MCA0333"
FT   CDS_pept        328446..329015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0333"
FT                   /product="MutT/nudix family protein"
FT                   /note="identified by similarity to OMNI:MT1739; match to
FT                   protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90398"
FT                   /db_xref="GOA:Q60BY0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BY0"
FT                   /protein_id="AAU90398.1"
FT                   /translation="MAEPNPWRLLSRREIYDNPWIHVDEDRVVNPGGGISLYGRIHFKN
FT                   RAIGIIPLDGRGNTWLIGQYRYVPDAWSWEIPMGGSPEGEPILESARRELKEETGLSAA
FT                   SWTLLMRLHTSNSVTDEEGFVFVAEDLEEGEPEFEETEDLRIWKLPLADAVAMVISGEI
FT                   TDAISVAGLLRLALERASNQVGSGFK"
FT   gene            complement(328991..329356)
FT                   /locus_tag="MCA0334"
FT   CDS_pept        complement(328991..329356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0334"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:14026911; match to
FT                   protein family HMM PF04343"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90397"
FT                   /db_xref="GOA:Q60BX9"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BX9"
FT                   /protein_id="AAU90397.1"
FT                   /translation="MTIRLKRVYEPSSPEDGERFLVERLWPRGISRQALALDGWLKDIA
FT                   PSKELRRWYGHDPRKWGEFRQRYLAELDRAPAALTLLLEACSRGTVTLLYSARNGECSS
FT                   AVALRDYLERHLNPDPT"
FT   gene            complement(329353..333048)
FT                   /locus_tag="MCA0335"
FT   CDS_pept        complement(329353..333048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0335"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:15619037"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90388"
FT                   /db_xref="GOA:Q60BX8"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BX8"
FT                   /protein_id="AAU90388.1"
FT                   /translation="MNDDAMHGLGIAGLRYPDLHEPEKLRLLLQTFDDWTLQHDPDLFA
FT                   TFRDYRASNGTNMAPEAVSELLVKMAPLVGEFVARLFGVEAERERQMAEIRDSFATIFT
FT                   FRSEIVAKLPSRFKKVSIEDWDVAALAAKIDVLVEAFAPEYATTDREAAVARVGLALQN
FT                   LHRHYEEEAKQPGGGPLSDPETRTAKLRAQLGAHPRAALWKDAISLGDADFAAGLFAEF
FT                   ERWCFAASCDDRLGSQVKDWVSFKVPAKTDFRHLVHHVVEHRDGYDVWAAEPGHHRRRD
FT                   GFALTDPRFPERRVLYEVDHCIYCHDRDADSCSKGMRNKKDGGFKTNPLGVPITGCPLE
FT                   EKISEMHWLKRQGDNIAALALITVDNPLCPGTGHRICNDCMKGCIYQKTEPVNIPQIET
FT                   NVLTDVLFMPYGFEIYSLLTRWNPLNVKRPCALPYNGKNVLVAGMGPAGYTLSHYLLNE
FT                   GFGVVGIDGLKIEPLPAELVGDEHHPPQPIRDFGALYERLDRRIMLGFGGVAEYGITVR
FT                   WDKNFLKVIYLNLLRRKTFRCYGGVRFGGAITINEAWDLGFDHIAIASGAGKPTLIELK
FT                   NNLIRGIRKASDFLMALQLTGAAKESSLANLQIRLPAGVIGGGLTAIDTATELLAYYPV
FT                   QVEKILHRYEKLCAAHGESAIRARYDAEELGILDEFLAHGRAIQAERRRAEAAGETPDF
FT                   LPLLNQWGGATLFYRKGIEDSPAYRQNHEEIREAMDEGIVLAEGLNPLVALEDEHGHLK
FT                   AVRFEKLEEREGRWQPAGEIEIPLRSLFIAAGTSPNTIYESEHPETFEMDHKFYRRHEP
FT                   EWVGETPGLVPVRDEPWPKIGKPAPFTSYRRGGKFITFYGDNHPVYAGNVVKAMASAKD
FT                   GYPYIVRLFEQELKRLDPAEQSHRDRNLQAFQAVIDDALTARIVAVNRLTPTIIEVVVR
FT                   APAAAKHFQPGQFYRVQNYEALAPVVEGTVLATEGIALTGAWVDKDNGLISLIALEMGS
FT                   SSRLCAQWKPGDPLVVMGVTGAPTEIPSGQTVALVGGGLGNAVLFSIGKALRSAGNQVI
FT                   YFAGYRNSADVFKAEELEAASDLLVWTVDKREGNTPIPITRPDDKSFMGNIVEAMLAYA
FT                   KGELGPTPIHLDDVDHMIVIGSDRMMEAVKHARHGLLAPYLKPHHAAIGSINSPMQCMM
FT                   KGVCAQCLCKHVDPETGREYFVYSCYNQDQELDRVDFPNLQARLRQNSVQEKLSALWLD
FT                   WLLTRP"
FT   gene            333232..333573
FT                   /locus_tag="MCA0336"
FT   CDS_pept        333232..333573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0336"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90387"
FT                   /db_xref="GOA:Q60BX7"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BX7"
FT                   /protein_id="AAU90387.1"
FT                   /translation="MSSDRNFKHLLRVRVKEFNIPPISDGVVLGREAPIGCAAFRKALE
FT                   LLVVAPFEHIQLDDDVISDILVRRAFLRRVPREYLVQFVLQRIKPLMGSEEIMQLDLNA
FT                   EILIEDEAL"
FT   gene            333864..335336
FT                   /locus_tag="MCA0337"
FT   CDS_pept        333864..335336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0337"
FT                   /product="EAL/GGDEF domain protein"
FT                   /note="identified by match to protein family HMM PF00563;
FT                   match to protein family HMM PF00990; match to protein
FT                   family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90386"
FT                   /db_xref="GOA:Q60BX6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="PDB:3ICL"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BX6"
FT                   /protein_id="AAU90386.1"
FT                   /translation="MPLAVLERDGSFLGVLTPHSIVEVLLERERRLLEDARKINAEIRR
FT                   EADKAIEQLDIKAHYDTVTGLPNRQLFCDRLLQALAAHERDGNPVVLLFLDVDNFKSIN
FT                   DSLGHLVGDRLLRATAERIRTAVRDGDTVARIGGDEFTILLNGAKDTLNGALVAQKILD
FT                   GLAQPFVFGAQQIVISVSIGIAVSPADGETMEQLLRNADTAMYHAKSRGKNNYQFFSPE
FT                   LNVQAYRRQEIERNLRCALLQGELGLRYAPRVDLRSGRIVALEVCPFWLSSELGDVPPD
FT                   DFIPVAEETGLIVQIGIWAFRTACAHAAVWRTQGLADRCLSFRLSQRELDDPQFGDRIM
FT                   SLLDGCGLEPENLQFELSERMLMTHAAHTLAVLQELSNRGIRFSVGDFGTGNASLRRLR
FT                   RFPIDELKIDLSSVRDIEPDSDDAAVITAMIAMAKSLRMDVVAVGVETPEHVAFLLERG
FT                   CRHGQGRLIGARLPPERIAALLAGDAVDLFVA"
FT   gene            complement(335452..338361)
FT                   /locus_tag="MCA0338"
FT   CDS_pept        complement(335452..338361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0338"
FT                   /product="cytochrome c5530 family protein"
FT                   /note="identified by similarity to GP:4325062"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90385"
FT                   /db_xref="GOA:Q60BX5"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BX5"
FT                   /protein_id="AAU90385.1"
FT                   /translation="MYTTNHRFKQGIASVLAVSIAAFAGMVQAKDLTITSASWNAKTKS
FT                   LSLAGTSENRAVVTLYNARTNAKLASVTASKSGAWSNTLSKPAAVPCRVRATSKDSATE
FT                   RDVANAPADCSGSAPNQPPVANAGPDQAVTLAQGQSSIAVTLNGSGSSDPDGSIASYQW
FT                   TGNPDPADTVSPGVILTAGTYVFTLTVTDDKGATSAADTVQVTVAAPPASSAGSINSTS
FT                   AGSLAKVTTPVPEPSKVTSGNYGVLAVNDLGMHCVDLDTRIVNILPPFQVMLGQVIQKG
FT                   TKPVINPQGVELYYSAVSNPKDPILSRNDLFNGIAADGTTFKTNFWDSVVNGAYDAFYP
FT                   PLDQPPLSLPAGTKLADLVPVDKGLPVPNAEKLYIGSDGRVNSGDERLAVAQHAMPGFS
FT                   SPYAANAPQRVEERYTDKPMFVNFPFGYVANGVNWFEAAGIPLAPFDDFGRQNPFPLVR
FT                   VQAKSGTTVLATVDTVLPVSSEASCTNCHSDPADVANSRSSWPTDALRGAGLEVATRVQ
FT                   DPDTNNPTKVSVEYAADINILRLHDLRQGANYVDPTGAKTPCDIKSGLPASSNGDANCL
FT                   TYKAVVQNKPVVCQSCHYTPALDLAQVGPQAGAIGSPANGRNQLAHQSNSRVMHNHHGA
FT                   FTNLFTAIPAPDQDPATGAIRNQAERLTALEQNCYQCHPGKETKCLRGAMFNGGMLCSD
FT                   CHGDMKQIGADFSTGVSPANPGAFVLNQGNFYDPASSQPRVPWANEPGCGSCHTGDANG
FT                   NLTGSANVIVNKVDSKGNKDGIRLRQAFRTGDAKATPIVPSNKRFAEPAIPAQFNGFNN
FT                   PGAGNPKLYRVSTGHGGVMCEGCHGATHAEWPNATANANDNLAAVQLQGHTGTIAECNT
FT                   CHTAGSLPSSTQGGPHGMHLVNDSRFYGDAHGDLAENQNRQPGGGTCGACHGSDHLGTV
FT                   LSRAAADRRFSVEGKTVSIKAGQPVACNLCHSLSKSFER"
FT   gene            338735..340015
FT                   /locus_tag="MCA0339"
FT   CDS_pept        338735..340015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0339"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:17428048; match to
FT                   protein family HMM PF02646"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90573"
FT                   /db_xref="GOA:Q60BX4"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BX4"
FT                   /protein_id="AAU90573.1"
FT                   /translation="MERLLREELSQLRAEIGRASRDSREEIGGAIGRFQMAQQDQAERM
FT                   RLLMDEKLVRVQADARDGREEMSLGLKRFGEVQKEQLDSVGLLLKNQLETLAGTNEKSI
FT                   ERLRLTIEERLQALQHDNGQKLEQMRQTVDEKLHNTLEQRLGESFKLVSERLEQVHKGL
FT                   GEMQSLASGVGDLKRVLTNVKTRGTWGEVQLDALLEQILTPEQYGKNVPTRPNGAERVE
FT                   FAIRLPGRDSGDAPVWLPIDAKFPIEDYQKLLDAQDGADHAGIEASGKALEQRLKNEAR
FT                   TIRDKYVEPPHTTDFAILYLPIEGLYAEALRRPGLAETLQRDYRVTLAGPTTLAAMLNS
FT                   LQMGFRTLAIERRSSEVWTLLGAVKTEFTKFGDALAYTRKKLEEATSSIDKAETRTRVL
FT                   TRKLKEVEAIPAQEAGWLLPSTAEADD"
FT   gene            complement(340020..341930)
FT                   /locus_tag="MCA0340"
FT   CDS_pept        complement(340020..341930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0340"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to GP:17133197"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90564"
FT                   /db_xref="GOA:Q60BX3"
FT                   /db_xref="InterPro:IPR007263"
FT                   /db_xref="InterPro:IPR007782"
FT                   /db_xref="InterPro:IPR011020"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BX3"
FT                   /protein_id="AAU90564.1"
FT                   /translation="MQKALFNLVLRGLEKQVPATGLGLFRLAFGLVAFQEICFLYYFRQ
FT                   LIFDPVPYLDIASPSVHLFLVLWAIAALCLALGLYTRLAAIANYLFWLVFTVFTPMWKD
FT                   FDGGFDQLMLGSSLLLIFLPSERAWSLDRLRLAWRHSTVDRCYALPRTVPVLCYFLPLA
FT                   VSLGFIYFDSVIHKLFAEFWRNGLGPWLPSSLPYYMSPLDMGWLLEIEPLQRAIGYTII
FT                   AFQFAFLFLLYFRRFRVPLMLVGLSLHAGIIVSLNIYPFGFGMLVHYFLMVPFRWWRTL
FT                   GRTLRPAEPALQVFYDERCPLCLKTVLAIEHFDVFRAVEFRGLQTHAATAPALEDIPER
FT                   DLLGDLYAVDREGRRYSGVATYARILVAMRYPALAGLAMRLPGLATIADRVYRRIADNR
FT                   VRLGCDASCAPAPGRTEPDLAQRIGRWVGGSLQQRANRISRMLVVVLILQLNCTLHYAI
FT                   LYRLGVDTKANEAGQVLTMLSNALISASHTFLGITPHPLYLHDHFQGYEHILGIVHLDA
FT                   DGKERWLPFVDEEGRIVSPNWGRVHSMWANVAVTRHMDPRRLDKFVRKVTAFWGTRLGL
FT                   DLNRTTFVLKLKTVKAPMDWEPGLRRYNLAQPWEDVGRAVWRDGEMRLELDRDLEALSA
FT                   D"
FT   gene            341996..342505
FT                   /locus_tag="MCA0341"
FT   CDS_pept        341996..342505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0341"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90563"
FT                   /db_xref="GOA:Q60BX2"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BX2"
FT                   /protein_id="AAU90563.1"
FT                   /translation="MRRRGAPQVRIGGSPGINAFFSRVRKRPVDLGLNEERAERARRLT
FT                   GDLSGVVEPCLPNSSNASCNAGPNNLDASKRPLPRGMTSRKNTVLLPTSIRRSDGPVRC
FT                   PPKYRPPARGRRPVFALRRLSAQGRGAAAGASVAVARLGGRAGSSSAIGDQIIGATDPM
FT                   PSRAWR"
FT   gene            342615..344225
FT                   /locus_tag="MCA0342"
FT   CDS_pept        342615..344225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0342"
FT                   /product="MutS family protein"
FT                   /note="identified by match to protein family HMM PF00488"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90562"
FT                   /db_xref="GOA:Q60BX1"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BX1"
FT                   /protein_id="AAU90562.1"
FT                   /translation="MESIDIRGYPTILKSDGREPPKIPSVAPGRTGAAVLDEQAFRVIE
FT                   VDKLFEAADHATTAIGRAVLYRSLAQPPVDAGLIRAKQEAVRELERNAELRTGLEVLLA
FT                   EAAKLEGEFYNLLYAQFLGLIGSPAHPLEIDGYGYATYIKGTRFMLELVERANRLPEPD
FT                   SAYLKALVREVRDFARSRAYALMKGPVYRTERRVCTRAEKGWFTPGIRFRPSLFKPVGL
FT                   TVTVLLFLAAMEFLPFALDIAASIAPVFWLFLLPLGFVYVPIVGGMDRDGIIYPLREVY
FT                   RRSEEVQATLDTLGQLDELMSFIRFRESFGHFMTLPAILDGERHRMSLRGVRNPVLAKN
FT                   DPLYVPNDIDLTEQRLTFITGPNSGGKTAFCKTLAQVQILAQAGCYVPAERAELTVADR
FT                   VFYQVPEISHLTDGEGRFGTELKRTKDIFLASTPRSLVIMDELSEGTTNEEKMDISVAI
FT                   LDGFREKGNTTVLITHNHELVDVYQGRRIGQARQVEFRNEQPTYRLIEGVSRVSHADRI
FT                   ARKIGFSREDIARYLQGKP"
FT   gene            344225..344995
FT                   /locus_tag="MCA0343"
FT   CDS_pept        344225..344995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0343"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="identified by similarity to SP:P05446; match to
FT                   protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90561"
FT                   /db_xref="GOA:Q60BX0"
FT                   /db_xref="InterPro:IPR001018"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BX0"
FT                   /protein_id="AAU90561.1"
FT                   /translation="MLEILQIPVLEDNYVYLLHEPGSGATAAVDPAVAGPVLEALDARG
FT                   WRLGHVLNTHHHGDHVGGNLELKAATGCTVVGAAGDRHRIPGIDVALKDGEEFRLGSAS
FT                   ARMLDVPGHTSGHVAFWFEDDAALFCGDTLFALGCGRLFEGSAEQMWRSLERLRALPAE
FT                   TKVFCAHEYTQANARFAVTIEPGNAALRERVERVEALRREGAATVPSILSEELATNPFL
FT                   RPESPEIRARLGLPGVPEVEVFAEIRRRKDVFRG"
FT   gene            complement(344992..346389)
FT                   /locus_tag="MCA0344"
FT   CDS_pept        complement(344992..346389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0344"
FT                   /product="amino acid permease family protein"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90560"
FT                   /db_xref="GOA:Q60BW9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BW9"
FT                   /protein_id="AAU90560.1"
FT                   /translation="MRIFRTKAVSTDDCSGGSLKRCLGALDLTLLGIGAIIGTGIFVLT
FT                   GIAAATQAGPAVVLSFVFAGLACAFAALAYAELAACVGGCGSAYGYSYAAFGELIAWII
FT                   GWDLILEYAISVAAVANGWSGYFANALTAVGLELPDYLTKAPEKGGIINLPASAIIILL
FT                   MALLIAGVKESARLNTVMVSVKVLAIAVFVAVASAHVDPAHWDPFLPFGWFGHDAEGRP
FT                   TGVLAGASIVFFAYVGFDAVSTAAEEARNPMRDVPIGIIGSLVFCTLIYIVVAGLLTGV
FT                   VPYTELNVSSPVAHALQLLGIRWASGLVATGVIAGLTTVMLVLYYALTRIIFAMSRDGL
FT                   LSPWFSAVNTRTQTPVRVIVLCGLFISLVAGFVPLGELAELVNIGTLFAFVLVCLGVIV
FT                   LRVTRPELHRPFKTPVVPWFPILGALSCGALMAFLPALTWLRFVVWLLLGIGIYFAYSY
FT                   RHSRLAD"
FT   gene            346923..347954
FT                   /locus_tag="MCA0345"
FT   CDS_pept        346923..347954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0345"
FT                   /product="cytochrome c peroxidase family protein"
FT                   /note="identified by similarity to SP:P14532; match to
FT                   protein family HMM PF03150"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90559"
FT                   /db_xref="GOA:Q60BW8"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR026259"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BW8"
FT                   /protein_id="AAU90559.1"
FT                   /translation="MFTLRLLTGALALAGVSAAVADWQALPAKAPEPAANPSTPAKVEL
FT                   GKMLYLDPRLSSTGTVSCNSCHNVMLGGEDNRGGSVGVHGQVGGRSAPTVWNAAFNSVQ
FT                   FWDGRAPSLEAQAKGPVTNPIEMGMKSWDDVVARLKAIPGYPEAFAAAFGSGDAVTADN
FT                   AAKAIAAYERTLITPNSPYDRYVGGDKTALTEQQVRGMNTFAETGCSNCHSGPAFNGPT
FT                   LPEGTPFFMKFPTFENGMFEAKYGFSRDKGRAEVTKKTEDEHLFKVPTLRNVALTAPYF
FT                   HNGKVKTLDEAVRVMAKLQLNKDLSDQQVADVVAFLNALTGEFPKQQMPQLPGLPNGTF
FT                   DYD"
FT   gene            complement(347951..349270)
FT                   /locus_tag="MCA0346"
FT   CDS_pept        complement(347951..349270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0346"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90558"
FT                   /db_xref="GOA:Q60BW7"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BW7"
FT                   /protein_id="AAU90558.1"
FT                   /translation="MKRPSRAAIVRGILVALVLLPMTALWSALEPNPLVNAPLPASHAY
FT                   DGQDLLRARKRGGEARAVHLTAGDIEAAVNDLMARKKLDGAIRTDMQGGCLAATVTLRL
FT                   PYLAGWFLNIRLTVEDGDPLPAVTGLRVGSLPLPPKVVNAFVIHQMEKKGLLPNVPGDQ
FT                   GLILSAHIRDGKLELTFTGESQTAERLRALITEAAGAERIRSYHDRLANALSESNTHHF
FT                   IRLGILTRALFALAAQRSGITDPAAENRAVILLLAAYVNGYDLMSGSDGDAQPLPVRSV
FT                   LLQGRQDLGRHFMTSAAFALAGQRTLTDAIGLIKELNDTHSGSGFSFTDLAADRAGTVF
FT                   GKRATQPQYARRIQGILAASTDDAVFMPNVGDLPERLRGAEFFERFRDVYSPQFERLTQ
FT                   LIDERIDRLSLYTAPDSQAITHKKASPEGLAPGAEKADGT"
FT   gene            complement(349596..350375)
FT                   /locus_tag="MCA0347"
FT   CDS_pept        complement(349596..350375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0347"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90557"
FT                   /db_xref="GOA:Q60BW6"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BW6"
FT                   /protein_id="AAU90557.1"
FT                   /translation="MIDVVGRGVEVPRFRRGTTCRQRIAGRITHHGHGRSGTVGIAQGG
FT                   DREARGRLQQPGLDLLLAAVLDCRHVIHRLIDAGVRGKERRLPAGLDPERETGVLGTGK
FT                   VAVLPRHCPSAIAGRMNGAVTGFDLAEPRSHRGKRGTPVPHHGVLDDLDGLARNRLGDA
FT                   VQSMPLRRHYDDLHDREVLLAFAAVMGNDRRRIDGLAFDVLHRGAVRESLEAGMAEHLA
FT                   GAQGDSCAQQGQRQKFVRIGHCCFSLLCVLEKAKPTE"
FT   gene            complement(350468..351934)
FT                   /locus_tag="MCA0348"
FT   CDS_pept        complement(350468..351934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0348"
FT                   /product="glycine cleavage system P protein, subunit 2"
FT                   /EC_number="1.4.4.2"
FT                   /note="identified by similarity to OMNI:TM0214"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90547"
FT                   /db_xref="GOA:Q60BW5"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023012"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BW5"
FT                   /protein_id="AAU90547.1"
FT                   /translation="MLIFDRSREGRACASLFPQTPADIRGLPGHLLRQTPPPLPEVTEL
FT                   DVVRHYTRLSQKNFSIDTHFYPLGSCTMKYNPKAANVLARQPGFAALHPLGTERFGQGT
FT                   LSCLYELQEYLKTLTGMTAVSLSPAAGAQGEFCGVAMIRAYHDARNDHERNEILVPDAA
FT                   HGTNPASAAMCGYQVREIPTNADGDVDLEALKQAVGPKTAGIMLTNPSTLGVFEHRIPE
FT                   IAALVHEAGGLLYYDGANLNAILGKVRPGDMGFDVIHLNLHKTFSTPHGGGGPGAGPVG
FT                   VNARLQPFLPLPMVARSGNGYRWLAESDRPQSIGRLSAFAGNVGVLLRAYVYIRLLGYP
FT                   GLRRVAEYATLNANYLQKRLVEAGFDTAFPARRAAHEFILSVQRQKKEHHVTALDFAKR
FT                   LLDYGFHAPTVYFPLLIPECLMIEPTETENKETLDAFVDAMAAILKEAAEEPERLGQAP
FT                   HCTPVRRLDEARAARHPDLAWKPAAPVPPR"
FT   gene            complement(351928..353289)
FT                   /locus_tag="MCA0349"
FT   CDS_pept        complement(351928..353289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0349"
FT                   /product="glycine cleavage system P protein, subunit 1"
FT                   /EC_number="1.4.4.2"
FT                   /note="identified by similarity to OMNI:TM0213; match to
FT                   protein family HMM PF02347"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90546"
FT                   /db_xref="GOA:Q60BW4"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023010"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BW4"
FT                   /protein_id="AAU90546.1"
FT                   /translation="MPFIPHTEAEVRDMLAAIGAGSIDELFAEIPPDLRCGELKDLPEA
FT                   LSEMEVCKLMEERAAENRSALCFAGAGAYEHYIPAAVWEIALRGEFYSAYTPYQAEASQ
FT                   GSLQVFYEYQSMMAGLMAMDVSNASLYDGASALGEAILMALRTNPESRSRKILLPRSLN
FT                   PVYKRVVRTLTRNQRVELVDLDYDRSLGRIAENALETFEGGEFAAVVIPQPNHFGVLEE
FT                   VDVLADWAHRHGARSIAVVNPTAMALLKPPGEWGEHGADLACGEGQPLGIPLSAGGPYF
FT                   GFLCSRQDFVHQLPGRLVGRTVDVDGREGFTLTLQPREQHIRRGKATSNICTNQGLMVT
FT                   AATLYMALMGPKGLRNVAAACHANASALLERLTRIDGVEPVFPAPFFHEAAIRLPRAAD
FT                   RVLAGLAERGILGGHVLSADYPELGDALLICATETRGPEDMDRYAAALAEVLEC"
FT   gene            complement(353383..354465)
FT                   /gene="gcvT"
FT                   /locus_tag="MCA0350"
FT   CDS_pept        complement(353383..354465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvT"
FT                   /locus_tag="MCA0350"
FT                   /product="glycine cleavage system T protein"
FT                   /EC_number="2.1.2.10"
FT                   /note="identified by similarity to SP:P27248; match to
FT                   protein family HMM PF01571; match to protein family HMM
FT                   TIGR00528"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90545"
FT                   /db_xref="GOA:Q60BW3"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BW3"
FT                   /protein_id="AAU90545.1"
FT                   /translation="MGRCTALHEEHLALGARMTEFSGWELPLHYGSQIAEHHAVRRAAG
FT                   MFDVSHLGVVDVEGLQAAPFLRRVLANDVARLAEPGRMLYGCMLNQDGGIVDDLVVGFI
FT                   DDRRFRLILNAGTREKDLSWLHRQAAPFSVTVTPRDDLAMIALQGPDSPRIADAVVAAG
FT                   SSGLKPFTATQRGDRFIARTGYTGEDGFEIILPHAEAGSLWRQLFQAGARPCGLGARDT
FT                   LRLEAGMRLYGQDMDETVTPLACGLGWTVAWEPEERDFIGRAALERERIGGSPSKFVGL
FT                   ILEEPGILRSGQKVAVANVGEGVVTSGGFSPTLRRSIGLARVPAATGRECRVEIRGSLK
FT                   RATVVKPRFVRRSTSLIDIC"
FT   gene            354603..354929
FT                   /locus_tag="MCA0351"
FT   CDS_pept        354603..354929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0351"
FT                   /product="carboxymuconolactone decarboxylase domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02627"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90544"
FT                   /db_xref="GOA:Q60BW2"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BW2"
FT                   /protein_id="AAU90544.1"
FT                   /translation="MNKDRLPKNYVLLQQEYPGFMAAVERLGAALKEQGPLDDKTAHLI
FT                   RLAAAVAIHSEGAVHSHVRRALAAGASREEINHAIILLTSTLGFPTVSAALSWAQDIFG
FT                   EGKD"
FT   gene            354999..355358
FT                   /locus_tag="MCA0352"
FT   CDS_pept        354999..355358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0352"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:AF0187; match to
FT                   protein family HMM PF02635"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90543"
FT                   /db_xref="GOA:Q60BW1"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BW1"
FT                   /protein_id="AAU90543.1"
FT                   /translation="MKTLIISGSRGTDDPTMATLPFIAAKAAREQGHDVILWLWNEAVT
FT                   LARKGTADHVVGVNLTPLKDLLAAVQAAGVPIWVCGACAVARQIGEADLIGGAAIKGMP
FT                   DYIAAVLERDRNIAF"
FT   gene            355418..355876
FT                   /locus_tag="MCA0353"
FT   CDS_pept        355418..355876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0353"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:DR0566; match to
FT                   protein family HMM PF04543"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90542"
FT                   /db_xref="GOA:Q60BW0"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BW0"
FT                   /protein_id="AAU90542.1"
FT                   /translation="MRYWLMKTEPGEFGIDDLAARPAQTEPWDGVRNYQARNMMRDEMK
FT                   VGDGVLFYHSNCDVPGVVGIAEIAREAYPDFTAFDPDHKHYDPASKPEAPRWFMVDVRF
FT                   VRKLRRTIALSELRDRPELAGLALVRKANRLSVMPVSPDQWNFILSLE"
FT   gene            complement(355962..357491)
FT                   /gene="ilvA"
FT                   /locus_tag="MCA0354"
FT   CDS_pept        complement(355962..357491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvA"
FT                   /locus_tag="MCA0354"
FT                   /product="threonine ammonia-lyase, biosynthetic"
FT                   /EC_number="4.3.1.19"
FT                   /note="identified by similarity to SP:P04968; match to
FT                   protein family HMM PF00291; match to protein family HMM
FT                   PF00585; match to protein family HMM TIGR01124"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90541"
FT                   /db_xref="GOA:Q3V8A4"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V8A4"
FT                   /protein_id="AAU90541.1"
FT                   /translation="MLQKYIEKILRARVYDVAQETPLDPAPGLSRRLDNTVLIKREDLQ
FT                   PVFSFKLRGAYNKIASLTPEARAAGVIAASAGNHAQGVALAAQRLGIRAVIVMPCTTPH
FT                   IKVDAVRNRGGEVVLHGDAYDEAYEHALELARDQCLTFVHPYDDPEVIAGQGTIGMEIL
FT                   RQHQDAIHAIFVPVGGGGLIAGIAAYVKFVRPDIRVIGVEPVDSDCLHRALKAKRRVIL
FT                   KQVGLFADGVAVKQVGKEPFHLAHQWVDEVVTVDTDEICAAIKDIFDDTRSIAEPAGAL
FT                   GIAGLKKYVAETGIKNACLVAIESGANINFDRLRHVAERAEIGEKRELLLAVTIPERPG
FT                   SFLEFCRVLGRRNITEFNYRFFDEKAAQVFVGLPVASGAIDRESLVREFERQGFGVLDL
FT                   TGNELAIEHIRYMVGGHAPKLLDEQVYSFEFPERPGALLRFLSIMGGRWNISLFHYRNH
FT                   GAAFGRVLMGIQVPKPERKAFREFLEAIGYAFKEETQNPAYRLFAGGSERG"
FT   gene            357582..358238
FT                   /gene="rpiA"
FT                   /locus_tag="MCA0355"
FT   CDS_pept        357582..358238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /locus_tag="MCA0355"
FT                   /product="ribose 5-phosphate isomerase A"
FT                   /EC_number="5.3.1.6"
FT                   /note="identified by similarity to SP:P27252; match to
FT                   protein family HMM PF06026; match to protein family HMM
FT                   TIGR00021"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90531"
FT                   /db_xref="GOA:Q60BV9"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BV9"
FT                   /protein_id="AAU90531.1"
FT                   /translation="MTQDELKRKVAEAALDYVKDVTILGVGTGSTVNHFIDLLADLKGG
FT                   IEGAVSSSQASSERLKKIGIPVLDLNAAGTLDVYVDGADEVNAAKQMIKGGGAALTREK
FT                   IVAEASRKFVCIVDETKCVDVLGKFPLPVEVIPMARSLVARRLVELGGTPVWRENCITD
FT                   NGNVILDVHNLTITDPVELERRINDIPGVVCNGVFALRPADVVLIGSPSGVRTLP"
FT   gene            complement(358368..358925)
FT                   /locus_tag="MCA0356"
FT   CDS_pept        complement(358368..358925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0356"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90530"
FT                   /db_xref="GOA:Q60BV8"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BV8"
FT                   /protein_id="AAU90530.1"
FT                   /translation="MSRLFPPKSMTASVFACLLGACAQHVDISYQPANLSKGIGEIRVE
FT                   TFEYLPAAKGDVEPNEAQQDKSGLASTFFQENVDALFTGALKKELGSSGYALSDGGSRS
FT                   ISGEIRRFSFDWVGMTGMKFDIVVHFTVATNGKVVYSNVLEATREARQEDHKLDAPSEP
FT                   IELAMADCIGRFIRDAQKKGAL"
FT   gene            complement(359089..359472)
FT                   /locus_tag="MCA0357"
FT   CDS_pept        complement(359089..359472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0357"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL03PA00341"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90529"
FT                   /db_xref="GOA:Q60BV7"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BV7"
FT                   /protein_id="AAU90529.1"
FT                   /translation="MPLWLILVIIGILGGFAAGFFGIGGGLVIVPALVYWAGYSQHMAT
FT                   GTSVAVLLPPIGIAAAVEYYRHGNVDVRAALILAVTMLIGSWAGAYFANQIPGPYLRLM
FT                   FGIFVWIVGIYLIYGACERLGWL"
FT   gene            complement(359519..360094)
FT                   /gene="tag"
FT                   /locus_tag="MCA0358"
FT   CDS_pept        complement(359519..360094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tag"
FT                   /locus_tag="MCA0358"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="identified by similarity to SP:P05100; match to
FT                   protein family HMM PF03352"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90528"
FT                   /db_xref="GOA:Q60BV6"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BV6"
FT                   /protein_id="AAU90528.1"
FT                   /translation="MSPIIRCAWALRSPEETVYHDTEWGVPLHDDVKLFEYLVLDGAQA
FT                   GLSWTTIVKKREAYRQAFDGFDPAAVARYDEARIAALLANPGIVRNRLKIESAVRNARV
FT                   YLRIQDEFGSFDDYLWRFVDGMPVRNAWRHPREIPARTPLSDTLSRDLKRRGCNFVGST
FT                   ICYAFMQAAGLVNDHLVDCFRWSEVNGG"
FT   gene            complement(360091..360924)
FT                   /locus_tag="MCA0359"
FT   CDS_pept        complement(360091..360924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0359"
FT                   /product="PHP domain protein"
FT                   /note="identified by match to protein family HMM PF02231"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90527"
FT                   /db_xref="GOA:Q60BV5"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BV5"
FT                   /protein_id="AAU90527.1"
FT                   /translation="MYDLHAHSTASDGTLSPTELVRAATAGGIRTLALTDHDSVAGLKE
FT                   AGAAAAEAGLCLIPGVELSVTWESRTIHVVGLNIVPDHPGLNQGMRRLQAVRFERAQEM
FT                   DRRLTKKGIPGTLEIAVGLAGAGMVTRTHFARALVQLGQAATVRDVFDKFLTQGKPGHV
FT                   PTVWAEMTAAVGWIIEAGGVAVLAHPQRYKMTGSWIGRLAGDFKAAGGEAIEVVSGNAT
FT                   SSDIQANAAIARRHGLLASVGSDYHGPEQSWLKLGRIPPLPAGLTPVWTRWEDGR"
FT   gene            complement(360930..361481)
FT                   /locus_tag="MCA0360"
FT   CDS_pept        complement(360930..361481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0360"
FT                   /product="MutT/nudix family protein"
FT                   /note="identified by similarity to OMNI:NTL03PA03755; match
FT                   to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90526"
FT                   /db_xref="GOA:Q60BV4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR029401"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BV4"
FT                   /protein_id="AAU90526.1"
FT                   /translation="MKYCSQCAAPLRLGIPAGDDRPRHICDACGTIHYRNPKVIAGCIP
FT                   VWNGQVLLCRRAIEPRHGFWTLPAGFMELGETLEQAAERESYEEATARVRIDSLYTLFS
FT                   LPHLSQVYAFFRAELLSPDVAAGLESLETRLFEETEIPWDELAFETVHRSLALFFEDRR
FT                   NGAFGLHVETLGPDDRLIRD"
FT   gene            361715..362998
FT                   /gene="purD"
FT                   /locus_tag="MCA0361"
FT   CDS_pept        361715..362998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="MCA0361"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="identified by match to protein family HMM PF01071;
FT                   match to protein family HMM PF02842; match to protein
FT                   family HMM PF02843; match to protein family HMM PF02844;
FT                   match to protein family HMM TIGR00877"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90525"
FT                   /db_xref="GOA:Q60BV3"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BV3"
FT                   /protein_id="AAU90525.1"
FT                   /translation="MKILIVGSGGREHALAWKAAQSPRVRKVFVAPGNAGTALEPGVEN
FT                   VTIAADDVAGLLEFAKAAGVTLTIVGPEAPLVAGIVDAFRAAGLACFGPTRQAAQLEGS
FT                   KAFCKDFLARHGIPTAAYQVFTDAGEAEDYIRRKGAPIVVKADGLAAGKGVIVAQSEDE
FT                   AIAAVRDMLAGDAFGSAGHRVVVEEFLPGEEASFIVMADGEHALPMATSQDHKARDEGD
FT                   RGPNTGGMGAYSPAPVVTPEIHQRVMEEIILPTLAGMKADGMPYTGFLYAGLMVAPDGG
FT                   CKVLEFNCRFGDPETQPIMMRLRSDLVDLCCAAEEGRLDVVKADWDPRVALGVVMAAGG
FT                   YPFDYRKDDVIEGLGLAIAPGAKVFHAGTRLDGGRVVTAGGRVLCVTALGKTVAQAQAA
FT                   AYRLVEKIRWPDAYWRRDIGHRAIGRGV"
FT   gene            363020..364334
FT                   /pseudo
FT                   /locus_tag="MCA0362"
FT                   /note="putative paraquat-inducible protein A, authentic
FT                   frameshift; this gene contains a frame shift which is not
FT                   the result of sequencing error; identified by similarity to
FT                   SP:P43670"
FT   gene            364331..366049
FT                   /gene="pqiB"
FT                   /locus_tag="MCA0363"
FT   CDS_pept        364331..366049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqiB"
FT                   /locus_tag="MCA0363"
FT                   /product="paraquat-inducible protein B"
FT                   /note="identified by similarity to SP:P43671"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90524"
FT                   /db_xref="GOA:Q60BV2"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BV2"
FT                   /protein_id="AAU90524.1"
FT                   /translation="MNESPKEGAGGAPDYDVWEAEVKSSRGLPLVWLIPLVALGIGIWL
FT                   AYRTLSEEGPTITLLFKEAPGLEAGKSKIKFKDVEIGTVESVVLNEDLTGVVVTAKMEK
FT                   HVATHLGENTAFWVVKPELGLGGVSGLDTLMAGNYIAVEFGGGKVVRRFVGLERPPRIK
FT                   ADTPGRSFFLSADNAGPLKYGTPVYFRDIEVGQVVNVGLAEDNRSVQVEIFIDAPYHRL
FT                   VHNSTRFWQVSGIDLSLSAQGVNLKVGSIMSLLQGGITFETPTLNDPKVQSSEPNTRFR
FT                   LHKDFASIAEGTYTLRQPYLLFFDDSVRGLNVGAPVELKGIRVGTVTELKLALDFGAHK
FT                   IRIPVVIEIDPERLIPYGAEEIIERAKKEYKAAMEAGRRPFMEKLVERGLRARLRTGNL
FT                   LTGQLYVDLDFYPESPPKSLDYSGQYPELPTLPSVADELQRNVTEIIANLKKIPLDKIG
FT                   QELLGTVQGSNRLLNSPELKGAVGSLNLALKDLRHLAQTADREMVTLTSAAEKSLSSTA
FT                   RVLEQLEPGSAMAVDISNALEELAASARSIRALTDYLERHPEALLHGKGGSGGKP"
FT   gene            366046..366651
FT                   /locus_tag="MCA0364"
FT   CDS_pept        366046..366651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0364"
FT                   /product="putative lipoprotein"
FT                   /note="identified by similarity to OMNI:NTL03PA04964; match
FT                   to protein family HMM PF03886"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90523"
FT                   /db_xref="GOA:Q60BV1"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BV1"
FT                   /protein_id="AAU90523.1"
FT                   /translation="MREPAMRSTFLTASLGALLLTGCGTSPDTRFYVLSAVQEPARALA
FT                   GQEREIALGVGPVELPEYLDRPQIVTRRDPNELQLAEFDKWAESLKDGVTQVLAENLAT
FT                   RLPSRKVVTYPWKRSAQVDYQLVVKVTRFEGSGGEAVLSVRWSVSSGDGKTELLVRESR
FT                   YAEPAAGTDYRATVAAMNRALARFSRDVAEAVRSLGRV"
FT   gene            complement(366700..368109)
FT                   /locus_tag="MCA0365"
FT   CDS_pept        complement(366700..368109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0365"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:15808730"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90522"
FT                   /db_xref="GOA:Q60BV0"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BV0"
FT                   /protein_id="AAU90522.1"
FT                   /translation="MTKKMQLSTVAAALFAANACHAGIDLIAIGSADPASFDRAARTHA
FT                   PLETGVSGNVLGGLGSGLAWAGGSLFLALPDRGPNATPYNPLVDDTASYINRFQTFDFQ
FT                   LKRNGGGSGLPFTLTPVLLSTTLFYSATPLVYGTGALGTDESHTLGSGAPALNGRRSFY
FT                   FTGRSDNFDPAAPSTNPDNGRLDPEGIRLSNDGRSVFVSDEYGPYVYQFDRISGKRIKS
FT                   FTLPDHFAVTTPSPRSADEIAGNTVGRIANKGMEGLAITPDGKTLVGVMQANLTQDKKN
FT                   SVRIVTLGIATGMTHEYAYRLTEGSGVSEILAINDHEFLVDERDGKGLGDDSAAKVKKL
FT                   FKIDLAGAADVSGISGDLSAYAVPKTLFLDFKAALADAGISAYDIPSKIEGIAFGPDVT
FT                   IDGRKRHTLFVANDNDFLPNITDSNHPDGVANPNNFYVFAFDDADLGTDAGGKPTVFQK
FT                   QKIAGASFTFR"
FT   gene            complement(368221..369297)
FT                   /locus_tag="MCA0366"
FT   CDS_pept        complement(368221..369297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0366"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90521"
FT                   /db_xref="GOA:Q60BU9"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BU9"
FT                   /protein_id="AAU90521.1"
FT                   /translation="MNGELDYLLGFVGKNRLDPHRFDAARIGRLLDFVASPKDEARLYR
FT                   AGERNGAASAYYESDLRRSLDHLLRLTYSNDIPSVFSAPSTVRTERWTTVDAPGQRLPE
FT                   LWAQPTAPDKPVVVTGMEHLVNSPDSHSGAYYEYDLYRTLLLTRVGGRKLLISLSSQTG
FT                   ESRVGRKGIIVGPDDNWDYLYTDQTGLNRTGLGWASTYMYGSQSVAFYLETETSPPKTR
FT                   FGAFKWIRAGWAGINVVNSQHIFSGLRRFGDVFKRIAEHPRTDDTAILARNFRAVARLP
FT                   QSRLKRLTQDYLAGLRKRCEEEGLLADGEVQALFRDGHYLDSLSREDMESILAIEYAKQ
FT                   ILGKPHYVELADEFAQME"
FT   gene            complement(369651..372014)
FT                   /locus_tag="MCA0367"
FT   CDS_pept        complement(369651..372014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0367"
FT                   /product="BNR repeat domain protein"
FT                   /note="identified by match to protein family HMM PF02012"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90520"
FT                   /db_xref="GOA:Q60BU8"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BU8"
FT                   /protein_id="AAU90520.1"
FT                   /translation="MPTDTHTIARTAKRPARFACCISALLGAMTADPSLADWVEQGPGP
FT                   TINGQTEGLKDPRNPVSGAINAIVPDPSNGDILYVGTVNGGVWKTTNAKDVSPNWTPLT
FT                   DTQLPALSIASLASSPLNRNRLFAGTGSTSSNGGEGNPGFGVARSDDGGTSWKVLATDT
FT                   FKDKRVTSIVPTAMDDGNVVLAANFYEKGGVYRSTDGGEKFERISGKDGSGLPDAGVSS
FT                   LIADPAAPQRLYAAIPAVAPSLSPDRGPEPNSGQPGIYRSDNGGVTWSRMGTAPVDGPD
FT                   PSLRILLSLHHSEGGNVLYAAVAVQKKKTDKSGKEEYKDVWDSVYRSSDRGANWTKLPD
FT                   IPNVSPGAQASIHGALLADIGDPNAVYLSGDVQTGPANGGNISVTNPNALGCTRWSANV
FT                   YRYNGRRWEPAVCKGANGTSPHADSRNMVFDADGNLLQANDGGIYRLVKPADRKRRRWV
FT                   SVLGNLRLAETISAAYDPLSGLAFCGTQDNGSAAQTAQNDFSWKTLIEGDGGVVAVDSD
FT                   VNGHPGKSIRYYTYAELGFFTRSAWNARGRMIKGSEQAVRLRVKGTGKPLTRVDDTVQF
FT                   YNRYALNLVDPKRMLIGTTKLYESLNRGDLLDALYEGDGYVKALAYGGRRQGAEFADVL
FT                   YAGTSSRQDPQPEDDDVEKSLPTAGFANADEPEATGETTGRILHRTNVGEQVAALASYK
FT                   GSGVVDLAIDPQDYGHVFVVDDKDRIWASFDEGQSWSELTANLKDLLKGPVKTLTVKGA
FT                   DSYSPDTVLVAGGGYGVAQLRNPETRGDWATVDK"
FT   gene            372168..373259
FT                   /locus_tag="MCA0368"
FT   CDS_pept        372168..373259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0368"
FT                   /product="zinc-binding domain protein"
FT                   /note="identified by match to protein family HMM PF00246"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90519"
FT                   /db_xref="GOA:Q60BU7"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BU7"
FT                   /protein_id="AAU90519.1"
FT                   /translation="MIASQEHIFRAEDESQPLTRNLLRGLPELREILLLVEHLKEFPEL
FT                   GRVETLARLRHGEESFPLLAISFGPADPTTPVLALFGGVHGLERIGTRVVIAYLRTILE
FT                   LARWDEVTREMLRKTRLLMVPLVNPVGMYLKRRSNGEFVDLMRNAPVQAEGLSPWHLFA
FT                   GQRLSPSLPWYQGAADAPMQTEAQALCDFVQREIFPARIALSVDVHSGYGRVDRLWFPY
FT                   AKTREPFPNLPEAVALKHLLDRTHPNHVYCMEPQSRQYLAHGDLWDYLYDRYRKDQPAG
FT                   RFIPFTLELGSWAWIRKNWSQLFSILGVFNPRMPHRVRRTLRRHLFLFDLLYRAVRSPE
FT                   PWTGLDRGERRRLMQQGLDYWYV"
FT   gene            373252..374043
FT                   /locus_tag="MCA0369"
FT   CDS_pept        373252..374043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0369"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90518"
FT                   /db_xref="GOA:Q60BU6"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BU6"
FT                   /protein_id="AAU90518.1"
FT                   /translation="MSERTGPAEWVFIRGLVRESAHWDGFPQVFSGAVPGARVRTVDLP
FT                   GNGRHWRLDSPLSIRETMEFARAELGTEAGMPRYLLALSLGAMVALEWIARHPREIAGA
FT                   VLINTSLSSLSPLYRRLNWRVWPEVVRALLTADVAARERAILRLTSRSAAEEPLRVLAR
FT                   AEVYRQRPIRKANVFRQLWAAAHYRPSAETPAVPVLVLGSRGDRLVCPECSEAIARHWG
FT                   LPLKMHPDAGHDLPLDDPAWTVEAILAWLGTGPEREPDSRG"
FT   gene            complement(374530..375375)
FT                   /locus_tag="MCA0370"
FT   CDS_pept        complement(374530..375375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0370"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90517"
FT                   /db_xref="GOA:Q60BU5"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BU5"
FT                   /protein_id="AAU90517.1"
FT                   /translation="MSAFHSFPPSPLLAPFVSALWVHDDLMKPELGTCTVLPDTATYIC
FT                   FLCGDHPIQATHRHRSYTTLSGVSGFQTHRFDLESRGAMSGVTVRLTPWGLSAFLGDAV
FT                   GAVAEIRVDCRDLFAPAAVRELEDHLFRLKSPKARAQCVENFLLARLRHPRVDELARAA
FT                   CLALARTSGALPIRKLARDLDLGERTLVRRFQNAIGTTPKKYARVLRLRDAVYLHNKFS
FT                   SWTEIAYAAGYCDQSHLIRECQDLFGASPEALFPIPRGGDTDKSGEPDRSVSSRLVIAR
FT                   "
FT   gene            375497..375859
FT                   /locus_tag="MCA0371"
FT   CDS_pept        375497..375859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0371"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90516"
FT                   /db_xref="GOA:Q60BU4"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BU4"
FT                   /protein_id="AAU90516.1"
FT                   /translation="MFFNAPSPGAGLRIYRYLAFRMDLVLTALAFFNVTMQGFLPRGRF
FT                   RRRMGSLRSWRFSREIQVRYFPNPRFFEAPLSAWNLDGCSRSEASFEAPALHISGEPPD
FT                   AKPGKPHLRPCAVSSR"
FT   gene            complement(375826..376386)
FT                   /locus_tag="MCA0372"
FT   CDS_pept        complement(375826..376386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0372"
FT                   /product="CDP-alcohol phosphatidyltransferase family
FT                   protein"
FT                   /note="identified by similarity to GP:14027356; match to
FT                   protein family HMM PF01066"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90508"
FT                   /db_xref="GOA:Q60BU3"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BU3"
FT                   /protein_id="AAU90508.1"
FT                   /translation="MRPEHIPNIISTLRIFLVYPVVHLMLAERYTAALALFVVAGVSDA
FT                   IDGFLAKHYGWQSRLGSYLDPLADKLLLVCCFVAGAWLGLLPVWMAAAVLLRDAVIVTG
FT                   AIAYYLLLHPFDGQPILASKLNTLLQLAFIVAILFNRGVSELPPFLLDGLLAATLATTI
FT                   ASGAIYVYVWGRNYRLETAQGRR"
FT   gene            376570..377607
FT                   /gene="purM"
FT                   /locus_tag="MCA0373"
FT   CDS_pept        376570..377607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="MCA0373"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="identified by match to protein family HMM PF00586;
FT                   match to protein family HMM PF02769; match to protein
FT                   family HMM TIGR00878"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90507"
FT                   /db_xref="GOA:Q60BU2"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BU2"
FT                   /protein_id="AAU90507.1"
FT                   /translation="MKTENPLSFDYKSAGVDIAAGNALVERIKPAARKTVRPGVLAGLG
FT                   GFGSLFELPVDRYRKPVLVAGTDGVGTKLRLAIESGRHGGVGIDLVAMCANDIVVQGAE
FT                   PLFFLDYYATGKLDVDVAASVIAGIAQGCERAGCALVGGETAEMPGMYAGGDYDLAGFC
FT                   VGVVEKEAIIDGSRVRPGDRLIGLASSGPHSNGYSLIRKIVGHSGLGLDAPVAGRALGD
FT                   WLLEPTRIYVKPLLELLKSVEVHALAHITGGGITENLPRVLPVGTAARIDTAAWTMPEI
FT                   FRWLQRHGGVETPEMFRTFNCGVGMIVCVAPEDEARTLEALSSLGERAFAVGEIIAGEP
FT                   AVHYV"
FT   gene            377637..378368
FT                   /locus_tag="MCA0374"
FT   CDS_pept        377637..378368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0374"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /note="identified by similarity to OMNI:CC0469; match to
FT                   protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90506"
FT                   /db_xref="GOA:Q60BU1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BU1"
FT                   /protein_id="AAU90506.1"
FT                   /translation="MSMRLSVVVPVHNEIDNLESLIGEITRALTPLGDYEIVYVDDGST
FT                   DGTLEKLRALKTSVPVLRVLRHVRCCGQSTALRTGILAARGAWIATLDGDGQNDPADIP
FT                   RLLEALDRLGGETGRGMVAGYRRKRKDTGWRRFSSRIANAVRGGLLRDNTPDTGCGLKV
FT                   FSRALFLELPYFDHMHRFLPALTQRAGAPVVSVEVNHRPRLSGVSKYGTWHRLWVGIVD
FT                   LFGVMWLQRRARVPQVEELGA"
FT   gene            378381..378755
FT                   /locus_tag="MCA0375"
FT   CDS_pept        378381..378755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0375"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90505"
FT                   /db_xref="GOA:Q60BU0"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BU0"
FT                   /protein_id="AAU90505.1"
FT                   /translation="MKSRTGWPLLLLAVAAGLDGQAIAAEAAFSRQELLEKGFEPAAPR
FT                   IDVRVARVVLPVGYKTPLHTHEGPGPRYVVRGRVRVEEGGQSNTYEPGQVFWESGQWMS
FT                   IENVGENEAEIILVELAKPK"
FT   gene            378759..379928
FT                   /gene="nadA"
FT                   /locus_tag="MCA0376"
FT   CDS_pept        378759..379928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadA"
FT                   /locus_tag="MCA0376"
FT                   /product="quinolinate synthetase complex, subunit A"
FT                   /note="identified by similarity to GP:6977796; match to
FT                   protein family HMM PF02445; match to protein family HMM
FT                   TIGR00550"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90504"
FT                   /db_xref="GOA:Q60BT9"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023515"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BT9"
FT                   /protein_id="AAU90504.1"
FT                   /translation="MSVRFVIPYWPTWSFLPPEQPTKSMSETALSIHDYAMLDDAECET
FT                   RIRAARAALGKRCVILGHHYQRDEVFRHADFTGDSLKLSRLASQSDAEYIVFCGVHFMA
FT                   EVADILSRPDQVAILPDLAAGCSMADMANLVAVERCWRELATVLDPESEVTPVTYINSA
FT                   ADLKAFCGRHGGIVCTSSNAQKILEWSFARRGKVLFFPDQHLGRNTGYRMGIPLEEMVT
FT                   WDFGKPLGGLTEDEIRRARMILWAGFCSVHQMFRPEHIDRFLAQYPDTRVIVHPECSFE
FT                   VCQKAQYIGSTEYILNTVRAAEPNTRWLVGTELNLVNRLAREVQPQGKSVHFLSPTVCM
FT                   CSTMFRTDPQHLLWVLENLVEGHVVNRIEVPAAIAAEARGALENMLQVA"
FT   gene            379938..380405
FT                   /locus_tag="MCA0377"
FT   CDS_pept        379938..380405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0377"
FT                   /product="conserved hypothetical protein TIGR00246"
FT                   /note="identified by match to protein family HMM PF02590;
FT                   match to protein family HMM TIGR00246"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90503"
FT                   /db_xref="GOA:Q60BT8"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BT8"
FT                   /protein_id="AAU90503.1"
FT                   /translation="MQLNLVCVGERMPSWVNEGYEEYARRLPRECALMLREIAPGKRTR
FT                   NCDIQRILADEGQRMLAAVGGNAHIVTLDVGGKDWSTRELAEVLARWLREGRDIALLVG
FT                   GPDGLSDACRQRAAESWSLSRMTFPHPLVRVIVAEQLYRAWTLLNNHPYHR"
FT   gene            380410..381018
FT                   /gene="maf-1"
FT                   /locus_tag="MCA0378"
FT   CDS_pept        380410..381018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maf-1"
FT                   /locus_tag="MCA0378"
FT                   /product="maf protein"
FT                   /note="identified by similarity to SP:Q02169; match to
FT                   protein family HMM PF02545; match to protein family HMM
FT                   TIGR00172"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90502"
FT                   /db_xref="GOA:Q60BT7"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BT7"
FT                   /protein_id="AAU90502.1"
FT                   /translation="MQAEDLKLILASTSPRRRELLGRFGLPFEVLGVEVEEVPRCGEAA
FT                   EDYVRRVASDKSARGQSMAPSDAAVLAADTEVVLDGQIFGKPQGAEHAREMLGRLSGRT
FT                   HEVLSAVSLRRGDCHWQALSVSRVRFRDLGLEEIDAYWASGEPADKAGAYAIQGRGELF
FT                   VAELQGSFSGVMGLPLLETARLLRHLGLGTARLLAGAAP"
FT   gene            381015..382469
FT                   /gene="cafA"
FT                   /locus_tag="MCA0379"
FT   CDS_pept        381015..382469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cafA"
FT                   /locus_tag="MCA0379"
FT                   /product="ribonuclease G"
FT                   /EC_number="3.1.4.-"
FT                   /note="identified by similarity to SP:P25537; match to
FT                   protein family HMM PF00575; match to protein family HMM
FT                   TIGR00757"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90493"
FT                   /db_xref="GOA:Q60BT6"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BT6"
FT                   /protein_id="AAU90493.1"
FT                   /translation="MSDEILINVTPPETRVAIVENGVVQEVLIERTRRRGLVGNIYKGR
FT                   VCRVLPGMQAVFVDIGLERAAFLHISDLSAAEREKAGTDKIEAIFREGQEIAVQVVKDP
FT                   IGTKGARLSTEISVPSVYEVYMPFSKTSGVSQRIECEAERARLRACVEAFQREHGTGGF
FT                   IARTSAEGVDESLLRADMLFLLKLWNSIAQRIKTAKVKVLLHEDLPLSMRVLRDLRRTR
FT                   VDKIRVDSRETHARLTKFAREFVPEIAPMIEHYAGERPLFDLYGVEEEIQKALERRVTL
FT                   KSGGYLIFDQTEAMTTVDVNTGAFVGGRNLEETIFKTNLEAAQAIARQLRLRNLGGIII
FT                   IDFIDMRDEDHKAQVLHALSRHLERDPAKNTISEVSPLGLVEMTRKRTRESLEQVLCEP
FT                   CPACGGRGVLKTAETTCLDIFREIIREVRQYQVQELLVLASNEVVERLLDEEADTLSEL
FT                   ESFIGVPIKFRAESQYNQEQYDVVIL"
FT   gene            382586..386383
FT                   /locus_tag="MCA0380"
FT   CDS_pept        382586..386383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0380"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL02EC4081; match
FT                   to protein family HMM TIGR02099"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90492"
FT                   /db_xref="GOA:Q60BT5"
FT                   /db_xref="InterPro:IPR011836"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BT5"
FT                   /protein_id="AAU90492.1"
FT                   /translation="MKSILRVSARAVRYGALVALLGLAAGSAAFRWWLIPGIDEFKGYL
FT                   EQRIGRLGGENIRIGHISAALWTGTLELVLREVSVLDDAGAESLRFAEIRLGIAAMASL
FT                   MAHDLRVTWLELRGTPLSLRRLADGGFGIVGLHAIETIPDWLRSLGSFRISDCRIDWQD
FT                   LQRGGARLELGDVDLLLVSRGDHHRLSVSLDPPAALAGTVRVGFDLRGDLFESSTLSGS
FT                   LYADAEDLALTALEDELPAGFRLGSGLTDVRAWGQLSAGSIESLAARFGVRNLRIEQLP
FT                   GGPGNTPGLALAALAGDVFWHREAGGWRINAQGLKVVSGGHEWPLSRLALAVTQGSDGR
FT                   VASAFAVADTLALDDLRPLWFMLGLPVPPPAGRLEALRFGYESAENPRFGLCAHFADIV
FT                   LPARDGLPGAAGVSGHVCGSDERGRGVVRMQNGVLDPAGMLAEPVLIQQADIPLAWRRT
FT                   GEDWAMRADRARLETGDWSLSASFGLSRRAGQGLWVDLRAEAGAADASRLKRYFPAKAF
FT                   PLLGRWLDQSLEHGRLDGARLRFGGPLAAFPFRKGEGLFQADVGFSGVRLRYDPEWPAL
FT                   EDAAGTVRFSGPGMEVEAASGRLAGGEIRGARATVADLAKDAVIGIEGRVSATLAQCLE
FT                   FFRTTPLRPVADKVDAVMTVEGDVLLDLAMRVPMQSKAPPFKLDGTARLSRTRVELAGL
FT                   AEPVEKADGELGFTEDGLVSGRLQGQWLHKAVSGRARRSGDGLDVDVSGQFPVAAFRDR
FT                   FPNPLWRHLAGAIPLAVSVRLPVAMEPGGGVPLSLSSDLVGTKVILPAPLGKAQGERRM
FT                   FRLDTRLGGAATRIDLSYGADVTARLDLGGEDYRLKGLQLAVGTGLPRTADGSGLRVVI
FT                   RSPSLDLAPWADVFAAGGSEREGIGMDVKALDVQIGRLLWDGAAKGPVVVQAVGRAGGL
FT                   RGMIDSAYVKGGFDADMAAGRLSSIKADLDFVKLSRLDEKAVASTDSWLDTLHPGSFPS
FT                   LSLVGRHVLWHGFDVGRLQVEVDSQARGIVLRSASLRSDNHELVVERGEWTRHGGTDRT
FT                   HIAGTLKVKNSGMLAAEFGYPEFVRDTPAEVNYTLNWAETPFGVSSANLAGTVDMKLGK
FT                   GALLKVDVGIGRFLGLFNVDALWRRLSLDFSDLFGAGMAYDGIAGKLDIAHGRAETKGF
FT                   VIDGVAAKIVIDGGVKLVTREVDQVVTVIPNTSIALPVAGVLMGGPLGPAVGAAVGAGV
FT                   FVADKMMDGQVERLTQTRYRVEGSLDNPVITKDSGDAPRE"
FT   gene            386432..387253
FT                   /locus_tag="MCA0381"
FT   CDS_pept        386432..387253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0381"
FT                   /product="hydrolase, carbon-nitrogen family"
FT                   /note="identified by similarity to OMNI:NTL01NM01917; match
FT                   to protein family HMM PF00795"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90491"
FT                   /db_xref="GOA:Q60BT4"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BT4"
FT                   /protein_id="AAU90491.1"
FT                   /translation="MKKMICAAVQMASGPQVGSNLLEAGRLVKQAAEAGARLVVLPENF
FT                   AIMGMTETDKLGVAETDGSGPIQEFLAGAAERHKVWLVGGTMPMCAGDGRVRASCLVYD
FT                   DHGRRVGRYDKIHLFDVVVPGTEETYRESLTIEPGTVPLVLDSPFGALGIAICYDLRFP
FT                   ELFRRMAQQGLDLLAVPAAFTARTGAAHWEILVRARAVENLCYTVASNQGGFHLNGRET
FT                   FGHSMVVDPWGKVLASLPTGAGIVCAEIDRERLAQVRASFPVLEHRRLHCA"
FT   gene            387283..388728
FT                   /gene="tldD"
FT                   /locus_tag="MCA0382"
FT   CDS_pept        387283..388728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tldD"
FT                   /locus_tag="MCA0382"
FT                   /product="tldD protein"
FT                   /note="identified by similarity to SP:P46473; match to
FT                   protein family HMM PF01523"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90490"
FT                   /db_xref="GOA:Q60BT3"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BT3"
FT                   /protein_id="AAU90490.1"
FT                   /translation="MATEIVAIAERAILEPCGLIPQDIEKVVARLAGSDIDDADVYLQS
FT                   SHYESWSLEDGIVKEGSYGIEQGAGLRAVSGEKTGFAYSDELALPVLLEAAGNARSIAR
FT                   GGQAGRIAVSGVQPVPRLYAPVDPLASLPAEAKIDLLRSLDAEARRADPRVEQVFVSLS
FT                   GGYSSVLIFGLDGAMHGDVRPLVRLNVSVIVEAGGRREQGSAGGGGRTDYGFFFERDRA
FT                   LGYAREAVRQALVNLEAGDAPAGTMTVVLGPGWPGILLHEAIGHGLEGDFNRKGTSAFS
FT                   GRVGERVASPLCTVVDDGTLPNRRGSLSIDDEGTPTRRTVLIEDGILKGYMQDRLNARL
FT                   MGAAPTGNGRRESYQCLPMPRMTNTYMLPGEHAPEEIIASVAKGLYARNFGGGQVDITS
FT                   GKFVFSASEAYLIEGGRITRPVRGATLIGNGPDVLTRVSMVGNDLELDPGVGTCGKDGQ
FT                   SVPVGVGQPTLKIDGLTVGGTRV"
FT   gene            388721..390055
FT                   /gene="pmbA"
FT                   /locus_tag="MCA0383"
FT   CDS_pept        388721..390055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmbA"
FT                   /locus_tag="MCA0383"
FT                   /product="pmbA protein"
FT                   /note="identified by similarity to SP:P24231; match to
FT                   protein family HMM PF01523"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90489"
FT                   /db_xref="GOA:Q60BT2"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BT2"
FT                   /protein_id="AAU90489.1"
FT                   /translation="MSDTRTELERLESLTRLCLEEAARQGASAAEVACSADQGLSLTVR
FT                   LGAVETIEHHRSQGVGITVYYGQRKGSASTTDLSERALTDTVGAACRIARYGAEDPCAG
FT                   LPEAELLAKDIPDLDLYHPWTLDAEQGIELALACENAARGHSDAITNSEGASLNAFEGV
FT                   RVLGNSLGFLHGYASSRHSLSCSVIGERDGNMQRDDWWTVARDPAELESAEAVGRKAAE
FT                   RTVRRLGARGLSTRQCPVLFAADVASSLIGHLIAAIRGGNLYRKSSFLLDAVGQRIFPE
FT                   FVHIHERPHLRRGLGSAPYDAEGVATRDRDLVRDGVLESYVLSTYSARKLGLQTTGNAG
FT                   GVHNLIVAPGQEDCDTLIRRMGTGLIVTELLGQGVNIVTGDYSRGAAGYWVENGEIRFP
FT                   VEEITIAGNLRDMFGHVVAIGNDVDLRGNIRTGSILIESMTVAGD"
FT   gene            complement(390121..390441)
FT                   /locus_tag="MCA0384"
FT   CDS_pept        complement(390121..390441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0384"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90488"
FT                   /db_xref="GOA:Q60BT1"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BT1"
FT                   /protein_id="AAU90488.1"
FT                   /translation="MGESETIEIWLENFRHRRRESPSIRHSAHPVEAALAKRPIGPGRG
FT                   KCLENSRAAAVFGAAQARREAAAGERPNPVIIPVLLPREGSSPHRGEFASRHVPGRRPF
FT                   AP"
FT   gene            390880..391359
FT                   /locus_tag="MCA0385"
FT   CDS_pept        390880..391359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0385"
FT                   /product="competence/damage-inducible protein CinA domain
FT                   protein"
FT                   /note="identified by similarity to SP:P41053; match to
FT                   protein family HMM PF02464; match to protein family HMM
FT                   TIGR00199"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90487"
FT                   /db_xref="GOA:Q60BT0"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BT0"
FT                   /protein_id="AAU90487.1"
FT                   /translation="MYVLAGKVGRQLQDRGRRLVTAESCTGGWIAQCVTSVPGSSGWFE
FT                   RGFVTYSNESKQELLGVPARLIAAHGAVSAETVAAMVGGALAHSRADCAVAVSGIAGPE
FT                   GGSPDKPVGTVWLAWQLKGEAPLTRCFRFEGDREAVRRQAVMAALEGLTDVCSAS"
FT   gene            391340..391912
FT                   /locus_tag="MCA0386"
FT   CDS_pept        391340..391912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0386"
FT                   /product="putative 2'-5' RNA ligase"
FT                   /note="identified by similarity to SP:P37025; match to
FT                   protein family HMM PF02834; match to protein family HMM
FT                   TIGR02258"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90486"
FT                   /db_xref="GOA:Q60BS9"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR014051"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BS9"
FT                   /protein_id="AAU90486.1"
FT                   /translation="MSALLPEPPPLRLFFALWPDAGVRETLGRLVRSLRRTVKGRWVEP
FT                   DKLHLTLAFLGAVPAERLPELTAMTGDLDLPPFELALDRLEYWQRNRVLCLGASATPPL
FT                   LIELVGILNSKLGRAGFPVERRPFRPHLTLARKAEAAWSAMPLKTSVTWPVDRVTLVES
FT                   RLSRAGPLYLVRAEKQWRAMPEMAAMK"
FT   gene            391945..392988
FT                   /gene="recA"
FT                   /locus_tag="MCA0387"
FT   CDS_pept        391945..392988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recA"
FT                   /locus_tag="MCA0387"
FT                   /product="recA protein"
FT                   /note="identified by similarity to SP:P18076; match to
FT                   protein family HMM PF00154; match to protein family HMM
FT                   TIGR02012"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90485"
FT                   /db_xref="GOA:Q60BS8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BS8"
FT                   /protein_id="AAU90485.1"
FT                   /translation="MDENKRKALGAALSQIEKQFGKGSVMRMGDVAAVRDIDVIPTGSL
FT                   ALDIALGCGGLPRGRIVEIYGPESSGKTTLTLEVIAQAQKTGGVAAFVDAEHALDPVYA
FT                   EKIGVNLDDLLVSQPDTGEQALEIADVLVRSGGVDVVVIDSVAALTPKAELEGEMGDSH
FT                   MGLQARLMSQALRKLTANIKRSNTLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVR
FT                   LDIRRSGAIKNGDEVIGNETRVKVVKNKVAPPFRTADFEILYGEGISREGELIDLGVNH
FT                   DIVQKSGSWYSYGGDRIGQGKDNVRIYLKEHPEVAAAIEAAVREKALAGFQHAPSAERA
FT                   ALEESGF"
FT   gene            393039..393455
FT                   /gene="recX"
FT                   /locus_tag="MCA0388"
FT   CDS_pept        393039..393455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recX"
FT                   /locus_tag="MCA0388"
FT                   /product="recX protein"
FT                   /note="identified by similarity to SP:P37861; match to
FT                   protein family HMM PF02631"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90476"
FT                   /db_xref="GOA:Q60BS7"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BS7"
FT                   /protein_id="AAU90476.1"
FT                   /translation="MARREHSRLELQRKLAARGFEFPTIAAVLAECSDRGWQSDARFAE
FT                   GFVCARKAKGYGVNRIRQELRLRGVEADLADSRDWMTDMDRVYTKKYRGKLAVTTPRER
FT                   ASRARFLAQRGFTSSQIRDFFERLGVDGEYPDTD"
FT   gene            393475..396078
FT                   /gene="alaS"
FT                   /locus_tag="MCA0389"
FT   CDS_pept        393475..396078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alaS"
FT                   /locus_tag="MCA0389"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="identified by similarity to SP:P00957; match to
FT                   protein family HMM PF01411; match to protein family HMM
FT                   PF02272; match to protein family HMM PF07973; match to
FT                   protein family HMM TIGR00344"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90475"
FT                   /db_xref="GOA:Q60BS6"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BS6"
FT                   /protein_id="AAU90475.1"
FT                   /translation="MTSAELRARFLKFFADRGHTVVASSSLVPVNDPTLLFTNAGMVQF
FT                   KDVFLGREHRPYVRAASAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRE
FT                   AIVYAWEFLTEVLMLPPERLWITVYAEDKEAERIWLEEVGVDPGRFTRIATSDNFWSMG
FT                   DTGPCGPCSEIFYDHGPSVAGGPPGTPEEDGDRYVEIWNLVFMQYERAGDGTLTPLPKP
FT                   SVDTGMGLERLAAVMQRVRNNYDIDLFRNLVKAAAELAGTTDLAQSSLRVIADHIRSCA
FT                   FLVTDGVLPSNEGRGYVLRRIIRRAIRHGYKLGIREPFFYKLVGPLCAEMGQAYPELVE
FT                   ARPRVEQVLDKEEERFAETLEQGMKILDVAIRDLGSPVISGDTAFQLYDTYGFPVDLTA
FT                   DVAREHGLQVDMAGFERAMEAQRERARAASHFSVDYSQEIHLDVACEFTGYRNAVEDTR
FT                   IVALLRDGQAVDRLEAGEDGVVVLEKTPFYAESGGQVGDRGVIRSDSAVFEVADTRKQG
FT                   SDLILHRGKLREGALLRGAVCRAEVEQSLRLATALNHSATHLLHAALRRVLGEHVTQKG
FT                   SLVDPERLRFDFSHFEPVSPEQLDEIERLVNREIRRNAEVTAEVMAKDAAMRLGAMALF
FT                   GEKYGDDVRVLRIGDFSTELCGGIHARRAGDIGLFKIVSESGVAAGVRRIEAVTGAAAV
FT                   EAVEATERLLRRLAERMKAGRDTLEERLDQMFEKNRALERELERLKAKTAGAAGADLAS
FT                   RAVDIAGVKVLAARVDEADARMLRELVDQLKDRLGSAAIVLAAVEGGKVSLVAGVTRDQ
FT                   TGHIRAGDLVNSVATRIGGKGGGRPDLAQAGGNRPEELQGALDGVPEWVRRMLNA"
FT   gene            396113..397342
FT                   /locus_tag="MCA0390"
FT   CDS_pept        396113..397342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0390"
FT                   /product="aspartate kinase, monofunctional class"
FT                   /EC_number="2.7.2.4"
FT                   /note="identified by similarity to SP:P26512; match to
FT                   protein family HMM PF00696; match to protein family HMM
FT                   PF01842; match to protein family HMM TIGR00656; match to
FT                   protein family HMM TIGR00657"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90474"
FT                   /db_xref="GOA:Q60BS5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BS5"
FT                   /protein_id="AAU90474.1"
FT                   /translation="MALFVHKYGGTSVGSPERIKNVAKNVIRARSRGDDIIVVVSAMSG
FT                   ETNRLVALAHEMHERPSTREMDVLLATGEQVTIALLSMALEAAGCPACSYTGGQVRILT
FT                   DDAHTKARILDIDTDRIRSDLAAGRVVVVAGFQGITEAGDITTLGRGGSDTTAVALAAA
FT                   LKADECLIYTDVDGVYTTDPRIEPKARRLDRITFEEMLEMASLGSKVLQIRSVEFAGKY
FT                   NVPLRVLSSFAAGPGTLITYEEASVEKPLISGIAFNRDEAKLTVKGVPDKPGVAYQILG
FT                   PVAHANIEVDMIVQNVAEDATTDFTFTVHRNDYRKALDILQATCTALGAREVTGDDKIV
FT                   KVSLVGVGMRSHAGIAARMFEALAREGINIRMISTSEIKISIVVDEKYLELAVRTLHEA
FT                   FNLDREPDAV"
FT   gene            397493..397687
FT                   /locus_tag="MCA0391"
FT   CDS_pept        397493..397687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0391"
FT                   /product="carbon storage regulator"
FT                   /note="identified by similarity to SP:P31803; match to
FT                   protein family HMM PF02599; match to protein family HMM
FT                   TIGR00202"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90473"
FT                   /db_xref="GOA:Q60BS4"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BS4"
FT                   /protein_id="AAU90473.1"
FT                   /translation="MLILTRRVGETLMIGDDVTVTVLGVKGNQVRIGVNAPKDVSVHRE
FT                   EIYERIKKEQQAGPEHDSD"
FT   gene            397706..397798
FT                   /locus_tag="MCA_tRNA-Ser-2"
FT   tRNA            397706..397798
FT                   /locus_tag="MCA_tRNA-Ser-2"
FT                   /product="tRNA-Ser"
FT   gene            397949..398203
FT                   /gene="rpsP"
FT                   /locus_tag="MCA0392"
FT   CDS_pept        397949..398203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="MCA0392"
FT                   /product="ribosomal protein S16"
FT                   /note="identified by similarity to SP:P02372; match to
FT                   protein family HMM PF00886; match to protein family HMM
FT                   TIGR00002"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90472"
FT                   /db_xref="GOA:Q60BS3"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BS3"
FT                   /protein_id="AAU90472.1"
FT                   /translation="MVSIRLARGGAKKRPFYHVVVAESRSKRDGRYIERVGFFNPIARG
FT                   QEERLRLDESRIAYWIGTGAKPSDRVVSLIKEFKKQQQV"
FT   gene            398203..398721
FT                   /gene="rimM"
FT                   /locus_tag="MCA0393"
FT   CDS_pept        398203..398721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="MCA0393"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="identified by similarity to SP:P21504; match to
FT                   protein family HMM PF01782; match to protein family HMM
FT                   PF05239; match to protein family HMM TIGR02273"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90471"
FT                   /db_xref="GOA:Q60BS2"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BS2"
FT                   /protein_id="AAU90471.1"
FT                   /translation="MPGNSGNDRSVVVGRVSGAFGVRGWVKAVSFTDPPVNLVGYRPWT
FT                   LRRGDAERRADVLEGREHGNAVIVRLQGVDTREQAEALKGFEVTVRRSQLPPPAPGEYY
FT                   RVDLVGLKVVNLGETVLGEVVDVMETGANDVLVVQGDRERLLPFVQGVFVKSVNLEESR
FT                   IVVDWDPGF"
FT   gene            398738..399493
FT                   /gene="trmD"
FT                   /locus_tag="MCA0394"
FT   CDS_pept        398738..399493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="MCA0394"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /note="identified by similarity to SP:P07020; match to
FT                   protein family HMM PF01746; match to protein family HMM
FT                   TIGR00088"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90470"
FT                   /db_xref="GOA:Q60BS1"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BS1"
FT                   /protein_id="AAU90470.1"
FT                   /translation="MRFDIVTLFPEMVRDAARYGVTGRALAAGKVSLEVWNPRDFTRDR
FT                   HRTVDDRPYGGGPGMVMKVEPLRDAIRAAKGQATPGARVVLMSPQGTRLDQAAVRRFAA
FT                   APGLILVAGRYEGVDERLIETEIDEEWSIGDYVLSGGELPALVVFDAVVRLLPGVLGDA
FT                   ESAEQDSHAEGLLDHPHYTRPERVAGRDVPAVLQSGNHAAIGRWRLKQALGKTWLKRPD
FT                   LLACRVMTPEQLELLDEFKREFELQKNRG"
FT   gene            399498..399842
FT                   /gene="rplS"
FT                   /locus_tag="MCA0395"
FT   CDS_pept        399498..399842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="MCA0395"
FT                   /product="ribosomal protein L19"
FT                   /note="identified by similarity to SP:P02420; match to
FT                   protein family HMM PF01245; match to protein family HMM
FT                   TIGR01024"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90469"
FT                   /db_xref="GOA:Q60BS0"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BS0"
FT                   /protein_id="AAU90469.1"
FT                   /translation="MNIVQQLESEWMSGKTIPAFGPGDTVVVQVKVKEGNRERLQAFEG
FT                   VVIAKRNRGYNSAFTVRKVSHGEGVERVFQTYSPQVEEIQVKRRGDVRRAKLYYLRDRA
FT                   GKAARIKEKI"
FT   gene            399926..400855
FT                   /gene="xerD"
FT                   /locus_tag="MCA0396"
FT   CDS_pept        399926..400855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerD"
FT                   /locus_tag="MCA0396"
FT                   /product="tyrosine recombinase XerD"
FT                   /note="identified by similarity to SP:P21891; match to
FT                   protein family HMM PF00589; match to protein family HMM
FT                   PF02899; match to protein family HMM TIGR02225"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90461"
FT                   /db_xref="GOA:Q60BR9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BR9"
FT                   /protein_id="AAU90461.1"
FT                   /translation="MSEVLPDAGAVREADLLAIQRFVESLWVEEGLSPHTLKAYGSDLR
FT                   LFAAWLATNRCAELTALTGEDIEAYLGWRHSRKSKSRTSARVLSSIRHFCAYRLRRGEI
FT                   TGDPCALIAPPKLGRFLPDTLTESEVEALLAAPDVDTPLGFRDRAMLEMLYATGLRVSE
FT                   LVGLSFGQISLRQGVVRISGKGDKDRLVPVGEEALDWLERYLDKVRPVTLKGRQSDFLF
FT                   VTDRGGAMTRQAFWHLIKRYAGQAGISKPLSPHTLRHAFATHLLNHGADLRVVQMLLGH
FT                   SDLSTTQIYTHVAQERLKELHTRFHPRG"
FT   gene            400872..401654
FT                   /gene="lpxA-1"
FT                   /locus_tag="MCA0397"
FT   CDS_pept        400872..401654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxA-1"
FT                   /locus_tag="MCA0397"
FT                   /product="acyl-(acyl-carrier-protein)--UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /note="identified by similarity to SP:P10440; match to
FT                   protein family HMM PF00132; match to protein family HMM
FT                   TIGR01852"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90460"
FT                   /db_xref="GOA:Q60BR8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BR8"
FT                   /protein_id="AAU90460.1"
FT                   /translation="MSSIHPTACVAPTAKLGADISVGPFAVVEDYVELGDGCRIGAHAV
FT                   IHAYVRMGRANVVHPHAVLGGLPQDLGFDPATETYVELGDGNVLREGVTISRATRAGGS
FT                   TRLGSNNYLMNNTHVGHDCVLGDHNILASGATLGGHCRVDDRVFFGGGVMVHQFCRIGS
FT                   LAMLQGLAGINKDVIPFTLVGGRPGKHYRLNLIGMRRAGIDGDRLKTVSAAFRRLRARA
FT                   GLDGLPDTPELAYLRAWCGAGSKRGTLAFFEPESREPD"
FT   gene            401680..402639
FT                   /locus_tag="MCA0398"
FT   CDS_pept        401680..402639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0398"
FT                   /product="putative oxidoreductase, Gfo/Idh/MocA family"
FT                   /note="identified by similarity to GP:1001423; match to
FT                   protein family HMM PF01408; match to protein family HMM
FT                   PF02894"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90459"
FT                   /db_xref="GOA:Q60BR7"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BR7"
FT                   /protein_id="AAU90459.1"
FT                   /translation="MNPLKCAVIGVGYLGKFHAEKYAALPGCELVAVVDADPVTAAEIG
FT                   DRLGVRGLTDHRALLGKVDAVSVVVPTSLHHRVARDFLEAGAHVLVEKPITVTVEEADE
FT                   LIRIAKEKQRVLMVGHLERFNAAVLGLDLDHHKPLFIESHRLAPFKPRANDVSVVLDLM
FT                   IHDIDIILDMVDSEVERIDAKGVAVLTGDIDIANARLQFKSGCVANVTASRVSLKVERK
FT                   MRMFMPNAYVSVDFQNRVLARHRKGEGEMFPGVPEILSEESVFENGDALMEEIRHFLDC
FT                   IREHREPLVSGAAGRRALATAIEITNLLKVQESRSCTA"
FT   gene            402636..403730
FT                   /locus_tag="MCA0399"
FT   CDS_pept        402636..403730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0399"
FT                   /product="aminotransferase, DegT/DnrJ/EryC1/StrS family"
FT                   /note="identified by match to protein family HMM PF01041"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90458"
FT                   /db_xref="GOA:Q60BR6"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BR6"
FT                   /protein_id="AAU90458.1"
FT                   /translation="MIPMVDLKTQYARLKPEIDKGLADALESCAFVLGPNVQAFEKEAA
FT                   GYLGVKHAIGVASGTDALHLALLAAGIGEGDEVITSPFTFIATAEAIRYVGAKPVFVDI
FT                   DAKTFNLCPAAVEAAVTARTRAIMPVHLFGQPADMPRLQSIAERHGLKIVEDCAQSFGA
FT                   TIGGRQTGSFGVSSGFSFFPSKNLGCYGDGGLVTTDSDEVAEQVRMLRNHGSKVRYYHD
FT                   VIGYNSRLDELQAVVLRVKLKYIDEFNANRRRVAHLYSELLGGIAEVPYEDGIGQHVYH
FT                   QYTLLSDRRDAILEALQKAGIGCAIYYPVPLHRQNVFARDYADLSLPVCEAVAARCISL
FT                   PIFPELAEADIRRIADVVRQAVNG"
FT   gene            403723..404877
FT                   /gene="lpxB"
FT                   /locus_tag="MCA0400"
FT   CDS_pept        403723..404877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxB"
FT                   /locus_tag="MCA0400"
FT                   /product="lipid A disaccharide synthase (lpxB)"
FT                   /EC_number="2.4.1.182"
FT                   /note="identified by similarity to SP:P10441; match to
FT                   protein family HMM PF02684; match to protein family HMM
FT                   TIGR00215"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90457"
FT                   /db_xref="GOA:Q60BR5"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BR5"
FT                   /protein_id="AAU90457.1"
FT                   /translation="MAERAPLVMLVAGEVSGDQHAAAMFRELRTLIPQVRGIGMGGSAM
FT                   REAGIDIRVDSTGLGVIGLAEIARHYGEIRRALEAMKALARTERPDLLICVDYKEFNFR
FT                   LARAAKAAGIKVLFYVSPQVWAWRPGRVKSYGKAIDHMAVIFPFEVPFYERHGIPVTYV
FT                   GHPLAGKIAPVADKGKVRREQGMDGPGPLVGLLPGSRGNEIRRLLPMLLQTAARIAGER
FT                   PDARFVLIQAPSVADELLAAELETAPVPVRVVKERRHEILGSCDAVITTSGTATLEVAL
FT                   LGVPMAIVYKLAPLSYWLGRLLVTIPFIGLPNILAGRRIVEEFIQHAANAEMVGGEILR
FT                   ILNDPAYALRIRDDLVEVRTLLGEGGGSRRLAELAAELLERPAR"
FT   gene            404950..405450
FT                   /locus_tag="MCA0401"
FT   CDS_pept        404950..405450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0401"
FT                   /product="putative transcription elongation factor"
FT                   /note="identified by similarity to OMNI:CC2202; match to
FT                   protein family HMM PF01272"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90456"
FT                   /db_xref="GOA:Q60BR4"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BR4"
FT                   /protein_id="AAU90456.1"
FT                   /translation="MSRAFVKETDGEDLDDGAPDRPVSPHPNYVTPAGLAQLQARVAEL
FT                   TAERQRLLGDESVGAKQQLRRVERELRYYDERVVSAIPVDPAARSGDRVHFGATVEVED
FT                   EAGNVQRYSIVGEDEADAAHGKISWVSPLARALLNAEAGDTVTWKRPAGDKELHILAIH
FT                   PYR"
FT   gene            405463..406200
FT                   /locus_tag="MCA0402"
FT   CDS_pept        405463..406200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0402"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to OMNI:DR2490; match to
FT                   protein family HMM PF01863"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90455"
FT                   /db_xref="GOA:Q60BR3"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BR3"
FT                   /protein_id="AAU90455.1"
FT                   /translation="MEHSLPPYRLRRSPRAKYLRLLIRPDGIEVVVPTGLSDATVLAFV
FT                   RQHGGWAQARLEELLARLAKLRQGQAERFPAEGGSVPLEGRETPLFIEETGGSRIRVSL
FT                   EDQGLRLILPRTCGADRDRYVRDALFGWMKRRLPGRVTELIERHAPLHGLYPRQLRIKS
FT                   MRTRWGSCGPANDINLNWLLGLAPLSVLEYVVVHELCHIRHRNHSRDFWELVAAHLPDW
FT                   RQERQWLKAHGGGLIQRFDPAFR"
FT   gene            406200..406688
FT                   /locus_tag="MCA0403"
FT   CDS_pept        406200..406688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0403"
FT                   /product="putative suppressor for copper-sensitivity D"
FT                   /note="identified by similarity to GP:2327006"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90446"
FT                   /db_xref="GOA:Q60BR2"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BR2"
FT                   /protein_id="AAU90446.1"
FT                   /translation="MAHRWRRALRWGAVVALFFAVQGVLNRDMASGPAPAIEGSFLDGS
FT                   PASLDGLRGRPALVYFWASWCPICGTMEDEIGVLARDHAVITVAYQSGDAGEVARHVAE
FT                   RRLDWRVVPDPDGTIGAAYGIRGVPAFFVLGPDGTIHSRNVGFTPEWLLRLRLWLAAG"
FT   gene            407104..407259
FT                   /locus_tag="MCA0404"
FT   CDS_pept        407104..407259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0404"
FT                   /product="type I restriction-modification system, M subunit
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90445"
FT                   /db_xref="GOA:Q60BR1"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BR1"
FT                   /protein_id="AAU90445.1"
FT                   /translation="MTGFLHMFWLKDESPSDSDGLPAPAVIAREIVADLEAALDRCRLI
FT                   GADLGE"
FT   gene            407486..408094
FT                   /locus_tag="MCA0405"
FT   CDS_pept        407486..408094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0405"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01SMA00006"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90444"
FT                   /db_xref="GOA:Q60BR0"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BR0"
FT                   /protein_id="AAU90444.1"
FT                   /translation="MKAVERGDYPAALREFKQAAERGESAAQVNLGNLYMKGLGVEQDY
FT                   AAAERWYRQAAEHGDPMGQSKLGILYYYGLGVDKNTDEAARWFVKAAEQGEPGAAAVLG
FT                   SMYAEGEGVIRDNVKAYYWYTLAADGGQTDALQARATLVDEMTPGEIAEALQRVGEWRE
FT                   AQLEAAKSSAQDIADKPSGVKGKKRNGSGGARKKSRNRG"
FT   gene            408679..409215
FT                   /locus_tag="MCA0406"
FT   CDS_pept        408679..409215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0406"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90443"
FT                   /db_xref="GOA:Q60BQ9"
FT                   /db_xref="InterPro:IPR025411"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BQ9"
FT                   /protein_id="AAU90443.1"
FT                   /translation="MDRNTSWRRPSAAGLLVAALLAACATIRVDTGFDKNADFSRYRTY
FT                   FWLNGPASGDASVDRRIVELVDAALRSKGWRRAAEGKGDAAVDVEVLTEEEERNDTYYD
FT                   GWVLNQNLGPAQTVVTTFREGTLIVNVLDGRSMRPVWRGVAHEMLSGNPAENEKLAKEA
FT                   IARMFAAFPPGPAPR"
FT   gene            409353..409721
FT                   /locus_tag="MCA0407"
FT   CDS_pept        409353..409721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0407"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90442"
FT                   /db_xref="GOA:Q60BQ8"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BQ8"
FT                   /protein_id="AAU90442.1"
FT                   /translation="MEAKSAPYAASGLEGTSSVIAGIGLKCAFLGSVCSNAVARVSASD
FT                   RQDLVDWPGLKRREKIGEKMRLADRPGSAVLKLGVAMTDAENATPVLRSVSMIVPQTLF
FT                   NLQISGDGHLPLRRRRSR"
FT   gene            409964..410731
FT                   /locus_tag="MCA0408"
FT   CDS_pept        409964..410731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0408"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01SS00205"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90441"
FT                   /db_xref="GOA:Q60BQ7"
FT                   /db_xref="InterPro:IPR019207"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BQ7"
FT                   /protein_id="AAU90441.1"
FT                   /translation="MICLGAAEAADKPATGTEHPQEQVIGPQVDLLLRQMGDYLKSAKE
FT                   FSVHVDALYDDLLASGQKIQLAASDDISVRRPDRFRVRYRTDMGGKRFWYDGKTFTLLD
FT                   EAHGTYAVEQTPAGIDATLDYLIGRLGFTPPLSDLLYSDPYAILKQHVVFGFQAGMSDV
FT                   EGTPCHHLAFVGKNVDWQLWIEDGKLPLPRKLVITYKTLPGAPQYMAVLSDWDFATHLP
FT                   DSAFSAVIPPKADRIGFLKAAVSAGQERAKKAP"
FT   gene            410752..411822
FT                   /locus_tag="MCA0409"
FT   CDS_pept        410752..411822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0409"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90440"
FT                   /db_xref="GOA:Q60BQ6"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BQ6"
FT                   /protein_id="AAU90440.1"
FT                   /translation="MNRNTGFEKRLGITVLALLLACAELPRIAGAHGGFGGGFGGGHFG
FT                   GGFGGGGFGSHVGGGGFGQRGGGDRGEEGPRYGGTGIGGGSFGGGGLGSVRASDGADGA
FT                   GHDWRQNANRDFGNGVQGFQAPEDRQAATPAQRQEDRDDEVNTAQQNREKEIDTVQQNA
FT                   YKQQDAMAQYHYQQAEQLQKNRYDYYGGGNYYGPVFIGGTWGGYYSGMAMMGMMEGLMI
FT                   GEMVASVPRNSQPVVVENNTYYYSNGAYYLPQGSGYVVTPPPLGATVTSLPPSCVTVYS
FT                   GQQPYSDCGGAFYTPSGGGYTVVMPPPGLTVNSLPGGAATHTVNGVRYYEFGGVWYRPF
FT                   YSGSDVVYQVVNSPNA"
FT   gene            411815..412087
FT                   /locus_tag="MCA0410"
FT   CDS_pept        411815..412087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0410"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90439"
FT                   /db_xref="GOA:Q60BQ5"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BQ5"
FT                   /protein_id="AAU90439.1"
FT                   /translation="MPEPIIFRRTVVRISNEEKGSGGMPSRDVSGRSRALPGAVAVALL
FT                   CGCSATKQAREVQPSGFLGSYSSLRKGNGDGPLLVYANPAADCRK"
FT   gene            412094..412390
FT                   /locus_tag="MCA0411"
FT   CDS_pept        412094..412390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0411"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90429"
FT                   /db_xref="GOA:Q60BQ4"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BQ4"
FT                   /protein_id="AAU90429.1"
FT                   /translation="MMVNPVTLWAKTGDSWLQRLEPKERDMLRKLGTDTLLEVMNKARF
FT                   EVVTRQIRAQGAKSADLPHSCGPARRGGVTASSDSPGVRRALCVACMLLRRMA"
FT   gene            412474..413778
FT                   /locus_tag="MCA0412"
FT   CDS_pept        412474..413778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0412"
FT                   /product="LysM domain protein"
FT                   /note="identified by similarity to SP:P40680; match to
FT                   protein family HMM PF01476; match to protein family HMM
FT                   PF03734; match to protein family HMM PF05036"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90428"
FT                   /db_xref="GOA:Q60BQ3"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BQ3"
FT                   /protein_id="AAU90428.1"
FT                   /translation="MAVAGALLGGCAFTPPPREAPPSPPPLPLAVEKHRFSVAGDESVV
FT                   GQLASVEIRDGDTLSDIARHYGLGFQELAEANPGVDPWVPEAGRRLVLPLQFTLPDAPR
FT                   KGMVINLATMRLYHFPAKAAEGVISTYPVGIGKEGRSTPTGYMTVVRKTEFPTWYPTEN
FT                   IRRDHALKGDPLPPAVSPGPDNPLGDYAMYLSRPQYLIHGTNKPYSIGFRASNGCIRLY
FT                   PEDIAAVFPEVKPGAAVRIVNQPYLVGRKGGQVYLEAHEPYEELNRARLKSELTARLKR
FT                   LEKKDGVVLDWTRVEQVLSEARGIPVPIQANSPPMAAVVAQAIELRRPVAWFGRPELPA
FT                   ADAGGWLVKAATTHEESSARRVAAVLNHQGPPIPARAVKAGDGFEVLAGPFKDDKTAKT
FT                   VAKRLKIDLELDAEVRPPVDSMHVAGARPLARSGQ"
FT   gene            complement(413786..414334)
FT                   /locus_tag="MCA0413"
FT   CDS_pept        complement(413786..414334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0413"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01SM00917; match
FT                   to protein family HMM PF02622"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90427"
FT                   /db_xref="GOA:Q60BQ2"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BQ2"
FT                   /protein_id="AAU90427.1"
FT                   /translation="MRPPEIPEGHADTSGQFLVAHPKMPANIFAHSVIYVVSHNADGAM
FT                   GLIVNRLAGAGPLGKLLEAFGLASKAQREIKLYLGGPVGIGQGFVLHSDDYAGASTRAL
FT                   KKGLSLSTGLDVLEAIARGRGPRQVRMLFGYAGWSPGQLDGEIARGDWLLAPADTSLIF
FT                   SEEPDKVWEEALKHAGLPL"
FT   gene            complement(414444..414761)
FT                   /locus_tag="MCA0414"
FT   CDS_pept        complement(414444..414761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0414"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:P45806; match to
FT                   protein family HMM PF07119"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90426"
FT                   /db_xref="GOA:Q60BQ1"
FT                   /db_xref="InterPro:IPR010780"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BQ1"
FT                   /protein_id="AAU90426.1"
FT                   /translation="MNTKRGLTIILVLTAALANGCASIRARTDVLPRQGWTVYPGAQQG
FT                   VKDIDAAVDGRLPYPGWMHVLLLPAFVLDLPVGAVFDTLALPYDLYRMHHPEDFAGRKR
FT                   K"
FT   gene            complement(414866..416083)
FT                   /locus_tag="MCA0415"
FT   CDS_pept        complement(414866..416083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0415"
FT                   /product="TPR domain protein"
FT                   /note="identified by similarity to OMNI:NTL03PA01484; match
FT                   to protein family HMM PF00515; match to protein family HMM
FT                   PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90425"
FT                   /db_xref="GOA:Q60BQ0"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR017560"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BQ0"
FT                   /protein_id="AAU90425.1"
FT                   /translation="MTSFWVLAATLLLAGYGFFLPTLLGQKSAAGVDRARLNWLINRQK
FT                   REELAAETGDDQAAERLGEEFDRDLLADLAAAETGPRRQPPEAGKTAVIVVLTALPLAI
FT                   LALYGGLGRMDLVARPATVAAAEPAMAAGDLQARIEQLSRRLQQQPNDLDGWLLLGRSL
FT                   LAVQQTDKAVQAYEFALKLAPGNPDVEALYAQALGEANQGSLAGKPTEIIEGILQRNPD
FT                   HMHSLWLAGLAAVEREDKPKALEYWKKLRSLLPPDGEQTRQLDGYIAELAGTAPPRASA
FT                   DTAPATAGAGKSIRVKVTLDNKLKGQAGPDDVVFVFARAADGPPMPLAISRKKVRDLPA
FT                   EITLNDGMAMAPGMKLSSFPRIVIGARVSKTGNAMPSPGDLQGLTSPVEAQDGGTYSVE
FT                   IGQVVN"
FT   gene            complement(416089..416550)
FT                   /gene="ccmH"
FT                   /locus_tag="MCA0416"
FT   CDS_pept        complement(416089..416550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmH"
FT                   /locus_tag="MCA0416"
FT                   /product="cytochrome c-type biogenesis protein CcmH"
FT                   /note="identified by similarity to SP:P33925; match to
FT                   protein family HMM PF03918"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90424"
FT                   /db_xref="GOA:Q60BP9"
FT                   /db_xref="InterPro:IPR005616"
FT                   /db_xref="InterPro:IPR038297"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BP9"
FT                   /protein_id="AAU90424.1"
FT                   /translation="MKRLILCLCGMLAISAAEAMEIRQFDDPAKEERYETLIKDLRCLV
FT                   CQNQSLAESDAELAKDLRTEVYNIIQSGKSSEEAVRFLTERYGDFVLYRPPFKRITLLL
FT                   WLGPFLLLAGGAVFLWKQARRRAAAAQQDATLSAEERRRLQQLKDRFQG"
FT   gene            complement(416547..417113)
FT                   /gene="dsbE-1"
FT                   /locus_tag="MCA0417"
FT   CDS_pept        complement(416547..417113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbE-1"
FT                   /locus_tag="MCA0417"
FT                   /product="thiol:disulfide interchange protein DsbE"
FT                   /note="identified by similarity to SP:P33926; match to
FT                   protein family HMM TIGR00385"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90423"
FT                   /db_xref="GOA:Q60BP8"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BP8"
FT                   /protein_id="AAU90423.1"
FT                   /translation="MMPIERNPTVTSHMRFAIPLVIFVLLVVLLGVGLTLDPREVPSPL
FT                   IGKPAPAFSLPEVAAADRTLSLEQLKGQVFLLNVWASWCVSCRQEHPVLVDFAKRGIVP
FT                   IYGLNYKDTRNDALAWLKRFGDPYRASVFDEDGKTGIDWGVYGVPETFLVDKHGVIRYK
FT                   QTGPVTHEDLENKILPLIRELQGAA"
FT   gene            complement(417110..419083)
FT                   /gene="ccmF"
FT                   /locus_tag="MCA0418"
FT   CDS_pept        complement(417110..419083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmF"
FT                   /locus_tag="MCA0418"
FT                   /product="cytochrome c-type biogenesis protein CcmF"
FT                   /note="identified by similarity to SP:P33927; match to
FT                   protein family HMM PF01578; match to protein family HMM
FT                   TIGR00353"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90422"
FT                   /db_xref="GOA:Q60BP7"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003567"
FT                   /db_xref="InterPro:IPR003568"
FT                   /db_xref="InterPro:IPR032523"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BP7"
FT                   /protein_id="AAU90422.1"
FT                   /translation="MIAELGHIALIMALLMALLQGAFPLMGASQGVDIWMSVAKPAGRA
FT                   QFLFLLVSFGALTACFVNNDFSVEYVARNSNSALPLYYRIAAVWGSHEGSMLLWATILG
FT                   LWTAAVTVFSRSLSEDFLARVLGIMGLVSVGILLFILFTSNPFERLTPVPPDGNDLNPL
FT                   LQDFGMTVHPPMLYMGYVGLSVAFAFAIAALLGGSLDSAWARWSRPWTLVAWLFLTGGI
FT                   TLGSWWAYYELGWGGWWFWDPVENASFMPWLVATALIHSLAVTEKRGAFKAWTVLLAIF
FT                   AFSLSLLGTFLVRSGVLTSVHAFASDPTRGLFILILLAIVVGGSLLVYTVKAPAVRDVA
FT                   RYSLVSKENLLLLNNILLVTASGSILLGTLYPLILDALKLGKISVGPPYFGTVFAPLMA
FT                   PIFLLAGIGPMFAWRESPIGRILHRVRYLFPASFAAGIALAALAWDETDFKMMAGLGCA
FT                   FWLAASACLSLWSRIRLRDGWLEGLRAQSPSVYGMTAAHLGVAVFLVGAVLSDRLSQEK
FT                   LVRMAPGDSVMLAGYAFHFLGTETVQGPNFSAQQATFRVERDGESLELRPQKRNYKVQR
FT                   NMMTEAAIDPGLSRDLYVALGEPLDGNAWSVRLYVKPFIRWIWAGGLFMIAGGILSVSD
FT                   RRYRLPLPETRAVAGRAASRAI"
FT   gene            complement(419080..419541)
FT                   /gene="ccmE"
FT                   /locus_tag="MCA0419"
FT   CDS_pept        complement(419080..419541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmE"
FT                   /locus_tag="MCA0419"
FT                   /product="cytochrome c-type biogenesis protein CcmE"
FT                   /note="identified by match to protein family HMM PF03100"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90413"
FT                   /db_xref="GOA:Q60BP6"
FT                   /db_xref="InterPro:IPR004329"
FT                   /db_xref="InterPro:IPR036127"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BP6"
FT                   /protein_id="AAU90413.1"
FT                   /translation="MMTPRQRRMTWVALMVAGVSLAAFFALTAFQKNLLYFYTPSQVAS
FT                   GEAPKGYPFRIGGLVVKDSVKREPDSLTVRFEVSDGPNAVPVLYTGILPDLFREGQGII
FT                   AVGQIDDGGTFQATEVLAKHDENYMPPEVAESLKKNGGLPADYSEYRKK"
FT   gene            complement(419538..419750)
FT                   /locus_tag="MCA0420"
FT   CDS_pept        complement(419538..419750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0420"
FT                   /product="putative heme exporter protein CcmD"
FT                   /note="identified by similarity to SP:P45035; match to
FT                   protein family HMM PF04995"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90412"
FT                   /db_xref="GOA:Q60BP5"
FT                   /db_xref="InterPro:IPR007078"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BP5"
FT                   /protein_id="AAU90412.1"
FT                   /translation="MSIPISPSSEAFLKHMNFQEFFHMGGYAVYVWTSYGLCFAVLVFN
FT                   LITPLRRKNEMLKSLRRQLKQESRP"
FT   gene            420130..423453
FT                   /locus_tag="MCA0421"
FT   CDS_pept        420130..423453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0421"
FT                   /product="cytochrome c5530 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90411"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BP4"
FT                   /protein_id="AAU90411.1"
FT                   /translation="MVIADYQFGRPSPTRAPRTTIKNPGGTMNTPRPATETRRSRRLLL
FT                   GVPLLPLVLALAPQAVPAAAKIKVAKTVWSDKAGTLTVAGKAKGGSGAIDIYDINGRWL
FT                   GSGQGDGFALTLSRSDLAGVPCAVRVRSGDAEVIKAVKGAPKSCAGAPTCSIVNPTEGK
FT                   AVQAGAETAFEATASTKDPAAQPLKYEWDFAGGAMGELIAGSNPPAYKRPDTLATTVAF
FT                   VRNDSHYRVRFIATDAKGRRCEDSVEVTVGNPPSGLPGKVAEQPAPKLGGELDGIRGDV
FT                   VVMPFEEWTYQNLSDMRYGRNGWGSATPVVNNVRAYAFRKDRLPVFLSGSDVELRYSAA
FT                   SNPSDPVGGDSINSTSRNWPLGASLVDAALQKTDVWELPDRPASQKSANYYACSWAMEG
FT                   AWGAMWDCASALGKPEADEGYFIAKKDAAGNIVSDDRNTDLQHGAYMPGKDQPFESNTP
FT                   QPFSQYVAATQSDGKDKAASWFAANMLPFTDVDDRGRVNPYPLLRVEAVAKGGGSVLAR
FT                   TDGVVSASRDFHCRECHAKGGIAANPNAPRTKAAYGSSAWGKTALQIGREKGPSHRYYL
FT                   PDDKIPSQPELFSVSDIGGDPNNPFDAEYAAALNYSSMHQFYDAYPFLYKMLYGVEKLN
FT                   LSDSDKTDPTNIAHDNPMPCYGCHLSPLAYVPYKMDMAWYDEEGFDINDPAYAPNYSIS
FT                   MHRFHGELQWNDSRTDIVRDDKGAFVRFDWKTKGQHNSTRTGSLFPIFDDNGKQLPMEQ
FT                   NCLRCHAGHREQQYRDRMATAGVTCYDCHGDMLAVGEAFPKNYLANRDKLGSIDRDDYR
FT                   VPWFDQPDCGSCHIGDGNQGADKSGGFFSAGVMKRAFDDADFSATPRAVDRSDPNSRRF
FT                   SAAPLETYKAVFPTTYAYGYDPVGKMFLEQSTETRIDVPLFREGKDRHGNVACAACHGA
FT                   AHSIWPNRDPSANDNVTALQLQGHTGTILECNVCHTADSFARKEDLDGGQYSGDAKAGI
FT                   LGGPHDMHPVNDPYWWKGAQGDGANSDGTTYGGWHNDYAKLPGMKGEDQCAACHGNDHK
FT                   GTRLSKTPVDRVFDFRGFDGKKLKKAGFKTRVVKVAAGTPIGCDTCHSLQTSFIGSPGH
FT                   "
FT   gene            423936..427412
FT                   /locus_tag="MCA0423"
FT   CDS_pept        423936..427412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0423"
FT                   /product="cytochrome c5530"
FT                   /note="identified by match to protein family HMM PF00801"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90410"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:G1UBE0"
FT                   /protein_id="AAU90410.1"
FT                   /translation="MNSKHLQQRGGPLGVATGVAALVLALAGGGAQAASVSGSAKLDAG
FT                   LGKVSVKGKTAGLAPGSWVSIYDADSNMLLYTAKTDGKQKFKVTLQNGGVPCRLRLETG
FT                   DGSKVLVPVGGADASCKKAAACSIQNPASDVEIAEGQSVEFAAWAKAKKKVTLNYLWTV
FT                   SDGSDPYQSPSFSHQFNHAGQYRVMLQVADSTGNRCADDVVVRVAPPNANPYPKVSERP
FT                   APTVAEALNAADGSYVVMPFEETGMQGGSQVTLPFNPLIPYNTLNAQVFKKVKQKPALI
FT                   DPSELDVFYSAASNPKDPVGGDSINSTSQNRFSTGESGANWDPAQTTASQTVLIGGRDF
FT                   AEATLRKTEMWDKIDQPNSNLSGKPKNGKSMAEQQSTYTPAKPMMQLDEGIRGNADEGA
FT                   GARRMPGAANPYRANDPQQISAYDSASKTFLAQFIPASDVDDKGRVNPYPLFRVEARDK
FT                   GGNLVAKTDAVFSTASETRCRECHAKGKVAADDTVWRTPVQETELVNADGSPGPATGAG
FT                   SFSAGNTGYNGIWPPAIHNVFNVNAYDPLPPNKPAPYLLAGAVPADASGLRTDRVAESR
FT                   VGADGKLQIRLKFKDASEYGDPDDWVAQEKAALFNTLVLHDYMVKYSPTGTISSQIADL
FT                   VEDKLSGSRGAAMYFCSSHHTSQLKFDTGVAARSYPSNRSDYSRAFHAFHGKMQVYAQD
FT                   VSASESADGQEHKKGELIRDRRGHPLMFGGRGWDSQHNDNNGVPVKSDGSGTSYAWDTG
FT                   KNDWAPEQFPMHPKGELLYQFGEGVAAEENCAKCHTGHTEKAYRDIHYASGLKCDNCHG
FT                   DMLAVGNAYSSPRYDANLSGAGAYVGDSVHFRRPWLDEPDCGSCHVGDGNRKDPNQGFF
FT                   SAGVKKTAWQANDPAKASVFPDDARFAVMPVVETRKEKSTDANGNTVYVDKQVSVALFR
FT                   KSKDVHGTGSGGAIACSTCHGGSHAIWPNADPDANDNVTARQLQGYDGNIVECSVCHVK
FT                   DDFKEGLVATDGGASNKGVAQGVRDGKVVDATSGRAYLAGPHGMHPVNDPYWWKEAAAS
FT                   APNGSGTRKGGWHNDFAKKPGPFGEDQCAACHGSDHKGTRLSKTLTAREFVNEKGKVVK
FT                   VAANTPIGCNLCHSLQKSFTGVPTGQPLAYPPPTPSPIHGGGGGGGGGHGH"
FT   gene            427847..430600
FT                   /locus_tag="MCA0424"
FT   CDS_pept        427847..430600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0424"
FT                   /product="cytochrome c family protein"
FT                   /note="identified by similarity to GP:4325063"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90409"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BP2"
FT                   /protein_id="AAU90409.1"
FT                   /translation="MWIHRLQICPWLWAVCFIAGILPSYGGEAPADNGFDRAVLHPAIP
FT                   LLDESGRHVLDSGLPYSPKNSCGNGSGSGCHDYARITRGYHFEQGRDETRDGFGNKLGL
FT                   PQLTGPGYFGGYNCMSGNAPGWLARKSNGSAAEFGDFGAPDLVRYCGACHSGGGWGEFD
FT                   RNGGRYDEQSAETVKAFDGDYFSRQFQEPGKTGQYGGSGPSEVVAWDWRRSGVREADCM
FT                   LCHADFSRLKIFPPSGLGTGGSESAALQFARLRDEKFIAGGFFRHAASAIWEFLDVRPD
FT                   TEGGAALLAVERTPATGTATPDYRLVLDDQGNPKLHWNRDAFDESGKIQVPMLRFPASD
FT                   NCMYCHKTGNSRRGFYGFGPEVRVRMAGDGTTITDFRTDVHKGAVWTEDNGQARVIDNC
FT                   NACHARQYYKSPAANVDLDADHNFPKGNGDNDVRNDLDNAPPPASCEHCHDQAAKPALP
FT                   SGHKNVLEAHREIWKANGDMRGYPENTLDRITQTHLNVVACQTCHISRLADNGKEFPMR
FT                   YRYRVGYGGRLKIFPYKPAYRYFVQDRTSGRVLNRYERFSVIEERTGSDGGNYGAILEP
FT                   ASGKELGRVVMNGDEFGEPPTFADYKALKQAYDALLGMKGYAMPNVRFVYIESNEYALS
FT                   HATRPSPQAVQCEDCHARKQSGAFSALISAEGLLGEANVAEVAKLPDRRLVDAGIVELG
FT                   MPYYKVQDDGRIVENVADVLYASRLDPSMSILRSETARTVENEFKTLSRAEALAFADLD
FT                   EAAGQKLAADLPSGEALLFGSKVGHSSLRGFALIQTRGTRTLAYGDVLKGRVESRPAKA
FT                   KDRTRIFGQGFGNLVADIYSLAVMDASGRTLPGLVEGTALVRLPYRGKAKARGGVNVLV
FT                   SNDGKVWQRVGGKNLLVFRPRGDVDGYVVVRIRRSALYLTLADKVG"
FT   gene            430651..430956
FT                   /locus_tag="MCA0425"
FT   CDS_pept        430651..430956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0425"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90408"
FT                   /db_xref="UniProtKB/TrEMBL:G1UBD4"
FT                   /protein_id="AAU90408.1"
FT                   /translation="MHAKSHRSQLCCSSSPPVAEDAAALPRAPGMPGHPLVQKVLPWLA
FT                   GAGMGLGHAAVASNCTVPQQGRCSSCGSCIVVVGSLVAWALSRQRGRGAFYEEGRR"
FT   gene            431006..433756
FT                   /locus_tag="MCA0426"
FT   CDS_pept        431006..433756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0426"
FT                   /product="cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90407"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BP0"
FT                   /protein_id="AAU90407.1"
FT                   /translation="MKGELGRRLRSAAWCLSLFGFLPSAVAAGAVNAFDRTLMHPAIPL
FT                   VDEDGRHVLESGRPYSVRMSCGNGNGGGCHDYDGMNHAYHFEQGRDETRDDYGARRGLP
FT                   QLVGPGYFGGFNCMQGNAAAALAKKANTSEAEFGDYGAAGYVKACSTCHLGGGWEESDR
FT                   GGVRYDQMPAGSVPAWDGDYYDRNGDGQVVPWDWRKSGVREADCLTCHADFSLLKKFSA
FT                   SGLGGNGDGTAGAQDHWGLLQDGKFVAQGFFRYANSAMFEFLDVRPDLSGGAQLLTVAR
FT                   AVKPGTAKPDYDLVLGDSGEPVLHWNRDAFDDSGKVRIPMRRFPGNDNCMLCHLAGAGI
FT                   NRINAKVKSSRRGFYGFGEEAAQTLGEDGKPVDDYKDDVHKGKSWTDDTGETRIIDNCN
FT                   ACHAKQYYKPAYANIDLDADHDFPKGNGDADIRNDLDYQPGPADCEYCHSTAKAPALPS
FT                   GQPTLLDAHRERWKSSGFMRGYATNSYNRVVQVHFDDLACQACHNHKAVYNGKTLPMHY
FT                   RYRARADGALRVIPYVPNARFFVQDRSSGRVLYRYERQSVFRLKNGGQAAIVDPASGQE
FT                   TGSVTVTAGQFDLPATYNDFKALKQAYDNLLKGKGYSSADVRFVYAESNEYIFTHQTRP
FT                   AEQAVACEECHTRRADGSINGAVAANGLMGANRVIEVARIPDARLVDEGVVELASGYHK
FT                   VQADGRITETVAEVLEATDKAPDMSILKAATGRAVGGPLRKLPASEAAALAALDQDATG
FT                   KLTAGWDSGLSLTFSARVGHPSVQGAALFIPGSPLNQLLLEGVRVELSSRESTAAERRK
FT                   VGKLGTGTLAPDVYGLSLTRSGGSGVKNFGGGEGWIKLPYWGAATRIKGVKVVYSEDGK
FT                   TWRTLARHRIVAFKAASGGAAGYVLLRLKRPVAYLAFAGKAGSKS"
FT   gene            433828..435240
FT                   /locus_tag="MCA0427"
FT   CDS_pept        433828..435240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0427"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90406"
FT                   /db_xref="GOA:Q60BN9"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BN9"
FT                   /protein_id="AAU90406.1"
FT                   /translation="MVWLAVGGLVPFPGRCDNWHGSVRSKLQVDNRYTLQNAHVFGELW
FT                   GQGFYDDSQDDLHGAMEFVTRTGYQPDGGGVAGLYQAFVEKGFDSLNTRVKLGRFQRTD
FT                   NLGLYLVDGGAVAYAADDNGWGFDAYAGHPSRYDHVISVEGKFVGGLEGRAQWTPDWGW
FT                   GSDGPSLGRIDVRGGYQYFWRDLSQRAFGYSPYTGDGGNGSGTVNPGMLIGDTGLQGAV
FT                   AGSYSAYGGSKPWGSSLQRLYFATTGAGRLGLWRNSDYELGVLGTYRADRDAFENIRLN
FT                   GQLDLTNDVRVRGSYEYFQPRDPILTFREKFYSAYALGEQTLARTRIQHEPVKGFNYYV
FT                   GGLASSRKGYDGYGGELGANYVFNPNFGLIGEFDYMSLGPESASSFYVSSTHTVNSRLQ
FT                   MRVNTALRFEDKILYGFNRAVGAEIEAFYMLRNNLVLNVAGSYVWYTRILDEYLGAVQV
FT                   IYYFDNFKPKGM"
FT   gene            435387..435851
FT                   /locus_tag="MCA0428"
FT   CDS_pept        435387..435851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0428"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90405"
FT                   /db_xref="GOA:Q60BN8"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BN8"
FT                   /protein_id="AAU90405.1"
FT                   /translation="MEVMDEEGDSCMLCHSFAPNAMTDESKLKPLTTIANEPLKAVCHD
FT                   CHVTEQRGPWRCNLCHDDKTKIWPEDHRFGYVDHHGEAARRDEAACKECHLDLAFCTNC
FT                   HFRRDTMGTGYHPLGYRTLHGLGVRVDTLDCGRCHNQIYCETCHARTRFQ"
FT   gene            complement(436750..437817)
FT                   /locus_tag="MCA0429"
FT   CDS_pept        complement(436750..437817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0429"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90396"
FT                   /db_xref="GOA:Q60BN7"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BN7"
FT                   /protein_id="AAU90396.1"
FT                   /translation="MRSRDAQQVFSLALSFVELMAGQAQLAVLGRQPQQYFLVDPPVPQ
FT                   LESSSALFAQSLQPRLLVFPHHRIPGVLAVADTGFQIGVVHPAGGGIERIDDARLMRGV
FT                   AGRAHDLALPAEGQNDPVALLRVLHVELHPGVGLRFLMFQRIEVRRLQMAAVAKIFRRQ
FT                   PQLVVRRAQRPVPLPVNLLVTIGAVFLLELAALVQHDVDVGTLEPVFLVALVTEGIQLV
FT                   VRPAPQEIRQAAVDEAERHPVDVLDAMTGRTAQLAVLAQRQAFRRLHLLGQHDAGDVVQ
FT                   GGQLLRGRIAVLGARSRDAGAEQPRHHSRQPPARSRPRAPAFPHNPPFTGSPWVWHWLQ
FT                   SEVTSCTPDRPLPAS"
FT   gene            437933..438982
FT                   /locus_tag="MCA0430"
FT   CDS_pept        437933..438982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0430"
FT                   /product="4Fe-4S binding domain protein"
FT                   /note="identified by match to protein family HMM PF00037"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90395"
FT                   /db_xref="GOA:Q60BN6"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BN6"
FT                   /protein_id="AAU90395.1"
FT                   /translation="MNALTAKLTEKIRSVPKIQRYRYFWIAVSCAMFLGPLAVLPGLAG
FT                   NTDLCGKLCMRRFYLYFPGMSWDDLFMHVSVALIGVVAFFVIITFTFFFGRIWCSFICP
FT                   VGGFSELVSRMLGDRWKIEYRGLPQVQIRYGYLAVYMGLLPLLGVSACTLCNFITVPRF
FT                   VEALSGGFVGLAFIFSTVGLVNLSLLFLLGFFASKGRAYCQFLCPIGAIDGLVNRLGAK
FT                   FRFTHHIRVDKQRCTGCTECAKKCMCGAIKMVDKVAVVDQFSCMSCHDCVDACDWNAIE
FT                   WTTAPRNKTPKRVKRGIQIHPEPQWQAVVRMRPKPAPTARVIHWGRVVNGVIVAGFSVF
FT                   LFATAVWLH"
FT   gene            439302..441953
FT                   /locus_tag="MCA0431"
FT   CDS_pept        439302..441953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0431"
FT                   /product="flavodoxin domain protein"
FT                   /note="identified by match to protein family HMM PF00175;
FT                   match to protein family HMM PF00258; match to protein
FT                   family HMM PF00667; match to protein family HMM TIGR01931"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90394"
FT                   /db_xref="GOA:Q60BN5"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010199"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BN5"
FT                   /protein_id="AAU90394.1"
FT                   /translation="MDCSESCHLKEPSKDRAFTHKPVVDEFKKSVHGAGHAPGATKDFH
FT                   GGNRLEEETGQQNPSCRRCHSNTPYIKDANLERFKQELHHTETECGTCHQGETWRNQFS
FT                   GHILRRLVGKNYDKMEANAMCVDCHGDHEAMAKVEIQDPETRERKKASFRFAHATDSYA
FT                   KTLHGRLLAVNDESGASCIDCHAPDGFRHGILRDESKDSPTHPDRLGETCSQAGCHGYA
FT                   KSPLNLGFLNTDLHDLDFLRMEDLSFALDFSRLDSAWYAAAWVLGPLGLIFLTSSLLSP
FT                   LSRSRRAPVTEVVGYDHFQRVMIGGGSAKDGLWRRIRGRLVGGTPAVPVPAPLVEPGAP
FT                   ITSLTILFGSQTGNGEGVAADLEARLKAWGYSVELADMADYDPREIVNERLLFVIVSTH
FT                   GEGQPPLPAEKLHGYLYAETAPRLEHLKFAVFALGDSSYKHFCKAGKDFDAFLQRLGAS
FT                   RVLDRVDADADFEEAAAAWIDAVLGCCRAIIGDTGIERPLEAEPVDHAVAKSGYGKTHP
FT                   YPAAVLRNVNLNGEGSAKETRHIEIDLGDSGLSYEPGDALGVYPKNDPAYVEALLAALQ
FT                   ADGYSEVTLGKETLSLREAFYKHLDITGLSRVLVEKYAELCDSRVLAGLLADPDPARLE
FT                   GYLWGRQIIDLVEDFPIQGISPQTFVNVLRRLPPRLYSIASSMKAHPGQVHLTVGAVRY
FT                   HAHGRNREGVCSTYLAGRIGPGERLAIFVQPNKHFRLPEDPETPLIMVGPGTGIAPFRG
FT                   FVEEREVTGARGRNWLYFGDQRRATDYLYREEWEDKLRRGVLTRLDLAFSRDQERKVYV
FT                   QTRMLENAREMYAWLEEGACFYVCGDASRMAQDVHRALLAIVMQEGGRTQEQAEEYLEA
FT                   MAASRRYLRDVY"
FT   gene            441981..442787
FT                   /locus_tag="MCA0432"
FT   CDS_pept        441981..442787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0432"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90393"
FT                   /db_xref="GOA:Q60BN4"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR023155"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BN4"
FT                   /protein_id="AAU90393.1"
FT                   /translation="MKLKDKMKLGPAGLVLSLSCWANGGSSFAGEPLFVQRVESAAPTR
FT                   EAIGKAEEQVREHKDVKLREKMAVPAFHKRIEPPLHEGETYCQGCHRPQPHSKKLRTRS
FT                   FLNMHSRYVACETCHFRPEDVRLEYRWFDYAARRPAAADGSRFRTGRNLDNSVPIDGKF
FT                   KIAPFYRGEPAFVLPGTAFAERVGREWQEGDLAARAQLKARLHAPLSKEGPACAKCHTE
FT                   DSPLLDLSALGADSRQASAIRRHVIPQFFGRYQSDDERLKIIDILR"
FT   gene            442795..445587
FT                   /locus_tag="MCA0433"
FT   CDS_pept        442795..445587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0433"
FT                   /product="NHL domain/cytochrome c family protein"
FT                   /note="identified by match to protein family HMM PF01436;
FT                   match to protein family HMM TIGR01905"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90392"
FT                   /db_xref="InterPro:IPR010177"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013017"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BN3"
FT                   /protein_id="AAU90392.1"
FT                   /translation="MARNVALVLRRAAAIAAGLIGLWPVAAGAFEAVVASDPVGYQAGF
FT                   EQPSAVATDGEGRVYVLDGAHHRIVALSPDGEVLRILGGAELLKLPIDFALSEEGLVVA
FT                   DTGHHRLVLLRPEGGVLKVLELPIEPMPEPSPQPGGSPSASSPPSLPPEPVAVSVQDGV
FT                   AFWADRRSHRVCRTRLADGRGLGCFGGRGGEPGRFQYPFQIAQDRDGYFNVVDIVNARV
FT                   QVFDKSGRVFSQIGRFGLDEGELFRPNGLAVDREQDAFFVSDGYFGTISVFRKGEFLGL
FT                   LRQADGQPVRLDSPTGLHFRDGRLYVAETGASRVWSYRVSYPGRAVSSRGSGQRTELSQ
FT                   KDCLLCHLSWAGDAPPEVRAADTEGALPEASYRMCYSCHNGAVMDSRLTIHRGAQHPTV
FT                   YESPKEKKRHAGLKPRKDKLPDKFPVTGNKQLLCTSCHTPHTDADKAQTLYPAHGNAWL
FT                   RVPNRGGDLCERCHESKVKGARVDAPVPAGSAEGTKGRKGLNHPLGIRFMPPPHPEAKG
FT                   YPTENELRKGLPERLTAGGAALGDHKELICQTCHQVHGGHGDGKTTVLETAEGELCAAC
FT                   HRRQFTKSKEEAHEKGVHPVNVKREPDESGARPVLWKGRPEITEVGCQTCHRVHDGSAG
FT                   TSLLPEGVANAESLCRNCHERQHAEDEKDARKKGVHPVNAELDEPVRIGGREVRTVGCL
FT                   TCHSVHGGKPHTAALVETDRDGELCSHCHKRKQTVVGTDHDLRITAKDQKNALGELPSA
FT                   TGVCGSCHTLHRGKGDRRFLFAARKVEPQPGPAMDETPFERDGLCLNCHQKGGVGEKKV
FT                   VHHFSHPQRDLVLRSDQKILPLLGAREEPADFGGIACITCHEPHVWDADKIPPPGKDGT
FT                   IAPSANRENLEGSNRDAFLRAKDADKVFCVDCHGLDTLVKYKYYHDARRARNRGVDYLR
FT                   "
FT   gene            445809..446354
FT                   /gene="dsbE-2"
FT                   /locus_tag="MCA0434"
FT   CDS_pept        445809..446354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbE-2"
FT                   /locus_tag="MCA0434"
FT                   /product="thiol:disulfide interchange protein DsbE"
FT                   /note="identified by similarity to SP:P33926; match to
FT                   protein family HMM TIGR00385"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90391"
FT                   /db_xref="GOA:Q60BN2"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BN2"
FT                   /protein_id="AAU90391.1"
FT                   /translation="MPRLFLLLPLLIFSILGFLFFQGMNLDPNTLPSPLLGKRLPAFEL
FT                   PALRDLSRTIRDGDIEGPALVNFWASWCAACRDEHALLVDLARNAGVKIYGIDYVDQRD
FT                   AALGWLDRLGDPYVEVLFDERGTLGAAFQVMGAPETYAVDGDNIVRYRHVGRLTWEVWT
FT                   AMQAALAGPALPPGSPEE"
FT   gene            446407..447078
FT                   /locus_tag="MCA0435"
FT   CDS_pept        446407..447078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0435"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:VC1548"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90390"
FT                   /db_xref="GOA:Q60BN1"
FT                   /db_xref="InterPro:IPR016866"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BN1"
FT                   /protein_id="AAU90390.1"
FT                   /translation="MKFLDSTRADTARRFPLRSLFASVLLVTGAFFGQAAVAPAADRTP
FT                   SADRAGKEGPPEAPARPASAPLPFESAVPALLQAAVARLRQEIENGPPFSLTERKRRID
FT                   GLEKLLAEPGVDIAEKYRRVLEAYRAELEYGKTVEAYRDLLRTEEGERLVDFLSIGRLA
FT                   LYYQTLDGRESGMWDDRDRQWHRLAPRYDRAIALGLRAARKLEPPQLLPLPLPGPRSPS
FT                   P"
FT   gene            447075..448286
FT                   /locus_tag="MCA0436"
FT   CDS_pept        447075..448286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0436"
FT                   /product="MotA/TolQ/ExbB proton channel family protein"
FT                   /note="identified by match to protein family HMM PF01618"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90389"
FT                   /db_xref="GOA:Q60BN0"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BN0"
FT                   /protein_id="AAU90389.1"
FT                   /translation="MKGLSLFRNLAGAAAGLVFFATARPGFPAPPPEPSGLGAAPTAAL
FT                   DALFLAVRESAANLKLFYEQNYLAGDGPGQRRLLDRLADPQHVPAAAELEDLFASLGAQ
FT                   MDALGRVSTFRAPVYAPDGRMAEREVLRLGGFGFIAGRRYLVYAPEVRALAELARQPSS
FT                   ALLDLAQRFAQVDADSLAPVALDPSGGQTLQLLVQVPDLAERIAQGGAVGYLILALATF
FT                   ALVLGGCRFADLARTSRRIRRQLGSLEARSDNPLGRVLLRLEQAQTEDEDALYLTVDEA
FT                   LAGERMRLERALGLLKLVAAIAPMLGLLGTVTGMIRTFQAIALHGSGDPRLMSGGISEA
FT                   LVTTVEGLVTAIPILLLHSVLVGKAQALGTLLEAQASAALSARLAGRRDRTVAVAGGPR
FT                   LLEG"
FT   gene            448294..448791
FT                   /gene="exbB2"
FT                   /locus_tag="MCA0437"
FT   CDS_pept        448294..448791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exbB2"
FT                   /locus_tag="MCA0437"
FT                   /product="MotA/TolQ/ExbB proton channel family domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01618"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90379"
FT                   /db_xref="GOA:Q60BM9"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BM9"
FT                   /protein_id="AAU90379.1"
FT                   /translation="MAAAGFSSAVDTVLAAARRVEELMDAGGPVMWPLLGVSLLSWGLI
FT                   LDRYWYFLRVLPRVRRRPRSEVEAVELRIALWRHLRLIRTLSGILPMLGLLGTVTGIVE
FT                   TFDLIRVFGSAETRIVARGVSQALITTLTGLVMGLSGVGAGYDLSRRAEAGERAMIGSR
FT                   SP"
FT   gene            448809..449222
FT                   /locus_tag="MCA0438"
FT   CDS_pept        448809..449222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0438"
FT                   /product="biopolymer transport protein, ExbD/TolR family"
FT                   /note="identified by similarity to SP:Q05606; match to
FT                   protein family HMM PF02472"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90378"
FT                   /db_xref="GOA:Q60BM8"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BM8"
FT                   /protein_id="AAU90378.1"
FT                   /translation="MSRTGGAEESADAINLTPLIDMVFILLIFFLVTTSFIHESSIAVQ
FT                   RPRAATATLARNVEVVVTIGADEQVWLNDVSVDVRLLRARLEGSGLGNPARSAIILADA
FT                   RTTTGLLVKVMDQLRLAGFTNISVAASSSPEPP"
FT   gene            449378..450025
FT                   /locus_tag="MCA0439"
FT   CDS_pept        449378..450025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0439"
FT                   /product="TonB domain protein"
FT                   /note="identified by match to protein family HMM PF03544;
FT                   match to protein family HMM TIGR01352"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90377"
FT                   /db_xref="GOA:Q60BM7"
FT                   /db_xref="InterPro:IPR003538"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BM7"
FT                   /protein_id="AAU90377.1"
FT                   /translation="MDFVRLPPRPAESGPPPSQTRKTVTESPAESSPSDARPDSAKPST
FT                   PSAPRLSRAPVVSRSKPEPRMPGVAAPRLDIPARGTGVEFPAVAGTDSRLTAPPAQWNL
FT                   RKMPAAPGDLASGAEGAGGGGNPLIVLFRVVPEYPEVARRRGIEGWVRLEVRVTAAGLL
FT                   GDARVVAASPRDTFDEAALEAIRHWRFKPAFREGRAVEQRAMLTMEFRLKRR"
FT   gene            450523..452850
FT                   /locus_tag="MCA0440"
FT   CDS_pept        450523..452850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0440"
FT                   /product="putative TonB-dependent receptor"
FT                   /note="identified by similarity to OMNI:NTL03PA03268; match
FT                   to protein family HMM PF00593; match to protein family HMM
FT                   PF07715"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90376"
FT                   /db_xref="GOA:Q60BM6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BM6"
FT                   /protein_id="AAU90376.1"
FT                   /translation="MNGAELVKHWSRFAIRCRKFMNTHSGSGLPATGVRRSRLRREAWV
FT                   LAPFLFIFGSAGLRVGSAEAAEDVVELDKITVYGEEDEVSPETEDLPEEQLEEKKAQTM
FT                   DTASLFKDVPGVSLYTGGGVSSLPAIHGMADDRVKILVNGMNITSACSNHMNPALSYVA
FT                   PASVGKASIMAGVTPVSQGGDSIGGTISVDPAAPSFAKAGQMAYTGKLGGMFRSNSDTF
FT                   GNNFSGSIASEDFAFDYGGSWAKGNNYMAGNGGPTVLPTRYLTTNMNLRASTKLDKGFF
FT                   SADVTGQHIPYQGFPNQRMDVAENDGLLGGFSYENDFDWGKLDARVYYHSTWHLMDMLS
FT                   ERKAGRMPMKADGSDLGYRVRAHLPVDDVHTVRVGSEYFQQGLQDWWPGQGMHMPQDFL
FT                   SINDGQRNRLGTFAEWEAAWNKEWLTQLGVRNDMVWMNTGRVQGYDNGAFYSFWATPFN
FT                   AANRSRVDHNFDATATTAFTPDANSRYELGLSRKQRSPNLYERYAWAGPNSMITWFGDG
FT                   NSYLGNLDLKPEAAYTATFTANWHDERQQVWSVSLTPYYTRVNDYIYGQKVAQYSNGFH
FT                   GMQFVNLSHADMYGGDFSARYAFLPESPAGSFAAKVVAAYVRGVGNDGQRSMGCPYVGT
FT                   SLAGLCNNNQQFWPVNGFLAPTSVNLYHMMPLNATVSLEHSIPAGSAVVDSAISVNLVD
FT                   SKTAVAQSYAEPTTPGYVLLNLRTSYQREHLRVDVGADNLLNKLYYHPLGGVDIVESIK
FT                   AQDVVRLPAIGRSVYVSLNLEF"
FT   gene            452874..453620
FT                   /locus_tag="MCA0441"
FT   CDS_pept        452874..453620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0441"
FT                   /product="TonB domain protein"
FT                   /note="identified by match to protein family HMM PF03544;
FT                   match to protein family HMM TIGR01352"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90375"
FT                   /db_xref="GOA:Q60BM5"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BM5"
FT                   /protein_id="AAU90375.1"
FT                   /translation="MAAVPLVQTDSKSSGAESLYRPGSAILVVVSLAHLAVWWSYRQLK
FT                   LLEPEERPSQPIEVSLEMIAPAPKPAEPAAQPAPAPTAPPKPVTPPKPKPVAKPKPLTK
FT                   TLPRPLPVQPERTLGDAAPRSEPAAPPPEASSAAGGEGVPGGRSGSSVPASTPASFNAN
FT                   YLHNPLPEYPAFARKQRWQGRVTMKVHVLPSGIPAEVELQASSGHDILDESALETVRRW
FT                   RFVPATKGGKAVASWVVVPLEFSLTH"
FT   gene            453638..454294
FT                   /locus_tag="MCA0442"
FT   CDS_pept        453638..454294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0442"
FT                   /product="MotA/TolQ/ExbB proton channel family protein"
FT                   /note="identified by similarity to OMNI:NTL03PA00199; match
FT                   to protein family HMM PF01618"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90374"
FT                   /db_xref="GOA:Q60BM4"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BM4"
FT                   /protein_id="AAU90374.1"
FT                   /translation="MVTDTSALIINVTLWVLISFSVLTWTVILLKGGQYWRHAVGNRLF
FT                   EEKFWSAASLDEARLRMDEAGGCPLYRLASAGFQVFDSGNGNGAASLKHRGDLVATLER
FT                   KLKRQLERESRLSDIGLTVLASIGSTAPFVGLFGTVWGIMHALQDISRSGKASLEVVAG
FT                   PIGEALIATAIGIAVAVPAVLAYNFLMRRSRRKQQALEIFAEDFLHLVAAETAHR"
FT   gene            454307..454717
FT                   /locus_tag="MCA0443"
FT   CDS_pept        454307..454717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0443"
FT                   /product="biopolymer transport protein, ExbD/TolR family"
FT                   /note="identified by similarity to SP:P05829; match to
FT                   protein family HMM PF02472"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90373"
FT                   /db_xref="GOA:Q60B14"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B14"
FT                   /protein_id="AAU90373.1"
FT                   /translation="MAMKTGGDSDEVMSEINVTPLVDVMLVLVIVFLVTAPLLTQSMNV
FT                   NLPKTGAVAASDDSQSTPIGIDAQGRIVLDKTEIAGLAELEAKLRERVQQNPEGLYIVH
FT                   ADQAVSYAVVAKVLAAAHKAGVNRLSLATVQE"
FT   gene            complement(454935..457010)
FT                   /locus_tag="MCA0444"
FT   CDS_pept        complement(454935..457010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0444"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90372"
FT                   /db_xref="GOA:Q60BM2"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BM2"
FT                   /protein_id="AAU90372.1"
FT                   /translation="MLSSSRHLASLAAALVLAAALDTAFLDESQPAAPMLGNGDVAALR
FT                   SVMERWKSRHEQQGDAETLKLALVPSSTLSAARTQGRGELRLNLLTGALEVKARGLPAE
FT                   RDYEVWLADNRGGASRAVKPEAGDRLIGLGMLRRTADGGAILRTTLDRTSLAGFELDQA
FT                   IITESGATPDRGGLLFGAPSLLQRTYFSSQPWSLTVSGDAPAPAAGPALPFAFLLPKAA
FT                   VAQTAGTDAASLEQLIARGRQIFVEETFDGNGRTCATCHRPDNNHTIDPRYIAKLPPSD
FT                   PLFVAEYNPDLKELEKPALLRQMGLILANVDGFDKPGVMRSVPHLLALPTSIDVEVCVE
FT                   HGGKGDFCEDEAFANALGWSGDGSPGTGSLREFALGAITQHMPKTLNRVPQVDFRLPTD
FT                   EELTALEAYMLSLGRTQDIDLSKLSFNSPLVQQGKLLFDVKENPVRNGEVILGETANCN
FT                   GCHQNAGANSSTTHANPTRDTGVENMRTPPAFLLDPALAVDGGFGKEERVSCGFSQDHT
FT                   CYGNGRFNTPPLVEAADTAPFFHNNSVNTLEEAIASYNGDSFNQSPGAKTSSGKDRRVK
FT                   LESSQVTAIALFLRTLNALENIRSSNSLSRKSMDLRGRNAKETLKLAMADTEDAIEVLQ
FT                   GGTLLPYPEALARLEEALALEKKALHTEIGPLRNLRLHKAIALKLQAKALMVTEQP"
FT   gene            457009..458079
FT                   /locus_tag="MCA0445"
FT   CDS_pept        457009..458079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0445"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90364"
FT                   /db_xref="GOA:Q60BM1"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BM1"
FT                   /protein_id="AAU90364.1"
FT                   /translation="MALYRRCRTDRPAGSLPAGGREWPGSGRLVREVAIPGLFLPVWRR
FT                   RRAASQEGYVRVSRKLTVSVALALAQILRQVAQIHVHAVAHRRMPAGLADDAAVGIDHL
FT                   AAAATTAGLLDVHLELEIDVVFLAGIAVLGIAAHGHGQPVFLPALECQRAADAGHGLRT
FT                   DTVGRHVARVRFAGPRGEQPAPERRCGLELARIPVQVRPLVLVAAPDGEGGDEVALGRI
FT                   AADIAFGVDGDVELAQTLRFQTAQVDEEPFRMHGPAVAGSGYGAGRRIGRRVAPGHGLG
FT                   GRDAGGRAAVAGGVDGLAGIDRERRGAGLGVLFLEHKFRGVGDAVAGDDFDGFRRGRGA
FT                   DEPQGQGGDNSFHRES"
FT   gene            458126..459169
FT                   /locus_tag="MCA0446"
FT   CDS_pept        458126..459169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0446"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90363"
FT                   /db_xref="GOA:Q60BM0"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BM0"
FT                   /protein_id="AAU90363.1"
FT                   /translation="MVSLRRLLLFHVDGQLVIDVVFGVGVLGIAAHRDRQIILGAALEP
FT                   ELPHDRGEILRGGRVGAVVAELIALDEGVTLQQPAPEFRHPLEFARKPVHLRSQCLVTA
FT                   VDGEGRDHVVVRGITAGVAFDADGDPDGAQPLALELAQVDQIPVGVHTPAVAAIVLVAG
FT                   RGDGRVAPGHRLGLRDHRRVAVVVRRVEGLSGVQGGGGRAGLGVLLVEDQLGGILDAVA
FT                   RIDVAGQGVASGSGEAGGRHRSQQLAEGHRFLMQGMIGKYYPVLMDAICGPKAGRRNSG
FT                   VSGGQAAPWVCEITHLVRLITQLVGIAAGCHCPSTRDDETSRMKDGFPRMARLMLRSAR
FT                   RARSRRA"
FT   gene            459204..460145
FT                   /locus_tag="MCA0447"
FT   CDS_pept        459204..460145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0447"
FT                   /product="sigma-54 dependent DNA-binding response
FT                   regulator"
FT                   /note="identified by match to protein family HMM PF00158;
FT                   match to protein family HMM PF02954; match to protein
FT                   family HMM TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90362"
FT                   /db_xref="GOA:Q60BL9"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BL9"
FT                   /protein_id="AAU90362.1"
FT                   /translation="MFEVLIGRSPGFEALIRSARLVAATDVTVLIVGETGTGKELLARA
FT                   LQGHSLRADRPFVTLNCAALPASVAESELFGHRRGAFTGAVSDFPGRLETADGGTLFLD
FT                   EINSLPLPVQAKLLRFLDSGEIQPVGARAPQRVDVRIIAATNANLADKIDKGEFRRDLY
FT                   YRLSVVPLEIPPLRERGGDVELLLHHFMRHFAQTHAIPPAVFGRGAVRRLIAYPWPGNI
FT                   RELRNLCERLAILMPGRVIEEQDLPEEALRAPPQARPLFTLPDEGFELERMEIDFIRQA
FT                   LQRTQGNRTRAARLLGLTRDQLNYRIQKYGID"
FT   gene            complement(460158..461900)
FT                   /locus_tag="MCA0448"
FT   CDS_pept        complement(460158..461900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0448"
FT                   /product="5'-nucleotidase family protein"
FT                   /note="identified by similarity to OMNI:DR0505; match to
FT                   protein family HMM PF00149; match to protein family HMM
FT                   PF02872"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90361"
FT                   /db_xref="GOA:Q60BL8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BL8"
FT                   /protein_id="AAU90361.1"
FT                   /translation="MNPSIIVRLLAVSTLTGASLLPAGRVCAAPDAAAPAIAVKIIAMN
FT                   DFHGNLRPPADFPSNGVPTVAGGVARLAARIRELRAANPDNVLVSAGDLIGASPLISAH
FT                   FQDEPTIEAMNLLGLDFNAVGNHEFDEGREELLRMQRGGCHPRLERAGRSCREKGLSPM
FT                   IRSKVGRKFKGASFRFLAANVFDRKSGGTLFPAYGIKQFHGRKIGFIGLTLKTTPNLVK
FT                   PGGVKDLEFRDEVETVNALVPVLRSQAIEAIVVLIHEGGHPGGGSDGCPGLSGPIAGIV
FT                   RRLDPEVDLVISGHTHETYACRLPNAAGEPVLVTSAHDYGRLVSDIDLVLDANTGEVTS
FT                   AVARNLVVSRDVQPEPLLTRLVEDYGRLSRPVEERIIGRITATFSRTPDDAGESALGDL
FT                   IADAQLEATRSRRHGGAAIAFMNSGGMRADLSHAPERNGWVRYREAFDIQPFGGTLVTM
FT                   TLTGAQIEQLLEQQFPGCPNGQPANRILQVSGGFEYTWNAGGEACDKVDPASIRLGGKP
FT                   VAAGRTYRIATNDFLADGGDGFTVFTQGTDRRAAMPELSALERYLGRHSPLTPGTLRRI
FT                   IRRP"
FT   gene            462237..465332
FT                   /locus_tag="MCA0449"
FT   CDS_pept        462237..465332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0449"
FT                   /product="cation-transporting ATPase"
FT                   /note="identified by similarity to SP:P37278; match to
FT                   protein family HMM PF00122; match to protein family HMM
FT                   PF00689; match to protein family HMM PF00690; match to
FT                   protein family HMM PF00702; match to protein family HMM
FT                   TIGR01494"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90360"
FT                   /db_xref="GOA:Q60BL7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BL7"
FT                   /protein_id="AAU90360.1"
FT                   /translation="MLRMPAPDRLRVKVSGLYRCDDLQRALEALPAQAGALRMVSANPV
FT                   TGNALVVFDPQCPLDAVLAALERCALDHGAPFVGAAASRPVSGKGPARPDHRRNGRPAA
FT                   APRPKLAAVIADTVRNKESWHALDAEEVLSRLSANRDGLGAAVVAERLARYGRNVLTEI
FT                   KPRSAVAMFLGQFASPPVALLGLSAAVSIATGGMADAVVIVGVVLINAVIGYFTEAQAQ
FT                   KTIDALGKIGPTHALVMRDGVKRSVPLEEVVPGDILVLSPGSYIAADARLLASNRLTVD
FT                   ESALTGESLPVDKRHTFVGTKDTPLGDRKNMLHMGTIVTGGSGRAIVVATGRHTEIGLI
FT                   QSLVGEVKTPETPLQRQLDEMGKQLALASSGICAFVFGLGVLRGAPALQMLKTAISLAV
FT                   AAVPEGLPTVATSTLALGIREMKKRHVLIRQLPSVESLGSVQTLCLDKTGTLTENCMRV
FT                   VSLRTPELDIGLSATGEFRSNGRTIRPAGAEDLRRLMQVVCLCSEVQLNGDPDRSVPPG
FT                   SQRVDAEPLSADASGRSGLEGSPTEMALVEMAMHAGEDVAALRRSLPLIKTVHRAEGRP
FT                   YMLTVHDTGGEEHLIAVKGSPTHVLALCDRRMEGGGVPVPLDDDTRAAIVEQNELMAGQ
FT                   ALRVLGVAYGHCRDTSTAAVSEKLVWLGMVGMEDTMRPGMAELMAQFHDAGIDTVMITG
FT                   DQSATAFAFGSRLNLNDDKPLEIVDSTNLDELDPDVLKGIVRDTTVFARVAPAQKLRIV
FT                   QALQANGRVVAMTGDGINDGPALKAADVGVALGNGSDVARSVADVVLEDDNLHTMIIAV
FT                   QQGRTIYRNIRKSLAYLLSGNLAEIEIMLVATAIGAGEALNPMQLLWINLVTDILPAVG
FT                   LSLEPPESDVLKEKPRAPNEKIFRREDLLRLLRQSLVISAGTLGVYGYGLARYGLGPAA
FT                   STHAFMALTVGQMFHAISCRSERTTVLEKRAGNPVLVSGVAATVALQAFAAVFPPLRGL
FT                   LRLTPIGPADWAAIAAGSVLPFVANEAIKLLPSREPESENRA"
FT   gene            465329..466522
FT                   /gene="metK-2"
FT                   /locus_tag="MCA0450"
FT   CDS_pept        465329..466522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK-2"
FT                   /locus_tag="MCA0450"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="identified by match to protein family HMM PF00438;
FT                   match to protein family HMM PF02772; match to protein
FT                   family HMM PF02773; match to protein family HMM TIGR01034"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90359"
FT                   /db_xref="GOA:Q60BL6"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BL6"
FT                   /protein_id="AAU90359.1"
FT                   /translation="MKKTFLFTSEAVTEGHPDCVCDIISDAVVDRFLQQDPYARVVTEC
FT                   ALSKSVVFLAARFASTAVVDIPDLARRTIEDIGYHPAEFSAPESTVVTSFIVQSLEGRS
FT                   ERDEAEMTDKELDQLTVKNQITQFGFACSHTPELLPLPIVLARRLAHQLTGARRRGEVP
FT                   YLSPDCTTQVGVEFEQGRPARIHSITLIAGTHGVPDLGLEELRRDLGQWVIAPAFEGEA
FT                   LMPDEHTEIFVNPRGMLHRSGPAAHSGMTGRKSASDTYGGYARHAGSALSGKGPLRIDR
FT                   VAAYAARHAAKNVVAAGLAEECEVQLSYTIGQARPVSVQVSTFGTGLVGEDVIKQRLEK
FT                   HFDFRLGAIVRDFNLRRLPAEYRGSFYRRLPAYGHFGASFTALPWERTDKADLLAGV"
FT   gene            466525..468546
FT                   /locus_tag="MCA0451"
FT   CDS_pept        466525..468546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0451"
FT                   /product="heavy metal-transporting ATPase family protein"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00702; match to protein
FT                   family HMM TIGR01494; match to protein family HMM
FT                   TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90358"
FT                   /db_xref="GOA:Q60BL5"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BL5"
FT                   /protein_id="AAU90358.1"
FT                   /translation="MPPRCQGGTAAAGDETAAVQPTIDYGERFKYPVLALGISVVATPL
FT                   EWPFAPAVVGIVLARAAFPLWKRTLANLKRTGRPNADLLDSLWVLVHGATGEALAPALA
FT                   ICLTETARVLRDLTAITGERRKPDRVPNRQYWIERKGRRRLVLAKDLRAGDQVILGSGD
FT                   RVPGDGVVVGGDGLIDGHDLLGGARLVPRGVSDEVYAASLLTQGCLVVEMRRLGAETRM
FT                   AQLAETIEERSWKETRIGNYMEEIGNRAVLPAIGASALVFAATANLSRAMAPLQLDFAQ
FT                   GIGISAPVPVLASLHHAARNRILIRSGHALERLAKVDAVVFDKTGTLTERGVEVGALET
FT                   SLSSVSEAELLYWAASAGRYVLLPFSAALVSHAETRGVALTASDPLDYSDSGVLARVDG
FT                   AEIIVGTFQFLASRGIPVDAGYHRRHDGVILNRSIRYVVRDREVLGAIFFSNALRRESA
FT                   VTIETLRRMGIACYLLTGDTSKSANAVAYQLGIRPGCTFAEASPEHKVEVLRRLRRKHD
FT                   AVAYVGDGVNDAPAMSRADVAVSFQQATDLARETADVVLLDDGLLGLCYGIETAREAMR
FT                   LVHRNIVAVTAANIAVVAGGIFFDLSTVGAVVVNNGAALLACLNGMRPLYSGERRDPEI
FT                   ERTTLRDDEGLLGIPWRKRGRAGVDGILGGHSGHAGPA"
FT   gene            468590..470059
FT                   /locus_tag="MCA0452"
FT   CDS_pept        468590..470059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0452"
FT                   /product="HAMP domain protein"
FT                   /note="identified by match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90357"
FT                   /db_xref="GOA:Q60BL4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BL4"
FT                   /protein_id="AAU90357.1"
FT                   /translation="MTSIRVVFPLIFALQIFVAVGLTGAIAYVSHMREAQDTAKEILEL
FT                   IGNMIDDQLYRFLSQPIDLTQVYADSLRGRPDLPLDDLLEPRLVKKLSNGVWTQAQMTR
FT                   WANLSIANSAGQNLRFDRREYGKKVVKVSDIRRGGGVEWRLLENYGKGGMPLEVQEAAY
FT                   DPRTEAYYRDALAKGGLVVSPIHFSPLLQGSAPVVTVAEPVYDAHGRPRAVVSSDIYLA
FT                   GIGRYLQNLHLPNSSIAFLFDAEGHLIAGSRGSFPGPTAGRLPLATASSDPIIRATAGY
FT                   IAERYGFLAVPDAESFRYVRGEQHNYVHTDHLLTDRQFAGLGLDWRLAVVIEESDLIEN
FT                   LITGIHSAAWLSLGLLVLAVAVGSWTAAGMIRPILTLGKVAAALEKDELDARHLDVRQL
FT                   ERDTRRRNEFGELAHVFLRMVQEVRARHDLLEAQLEQLRVNIDEADTQAKIRQIADTEF
FT                   FADLKAKATRIREERKRAAEPSAQAFAEHDP"
FT   gene            470120..470887
FT                   /locus_tag="MCA0453"
FT   CDS_pept        470120..470887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0453"
FT                   /product="ParA family protein"
FT                   /note="identified by match to protein family HMM PF01656"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90349"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BL3"
FT                   /protein_id="AAU90349.1"
FT                   /translation="MGKIISVHSFRGGTGKSNVTANLAALLARLGKRVGIVDTDIQSPG
FT                   IHVLFNLSPERFRYALNDYLWGKCRIEEAAYDVSGVLEGRRLKDAGSLHLIPGSMRTGE
FT                   ITRILRDGYDVGLLNSGFQELMERLELTHLLIDTHPGVNEETLLSIAISDILLLILRPD
FT                   QQDYQGTAITVELARQLEVEQMFMLVNKAINPRDFTALKQRVESTYHVPVLGVLPLSGD
FT                   VAILGSGDIFALANPDHPVTSVLEAAAQRIDAA"
FT   gene            complement(471257..471772)
FT                   /locus_tag="MCA0454"
FT   CDS_pept        complement(471257..471772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0454"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90384"
FT                   /db_xref="GOA:Q60BL2"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BL2"
FT                   /protein_id="AAU90384.1"
FT                   /translation="MKPLHMLFSLLGLSACAMDTFTTGVPVDELEKVSGEKPAHHARNV
FT                   DGVDIWTTGAPDRKYKILGMIHDVRRNVPWRTQTYLSDLAQATKKAGGDAAIIIIIADS
FT                   KLVYKMGMGCDASVETTEKCIHAQGASLSGAAPGEEATIYSENIESTSVPLEYKDSRVL
FT                   VIKYLDTK"
FT   gene            472143..472586
FT                   /locus_tag="MCA0455"
FT   CDS_pept        472143..472586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0455"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90383"
FT                   /db_xref="GOA:Q60BL1"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BL1"
FT                   /protein_id="AAU90383.1"
FT                   /translation="MMIVVSHDFHRLGQFKRDEIADTQVSEAARPGADRYGDPLSIGEQ
FT                   EYHLADGWVNGLDRSFEGPRTDEGRFRRGLSSASGKDSGGVIPGRCGGQGRGVLAGGGF
FT                   WGGFGASDDSKAGAQETGNRTATLFREHCSDLCQNWYWIWRRL"
FT   gene            complement(474069..475463)
FT                   /locus_tag="MCA0456"
FT   CDS_pept        complement(474069..475463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0456"
FT                   /product="GGDEF family protein"
FT                   /note="identified by similarity to OMNI:VCA0960; match to
FT                   protein family HMM PF00990; match to protein family HMM
FT                   TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90382"
FT                   /db_xref="GOA:Q60BL0"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BL0"
FT                   /protein_id="AAU90382.1"
FT                   /translation="MPADWLARPRFVSAFSIVVFLLLAAFGEYVVRIEAERLRVIAQNQ
FT                   VLAEASTIRARLEGELYSTLYLANGLSSYVSAHKALDPAAVKIILSTVFGYGRHLRNIV
FT                   LAPDNEVRFTYPLKGNEKVIGFRYQDNAEQWRAVKRAMETRTTVLSGPVDLVQGGRGLI
FT                   SRTPVFLPDGEYWGIVALVINIDSLFATINKDRRPARITWALRSNDETGEKGRILFGDA
FT                   WLFDHDHVNLSIAIPGGSWELAATPAEGWRPPGKRLLVLRIATLALSGLIAALVFLVLF
FT                   ERIRIQHLALHDSLTDLPNRRLLDDRLERAIAQARRNRDGFALLYVDLDDFKPINDRFG
FT                   HRAGDHVLVEIARRLRGALRRADTVARVGGDEFMLILPGARGRHGAMTVVQKLAGIICQ
FT                   PIGYKGQYLNVSASIGVSTYPENGVTADALISHADGSMYRFKQHRKSPTDINGNQRSGA
FT                   VSSEVS"
FT   gene            complement(475468..475872)
FT                   /locus_tag="MCA0457"
FT   CDS_pept        complement(475468..475872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0457"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90381"
FT                   /db_xref="GOA:Q60BK9"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BK9"
FT                   /protein_id="AAU90381.1"
FT                   /translation="MHGPGLPARAGRRLQRSGLGRMGRRSGQPHPGAVLPGGTLGRRLQ
FT                   SGAGRERHRAQQPAGRAHLQQRGIRLQGTLHRLRPRLRLLRRHLRRHVRTTVRQTVIPS
FT                   GTGSKPAVAASAGPSKAGASRDAPVRQRGD"
FT   gene            complement(475925..476371)
FT                   /locus_tag="MCA0458"
FT   CDS_pept        complement(475925..476371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0458"
FT                   /product="putative cysteine rich repeat domain protein"
FT                   /note="identified by match to protein family HMM PF00839"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90380"
FT                   /db_xref="GOA:Q60BK8"
FT                   /db_xref="InterPro:IPR001893"
FT                   /db_xref="InterPro:IPR039728"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BK8"
FT                   /protein_id="AAU90380.1"
FT                   /translation="MRTIASDTGIGRLKHVALSTFLAIAGTGPANAAPHPLPCSDEIAR
FT                   YCKNLGLGGGRVQNCLREHDAQLSPACRAGLESALARHREIQAACGADVERLCKDVRPG
FT                   KGRLAACLKEHHREVSSLCKDTLAAARKAGSRTGPTRRTQGIHP"
FT   gene            476610..476897
FT                   /locus_tag="MCA0459"
FT   CDS_pept        476610..476897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0459"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90371"
FT                   /db_xref="GOA:Q60BK7"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BK7"
FT                   /protein_id="AAU90371.1"
FT                   /translation="MEPDYEALGRYYASLETFNELSSKRHRLSGELCRMLSHSMERNHD
FT                   VLTLFDHKAARMLLEDIIALNAHLIQVTEHLNRHAAECGKPEIRTLYRKG"
FT   gene            476927..477190
FT                   /locus_tag="MCA0460"
FT   CDS_pept        476927..477190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0460"
FT                   /product="ferredoxin, 4Fe-4S"
FT                   /note="identified by similarity to GP:1518927; match to
FT                   protein family HMM PF00037"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90370"
FT                   /db_xref="GOA:Q60BK6"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BK6"
FT                   /protein_id="AAU90370.1"
FT                   /translation="MALIITDECINCDVCEPECPNGAISQGEDIYVIDPARCTECVGHF
FT                   ERPQCVEVCPVECIHPDPDYREDHDTLYRKYVELNAGPSERA"
FT   gene            477279..479063
FT                   /locus_tag="MCA0461"
FT   CDS_pept        477279..479063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0461"
FT                   /product="CBS/GGDEF/EAL domain protein"
FT                   /note="identified by match to protein family HMM PF00563;
FT                   match to protein family HMM PF00571; match to protein
FT                   family HMM PF00990; match to protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90369"
FT                   /db_xref="GOA:Q60BK5"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BK5"
FT                   /protein_id="AAU90369.1"
FT                   /translation="MSDVRTNEAEKRHAHPDFDAARFPADARVRVLARRFPPYHRDSPC
FT                   LAILDRFLHDPTLSAAAVVDDAMRPVGLIDRYSLVEQFLHPYSRDLYHKHSIAAFMDPE
FT                   PVIVEADSSIDDLSRIIIDAGMRHMVSGFIVTEDGLYLGIGSGHDLFEEVANRKQNHLY
FT                   HLAHYDPLTSLPNRLLLNDRLKRACLRGQRGGYRIALLFIDLDRFKLVNDTLGHAAGDQ
FT                   LLQGVAGRFAACVRKVDTVARLGGDEFTVLLEPVQGPDEALAVAAKLAQSLERPFLIQN
FT                   HEITTSASIGVVLFPEHDATVEGLMRKADAAMYCAKREGRNRFALFTEEMNSTVVERVT
FT                   LESYLNAALEKGEFCCHFQPQMATADDRIVGVEALLRWTNPVLGRVPPLKFIPVAEDTG
FT                   LILPLGLWALETACAQQVRWLSQGLPPLRMAVNISPLQFRNREFCDQVRAIVQRTGIRA
FT                   EHLELELTESAVMADAESSVGILRELRDSGIRLAIDDFGTGYSSLSYLRKFPLDRLKID
FT                   RSFVSGIDRIPANELIVKAIVALGGSLGLDVIAEGVETPEELECIERCGCSEYQGFRLS
FT                   EPLTAEDFAHWFEDSGYV"
FT   gene            479172..479759
FT                   /gene="cobU"
FT                   /locus_tag="MCA0462"
FT   CDS_pept        479172..479759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobU"
FT                   /locus_tag="MCA0462"
FT                   /product="bifunctional cobalamin biosynthesis protein CobU"
FT                   /note="identified by similarity to SP:P29931; match to
FT                   protein family HMM PF02283"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90368"
FT                   /db_xref="GOA:Q60BK4"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BK4"
FT                   /protein_id="AAU90368.1"
FT                   /translation="MPGRIARHERAGDEGLTALGTAFGMKELILGGARSGKSRHAEQRA
FT                   RLSGLDVAYVATAVAGDAEMAARIGGHRARRPPSWPTVEEPLALAASLEANAGPGRFIL
FT                   VDCLTLWLSNLLAEGEEVFRRERQALLQVLPGLPGRICLVSNEVGQGIVPLNPLARRFV
FT                   DEAGWLHQELAVLCDRVVWVVAGLPQVLKGAP"
FT   gene            479756..480796
FT                   /gene="cobT"
FT                   /locus_tag="MCA0463"
FT   CDS_pept        479756..480796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobT"
FT                   /locus_tag="MCA0463"
FT                   /product="nicotinate-nucleotide--dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /EC_number="2.4.2.21"
FT                   /note="identified by similarity to SP:P36562; match to
FT                   protein family HMM PF02277"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90367"
FT                   /db_xref="GOA:Q60BK3"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR017846"
FT                   /db_xref="InterPro:IPR023195"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BK3"
FT                   /protein_id="AAU90367.1"
FT                   /translation="MSWIVPDVAPPRSETFRRALQRQAELTKPAGSLGRLEDLAARLAA
FT                   MQGSGRPSLERVWISVFAADHGVAEEGVSAYPPSVTREMCRVFVAGGAAISVLARQIGA
FT                   VLEVVDAGIAEPLAGLGVVDARAGSGTANFTRAAAMSEAQRDRALAAGAEAASRARRYG
FT                   AQLFIGGEMGIANTTSAAALACALVGVGPERLAGPGTGLDGAGVRRKCEVIGTALRLHG
FT                   EALRDPAEILRRLGGFEIAALTGAYLTAAAASIPVLVDGFIATVAALLAVRMQPACADW
FT                   FLYAHRSAEPGHRLVLEALGGEPLIDLGMRLGEGSGAAVAVPLLRAACALHNEMVTFTE
FT                   AGVSGG"
FT   gene            480793..481386
FT                   /locus_tag="MCA0464"
FT   CDS_pept        480793..481386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0464"
FT                   /product="putative alpha-ribazole-5`-phosphate phosphatase
FT                   CobC"
FT                   /note="identified by similarity to SP:P52086; match to
FT                   protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90366"
FT                   /db_xref="GOA:Q60BK2"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BK2"
FT                   /protein_id="AAU90366.1"
FT                   /translation="MSRVIIDLLRHGEVDGGLCLGRGCDVPLNARGWSQMRAMLPEHPP
FT                   WTGIATSPLRRCAEFAGELAGRLGVELRVDERLGELGFGEWEGRPWSELYERHGGQLSD
FT                   FQRRPDRSPAPDGEHYPDFETRVAAAWEELLGLPGGRHWLVVAHAGTIRAILRRVLEFP
FT                   VTRLFGIDVPPACLSRIVRDGADAPRLVFHGGRP"
FT   gene            481410..482102
FT                   /gene="cobS"
FT                   /locus_tag="MCA0465"
FT   CDS_pept        481410..482102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobS"
FT                   /locus_tag="MCA0465"
FT                   /product="cobalamin 5'-phosphate synthase"
FT                   /note="identified by similarity to SP:P36561; match to
FT                   protein family HMM PF02654; match to protein family HMM
FT                   TIGR00317; match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90365"
FT                   /db_xref="GOA:Q60BK1"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BK1"
FT                   /protein_id="AAU90365.1"
FT                   /translation="MQFLTRLPVPRAVDFSPRALGRSVVLYPAVGLLIGTILLAARLLL
FT                   QDAGPALASALVLLVWVLVTGGLHIDGLADSADAWVGGHGDAERSLEIMKDPCSGPIAV
FT                   AVVVLLLLVKFGALAELSGGLPLLIAPLAARGLVPALLLTTPYVRKGGLGSPLAENLPR
FT                   RQALYAVLATAAVTVAALGPWPLVVAAAAAWTLRAMMLRRLGGCTGDTLGASIEIGEAA
FT                   VLVAAALA"
FT   gene            complement(481965..484082)
FT                   /locus_tag="MCA0466"
FT   CDS_pept        complement(481965..484082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0466"
FT                   /product="transglutaminase family protein"
FT                   /note="identified by match to protein family HMM PF01841"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90356"
FT                   /db_xref="GOA:Q60BK0"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR021878"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BK0"
FT                   /protein_id="AAU90356.1"
FT                   /translation="MTHPSSLPPELLRRNLPLLCAALALVVTPHWADLPPAFPGFVWLA
FT                   CGWRLAALYRKAPPPSRIGLFLLTLAGAGLVYLHFHKFYGREGGTALFLVGLGLKLLEM
FT                   HSLRDLYLVVYLALFVAVTEYLFSQSIPIAAHTLGVVTLLMSCLIGLNGGENLGLAGRL
FT                   RLGAKMVLQAVPVMVVLFLFLPRIAGPLWKLPEDEPGGTTGLSDSMEPGAISRLGLSRE
FT                   TAFRVDFEGAPPPPQERYWRGPVFWKYDGRRWTAGYDQPLPARRPPQTAGASYRYVLTL
FT                   EPQRRRWVFALETAETFPAELTRAEDGFLLAAEPIRERRRYLLSSRPAAAFDALSESER
FT                   RRALQLPGMPDERVRALVDGWLLEDPSADAVAQRALRHFREQPFIYSLRPPAIDGDPIA
FT                   GFLFETRRGFCEHYAGAFVYLMRVAGIPARVVTGYQGGHWNPVGHFLEVSQADAHAWAE
FT                   IWIDGNGWTRIDPTAAVAPERIERELAFEADADGAVVFASPVAEALGQRLSSLRGLIRE
FT                   AGLLWDAVDHAWVQWVLAYGPENQGRFLERLGVVDWNRLVYWLTGLLGLLALISFILLW
FT                   PRCRPAADPALRVYLRVAGKLERQGLVRAPAEGMRDFAARVARSRPDLAESFGRFTALF
FT                   LAIRYGGMVQPAELERLKALGREIPSRQRGSHQHRGFPDLDAGAEGIAGTTAEAAQHHG
FT                   PQGPGGRRGHD"
FT   gene            complement(484079..485044)
FT                   /locus_tag="MCA0467"
FT   CDS_pept        complement(484079..485044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0467"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL03PA02874; match
FT                   to protein family HMM PF01882"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90355"
FT                   /db_xref="GOA:Q60BJ9"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BJ9"
FT                   /protein_id="AAU90355.1"
FT                   /translation="MISVPMEWKERFDPRRFFRGEKAVDGPVLLTHRRVFIVPNRRGFG
FT                   LAVLLAIQFLAAINYGNNLAFILTFLLAGIAMQSTLHAFRNLAGLSVRRGKAPPVFAGE
FT                   PARFELHLDNPSRIHRLGLTARLAGSATPVRFDVAPETTATLILHAETEQRGWLSMPTV
FT                   TFDTSFPLGLFRAWSPINLRQRVLVYPRPAPPGIRPTPIPEPGLGVRPDTREEEDFHGF
FT                   SAYRPGDPLKRIHWKGVAKGQGVHVKQYAGGDTAELLLDWQYTPGADVEARLSRLCRWV
FT                   LDAEAAGTPYGLRLPGVAIQKGRGEAHRARCLEALALFGT"
FT   gene            complement(485058..485969)
FT                   /locus_tag="MCA0468"
FT   CDS_pept        complement(485058..485969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0468"
FT                   /product="putative moxR protein"
FT                   /note="identified by similarity to GP:18892502; match to
FT                   protein family HMM PF07726; match to protein family HMM
FT                   PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90354"
FT                   /db_xref="GOA:Q60BJ8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BJ8"
FT                   /protein_id="AAU90354.1"
FT                   /translation="MDPVFSRLLETANSVILGKEQPIRLCICCLLARGHLLIEDVPGVG
FT                   KTTLARTLAALLGLKYQRIQFTSDLLPADVLGSSIYDATTHGFRFHPGPVFNPMVLADE
FT                   INRSTPRAQSALLEAMEERQVTVEGETRPLPEPFFVIATQNPNTQIGTFPLPESQLDRF
FT                   LMRIELGYPDPRAERELLMGEERYALLPQLPVCLPAERLLALQSRVRDVHASSALLDYV
FT                   QALLHFSRESPLYQNGLSPRAGLALLHAAKAWALMDGRAAVLPEDIQAVLPPVAGHRLK
FT                   LASGGGGMAETVAPLLRDVAIP"
FT   gene            complement(486106..486630)
FT                   /locus_tag="MCA0469"
FT   CDS_pept        complement(486106..486630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0469"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90353"
FT                   /db_xref="GOA:Q60BJ7"
FT                   /db_xref="InterPro:IPR025411"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BJ7"
FT                   /protein_id="AAU90353.1"
FT                   /translation="MNIRGTLLGAVLAMTAACADLDIKVHTDYDPAADFSKYKTYSWIK
FT                   TPQTGNPLMEERMVQTVDAQLSAKGWRKIAAGPSDVALGVQVTAQEQERVDTFYSGWGG
FT                   YGHMGMAQSEVIKYTVGTIIVDMFDTRTKQPIWRGTATDTVSDDPQKNTALMQEAMEKL
FT                   FRGFPPKPAGS"
FT   gene            486838..487257
FT                   /locus_tag="MCA0470"
FT   CDS_pept        486838..487257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0470"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90352"
FT                   /db_xref="GOA:Q60BJ6"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BJ6"
FT                   /protein_id="AAU90352.1"
FT                   /translation="MNIKAIAAAVIVAGSIGGTPAGAVTADDFIIRDAKDLADLCATQP
FT                   ADPAHVAALQFCYGYLQGAYDYYLAERRGPDAGHFVCLPKPEPSREAVVRLFLAWLEAH
FT                   PGYGRDAAIEVLFRFGADQWPCPEKDDAAISAPKS"
FT   gene            487376..489127
FT                   /locus_tag="MCA0471"
FT   CDS_pept        487376..489127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0471"
FT                   /product="dolichyl-phosphate-mannose-protein
FT                   mannosyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF02366"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90351"
FT                   /db_xref="GOA:Q60BJ5"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BJ5"
FT                   /protein_id="AAU90351.1"
FT                   /translation="MSIPVTTAGAPAWSLERWLPAFAFLFAAFLLFVHLGDAPLLSPDE
FT                   GRNAEVAREMRESGAWLVPTYDGLTYLDKPAFYFKTVALSFALFGESEAVARLSSALFA
FT                   LSLLTVLFLFCRRVYDMRTASLAVLVVVATPLYWAFARIVIFDMTLAFFVCSAIFACYL
FT                   AEEHEGRQRERWYRLGALAAGFATLVKGPVGFIVPSLVVAAFGKLDGREGALRRCFAWQ
FT                   NWLIFLAVVLPWFVGVTLQCPDFPYYGIMKESVSRFTTTEFRRTQPFYFYAVIIASCFF
FT                   AWSLLLPESIVAAWRARRRWSRPDRLFIVWAVVVVAFFSVSQSKLPGYILTAVIALGVL
FT                   AARVFALAWSNGAGRAAAIVRRGTVALFALAAPVAVVLATAASDALWLERVLGLKRKTA
FT                   EFLQPGLLAMVVSLGVVTALTAFAWRRRNVKVAFAAFLGFPALLITLNFDLLADYADSR
FT                   SGRRLAEHMPELPAGVEIACLDCLPNGLPFYLKRLITVISDEGREFTSNYVLFSLQRGG
FT                   PWPERVVPLAQQDAWLAGRDHPVFLMARGDDVEQLDTIAEKYGASQIELGFGYWGALLA
FT                   PPQKEGL"
FT   gene            489129..491003
FT                   /locus_tag="MCA0472"
FT   CDS_pept        489129..491003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0472"
FT                   /product="asparagine synthetase, glutamine-hydrolyzing"
FT                   /EC_number="6.3.5.4"
FT                   /note="identified by similarity to SP:P54420; match to
FT                   protein family HMM PF00310; match to protein family HMM
FT                   PF00733; match to protein family HMM TIGR01536"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90350"
FT                   /db_xref="GOA:Q60BJ4"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BJ4"
FT                   /protein_id="AAU90350.1"
FT                   /translation="MCGISGLVQLEGVADTSAMRRSVETMVKALAHRGPDDSGVAGDGS
FT                   AVFGMARLAIRGCHDGRQPMVDAETGVMMVCNGEIDNHAELRGWLAERGRAVEHATDVA
FT                   VIPGLYLELGDGFVERLVGAFALAVWDPRRGRLLLARDRAGERPLFYACRDGRVSFASQ
FT                   AAALVAGSPEPYPADEAAVQAFLKAGYFEAPASPFAGMRKVLPGERIAIDVKGVERSRY
FT                   WRLNFTRGPARKNPLDEFDAVFREAVRRQSEVEVDFGAFLSGGVDSSLVTAVMRSVHPD
FT                   RKLKAFGLRFSESSYDEGVFAERVAESLGVDYTPIWVRPEDFPETLADLVRQSGEPLAD
FT                   PAWVPTALLARRASDEVRVALVGEGADELFGGYPTYFGARLAERYSRLPGGLRALIRKA
FT                   VEAWPVSDKKVTVSFLLKRFVQGDELDFLARHVLWTSSIPPALLRRLGVTPPETPHVAG
FT                   PQETMLDRLQQHDLETSLAEGLLTKADRASMRSALELRAPFLDKDVIEFAATLPERERV
FT                   QGLETKVFLKRVALRYLPKDIVYRKKRGLSVPLSAWLRGPLHDWAEARISSPRLEELGI
FT                   NRAAALELLREHERRSADHARALWTLIVVSEWLEWKAGMEAHPAAFTA"
FT   gene            complement(491179..491337)
FT                   /pseudo
FT                   /locus_tag="MCA0473"
FT                   /note="conserved domain protein, degenerate; this region
FT                   contains one or more premature stops and/or frameshifts
FT                   which are not the result of sequencing error; identified by
FT                   similarity to GP:3986434"
FT   gene            complement(491565..495974)
FT                   /locus_tag="MCA0474"
FT   CDS_pept        complement(491565..495974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0474"
FT                   /product="ATP-dependent DNA helicase, UvrD/REP family"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF00580; match to protein family HMM TIGR00614"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90348"
FT                   /db_xref="GOA:Q60BJ3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BJ3"
FT                   /protein_id="AAU90348.1"
FT                   /translation="MPPWVRHQFPEASVLIRRLRDTPCSDPACPWCSERHNARKELQRW
FT                   FGLPDFRPEPRGEDGRSLQQSIVEAAMRGEHVLGILPTGTGKSLCYQIPALSRYEKTGA
FT                   LTVVISPLVALMADQINGLANRGIHCCAAINGLLSMPERSDALDRVRLGDIGILVISPE
FT                   QLRNRAVRKVLAQREIGAWVLDEAHCLSKWGHDFRPDYRYVGRFIRDSAGDATIPPVLC
FT                   LTATAKPDVVADIVGHFSARLGIGLRVFDGGSQRSNLDFVVVQTTPAEKFADIHRILMS
FT                   DLPPDVPGGAIVYCATRRKTEEVAAFLRATGIAAAHFHAHLPPETKKNVQENFIRGELR
FT                   VIAATNAFGMGIDKPDVRVVIHADIPGSLENYLQEAGRAGRDREAARCVLLYTQEDVER
FT                   QFGMSAHSRLSLKEIRAVLKALRRLDRRKRLDGEVVATPGEILAEESEGDFGRDLATDD
FT                   TRVRTAVAWLEEAVLLSREENRCQVFPSSLRVGSVDEARRKLAKQPMHEEYRRQLLDLI
FT                   AALIGADPDEGVSTDELMGLLGLNPERIRNALYDLERLGLASNDTVLTAFVHSGVERAS
FT                   MKRFEEAVALETALIAELRLAAPDLDKDESSMLHLRIAAQRLKDAGHPGALPEKLQRLL
FT                   SGLAADGRAEDSGTGSLRLRRIDSESVNVTLQRRWSALEKTARLRRIAAQRLLEHLLAC
FT                   LPSGTRGTDLLAETTLGKLTAAMEGDLMLKAEMKNPPKLLQTALLWLHDQDVIRLNKGF
FT                   TVFRAAMTIRLAPDKRGFAKADFEPLKLHYDEQVLQIHVMAEYAQRGLKAVAEALRMAM
FT                   DYFRLDRDAFLRQWLPGREKELSRQTTPESWRNIVESLQNPAQQRIVADDREQTNVLVL
FT                   AGPGSGKTRVLVHRIAYLIRVRRENPRGILALAYNRHAAAEIRKRLAGLIGDDARGITV
FT                   LTCHALAMRLAGVSFAERWEKTGDEVFQEVLRQAIALLKGEGLPPEEADEQRDRLLAGY
FT                   RWILVDEYQDIGPDQYELISALAGRTLQDEDSRLNLLAVGDDDQNIYAFNGASVEFIRR
FT                   FEADYAAKPAYLTENYRSTSRIIEAANRLIGDAPDRMKQAHPITIDRARKKAAPGGDWE
FT                   AIDPVGQGRVQILPAGVDERTQAVTVMREFERLASLAPNWDWTRCAVIARKWDLLEPVR
FT                   SYCELAKIPVQMAGEETVPFRYLRETRTLLAWLKDTKLVDAAKILSWLDERPAGPWWNA
FT                   LRQAAEEYAVETGGAELPSAHFEEWLAEWGREIRRRPSGLMLLSAHRAKGLEFDHVAVL
FT                   DGGWKAGAKEDRHSPRRLYYVAMTRARKTLTLTRIEPNSPLLDSLAGIPDVLHRPPTEH
FT                   MQLPPELSRRYRKLTLKDVHLGFAGRYPETDPIHQAIAALEAGDPLWLKRKNDVWELND
FT                   AGGNTVGRLARAFDPPKGMICIQARAAAIIIRRRDETEADYLSGVCCDAWEVVIPELVF
FT                   EPAGKGRT"
FT   gene            complement(496823..497605)
FT                   /locus_tag="MCA0476"
FT   CDS_pept        complement(496823..497605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0476"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:VCA0776; match to
FT                   protein family HMM PF03746"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90347"
FT                   /db_xref="GOA:Q60BJ2"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BJ2"
FT                   /protein_id="AAU90347.1"
FT                   /translation="MARTIDLNADLGESFGPWRMGQDETLLELVTSANIACGFHAGDPD
FT                   VMAETVRLAVSRGVALGAHPSLPDRQGFGRRPMALRPDEIRNLVLYQIGALAGFARAAG
FT                   GRLVHVKPHGALYGQAASDAAMAEAIAAAVRAFDANLILVGPAGSQLVRAGQAAGLAIA
FT                   REGFADRRYEPDGTLTPRGRPEALIEEPAEAVAQALGMVERGEVTARDGTVIPMPVDTL
FT                   CLHGDGPDAAAFARRLRMELAARGIPVAALGGWLSGAA"
FT   gene            complement(497614..498606)
FT                   /locus_tag="MCA0477"
FT   CDS_pept        complement(497614..498606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0477"
FT                   /product="allophanate hydrolase, subunit 2"
FT                   /note="identified by match to protein family HMM PF02626;
FT                   match to protein family HMM TIGR00724"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90346"
FT                   /db_xref="GOA:Q60BJ1"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BJ1"
FT                   /protein_id="AAU90346.1"
FT                   /translation="MIRVEHPGLLSTLQDLGRPGCQHLGVTPGGAMDGYSAAIANALVG
FT                   NPPAAAVLEMTLQGPRLSFERGAWVSLTGADLSAELDGRPLACWRPVWLPAGSRLGFGR
FT                   PRLGCRAYLAVAGGFEVTAVLGSRSTDLRAGFGGLGGRPLGKGDVIEAGESTLALPDNP
FT                   SRPCVPAWSAAWNRALPLECPARLRLIPGPDWQDLPDEDRRALETDAFRVGQASDRMGL
FT                   RLEGPPLHPVSAAERLSAGVTFGTLQLPPDGQPILLGVDRQTTGGYPVLGTVASVDHPR
FT                   LAQLRPGETVRFEPIPVERAQTLYRIRALQLRRLRTGLDLRWPLNSPSP"
FT   gene            complement(498603..499292)
FT                   /locus_tag="MCA0478"
FT   CDS_pept        complement(498603..499292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0478"
FT                   /product="allophanate hydrolase, subunit 1"
FT                   /note="identified by match to protein family HMM PF02682;
FT                   match to protein family HMM TIGR00370"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAU90345"
FT                   /db_xref="GOA:Q60BJ0"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BJ0"
FT                   /protein_id="AAU90345.1"
FT                   /translation="MSASPPRLSPLGDSALLIVFGDRIDPALNRRAVALSNALADLPGV
FT                   TDRVPAYASLTLHYDPGVWSHDGLVETVMPYLADEGGTALEDRHLLIPVCYGGEHGPDL
FT                   DEVARHCGLAPDEVIARHSSGEYLVYFLGFTPGFAYLGGLDPDLATPRRAAPRSSVPAG
FT                   AVGIAGEQTGIYPQTSPGGWRLIGRTPLRLFDPLREPPCLLAPGDRLRFVPIGPDEFES
FT                   RLKGEAL"
FT   mobile_element  500329..501649
FT                   /mobile_element_type="insertion sequence:IS32"
FT   gene            500389..500929
FT                   /pseudo
FT                   /locus_tag="MCA0481"
FT                   /note="missing ISAs1 family element, transposase OrfB;
FT                   ISMca6, transposase, OrfA, truncation; comparison of this
FT                   gene to its homologs suggests this gene has been truncated;
FT                   identified by similarity to OMNI:PG0277"
FT   gene            501566..502495
FT                   /locus_tag="MCA0482"
FT   CDS_pept        501566..502495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0482"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93230"
FT                   /db_xref="GOA:Q60BI9"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BI9"
FT                   /protein_id="AAU93230.1"
FT                   /translation="MPFRTSSVPHDFLLDEQSLIDGKKWKGIRFGGCRSGSARCLIVEP
FT                   CYLAMSMRLYQTSMLACTFLAGCAFGNKQDYRQAQPSLAFSGVQKIAVGVQDQRPYVVN
FT                   GNKDEDFVGLQRGGLGNPFDVRTQSKRALAEEMTNLLADALKHSGANVTPVRLPPSLSR
FT                   DQVLSTLLAEKPDKSLLVTLYEWKSDTYVGSEIQYNVDMQAFGRSGKLLAEKRIEGIDQ
FT                   LGSAFWYPQGVAQDGAPAAFKKKMEEMYSGGIAKAITQTGESQIGLSNDQSPEDKYTRL
FT                   AKLRKLLDDGTLTQQEFEAEKRRILEPD"
FT   gene            504135..504551
FT                   /locus_tag="MCA0484"
FT   CDS_pept        504135..504551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0484"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GP:27348307"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93215"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BI8"
FT                   /protein_id="AAU93215.1"
FT                   /translation="MRTDYDSIAERYKRAKLQPWRNCIETFTLLDLIGNLSGQAVVDVA
FT                   CGEAFYTRRLRAQGAARVLGLDLSERMVELAREQEAEQPLGIDYRVGDGKNLSLPSEFD
FT                   LAVAAYFLNYAADQHELEAMCAGISACLRPGGAS"
FT   gene            complement(504872..505723)
FT                   /locus_tag="MCA0485"
FT   CDS_pept        complement(504872..505723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0485"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93214"
FT                   /db_xref="GOA:Q60BI7"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BI7"
FT                   /protein_id="AAU93214.1"
FT                   /translation="MQKEGFLESAYGVRMPGIVYGTAWKKDRTAALVEQAVSLGFRGID
FT                   TACQPKHYDEPGVGAGLAACTNAGLERADLYLQSKFTPVDGQDPERMPYDPKASLAEQV
FT                   ARSFESSLKNLRTSYLDCLILHSPLSKEKDTLDVWRAMETVFDGGGARQLGISNCYRPE
FT                   LLERLYRWSRVKPAVVQNRFYAETRYDREIREFCRQNRIVYQSFWTLTANPSILAHATV
FT                   RALAATHGRTPAQIFFRYLTQIGVVPLTGTASEAHMREDLAIFEFELTPDQCAAVSGLL
FT                   RT"
FT   gene            complement(505734..506360)
FT                   /locus_tag="MCA0486"
FT   CDS_pept        complement(505734..506360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0486"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:PSPTO5190"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93213"
FT                   /db_xref="GOA:Q60BI6"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BI6"
FT                   /protein_id="AAU93213.1"
FT                   /translation="MNEFMEPLDRISAETLGHYERNAEAFFEGTRDHDVSQNIAALLSH
FT                   IRTEPPFTVLDFGCGPGRDLKAFTELGHRAVGLDGAFRFVEMARDYSGCEVWHQDFLKL
FT                   DLPEEHFDGIFANATLFHVPSRELPRVLGELRAALKPEGVLFASNPRGRNEEGWNRGRY
FT                   GVYHDLDTWRRFLTSAGFLELEHYYRPAGLPRDQQPWLASVWRRT"
FT   gene            complement(506592..506759)
FT                   /locus_tag="MCA0487"
FT   CDS_pept        complement(506592..506759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0487"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93212"
FT                   /db_xref="GOA:Q60BI5"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BI5"
FT                   /protein_id="AAU93212.1"
FT                   /translation="MFFEGFSVWACAPSAGATASNPGTPCIAGKTVQRAASARDVATLG
FT                   KFLSTLAVSV"
FT   gene            506842..507156
FT                   /locus_tag="MCA0488"
FT   CDS_pept        506842..507156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0488"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93211"
FT                   /db_xref="GOA:Q60BI4"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BI4"
FT                   /protein_id="AAU93211.1"
FT                   /translation="MNHIDTLIRLINQGFSAQVMLKDGSMIRGFRPHDIIARGGVSAGV
FT                   VVARGLVGGEDRIVPLCDVSGVFSERPRRVLTTDAGFFQRNPVPRGWTRLHPLAVSDGN
FT                   "
FT   gene            complement(507177..507500)
FT                   /locus_tag="MCA0489"
FT   CDS_pept        complement(507177..507500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0489"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93210"
FT                   /db_xref="GOA:Q60BI3"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BI3"
FT                   /protein_id="AAU93210.1"
FT                   /translation="MSRILIVLFWLALMPLPAAVGDEAADIAKVEAATCAGATVGQRLQ
FT                   EEIQSHSRRDLGWRVFVEDDHRDLERSLRISKAMEARYRWRIDAAGKIEPVSDAARQLC
FT                   APR"
FT   gene            complement(507520..508815)
FT                   /gene="amt-2"
FT                   /locus_tag="MCA0490"
FT   CDS_pept        complement(507520..508815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amt-2"
FT                   /locus_tag="MCA0490"
FT                   /product="ammonium transporter"
FT                   /note="identified by match to protein family HMM PF00909;
FT                   match to protein family HMM TIGR00836"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93209"
FT                   /db_xref="GOA:Q60BI2"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BI2"
FT                   /protein_id="AAU93209.1"
FT                   /translation="MKFPVAMMRVLALSGLTWPVLAAPEGPNAADTAWILTSTGLVLFM
FT                   TMPGLALLYAGLVRTKNVLSVMVQIFTATSLVSVLWVIAGYTLALTDGGELQAWIGGGK
FT                   RLFLLGLKADSLNGNLPEVVYCMYHLTFAIFAPALMLGAIVERMKFSVTLWFTGIWTLL
FT                   VYVPVCHWVWGEGWLARIGAIDFAGGVVVHTTAGVSALVGAWMLGPRRGYPRTLLPPHN
FT                   LTLTAIGAGILAVGWHGFSAGSALMATGAAGMAMLTTHIGASVGALVWMAVEWRSFGKP
FT                   TLLGALTGMIAGLGVISPAAGFVGPLGAIAMGTAAGVICFGAIHWIKRSLQIDDTLDVF
FT                   PVHGVGGMIGTVLTAPFAAEALGGAGITTGLTIGQQTLTQILAVGSVAAWSGLISWLLL
FT                   KILDRTIGLRVTPDQETEGLDVALHNSKAYHF"
FT   gene            509163..510329
FT                   /locus_tag="MCA0491"
FT   CDS_pept        509163..510329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0491"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:4378852"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93208"
FT                   /db_xref="GOA:Q60BI1"
FT                   /db_xref="InterPro:IPR011486"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BI1"
FT                   /protein_id="AAU93208.1"
FT                   /translation="MSGAGLEQARGVFEMLPDGMNPNGADWMQSLRLTLGGWIDAGLTH
FT                   NFDEPGSGYNGPVTFSDRSDEFQPNQVYLYLERAVDRQGESFDLGGRLDLLYGTDAWFS
FT                   QAFGDPQGSWDRQISDNNRYSLAVPQAYLEALVPVGRGLAVKLGHFYTVVGVESVMAPE
FT                   NFFYSHSYAMQYGEPFTHTGIRFSYQPTDNLLLDAAAVTGSQFAGWDGVFDHSLENWAF
FT                   VGGGTWTSDSGETSLSINGSNGTVTTVPRGELGFYSLVAQHDLTLRLHAILQHDHGWIS
FT                   GDGKTSSWYGLVQYLSYDLADDLSLGLRGEWFRDDDGIRVLSPARAPTMGLGPGSYYAV
FT                   TAGVKWSPLPWLTARPNLRYDWSDGTRPFDDGNATSQILLSADVIVSF"
FT   gene            510348..510626
FT                   /locus_tag="MCA0492"
FT   CDS_pept        510348..510626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0492"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to SP:Q47142"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93207"
FT                   /db_xref="GOA:Q60BI0"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BI0"
FT                   /protein_id="AAU93207.1"
FT                   /translation="MKAGVIHSSRRPEHITSRFKNGSGAGAPSCNSCRQLVSTVIIMAA
FT                   LTVCGGREFWTGAHFAYALTVAVLGGFIAPVARDLAAAMESLRNRPR"
FT   gene            complement(512192..513094)
FT                   /locus_tag="MCA0496"
FT   CDS_pept        complement(512192..513094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0496"
FT                   /product="conserved hypothetical protein TIGR01777"
FT                   /note="identified by similarity to OMNI:NTL03PA04657; match
FT                   to protein family HMM PF07993; match to protein family HMM
FT                   TIGR01777"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93191"
FT                   /db_xref="GOA:Q60BH9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BH9"
FT                   /protein_id="AAU93191.1"
FT                   /translation="MHLLVTGGTGFIGRSLCRRLLERGHRLTVLSRQAPDTVRRLCGET
FT                   VMPVAAIDSLSPQAGFDAVVNLAGEPIADKRWTEARKRLLWESRVGLTTALVDYIARAE
FT                   SKPPVLISGSAVGYYGNRGDTLLDEESAHGDGFGHRLCAAWEEAASRAAGHGVRVCMLR
FT                   TGLVVGRNGGFLQRMLPLFRLGLGGRIGEGRQWMSWIHLDDHIAITEYLIEDAHLEGAF
FT                   NATAPNPVTNREFTECLARLLNRPAPLPVPAFTLRLALGETAELLLGGQRVIPKRLQQE
FT                   PFRFRYEHLENALRDALGR"
FT   gene            complement(513153..513497)
FT                   /gene="phhB"
FT                   /locus_tag="MCA0497"
FT   CDS_pept        complement(513153..513497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phhB"
FT                   /locus_tag="MCA0497"
FT                   /product="pterin-4-alpha-carbinolamine dehydratase"
FT                   /EC_number="4.2.1.96"
FT                   /note="identified by similarity to SP:P43335; match to
FT                   protein family HMM PF01329"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93190"
FT                   /db_xref="GOA:Q60BH8"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BH8"
FT                   /protein_id="AAU93190.1"
FT                   /translation="MDACSLTAKQCTPCQGGIPPLTAEEAEKLLVHVPRWELKDAATKL
FT                   KRTFRFENFMEALDFARKVGELCEAEGHHPDIGIGWGYCRVEFQTHKINGLHENDFIMA
FT                   AKVDELAAEA"
FT   gene            complement(513623..514303)
FT                   /locus_tag="MCA0498"
FT   CDS_pept        complement(513623..514303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0498"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01SMA00697;
FT                   match to protein family HMM PF07298"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93189"
FT                   /db_xref="GOA:Q60BH7"
FT                   /db_xref="InterPro:IPR009915"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BH7"
FT                   /protein_id="AAU93189.1"
FT                   /translation="MLNLALAMLFFVGIHFLISGTSLRDRLVAYRGEQAFRAAFSVLSL
FT                   LALGWVVFAYRQAPYVETWGQLTGFKPIAAVLMLVSFIFVVAGLTTPNPTAVSGESVLN
FT                   DAEAARGILRITRHPFLWGLSLWALVHVIANGDVAALLLFGSLLALCLAGTRSIDAKRR
FT                   RTYGDRWERFAAATSNVPFMAIKEGRNRLELGEIGWQRLGIAVALYLAMLHFHAKIFGV
FT                   SPLF"
FT   gene            complement(514456..514827)
FT                   /locus_tag="MCA0499"
FT   CDS_pept        complement(514456..514827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0499"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL03PA04177; match
FT                   to protein family HMM PF04828"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93188"
FT                   /db_xref="GOA:Q60BH6"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BH6"
FT                   /protein_id="AAU93188.1"
FT                   /translation="MKYEVKGDPQRFYHCHCSRCRKSSGTGHATNLFLANAELVFASGQ
FT                   SLLKQFKVPEAKRFTRQFCSRCGSQVARYVPEIDGVVIPAGSLDDEAPIQPQARIFWDS
FT                   RAHWSCDGDALPRHAEYPG"
FT   gene            complement(514805..514972)
FT                   /locus_tag="MCA0500"
FT   CDS_pept        complement(514805..514972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0500"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93187"
FT                   /db_xref="GOA:Q60BH5"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BH5"
FT                   /protein_id="AAU93187.1"
FT                   /translation="MIDRPRSRPGFERLPRLKAVSSPQRLSFPDRHRRLYVSLTQRQLP
FT                   LRRSEIRSQR"
FT   gene            515916..516851
FT                   /locus_tag="MCA0503"
FT   CDS_pept        515916..516851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0503"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL03PA00821; match
FT                   to protein family HMM PF01844"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93186"
FT                   /db_xref="GOA:Q60BH4"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BH4"
FT                   /protein_id="AAU93186.1"
FT                   /translation="MPSDNDKIELLVKRIKYAPSREWVNSYFELVKRIIKITGLDNDDP
FT                   RLVMSLSRNSAGWRFPVTINNRYVVALRKKKENERTKLYVGLIFTASAREIPQLRDSPD
FT                   LGKWGQFRNLRGEDSDPPYFLRFGNFHELLYWLETSEQIYQSWSEALLAEVGRAKSSPY
FT                   RKSHEPLMYKMAVDVNFRAEILDRVYTESKPGLGLLPEQIDEPQEFYEGASKSITVNAY
FT                   ERNPQARNACIEHYGAKCIICGFVFHEKYGEIGKGFIHVHHIKPLGEICAEYQVDPIND
FT                   LCPVCPNCHAMLHMRKPPYSLNEIRAMLKR"
FT   gene            517168..518325
FT                   /locus_tag="MCA0504"
FT   CDS_pept        517168..518325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0504"
FT                   /product="GGDEF domain protein"
FT                   /note="identified by match to protein family HMM PF00990;
FT                   match to protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93185"
FT                   /db_xref="GOA:Q60BH3"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BH3"
FT                   /protein_id="AAU93185.1"
FT                   /translation="MDPYTFYTLLTLASVGKAGMILLVAPQYPGRITRGMYAWALGGLM
FT                   MGMNFALFVLTARSLVPEPVALGGAVTLGIGGTLLVFVAVQELRERVYSKFALLGVFVF
FT                   AAVANAYTLHAGHDGLRISVNSVLAAAVFFMIAHALLRPDPPSGRSIYRVTGFLALAIS
FT                   MVLAIRAVSPLILDSPIVHPMDENWVQQLTYSAILVGNVLGSLCFGLIVAEELNAELHQ
FT                   LASFDSLTRIYNRRVFENLATDELLRARTKRVPVSLLMIDIDHFKQVNDRHGHAAGDAA
FT                   LVRVAETMEESLRHRDLLCRYGGEEFGVLLPATARAQALRIAERLRLATMHAGFLYGGE
FT                   AIPLTVSIGVACIEGPPYDLSLLKHDADRALYVAKQAGRNRVAVV"
FT   gene            complement(518680..518922)
FT                   /locus_tag="MCA0505"
FT   CDS_pept        complement(518680..518922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0505"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93184"
FT                   /db_xref="GOA:Q60BH2"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BH2"
FT                   /protein_id="AAU93184.1"
FT                   /translation="MLEYPWDLPPVDAAPTADGRFYPNFLCQLPGSADRPGVVLAVGHK
FT                   GADRWNGAEDDRSIGRLWANLSQGRCRFVMVKDER"
FT   gene            518981..519721
FT                   /locus_tag="MCA0506"
FT   CDS_pept        518981..519721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0506"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93183"
FT                   /db_xref="GOA:Q60BH1"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BH1"
FT                   /protein_id="AAU93183.1"
FT                   /translation="MREAGAGFGEPDELGQLRECHVAADLAVGVEQRFGGQAAELETAA
FT                   QSFDGFLSSPACGRGGITTGLPFVTRRSGLRRRSFPGTSDEARAKNRPRCLSCTRQGHR
FT                   RAAGRGPVAKSSGGRAFQKRGTMSRPGTSLAAGVDATCHLPKPCQYGVLTNPEKSLRKV
FT                   GLGEGGEAIFFHPAKIRPERSAYHSRPKMTIPVISAAMSVVPMRKGKSKSRRCRRIYRL
FT                   ILRLSAWSSTIRWSPSSLGRMQEP"
FT   gene            complement(520023..520098)
FT                   /locus_tag="MCA_tRNA-Lys-1"
FT   tRNA            complement(520023..520098)
FT                   /locus_tag="MCA_tRNA-Lys-1"
FT                   /product="tRNA-Lys"
FT   gene            complement(520111..520186)
FT                   /locus_tag="MCA_tRNA-His-1"
FT   tRNA            complement(520111..520186)
FT                   /locus_tag="MCA_tRNA-His-1"
FT                   /product="tRNA-His"
FT   gene            complement(520196..520272)
FT                   /locus_tag="MCA_tRNA-Arg-2"
FT   tRNA            complement(520196..520272)
FT                   /locus_tag="MCA_tRNA-Arg-2"
FT                   /product="tRNA-Arg"
FT   gene            complement(520279..520355)
FT                   /locus_tag="MCA_tRNA-Pro-1"
FT   tRNA            complement(520279..520355)
FT                   /locus_tag="MCA_tRNA-Pro-1"
FT                   /product="tRNA-Pro"
FT   gene            complement(520441..521064)
FT                   /gene="fchA"
FT                   /locus_tag="MCA0507"
FT   CDS_pept        complement(520441..521064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fchA"
FT                   /locus_tag="MCA0507"
FT                   /product="methenyltetrahydrofolate cyclohydrolase"
FT                   /EC_number="3.5.4.9"
FT                   /note="identified by similarity to SP:Q49135; match to
FT                   protein family HMM PF04961"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93175"
FT                   /db_xref="GOA:Q60BH0"
FT                   /db_xref="InterPro:IPR007044"
FT                   /db_xref="InterPro:IPR036178"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BH0"
FT                   /protein_id="AAU93175.1"
FT                   /translation="MIQDQPIQQFLDELASKSATPGGGSAAAIMGAMGAALVGMVCNLT
FT                   VGKKNYEAVEAEMADVLARADALRAQSIDMIRADIEAFDRVMAAYALPRETEEDKVARS
FT                   TAIQEALKAATEVPLACARLCLDIIGLSETAAQKGNRNLISDAGVAVMAAHAALKSAAL
FT                   NVYVNAKGVKDEAFARERVDRLEALLEEGEAKAHAVFETVRANL"
FT   gene            521192..522052
FT                   /locus_tag="MCA0508"
FT   CDS_pept        521192..522052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0508"
FT                   /product="methylenetetrahydromethanopterin
FT                   dehydrogenase/methylenetetrahydrofolate dehydrogenase"
FT                   /EC_number="1.5.1.5"
FT                   /note="identified by similarity to SP:P55818"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93303"
FT                   /db_xref="GOA:Q60BG9"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015259"
FT                   /db_xref="InterPro:IPR035015"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037089"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BG9"
FT                   /protein_id="AAU93303.1"
FT                   /translation="MKKLLFQFDTDLHPSVFDTVVGYDGGADQVIAHGHLTPDNVGPLV
FT                   EGTIFTRAPKDKKNTAIFVGGSDLVAGQNLLRAVRKKFFADFRVSVMLDSNGSNTTAAA
FT                   GVAKLASSGTLAGKKAVVLAGTGPVGQRAAVMLAKEGCSEVVITSRQMARAEHACAEMK
FT                   ARFGVDLVPVEAFDDDARAAAIADAQIVFATGAAGVRLLEECHWRDRPDLELLADANAT
FT                   PPLGLGGTDMMDRGTDRHGKIVWGAIGFGTLKLAVHRACIAKLFERNDQVFDAEEIFAL
FT                   AKTMA"
FT   gene            complement(522065..523462)
FT                   /gene="cysS"
FT                   /locus_tag="MCA0509"
FT   CDS_pept        complement(522065..523462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="MCA0509"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="identified by similarity to SP:P21888; match to
FT                   protein family HMM PF01406; match to protein family HMM
FT                   TIGR00435"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93302"
FT                   /db_xref="GOA:Q60BG8"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BG8"
FT                   /protein_id="AAU93302.1"
FT                   /translation="MLKIYNSLTRQKEEFRPLEPRRVRMYVCGMTVYDYCHLGHARVMV
FT                   VFDMVARYLRHLGLKVTYVRNVTDIDDKIIRRAVENGETIGALTARFIEAMHEDERALG
FT                   VLPPDHEPRATESIDDILAMIGTLIERGHAYVGSNGDVFYAVASFPNYGRLSGKNLDEL
FT                   RAGERIEVDEAKRDPLDFVLWKSAKPGEPFWASPWGPGRPGWHIECSAMSTRCLGAHFD
FT                   IHGGGMDLQFPHHENEIAQSEGATGEHFVNYWMHNGFVRINEEKMSKSLGNFFTVREIL
FT                   ARYRPEVVRFFILNSHYRSPLNYSDENLDEAAAALSRLYTALRGLAPDLPLPLGEDRDE
FT                   GFSSRFADAMQDDFNTPEAIAVLFDLAREINRHKAAEPAKAAALGATLKSLGNVLGLLQ
FT                   TDPEAYFKSDAGGSGLSDADIETRIRARLEARKAKNWAESDRIRDELKAQGIILEDSAA
FT                   GTTWRRE"
FT   gene            complement(523464..524864)
FT                   /gene="gltX-1"
FT                   /locus_tag="MCA0510"
FT   CDS_pept        complement(523464..524864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX-1"
FT                   /locus_tag="MCA0510"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="identified by similarity to SP:P22250; match to
FT                   protein family HMM PF00749; match to protein family HMM
FT                   TIGR00464"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93301"
FT                   /db_xref="GOA:Q60BG7"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BG7"
FT                   /protein_id="AAU93301.1"
FT                   /translation="MSAIKTRFAPSPTGLIHLGNARTALFSALGGDVFVLRIEDTDLER
FT                   SRAEFVAELMNDLRWLGLDWQEGPRGAEPDPDWYQSRRGEIYATYYRLLEEKGLAYPCF
FT                   CTPLELEVSRKVQLGSGRPPRYSGRCAHLPADEVRRRHEEGLAATLRFRVPKDRVVEFE
FT                   DEVRGPQRFAGEDIGDFIIRRADGSPAFFFCNAIDDALMGITRVLRGEDHLANTPRQLM
FT                   ILAALDLPRPRYAHISLIVGDDGAPLSKRNGSRSIKQLREEGYFPEAVVNMLARLGHHY
FT                   DSAELLGLPALRAGFDIRRLGRSPARFDVSHLDHWQGLAVRGAADDTLWHWLHTETRAV
FT                   VPDAHRAGFLDLVRSNCLFPKEADAWARILFTDELELAADIAAVAQAAGEAFYLAAIDA
FT                   ATESPDDFAAFLAGLKRRSGAKGKHLFLPLRAALTGSLDGPELAKIYQMLDKPRLHRRL
FT                   AEFTYESE"
FT   gene            525098..526564
FT                   /locus_tag="MCA0511"
FT   CDS_pept        525098..526564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0511"
FT                   /product="putative NADH ubiquinone/plastoquinone complex
FT                   subunit"
FT                   /note="identified by similarity to SP:P50974; match to
FT                   protein family HMM PF00361; match to protein family HMM
FT                   TIGR01972"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93300"
FT                   /db_xref="GOA:Q60BG6"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BG6"
FT                   /protein_id="AAU93300.1"
FT                   /translation="MKTLSCLLWTPLAGALVLAFLPRHWHRHACSIALGFSGLCLLLTL
FT                   FVTIRFETNSPDVQFSEMLPWNPGMGSFYALGVDGFSLPLVLLSAFLCLVALLAGLGGP
FT                   RPRGYYIAFLSLEFGMLGVFLSRDWALFYVFWELTLIPLFFLIDQWGGKRRHGAALNFV
FT                   LYTMGGSVFMLIALLMVYAASTEHSTLMDSMQGVARGLPRGSQVLIFLGLLTGFGVKMP
FT                   VFPLHGWLPLAHVEAPSPISILLSGALLKMGAYGLIRACAMLPEAVVVMQPWLAAIALV
FT                   GIVYGALLAWRQSDLKAMIAYSSVSHMGFVLVGLAAMNPVGLIGAVMQMTAHGLVAGAL
FT                   FLLIGLLYERTHTRELADYGALGRTAPRLAAFTVLALLASMGLPGSVGFVAELHAMIGG
FT                   FQHFGAWMLVASFGVLVGGAYALRCVAALVAGPAKPAMSGLEDLRPAEFAGASCLVAAI
FT                   VWLGLAPAALLELSRVSIGHYLAALQPEFL"
FT   gene            526638..529859
FT                   /locus_tag="MCA0512"
FT   CDS_pept        526638..529859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0512"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01AA00598"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93299"
FT                   /db_xref="GOA:Q60BG5"
FT                   /db_xref="InterPro:IPR018752"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BG5"
FT                   /protein_id="AAU93299.1"
FT                   /translation="MEHVLPGQAPIRDFVHHNTLHGFQHLPFAAALEEAERLTGIRGYL
FT                   PENEFRALHRKGRIDDADIDTVLDRHLGAAGEEILAVAGGEPVTRRQIHRLRLTVDLEP
FT                   VDPARFTWLVDELEALDRFDPEVSPEARRRLMESAKRGRGEAVASRRLVRDLWDACLER
FT                   LGLGDYTASHPEDLLGHAIAHAEALYADFKAESSGGGLSVSHRAMREEARALLAEEIDA
FT                   VGREQTLRGFILKLTGQDVLDRVRPQLIRHCASHLDEGLAAWHSPDRSLGFYAAWKRSM
FT                   RHGAEGGLGEVPLGHAELDALPDDPAEVVVFELEQRGIPLPYWEGYLERLALELPGWSG
FT                   MMNWRAHRPLYRANRTAPVSLMDYLAVRLILDRRYLGRICSETWGIGGHIGELARYFEA
FT                   HLSEFVVRHALYCGDLPEFLAATCADLVRRAGCERVDRKPWRVAADMIFSWRHAPGAGR
FT                   DLRIRLHGSGWRLFKLAQHLGLSAHDVQALSASEIERLLCALDELTPAQRGYLWLCAYE
FT                   RHYREPLFNALASNHGRGRWATRDERPQAQIVFCMDDREEGVRRHLEELNPAVETLGAA
FT                   GFFGIPMYWQGLDDAEPSALCPIVVIPSHEVREVPRPGEEAARRLHDHRRGVVRLLGRV
FT                   FNQEIRRNLLSSHLLIDLVAPGVAVGLIAKVLLPRWAATLSRWLADLWMPEVPTTLALH
FT                   AADDAAPAGPEQPRPGLTDAEQADRVAAFLLNIGLTQGFAPIVVLMGHGSASRNNPHLA
FT                   AYDCGACSGRHGGPNARVFAAMANRPQVREQLAQRGLVVPADTWFVGAEHNTCSEEITW
FT                   FDVQDIPPLSRIGWHAFAAQLDEACRLSAQERCRRFASAPRRPSPARALRHVSTRSVDF
FT                   SQARPELGHATNAAALIGRRSVSRGLFLDRRVFLISYDPTRDPEGRILEGILLAAGPVG
FT                   AGINLEYYFSTVNNERHGCGSKVAHNVTGLFGIMEGAASDLRTGLPRQMAEVHEAMRLQ
FT                   VVVEQTPEILAAIYRRQPPIRELVGNGWILLSAIDPGDGTISVFDPERGFVPWAGAATD
FT                   MALCGRSTDWFEGHVEPLAPALIAV"
FT   gene            529905..531434
FT                   /locus_tag="MCA0513"
FT   CDS_pept        529905..531434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0513"
FT                   /product="putative NADH ubiquinone/plastoquinone complex
FT                   subunit"
FT                   /note="identified by similarity to GP:17221967; match to
FT                   protein family HMM PF00361; match to protein family HMM
FT                   PF00662"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93298"
FT                   /db_xref="GOA:Q60BG4"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BG4"
FT                   /protein_id="AAU93298.1"
FT                   /translation="MLPAAAAFCIAAGIALGRLEGESCERVSARIALAALGASGLLALL
FT                   LLVLGSAGILDARTVLGTWLASADYRVLLSLQLDRLSSGLSVLIALMAYLVAHFSIDYM
FT                   HRERGFHRFFLVLSLFTGAMQLLVLAGNPVLTFFGWELAGVCSYLLIAYAYDRPVAAGN
FT                   ATRAFLTNRVGDAGLVLAIALSFAWTGQLEWSRLLAGLARLSPEKQNLVAACFLVAAFA
FT                   KSAQVPFSPWLARAMEGPTPSSTLFYGALMIHAGVYLVLRLEPLFAQAEAVSALMAAAG
FT                   LATALYGYFCGLSQTDVKSALAFSTLAQVGLMFLACGLGFWQLAFWHLFAHAVVRGYQF
FT                   LTAPGLMHALSGQPPRPLPAWLAESRRGYAASLNRFWLEPAVDRACVLPVQRLADDFDA
FT                   FDRRVLDRLLDAPVPAVQALAALANWEERRIGVPLGAEAERRIGGLPGWIVARTADVLH
FT                   WFEDRLVLRGVGLDLWRAGRRLGRALQRLEALLAEPRYVCLVLLISLFAVG"
FT   gene            531445..532995
FT                   /locus_tag="MCA0514"
FT   CDS_pept        531445..532995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0514"
FT                   /product="putative NADH ubiquinone/plastoquinone complex
FT                   subunit"
FT                   /note="identified by similarity to SP:P31978; match to
FT                   protein family HMM PF00361; match to protein family HMM
FT                   TIGR01972"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93297"
FT                   /db_xref="GOA:Q60BG3"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BG3"
FT                   /protein_id="AAU93297.1"
FT                   /translation="MTGEIPWSEITGFPVLSTLIGLPLVFMLAALRAEQRGLAWIIGLA
FT                   GSLAELGVALFLLARFDAGTADFQFTEHTVFLSLLNYHLGVDGISLGFVLLTALLTVLA
FT                   LLCREVGKDGPSGLYVATVLACEATAMGMFLALDLVQFWIAACLELWPVALILGRWEGG
FT                   DGAEARRVYLRFAGMGLALLGVGVFLLGLGHARATGIWSYDLAALLETPLSGTFESLVF
FT                   VLLFYGFSVRLAQFPLHGWLPIVAAQGPPVTALALLVGMKVGIYGLLRFVLPLLPNAVH
FT                   EWTALTLGLALAGLFYGAVLALMQLDFRRLMAFATVSQTGMLVAGVFALDLEGLSGTLL
FT                   LAFDFGVAGAGLFFLAGMLRCRTGTLLLPRLGGLFESLPGPGLLFLVAASSTIAMPGTP
FT                   GFDAAHLLLEGLIENRGPAAAIAVAVGNVLAAGFLLWAFQRVFLAHRRSHRPYPERPRP
FT                   GWREHTLIALLCLVLLGVGFYTAPWVHLTRQSLFRLAQVYTPPAAVLPAAARPSTHPS"
FT   gene            533015..534550
FT                   /locus_tag="MCA0515"
FT   CDS_pept        533015..534550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0515"
FT                   /product="putative NADH ubiquinone/plastoquinone complex
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF00361;
FT                   match to protein family HMM TIGR01972"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93296"
FT                   /db_xref="GOA:Q60BG2"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BG2"
FT                   /protein_id="AAU93296.1"
FT                   /translation="MIPEALPLLSLLIGLPFAAALAMVLVPKPETARSLALAAAVLELL
FT                   LATVLLWGFDPVDPRLQFVERHAWIPSLNAYYHLGVDGVTVLFPFLGAVLNLAVIVASW
FT                   TAVQNRVRLYYGMILILGGATVGVFCATDLMLFFLFWEMTIAPVYLLAGFCGTGPQRRY
FT                   AAIKYALFMLAGGIPLLFAILLLALNHARFLGVPAPAGLSFDYLALLDTPLDGRLATTV
FT                   FLLFMLGFAIKAPLFPFHGWLPTLAMEGPAGLAAWLAGLKLGAFGIVRFAVPLSPQAAL
FT                   EHRGLVAGAGIVTAAYGALVAMRQTNLRRLLAFSSISHVGLVVAGLAALNFQAVQGALF
FT                   QLANFGIVAGGLFLVAGFIQHRIGSTEIDRLGGLARPMPLLGALFFLLGLASLGVPGTS
FT                   GFAAEHLILIGLLRQHMGLGLAALFAGVVAAAGMLGYFRRAFLGPDKLGMAAGEWDLRS
FT                   RERLVAGALAAWVVILGLFPRLALDLSDGAVSTLLARVHESLPEGPTSVAAAE"
FT   gene            534781..535278
FT                   /gene="ppiB"
FT                   /locus_tag="MCA0516"
FT   CDS_pept        534781..535278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiB"
FT                   /locus_tag="MCA0516"
FT                   /product="peptidyl-prolyl cis-trans isomerase B"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by similarity to SP:P23869; match to
FT                   protein family HMM PF00160"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93295"
FT                   /db_xref="GOA:Q60BG1"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BG1"
FT                   /protein_id="AAU93295.1"
FT                   /translation="MQLHTNLGDIVIRLDAEKAPVSTANFLAYVKEGFYDGTIFHRVIP
FT                   GFMAQGGGFTQDYKQKSTHAPIKNEADNGLTNRRGTVAMARTPDPNSATAQFFINYVDN
FT                   NFLNYKSPTPQGWGYAVFGEVVKGMEVVDEMAKVPTGAGGPFPTDVPQKAIVIEKATVV
FT                   SP"
FT   gene            535433..535864
FT                   /gene="dksA"
FT                   /locus_tag="MCA0517"
FT   CDS_pept        535433..535864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dksA"
FT                   /locus_tag="MCA0517"
FT                   /product="DnaK suppressor protein"
FT                   /note="identified by similarity to SP:P18274; match to
FT                   protein family HMM PF01258; match to protein family HMM
FT                   TIGR02420"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93294"
FT                   /db_xref="GOA:Q60BG0"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BG0"
FT                   /protein_id="AAU93294.1"
FT                   /translation="MSNVKAPETPFSFTPYEPAEGEEYMSPGQVAHFRRILQNWKSELM
FT                   AEVDRTVHHMKDEAANFPDPNDRATQESEFSLELRTRDRERKLIKKIEEALENLERGEY
FT                   GYCETCGVEIGLRRLEARPTATQCIDCKTLDEIRERQLG"
FT   gene            535883..536791
FT                   /locus_tag="MCA0518"
FT   CDS_pept        535883..536791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0518"
FT                   /product="glutamyl-tRNA synthetase domain protein"
FT                   /note="identified by similarity to SP:P96551; match to
FT                   protein family HMM PF00749"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93293"
FT                   /db_xref="GOA:Q60BF9"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR022380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BF9"
FT                   /protein_id="AAU93293.1"
FT                   /translation="MNSRHPSAPYRGRFAPSPTGPLHLGSLYTAVVGFCEARRRGGAWL
FT                   VRIDDADRQRCRQTHADSILRTLETHGLWWDEAVLFQSLRDEIYRVALERLAAGSRVFP
FT                   CTCPRRELAGSGPIYSGRCRARYPHPPAGEHALRLRVGDAVIGFDDRLQGRIEQDLGSA
FT                   VGDFVVRRRDGLPAYHLATVIDDAEQRVTEVLRGVDLLDSTPRQILLQECLGLPRPDYC
FT                   HIPVLTDRGGIKLSKQAGARPVDEDAPSENLWTVLALLGFVPEPPLIGAKPAEILDWAV
FT                   AHWDIRRLPPGRRIDVGGLAV"
FT   gene            complement(536810..537250)
FT                   /locus_tag="MCA0519"
FT   CDS_pept        complement(536810..537250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0519"
FT                   /product="MutT/nudix family protein"
FT                   /note="identified by similarity to GP:1001228; match to
FT                   protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93292"
FT                   /db_xref="GOA:Q60BF8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BF8"
FT                   /protein_id="AAU93292.1"
FT                   /translation="MPRPETPALAADVIIELTDRPGRPIVLIKRGFPPLGWAIPGGFVD
FT                   VGETVERAAIREALEETGLTVHLTALLGLYSDPARDPRGHTVTAVYVAEATGDPLAADD
FT                   AKTCRIVSLDALPEPLVFDHAQVLADYRRFREQGRPAPLRIV"
FT   gene            537327..538037
FT                   /locus_tag="MCA0520"
FT   CDS_pept        537327..538037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0520"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93291"
FT                   /db_xref="GOA:Q60BF7"
FT                   /db_xref="InterPro:IPR021342"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BF7"
FT                   /protein_id="AAU93291.1"
FT                   /translation="MVATMRKSGSGSGNYLTLTGLLSPIIRLIGGKFQKIYFQMVESAG
FT                   RHKRDILVARVDSARGSLEEAKEQFQTALERFSALTRFDGGTLEDVYRQLKIEFDYSAS
FT                   KALAVRDRIDAVQDVAEALFREWEDELDQYTNRSLRAASRQKLKLTQQHYAQLMSAMRR
FT                   AESKIDPVLRLFRDQVLFLKHNLNAQAIASLEGELADMSQGVAGLIQAMERSIDHAEVF
FT                   MRTLSGPKALPAGL"
FT   gene            538037..538480
FT                   /locus_tag="MCA0521"
FT   CDS_pept        538037..538480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0521"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01ST1808; match
FT                   to protein family HMM PF05779"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93290"
FT                   /db_xref="GOA:Q60BF6"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="InterPro:IPR008228"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BF6"
FT                   /protein_id="AAU93290.1"
FT                   /translation="MADAPFWHAKALAELSLAEWESLCDGCGKCCLHKLEDEDTGEILY
FT                   TRVACRLLDIAACRCTAYQDRFRLVPDCMDLRQVPDQFHWLPASCAYRLLSEGRPLPAW
FT                   HPLVSGAADSVHRAGKSVCRLAVSETVVDCIEDHVIEGLGDAV"
FT   gene            538507..538968
FT                   /locus_tag="MCA0522"
FT   CDS_pept        538507..538968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0522"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93289"
FT                   /db_xref="GOA:Q60BF5"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BF5"
FT                   /protein_id="AAU93289.1"
FT                   /translation="MDSKTVVDAALTRLDTLLAEDYGAKGGSLAERIRGLAAVLPADTR
FT                   KRLLDLTARGESLARTGAGERALAEFVFDCGVAYEQVDFLRKAQLAEDLGLVEVGGLAP
FT                   AELERGDLDAMARFIAARDRLVAKVAGFTLKALAVMGALFIIGLVFGVV"
FT   gene            538995..539465
FT                   /locus_tag="MCA0523"
FT   CDS_pept        538995..539465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0523"
FT                   /product="putative peptidyl-prolyl cis-trans isomerase,
FT                   FKBP-type"
FT                   /note="identified by similarity to SP:P45523; match to
FT                   protein family HMM PF00254"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93288"
FT                   /db_xref="GOA:Q60BF4"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BF4"
FT                   /protein_id="AAU93288.1"
FT                   /translation="MFSVAKSRRRGFLPALFAIGLAACGPSFDGEKNLMEARQFMAANG
FT                   QKAGVVTTASGLQYEVIREGAGESPKATDTVTVNYKGGFPDGSTFDAGDGVSFPLNGVI
FT                   PGWTEGLQLMKPGAKYRFFIPPELGYGEYGVGRLIPPNAALIFEVELLKVGG"
FT   gene            complement(539526..540011)
FT                   /locus_tag="MCA0524"
FT   CDS_pept        complement(539526..540011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0524"
FT                   /product="cytochrome P460"
FT                   /note="identified by similarity to GP:3659895"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93287"
FT                   /db_xref="InterPro:IPR032033"
FT                   /db_xref="InterPro:IPR038142"
FT                   /db_xref="PDB:6HIU"
FT                   /db_xref="UniProtKB/TrEMBL:G1UBD9"
FT                   /protein_id="AAU93287.1"
FT                   /translation="MRKLAIALLFPAAAVLAEPAAAPNGISLPAGYKDWKMIGVSSRIE
FT                   QNNLRAILGNDIAVKAAREGRTHPWPDGAILVKLSWKKSTHELFPSAEVPGDFTQADFM
FT                   VKDAAKYASTGGWGYARWLGMEQKPYGANADFAQECMGCHSGAKAADYVFTHPAKLP"
FT   gene            complement(540057..540458)
FT                   /locus_tag="MCA0525"
FT   CDS_pept        complement(540057..540458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0525"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93286"
FT                   /db_xref="UniProtKB/TrEMBL:G1UBD2"
FT                   /protein_id="AAU93286.1"
FT                   /translation="MRFETIIACLPLPLVPVMASGAALSHHGGLILDCTPPLFFEESPA
FT                   NDSSVEIFDRFSFTASDNTDGATLKIWVDGKPVAPTITPQRSGRLTVEGRPDAPIGQPG
FT                   SRVRILVSGFSKDGCERSHAYYVHVRPKG"
FT   gene            complement(540474..541184)
FT                   /locus_tag="MCA0526"
FT   CDS_pept        complement(540474..541184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0526"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to OMNI:NTL02SC1751; match
FT                   to protein family HMM PF00596"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93279"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BF1"
FT                   /protein_id="AAU93279.1"
FT                   /translation="MYTALPVRHPFRNKRPMMTGREGVTRYRLIFTPGPLPHPDLIREL
FT                   NAWRSIIRMLGLNGCDPQRYGGLAYGNVSLRLPDGGIRFLISGTQTGGRMHLTADDYCE
FT                   VHGFDLETNRLEARGPIPPSSEALTHAAVYRADPAWHCVMHAHSPEIWRHAGTLGLRTT
FT                   APEIEYGTPAMALAVAALATKPGVPLIAMLGHSDGVIAYGGTVDATARILITYLAEALQ
FT                   LDDSSTAGQPATTP"
FT   gene            complement(541133..542104)
FT                   /locus_tag="MCA0527"
FT   CDS_pept        complement(541133..542104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0527"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93278"
FT                   /db_xref="GOA:Q60BF0"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BF0"
FT                   /protein_id="AAU93278.1"
FT                   /translation="MADDWAGFGKESRHIIGISTNFHILPMRFRSALAAALAPFVCLAL
FT                   ALILVAALSYPLVRLSAGTLGITAILSRGTLLLLFAGLILGARRLGIGWRSVGFPASYA
FT                   VFVRQIGIGLGLGLVMLGLHVAVIMALDIRVFSEIQAARHPSIPVLLLKHVGVALLLAT
FT                   SEELLFRGLTFAILAKFVGPAHVIAITSFYYTLPHFLRSRLKLGESELNWDSGFTVLAD
FT                   AVGNGITEADFSSFLALLCAGVFLGCMRARTVQGLGYCIGIHAGWVFVIKTCKSFTHDG
FT                   NAGPFGVLVGSYDAIIGYLSAGWISACTLLFLFATRSGTNVR"
FT   gene            542169..542253
FT                   /locus_tag="MCA_tRNA-Leu-1"
FT   tRNA            542169..542253
FT                   /locus_tag="MCA_tRNA-Leu-1"
FT                   /product="tRNA-Leu"
FT   gene            542565..543680
FT                   /gene="tig"
FT                   /locus_tag="MCA0528"
FT   CDS_pept        542565..543680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="MCA0528"
FT                   /product="trigger factor"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by match to protein family HMM PF00254;
FT                   match to protein family HMM PF05698"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93285"
FT                   /db_xref="GOA:Q60BE9"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BE9"
FT                   /protein_id="AAU93285.1"
FT                   /translation="MIQSSFHQAVNDENLRPAGMPRITATAIGEGEGLSYIADFEVLPD
FT                   FEPSPLENLQCPRFVCEVTEGDLEAMVQRLREQRRTRRAVERPAALNDEVVIHFEGKLG
FT                   EESLTDGRLENFRVVLGGRPLVPGFEEKLIGAEVGSRLAFELDVPADYGNEKLAGKTVA
FT                   FDVEVVGINESVLPEVDADFVKTFGVDGDVEAFRADVRANMEREMRRALKARTKSAVLD
FT                   ALLAANSFTLPEVLVADELNELLQPYHKAAEQGNPGVELEALKERYTPLAKRRVALGLI
FT                   LSKLIDENKLSVDRKRVRSTIEEQAQSYENPEQVVNWYYSDKNNLREIENLVLEDQVVD
FT                   LILSKAAVTEQRVDFATLMAPAGATEQQPQS"
FT   gene            543746..544333
FT                   /gene="clpP-2"
FT                   /locus_tag="MCA0529"
FT   CDS_pept        543746..544333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP-2"
FT                   /locus_tag="MCA0529"
FT                   /product="ATP-dependent Clp protease, proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /note="identified by similarity to SP:P19245; match to
FT                   protein family HMM PF00574; match to protein family HMM
FT                   TIGR00493"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93284"
FT                   /db_xref="GOA:Q60BE8"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BE8"
FT                   /protein_id="AAU93284.2"
FT                   /translation="MPIVIEQSARGERAFDIYSRLLKERVIFLVGQVEDYMANLVIAQL
FT                   LFLESENPDKDIHLYINSPGGLVTAGLAIYDTMQFIKPDVSTLCVGQAASMGALLLAGG
FT                   AAGKRYCLPHSRIMIHQPLGGFQGQASDIDIHAREILAVRDRLNKILAHHTGQPIEKIQ
FT                   IDTDRDNFMGGDDAVSYGLIDKVLTHRTVTAA"
FT   gene            544429..545715
FT                   /gene="clpX-2"
FT                   /locus_tag="MCA0530"
FT   CDS_pept        544429..545715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX-2"
FT                   /locus_tag="MCA0530"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpX"
FT                   /note="identified by similarity to SP:P33138; match to
FT                   protein family HMM PF00004; match to protein family HMM
FT                   PF06689; match to protein family HMM PF07724; match to
FT                   protein family HMM TIGR00382"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93283"
FT                   /db_xref="GOA:Q60BE7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BE7"
FT                   /protein_id="AAU93283.1"
FT                   /translation="MSEDKHGKDSGGKLLYCSFCGKSQHEVRKLIAGPAVFVCDECVEL
FT                   CNDIIREELQESASTGADKLPKPKEIKKVLDEYVIGQEKAKRILSVAVYNHYKRLRAQQ
FT                   THSKKNEVELAKSNILLIGPTGSGKTLLAETLARLLDVPFTIADATTLTEAGYVGEDVE
FT                   NIIQKILQKCDYDVEKAEQGIVYIDEIDKISRKADNPSITRDVSGEGVQQALLKLIEGT
FT                   VASVPPQGGRKHPQQEFLQVNTANILFICGGAFAGLEKIIRSRSEQGGIGFAADVKSKD
FT                   DSRNVGEVLADVEAEDLIRYGLIPEFVGRLPVVATLEELDEAALVRILTEPKNALVKQY
FT                   RRLFEMESCELEIRDDALGAIARKAMARKTGARGLRTILEHTLLDTMYELPSSERISKV
FT                   VVDEKVINGESEPLMIYDNSLEKQAAAAD"
FT   gene            545845..548274
FT                   /gene="lon"
FT                   /locus_tag="MCA0531"
FT   CDS_pept        545845..548274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon"
FT                   /locus_tag="MCA0531"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /note="identified by similarity to SP:P08177; match to
FT                   protein family HMM PF00004; match to protein family HMM
FT                   PF02190; match to protein family HMM PF05362; match to
FT                   protein family HMM TIGR00763"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93282"
FT                   /db_xref="GOA:Q60BE6"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BE6"
FT                   /protein_id="AAU93282.1"
FT                   /translation="MENSGVEHDITSGERWVPVLPLRDVVVYPHMVIPLFVGREKSIFA
FT                   LDSAMRDSKQVLLLAQKDAEVDDPGFDDLYRVGTLSNILQLLKLPDGTVKVLVEGAQRC
FT                   RVEDIRLADRHYSASVSEIREVPGVDERELDVLMRTATNTFDQYVKLNKRIPPEVLNSL
FT                   SGIDDPARLADTIAAHMTVKIEDKQAILENSAISARLEKLITLMEAEVDMLEMERRVRG
FT                   RVKQQMEKNQREYYLNEQMKAIQKELGEMEEVPNEFEELARRIEKAGMPQAARTKAETE
FT                   LNKLKLMSPMSAEATVVRNYIDWIVNLPWKKRTKVSHDLQQAEEILEAEHYGLEKVKER
FT                   ILEYLAVQQRVKKIKGPILCLVGPPGVGKTSLGQSIARATNRKYVRMALGGVRDEAEIR
FT                   GHRRTYIGSMPGKILQNLSKVKTRNPMFMLDEIDKMAMDFRGDPASALLEVLDPEQNHT
FT                   FADHYLEVDFDLSEVMFVATANTLNIPPALLDRMEIIRLAGYTEDEKVNIAMRYLVPKQ
FT                   MKNCGLKDTELHISEAAVRDIIRYYTREAGVRSLEREIAKICRKVVKNLLLKPTHKKVS
FT                   VTPRNLDDYLGVPRFRFGRAEESDQVGQVTGLAWTEVGGELLTIEAVVMPGTGKQTYTG
FT                   KLGEVMQESIQTAVTVVRSRAEALGIDPAFYQKHDVHIHVPEGATPKDGPSAGIGMCTA
FT                   LVSSLTGIPVRSDVAMTGEITLRGEVLPIGGLKEKLLAAHRGGITTVLIPKENEKDLAE
FT                   IPRNIKQDLDIRTVRWIDEVLAVALQRLPEPASRVPPPTEECAPKTVGASGGLTAH"
FT   gene            548430..548702
FT                   /gene="hupB"
FT                   /locus_tag="MCA0532"
FT   CDS_pept        548430..548702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupB"
FT                   /locus_tag="MCA0532"
FT                   /product="DNA-binding protein HU-beta"
FT                   /note="identified by similarity to SP:P02341; match to
FT                   protein family HMM PF00216"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93281"
FT                   /db_xref="GOA:Q60BE5"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BE5"
FT                   /protein_id="AAU93281.1"
FT                   /translation="MNKAELIEAIADAANLTKADAGRALDAVIDAITDALKKGDTVSLV
FT                   GFGSFAVKERAERQGRNPQTGDSITIKAAKIPSFKCGKALKDAVN"
FT   gene            548717..548792
FT                   /locus_tag="MCA_tRNA-Val-1"
FT   tRNA            548717..548792
FT                   /locus_tag="MCA_tRNA-Val-1"
FT                   /product="tRNA-Val"
FT   gene            548809..548885
FT                   /locus_tag="MCA_tRNA-Asp-1"
FT   tRNA            548809..548885
FT                   /locus_tag="MCA_tRNA-Asp-1"
FT                   /product="tRNA-Asp"
FT   gene            549020..550837
FT                   /gene="ppiD"
FT                   /locus_tag="MCA0533"
FT   CDS_pept        549020..550837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiD"
FT                   /locus_tag="MCA0533"
FT                   /product="peptidyl-prolyl cis-trans isomerse D"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by similarity to SP:P77241; match to
FT                   protein family HMM PF00639"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93277"
FT                   /db_xref="GOA:Q60BE4"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BE4"
FT                   /protein_id="AAU93277.1"
FT                   /translation="MLILVGIPFAFWGINNYFDSGKEAPVAVVGDRDFFERDVVQAYQQ
FT                   DLANLVGLGDVDEKHLKRQALERLVRDELISQAAAGEGLAVPDSAVRAFIQTLPYFQTD
FT                   GKFDKDKYNVMLSAQGTSSPVFVEQVKRALLMEQFQRGITDTAFVTRQQVEAFFRLKNQ
FT                   EREIEFVTVPLAKADEEVSESSIDEYYRSHPDEFQSPETVSVNYLLLSLDDVAKEVKPT
FT                   EEELRNFYEEQKAGFTTEERRKVSHILVTVDPAKPEDEAAALAKIRQIRERLLKGEDFA
FT                   KLAKETSDDRVSAEKGGDLGVVTKGGMEPNFEKAALALSQGEVSEPVRTSFGYHLIKVT
FT                   ELTPATTKPYEQVKDEVAAGFRRNAAENRFYDLGQKLTEFAFEHPDTLEPAAQALGLKV
FT                   EETGPFTRESGEGISADEGVRKAAFSEEVLGGKNSDVVEVGADKVVVLRLKEHRPAETM
FT                   SLAEVRERIVSLLRDRATRQKTEALAEAALKEMGEGKTLGGVAKAHNWKVTGPLTVRRD
FT                   ASGVAAAVVNAAFGTRELNRPIRVALENGDQAILRIAAIKEGEAAPEAEKDMETVRQSL
FT                   ARVAGQREFAAFMAEMRRSADVYIKPDQD"
FT   gene            550891..552033
FT                   /locus_tag="MCA0534"
FT   CDS_pept        550891..552033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0534"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93276"
FT                   /db_xref="GOA:Q60BE3"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BE3"
FT                   /protein_id="AAU93276.1"
FT                   /translation="MEFDILLVVGIDAVGIARFPRILHDAGCRVTLLAPPGLAVARSRY
FT                   VSRHVATAAGPEALPRQLQTLLAERHFHHVIVGDEPTLTVIARHRGEAWLDGWFPVDHR
FT                   SDAVEVILSKSVFQRAADAAGLTTPKSEVRTGLAGLEAAARAMGYPVMLKRSHGCSGSG
FT                   VRKVAGEAELGAVFELLNEGNGTLLIQQFLDGRVGSSDVLFDRGVPVCWQSWYSRQCWP
FT                   TPLASSCVREAMVHREIGPMLAGVGALSGFHGFAGVDWVHDTERDRIYLIEFNPRPTPT
FT                   YHLDVLSGVRFADSFHAILAGTRSAGCREPSAAACGRVVYLFPQSLYRAIAECDLDSLW
FT                   RCWSDAPWSDPVLMAAHLRRVLTHFLPVRWRQAVKRLLGR"
FT   gene            complement(552042..552539)
FT                   /locus_tag="MCA0535"
FT   CDS_pept        complement(552042..552539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0535"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93275"
FT                   /db_xref="GOA:Q60BE2"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BE2"
FT                   /protein_id="AAU93275.1"
FT                   /translation="MITFRSGRERRGCPPSIPTALRFQYRTLSMTQPTAELVSIVHDKV
FT                   PNRIRFRVPLIRYRQTYAEILKQSILKDSAAKGIYHAEPNITTGTLLVKYHPAIHSETQ
FT                   VVELVRSTVANLSTGSIEITAKHKNPRIGKMRPGAFFTRELVVSIVGNVVAGLILAFVA
FT                   TR"
FT   gene            552555..552887
FT                   /locus_tag="MCA0536"
FT   CDS_pept        552555..552887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0536"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93274"
FT                   /db_xref="GOA:Q60BE1"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BE1"
FT                   /protein_id="AAU93274.1"
FT                   /translation="MMTERLPVLSRIRLTLSLLLMLGPASAGAGLTGPANYWECILHGM
FT                   EDVKNDPVAREVMKICLSDFPDGFSVEEPLEGTPTECILKHGEDVSSALAAQQIHIACN
FT                   VLYSRP"
FT   gene            complement(552891..553790)
FT                   /locus_tag="MCA0537"
FT   CDS_pept        complement(552891..553790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0537"
FT                   /product="conserved hypothetical protein TIGR00157"
FT                   /note="identified by match to protein family HMM PF03193;
FT                   match to protein family HMM TIGR00157"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93273"
FT                   /db_xref="GOA:Q60BE0"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BE0"
FT                   /protein_id="AAU93273.1"
FT                   /translation="MQAIRQGRVVCHLGKGLAVEDETGRIVLCHTRRRLGDAAVGDHVR
FT                   WEPCEGDQGRVLEVLPRRSSLVRPAHGGRVRVVAANLDRVFVVLAPEPEPDWLLADQIL
FT                   AVCEYRHITAALILNKIDLVGASALERALRDYEAAGYEVFRISTRTGAGLDALRSMLHT
FT                   GCSMLSGQSGVGKSSLTNALLPDRNLRIGELSAHSGLGRHTTTSATLYSLPGGGELIDS
FT                   PGVAVFGLAEVDPTELAQTYRDFHPYLGKCRFNDCRHVRDKGCAVREAVEAGTLSPARY
FT                   ERYLKLLVRAGTAEFSGG"
FT   gene            complement(553808..555169)
FT                   /locus_tag="MCA0538"
FT   CDS_pept        complement(553808..555169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0538"
FT                   /product="peptidase, M48 family"
FT                   /note="identified by match to protein family HMM PF01435"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93272"
FT                   /db_xref="GOA:Q60BD9"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR027057"
FT                   /db_xref="InterPro:IPR032456"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BD9"
FT                   /protein_id="AAU93272.1"
FT                   /translation="MCVLSHAVLPSAWEGSKLVTDFIKGYPLAPIDETDFRQYRMNTVT
FT                   TLFLTALAVSSGLEYWLARRQARHVRLHRDHVPDAFRDRVSLEDHQKAADYTLAKGSLD
FT                   DVGRIVGIAILLGFTLGGGIDAIAAVWNGWGLPPITTGVGIVLTTLLASQLLELPLNLY
FT                   QTFRIEERFGFNRTTPRQFAIDLALQTGLSLVIGAPLLALILWVMDSAGAQWWIVAWAI
FT                   LMAFSILMSWAFPTLIAPLFNKFTPLADATLKARIEALLERCGFRSEGIFVMDGSRRSG
FT                   HGNAYFTGFGSNKRIVFFDTLVDSLDHDEIEAVLAHELGHFKRRHVLKMLAGTALVTLA
FT                   GFALLGWLTGEDWFYQGLGVREQSHATALLLFMLVSPVFSVFLQPVVAYVQRRYEFEAD
FT                   DFAASQTRARYLVHALVKLYRENASTLTPDPLYAAFHYSHPPAAIRIDHLSAKI"
FT   gene            555152..555697
FT                   /gene="orn"
FT                   /locus_tag="MCA0539"
FT   CDS_pept        555152..555697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orn"
FT                   /locus_tag="MCA0539"
FT                   /product="oligoribonuclease"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by similarity to SP:P39287; match to
FT                   protein family HMM PF00929"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93271"
FT                   /db_xref="GOA:Q60BD8"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BD8"
FT                   /protein_id="AAU93271.1"
FT                   /translation="MAQDAQNLIWIDLEMTGLDPQNDAIIEIATIVTDGQLNVLAEGPV
FT                   LAIHQPESVLDRMDDWNRKQHGESGLTERVRRSTIGEAEAEHLTLGFVSEWVPPNESPI
FT                   CGNSICQDRRFLARCMPRLEAYFHYRNLDVSTLKILVERWAPALKEGLQKQSTHRALDD
FT                   IRESIAELRYYRDTVLKI"
FT   gene            555703..556644
FT                   /locus_tag="MCA0540"
FT   CDS_pept        555703..556644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0540"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:CC1055"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93270"
FT                   /db_xref="GOA:Q60BD7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BD7"
FT                   /protein_id="AAU93270.1"
FT                   /translation="MARTVLIVGCGDIGRRVARLESAEGRGVYGLARSPETAARLVRQG
FT                   ITAVHGDLDKPDSLAGLNGGWTTLYYFAPPPAAGDGDPRLAVFFEALPVRCLPGKVVYV
FT                   STSGVYGDCGGDWVDEERPPRPQTARSRRRLAAEEALMAWSRRYGVTVVILRVPGIYGP
FT                   GRLPLERLCAGVPVVRQEESPYSNRIHADDLAEVCVAAGTRAAAEGVYNVSDGHPTTLT
FT                   DYFHAVADHFGLPRPPAISLAEARRVLSPEMLSFVEESKRLDNGRMLRELRPRLHYPDL
FT                   ERGLPACSGGHPQGFQVAPCADGLRVFGHRPT"
FT   gene            complement(556567..557613)
FT                   /locus_tag="MCA0541"
FT   CDS_pept        complement(556567..557613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0541"
FT                   /product="glycosyl transferase, group 1 family"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93269"
FT                   /db_xref="GOA:Q60BD6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BD6"
FT                   /protein_id="AAU93269.1"
FT                   /translation="MIANLAAGFLDAGVAVDLVLARAQGEHLDAIPAGVRIVKLNVRHT
FT                   FTALPGLARYLREEKPDAVLAAKDRAIRVALLARRLAGSKARLVGRLGTTVSAALKGKG
FT                   RLRELAWFTGMRLFYPHLDAIVAVSQGVKDDILSITALPSERVRVIRNPVITPALERQA
FT                   ALPCDHPWPNDPAVPLIVGMGRLTRQKGFPDLIAAFARLRRDRICRLVIVGEGGDREKL
FT                   ERLADGLGVSEDVCFTGFLANPHALIARCSLFVLSSLWEGSPNALTEAMALGRPVVSTD
FT                   CPSGPAELLNGGEYGPLVPVGDVEALAVAMAHALDHPLPAECLRRAVAEYTQTISARRY
FT                   LETLGMAP"
FT   gene            complement(557693..559513)
FT                   /locus_tag="MCA0542"
FT   CDS_pept        complement(557693..559513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0542"
FT                   /product="asparagine synthetase, glutamine-hydrolyzing"
FT                   /EC_number="6.3.5.4"
FT                   /note="identified by similarity to SP:P54420; match to
FT                   protein family HMM PF00310; match to protein family HMM
FT                   PF00733; match to protein family HMM TIGR01536"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93268"
FT                   /db_xref="GOA:Q60BD5"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BD5"
FT                   /protein_id="AAU93268.1"
FT                   /translation="MCGIAGLFNCNLPADELRLDQAVAKLTHRGPDDRGIFLDGRFGMG
FT                   HTRLSIIDLAGGHQPLFSEDRRLALIANGEIYNFIELRSELTAAGFRFQTQSDSEVILH
FT                   AYLAFGEGFLERIQGMFAFALYDALEGRLILARDRLGIKPLFLARRPDGIAFASEIKAL
FT                   LPLLDQPREIDPQGLAQYFQNQFSTGATTVLRGVERVLPGEAVVVEAGKTTRRFRYWSP
FT                   LAVRTEELDFDEAAARFDALMERVMVEHMRSDVPFGLFLSGGVDSSLLLALLTRYSGEP
FT                   IRTFSVGFPGTSLTDELPLAEGLARRFRSRHREIRPGPQDILHSLPLTVWAADDLMRDN
FT                   ASLPTSLLARAAGEELKVVFSGEGGDEVFAGYGRYRTSPLERLFKSLLAPGSGGFRTRG
FT                   SFRGRWPKTLFGPALLAAAQSARRPVQESWRETPREWSDLQRMQYVDLCHALPDNLLVK
FT                   ADRMLMAWGVEGRVPFLDHRVVEFGLSLPDRLKIEGRQGKLFLKRWGERLVPAEQLYAR
FT                   KRGFHVPLGEWLDEPFLERLNRILPEHPALTPWFKPAGIRALIARCRDERQGSAMLWAI
FT                   IQFAIWHRLFISGNGERPEALTDPLEILQR"
FT   gene            559512..560024
FT                   /locus_tag="MCA0543"
FT   CDS_pept        559512..560024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0543"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93267"
FT                   /db_xref="GOA:Q60BD4"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BD4"
FT                   /protein_id="AAU93267.1"
FT                   /translation="MVPGSRRVGMGESVAAPLAWWEWDLRPIVPSVGIAERQSQPFRTG
FT                   VGFHAHGFFQGAQPVFHDVGFMGLAQHVEHIGQTGAIVAVDPAGAHVAVDRGHFLANRL
FT                   ERGIHRRFPAEPVIQGLDVLEVALAGLFPFLVRPPLLPPVGHALSAHEIPLIGCWQARV
FT                   AIKLQRP"
FT   gene            complement(560144..562228)
FT                   /gene="fusA-1"
FT                   /locus_tag="MCA0544"
FT   CDS_pept        complement(560144..562228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA-1"
FT                   /locus_tag="MCA0544"
FT                   /product="translation elongation factor G"
FT                   /note="identified by similarity to SP:P28371; match to
FT                   protein family HMM PF00009; match to protein family HMM
FT                   PF00679; match to protein family HMM PF03144; match to
FT                   protein family HMM PF03764; match to protein family HMM
FT                   TIGR00231; match to protein family HMM TIGR00484"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93266"
FT                   /db_xref="GOA:Q60BD3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BD3"
FT                   /protein_id="AAU93266.1"
FT                   /translation="MTDLSRYRNIGIFAHVDAGKTTTTERILKLTGKIHKIGEVHDGAA
FT                   TTDFMEQEQERGITIQSAATTCFWKDHRFNIIDTPGHVDFTIEVYRSLKVLDGGIGVFC
FT                   GSGGVEPQSETNWRYANDSEVARIIYVNKLDRVGADFYRVVKQIRDVLGAYPLVMTLPI
FT                   GREESFIGVVELLTRKAWIWDDSGDPMKYEVKDVPAEMADEVEKWRAELVEKAVEQDDE
FT                   VMEKYLEGEEPDVDTLKRLIRKGTIKLDFFPTYCGSSFKNKGVQLVLDAVVDYLPDPTE
FT                   VKPQPEVDLEGHETGEFAIVDPDRPLRALAFKIMDDRYGALTFLRLYSGRLEKGTTVLN
FT                   TATGKTERIGRIVEMHANQRNELDSAQAGDIVAVLGMKNVQTGHTLCDPDKPATLEPMV
FT                   FPDPVISIAVTPKDKAANEKMGIALGKMVQEDPSFHVETDQESGETILKGMGELHLDIK
FT                   VDILKRTHGVEVNVGKPQVAYRETITRRVEDEYVHKKQTGGSGQYAKINYVIEPGEPGS
FT                   GFVFESTVTGGNVPREFWPAVEKGFRSMLGKGVLAGYPCVDFKVNLTDGGFHAVDSSAI
FT                   AFEIAAQAAFRQSVPKAAPQLLEPIMKVDVFTPDAHVGDVIGDLNRRRGMIKSQEAGVT
FT                   GVRIKAEVPLSEMFGYIGDLRTMTSGRGQFSMEFSHYMPCPKNVADEVIKEAQERAARK
FT                   "
FT   gene            complement(562384..563520)
FT                   /locus_tag="MCA0545"
FT   CDS_pept        complement(562384..563520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0545"
FT                   /product="putative calcium/proton transporter"
FT                   /note="identified by similarity to SP:P31801; match to
FT                   protein family HMM PF01699"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93265"
FT                   /db_xref="GOA:Q60BD2"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BD2"
FT                   /protein_id="AAU93265.1"
FT                   /translation="MFSPSKSRKILRDHVSVVLGWLIWIILLLSGHKFGRGDSLAVLAA
FT                   GSALTFCTMLGCVFSVVRQADELAELLEEPYGTLVLTLSATAIEVSLMLMVMAGGGQNP
FT                   SMLRDTIFATLMVVLNGMVGVSLVSGGWINVEQSFNLRGALSFLHLIAPLSLLLLVLPN
FT                   YTSSTGGPTLAPVQEAFLGILCLLVYGVFLIIQTGRHRSYFANMSAVLDEEPENDGTAP
FT                   TLRSRRGAILRTSSGLLAALLPVVLLAEHLGSVIDFAIEESHTPAALGGLVVAALVLLP
FT                   EGVGAQRAAALNLMQRAVNICLGSALATIGLTVPTILLAASLQRHSLTLGLNGAEETLL
FT                   YATLLVSVMTFISGFANVLQGMVHLMLFVAYLFFVFVP"
FT   gene            563632..564648
FT                   /locus_tag="MCA0546"
FT   CDS_pept        563632..564648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0546"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93264"
FT                   /db_xref="GOA:Q60BD1"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BD1"
FT                   /protein_id="AAU93264.1"
FT                   /translation="MVMFRKFRGLPRLPTWMLFVLPVLAAAAADRPVTEVLGIADLGGL
FT                   DQGEIVSYDVREPTDKTLAAGLAMYVEAPPERLIAAVRNGALLMGDSDVIAAGIFLPAG
FT                   GPEALNGFEFGPSDAEEAEALSEVEPGSEFNFSAAEMQGFRALARTLAHVSETEKLRLL
FT                   SRRYREVLWQRLDGYRRYGADAIEPYARSGGATVDVAAELRTFTEQSAVLRHYAPELQA
FT                   ALLRFPAPSDAASTLQWVERKVEGRPTVILVHQMVQPKAGGALVAVRDFYVGHSFNSSQ
FT                   MVLGILPYRQGSLVFYSHCTSTDQVAGVGAGLKHAIGRERLRAVMFGRMERLKASVR"
FT   gene            564816..568460
FT                   /locus_tag="MCA0547"
FT   CDS_pept        564816..568460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0547"
FT                   /product="sensory box protein"
FT                   /note="identified by match to protein family HMM PF00563;
FT                   match to protein family HMM PF00785; match to protein
FT                   family HMM PF00989; match to protein family HMM PF00990;
FT                   match to protein family HMM TIGR00229; match to protein
FT                   family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93263"
FT                   /db_xref="GOA:Q60BD0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BD0"
FT                   /protein_id="AAU93263.1"
FT                   /translation="MFGIAHGADEWLDLFAASLGDHPVFAWARLAVLTISFLCLFHFGV
FT                   QGLVSQGVRLPVRRVYLAQALVFVGVGLLSPSAGGGSSGVLYDALGLPGALAAVGAFVR
FT                   AARTARGRYDVALVAAALAMAVFAVSLGVAGSGTSRFPPATLTAPLLRALCALAMGAGI
FT                   WLHYRRSGELPVPAEELSSGLGFGVRLVLVASVVLGAAFVLTELFGHAADRSVRRELSI
FT                   QAETVAASINPEWIRQVRTGATEVREREEHWLISQLLRIDAADPKLKGLYLLIPAEGGA
FT                   MRAIGSSAGDIEPPRNGVEGRGWPNTEHAEAVAGVFTSGRSRVLGLAHGDGKDTVSAFA
FT                   PVRDTETGEIFAALGLEIDAAVRRDRVAAYRVVAIAIALLIAMGTLGFEVSRQRLWLSS
FT                   RIAKAERRRLAEAQRLARVGSWVYDPATDRMTWSEETYRIFGLPFDGEVPHRYQEFAAL
FT                   FVPEDRELIEAALRGGRDDLLGVERPLCVRRADGAVRQVNFKVELQGRRGDSGPVLQGT
FT                   LQDVTERWEAERALRQSEERLRLHVEHLPLAVIEWDLDFIVSRWNPAAERIFGYGADRM
FT                   IGRSAGILFPEDVLEQAEAIWREVSGGSGNRVVTANVTADGRTIRCEWYNTPLTTPDGT
FT                   VIGVASLVDDITRREAVEAELRLAATTFETDEAILIAGADGRILRVNAAFSRITGYRQE
FT                   DVVGRNPRLFKSGLHGAEFYREVWRSLEQTGRWQGEIWNRRKNGEVYPERKTITAVRSA
FT                   NGDITHYVAISSDISELKRTEEKIRQLAYYDSLTGLPNRSLIFERLTQQMKAARREGTY
FT                   GALLFMDLDYFKTLNDSLGHHMGDRLLVQVAERLKNCLEDEEAAARLGGDEFVVLLAPA
FT                   KPSASVAAGQAIVHARRVRELLSAPFQLDDYVHYISVSIGIALFPDGANTAEDVLKQAD
FT                   TAMYVAKNEGRDGVRFYESAMEAVVRGRLELEKALRKALANDEFEVYYQPQMLGDGRVV
FT                   GAEALIRWFHPERGAISPDQFIPVCEQNGMILRVGAIVLRRACACLAEIRARGLALPKL
FT                   SVNVSPRQFMRSDLMTQLEQFCLENGVSPTDLCLELTEGVLLNHTELAVAQIGRLKNLG
FT                   VSFSIDDFGTGYSSLAYLKHLPLDDLKIASAFVRDLEQDSSDAAIVETIVSMARHLGLD
FT                   VIAEGVETRTQVEILERYGCHRFQGNYFARPLPKDDFIRFVAERQRRA"
FT   gene            complement(568423..569019)
FT                   /locus_tag="MCA0548"
FT   CDS_pept        complement(568423..569019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0548"
FT                   /product="RNA pseudouridine synthase family protein"
FT                   /note="identified by similarity to GP:9950157; match to
FT                   protein family HMM PF00849; match to protein family HMM
FT                   TIGR00093"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93261"
FT                   /db_xref="GOA:Q60BC9"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BC9"
FT                   /protein_id="AAU93261.1"
FT                   /translation="MSRIIVFNKPYGVLTQFTDREHGRATLADFIPIPGVRPAGRLDRD
FT                   SEGLIVLTDDGRLQARIADPRHKMAKTYRVQVEGLPDEAALNRLRRGVRLNDGLTLPAE
FT                   ANIIPEPAWLWPRDPPVRFRATIPTTWLELVIREGRNRQVRRMTAAVGFPTLRLIRWAI
FT                   GAWTLEGLAPGEWRELPPPAGKGLRRGADVRRRSG"
FT   gene            569026..569874
FT                   /locus_tag="MCA0549"
FT   CDS_pept        569026..569874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0549"
FT                   /product="RNA methyltransferase, TrmH family"
FT                   /note="identified by similarity to SP:P33635; match to
FT                   protein family HMM PF00588; match to protein family HMM
FT                   PF08032"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93262"
FT                   /db_xref="GOA:Q60BC8"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BC8"
FT                   /protein_id="AAU93262.1"
FT                   /translation="MIRKTRPPRAGGAPGKRGAGPAVRAARPAHSGAAEEKLGKIAGLS
FT                   AVAAVFRHEPERVVRLYYDDSMKTAAGPFCAVLARLRRPYRLLPPEEMARVAGTVLHGG
FT                   IVAAVRPREVPDLTLETAQRWAKAGAATVLLDGVGNPHNLGAIARTLAFFGLGHLVLSD
FT                   HPAQAGLSDAAYRVAEGGLEFLDVRRLTGAAQALRSLRPHFHVVGTALHARGIPPEAVP
FT                   RDRRPILLVLGNEENGLPPPTLAACETVVTIPGGGQIQSLNVSATAAILTYSLLLRQAE
FT                   R"
FT   gene            570770..574348
FT                   /locus_tag="MCA0550"
FT   CDS_pept        570770..574348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0550"
FT                   /product="DNA methyltransferase"
FT                   /note="identified by match to protein family HMM PF01555;
FT                   match to protein family HMM PF04480"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93260"
FT                   /db_xref="GOA:Q60BC7"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BC7"
FT                   /protein_id="AAU93260.1"
FT                   /translation="MSHPSPAAAGTISHPSPAGGRGAGVRAAFQPDLFSAPFENLPLRE
FT                   AIAFYKHERDWANRLIAGDSLLVMNSLIQKESMAGQVQMIYIDPPYGIKYGSNFQPFVN
FT                   KRDVKDRRDEDLTQEPEMIKAFRDTWELGIHSYLTYLRDRLLLARELLSESGSVFVQIS
FT                   DENLHHVREVMDEIFGSENFIAQITFSKTSGATNLFLPGTADYLLWYGKSKEQTKYRSL
FT                   YKDKTAGAEGGLAYGKVEFEDGRRRAMTASEKNDPSIVGIYGKVYRIDNLTSQSEGRQK
FT                   GEGAACWFPVKFAGKDYLPSIKGRWKTNEFGMTRLLLANRLEATDAGGLYYVRYLDDFP
FT                   AFPITNNWTDTGLAGFASDKRYVVETSAKVIERCLLMTTDPGDLVLDPTCGSGTTAFVA
FT                   EKWGRRWITCDTSRVAVTLAKQRLLTASYDYYELKYPHEGLKGGFIYKTVPHVTLKSIA
FT                   NNPEIDEIYERMHPAIERALAELNAALQSPSPPAPLPPAGEGKTAEASLPPAGKGETAK
FT                   ASLPSAAEGGTAPPSTGEGETALPPTGEWRTTPPSAGEGRTAKASLASRGEGSESPSPA
FT                   GGRAVASAVTETAGRKVWNESTSLPSPAGGRGAGGEGAEWDYIPHPPARLPEDLKRHAR
FT                   AMRKTATDAENLMWRLLRNRRLANAKFRRQHPIGEYIADFYCEEHGLVVELDGGQHAEQ
FT                   KTYDERRTAFLQSQGLTVLRFWNHQVLGETEAVLQVIWEHVARNDTLTPSPSPAYGRGE
FT                   NETPSPVGGGGENESPSPAGGRRVWDEGVSNPPATGDSLAPTPLPPTGEGLKEWEVPFD
FT                   FPPGWPASARAPFDAFHAARQAMQRQMDASIAAHADQETLYDQPLVSKTKLRITGPFTV
FT                   EAVPFPTVLALEPSPQPLFQGERDVGFVADTAVARSGETSRQARWRDELLKTGIRGKGG
FT                   QILKLADLEPLPGARYVHAVGTVAEESFPSPQPLSRLRERGLDRVAVSFGPEHAALEQR
FT                   QVEIAMREAGELFPLPKMLVFCAFTFDPEAAKDIDNIKGITALKVQMNTDLLTEDLKKA
FT                   RASNESFWLMGQPDVEVRRIPSPQPSPGGRGSDWYQVEVHGFDYFDTVTGELKSGGKKQ
FT                   IALWLLDTDYDNRSLFPRQVFFPMAGAKDGWYKLKKDIRAELDEDLLEQFHGTVSLPFE
FT                   AGENRCIAVKIVDDRGIESLKVMALD"
FT   gene            574465..577134
FT                   /locus_tag="MCA0551"
FT   CDS_pept        574465..577134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0551"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01TV1471; match
FT                   to protein family HMM PF04851"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93259"
FT                   /db_xref="GOA:Q60BC6"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BC6"
FT                   /protein_id="AAU93259.1"
FT                   /translation="MFDTRTHTRRVEELELVNRIRERVDEWRDAGFPGITSVTRRLLEH
FT                   WHDREARPLPFYFCQLEAIETLIWWVEGPQEFKQGIYLPGDGGPWERVCNKMATGTGKT
FT                   TLMGLIITWQVSNALTYPKRKEFSAAIFVVAPGLTVKERLQVLHPGHGKNVYDEFRLCP
FT                   NEAMRQKINQAALRVENWHTLMPLKEPDRSVVKKGAESDEAFTRRVLGKLAGYRDIVVI
FT                   NDEAHHAYRQRAELKVSKKEAEELGIDLDEATRWIEGLDRIHRTRRIRRCFDLSATPFA
FT                   PTGKKSTEKGLFDWIVSDFGLNDAIEAGLVKTPRVVVRDDALANAQSYKSKLYHLYDEA
FT                   EVKEDLNRKAGPHEPLPDLVQKAYALLAHDWRETARRWREAGHDTPPVLLTVCNRTETA
FT                   ARIERFFNGGDCPIGETREPDRTLRVDSKVLEKAERGESVTRDKDYAERLEAIIRAAGL
FT                   PDDERDDLLGAKQEEQLRALVDTVGKRGKPGQRLQNVISVAMLSEGWDAANVTHIMGLR
FT                   AFTSQLLCEQVIGRGLRRVAYERDEDGLFLPEYVNVFGVPLSIFQDVGEGGEPPPPPKP
FT                   SIQVEVVPGRQPLEIRWPNVLRVDTVLRPTLVMDWEAVTPLTLDPMQTPIHAEIAPALA
FT                   GQADLSKVSEIDLEKAAAEFRLQNLVFRAARKLYLQSADVFAADKQYLAVQLIRLVEQF
FT                   LAGDRLHIPSLWHRDPLRRRLLLAMNMDTVVGHVSRFVQVQNTEKLAACFDQENPIGST
FT                   AFMRTWYTTRPCAPIRKSQISHVAYDSVWEKAVADLCETEPAVLAWAKNDHLDFKVRYL
FT                   YRGSSRNFVPDYLIRLSNGKTLVLEVKGRDSERNRAKRAAMEIWVKAVNEQGGFGRWCF
FT                   SVVFEPARMRDTLLLHAG"
FT   gene            complement(577187..579481)
FT                   /locus_tag="MCA0552"
FT   CDS_pept        complement(577187..579481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0552"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93258"
FT                   /db_xref="GOA:Q60BC5"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BC5"
FT                   /protein_id="AAU93258.1"
FT                   /translation="MIESHHASTRLLVSPNRPTHPTRSVHVSQNQSIALTRSRPGPARL
FT                   LVLVQLGKLGQDFRQSLHLVGFDVRIQLVEFEVVAEQEGALREKRHRIHHRIRPIRQQR
FT                   RRGVLCPDQPAGTGIWHHRLGRRQGHLCRHRQGTGRRQTGPATVRGAAPATRECRSDPY
FT                   AVHRRGLPLIRLAVFALLVLPATLRAAEAHSARIDYLYLDANEGQAAGGHAALRFGDDV
FT                   YHFEYVEGGLIRAARQAFEPFRRLYTETENRTLHISRIAVTSVVYTALRERFESLLRRQ
FT                   NAQFEVPAALHRDAELLALLARPAPQPGLPVKGLGLFEPAGTDRPEDPALAGLRTRALA
FT                   RYGADGLRTRMASVRQAISALRPGPPDDPLPSDANHSPPWRYRFADRYHDFHALLEAYR
FT                   LLERAAPLRRDACHVPAGREFALRAGETETLRNFAGRLEDWVLAALDRPRPDQGPGLLV
FT                   AFARLEALGKTLRYGRLVFLDTLSEPEPAVLPWSSAPPVFTTADADFRLARRELTGGRE
FT                   LDEVGYSLLENAANRRLEARRALAGKAPFRLRIPPGLMPARPGTPTEIVRPALDAEAMQ
FT                   DAAAAFLAAESAQRERLAQIYRYHLVERNCVTELFRTLNDGLAGLNESDTRALGGHIEP
FT                   TAADAIPFVSAQSVERRYRITESLELASRRKLFLESLDAEAYLAELSPLSSAIYPHNDE
FT                   DSLFLFFTDDATWPRPLFGAANLAVGAAEALAGILTLPFDAGRTLHRGLRGMLVSLPEL
FT                   AFFNIRKGTFR"
FT   gene            579565..582750
FT                   /locus_tag="MCA0553"
FT   CDS_pept        579565..582750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0553"
FT                   /product="discoidin domain protein"
FT                   /note="identified by similarity to GP:9107638; match to
FT                   protein family HMM PF00754; match to protein family HMM
FT                   PF01851"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93257"
FT                   /db_xref="GOA:Q60BC4"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR032790"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BC4"
FT                   /protein_id="AAU93257.1"
FT                   /translation="MIEAFRSPAWSWGLVLWWGLAAGGGTEVLDDFETLSGWTAEGSPG
FT                   TRFELKQDGGFEGRGLRLDFEFAGGAGYVILRKHFELPLPENYAFSFRAKGAGPANTLE
FT                   FKLLDPGAQNVWWHRREAKGLPAGWQLQAIRKSAIDFAWGPSGGAPLLALGGIEFALTA
FT                   AAGGKGTLWLDDLRFERRDAVVDYRGQPKVSASSASGEDGAENALDGQTQTVWRSASRP
FT                   ARQWLRLDFGQRREYGGLVLAWEGECHARDYAVEVSDDGRRWRGVYRVADGNGRRDYLP
FT                   LPEIESRYLRLELRKSACGKGYALRELTVKPPDFAASPNRLFEHIARNEARGAYPRYFR
FT                   GEQTYWTLVGANGGHRKGLLGMDGALETERGGFTVEPFLYADGRLLGWNEGRLSQSLEQ
FT                   GDLPLPTVERDYGDLSLEVTGFAGKLGDAPLSLARYRVANRAVTARRLRLFLAVRPFQV
FT                   NPPWQSLNMKGGVSPIHRIEASGRVLEVDGADALVAMNPPDGFGAAGFDQGDITDFLGE
FT                   SRLPPRTVASDSAGYASGAWRFDLELGPAAAREIFIAVPERKKGSSLAVETALKAEGET
FT                   LGARLWQEAVGYWRQALAGPDFLLPESERDLVRSLRANLAYILVNRDGPALQPGSRTYA
FT                   RSWIRDGALMSSALLMLGRGEEVKRFLEWYARFQSADGAIPCCIDSRGPDSVPENDSHG
FT                   EFVYTVAEYYRHTRDLEFVQALWPHIVAAMGHVDALRHQRMTEVYRSGEGRAFYGLMPA
FT                   SISHEGYASQPVHAFWDDFWTLRGIRDAVMLAKVLGDHAHAGSWSHMAAEFGGHLHAAL
FT                   QATMARKHIDYIPASADLGDIDPNAVAIMVSIAGEAGRLPQAALAKTFDDYLAHFRKRR
FT                   DGNGDDGHTPYEVRLVEALVRLGRRDDAWEVLRSLLRDQRPQAWRQWAEVVWRNPEAPR
FT                   FIGDMPHSWIGAEFIRSLRSCFAYEDDAEDSLVLAAGIPAEWLYNAASAEVGVRRLPTV
FT                   HGLLDYGLRTEGAETLKLHIDGRLAVPPGGIRIRPPVARPIQAAKVNGTAVSGFTGAEL
FT                   RIEGVPAEVEIRY"
FT   gene            582796..583761
FT                   /locus_tag="MCA0554"
FT   CDS_pept        582796..583761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0554"
FT                   /product="HlyD family secretion protein"
FT                   /note="identified by similarity to OMNI:NTL03PA05233; match
FT                   to protein family HMM PF00529"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93256"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BC3"
FT                   /protein_id="AAU93256.1"
FT                   /translation="MSKAVIALAAVFVVVGAVGLGVWRDRHARELPPGIARGNGRLEAT
FT                   EIDVGAKYGGRITEVLVYEGDDVVPGQPLLRIDTSEEQAQLQNIDAELKRARESLDYAG
FT                   QMLRVARHDLELARNIFRRSSRLVEQAAVSAEKLDRDRTELSNAVARLDAAQSRIGEAE
FT                   AGIDAVAAEKRRIESVIKESVLLAPREARVLYKLSEPGEVLPRGGKALTLIDLNDVYMI
FT                   LYLGEAEAGQAAIGGEARIVLDALPDLPLPARLVFVSPKAQFTPKQVETSSERQKLMFR
FT                   LKAQVDPEFLRAHRGLVKPGMPGVAYVKLSPEASWPPLHR"
FT   gene            583758..586481
FT                   /locus_tag="MCA0555"
FT   CDS_pept        583758..586481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0555"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /note="identified by similarity to OMNI:NTL03PA05232; match
FT                   to protein family HMM PF00005; match to protein family HMM
FT                   PF01061"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93255"
FT                   /db_xref="GOA:Q60BC2"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BC2"
FT                   /protein_id="AAU93255.1"
FT                   /translation="MSAIIRVEECRHRYGKVEALAGISLELSAGGLTGFVGPDGVGKST
FT                   LLGLIAGVRALQAGRIEVFGADIADPKAHRRLRHRIAYMPQGLGHNLYATLSVWENAEF
FT                   FGRLFGFDGKERRRRIERLLAAVGLAPFRDRPAGKLSGGMRQKLGLCCALLHEPELLIL
FT                   DEPTTGVDPLSRRQFWELIDTLRQERPGMTVLVATAYMEEAARFDRLVAMDAGRVLASG
FT                   TAAELLDRTGTADMESAYVALLPPEKRRGHEALVIPPRRNGRGEAAIEAVGLTRRFGDF
FT                   LAVDGVSFRIERGEIFGFLGSNGCGKTTTMKMLAGLLPASAGSASLFGQPVASGNAAMR
FT                   RRIGFMSQGFSLYTELTVRQNLELHAHIFGLAPSALEARIAELAARMHLAGHLDALAES
FT                   LPLGIRQRLSLAVALVHDPELLILDEPTSGVDPVARDRFWELLVELSREKGVTIFISTH
FT                   FMNEAARCDRISLMHAGRVLAQGAPAELVREAGAPSLEDAFIACLERESAPTAGVAAVV
FT                   PSLAPEVAGPAPAASPWFSPRRFNAYVWRETMELARDPIRLAFALLGPMLLMVVMGYGI
FT                   SLDVEHLPYAVLDYDRTPESRRYLEHFAHSRYFEEQAPLQDDDDISRRMARGQLNFAVE
FT                   IPPGFGRDLKAGRPVEVGVRIDGSIPFRANTVQGYVEAVHARFRSDMMDESPARAAAPP
FT                   LRVETRFRYNPDLKSVYALVPGVIAVMLAVIPPILTAVSVVREKEIGSITNLYATPSTR
FT                   LEFLLGKQLPYVVVGLVNALSLIALALWLFGVPVKGDLSALLLGAMLAVAGTTGWGLLI
FT                   SAFTRSQIAALFAAFLLSIVPAINFSGFLAPVASQTGAAAVMGYGFPTSWFLSISVGVF
FT                   TKALGFPELYPNHVVLLAFVLGYLGLSLALLPSRGR"
FT   gene            complement(586447..586905)
FT                   /locus_tag="MCA0556"
FT   CDS_pept        complement(586447..586905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0556"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93254"
FT                   /db_xref="GOA:Q60BC1"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BC1"
FT                   /protein_id="AAU93254.1"
FT                   /translation="MVWFFRLVHNCRTIDAVFPQQDTIRRIVHTSIHNYIRRTDGPFSH
FT                   RDRRRSAGLCALCRLFIARRREKGTGRRGGNRHAGRTADPGPNRRTTGGNHRRGTRTGR
FT                   RRCRRRHTVAGDGNGRGDPRGLTGHTAAGRNRRPPGGLNVPGWGAARG"
FT   gene            586959..588098
FT                   /locus_tag="MCA0557"
FT   CDS_pept        586959..588098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0557"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by similarity to SP:P31993; match to
FT                   protein family HMM PF01061"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93253"
FT                   /db_xref="GOA:Q60BC0"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BC0"
FT                   /protein_id="AAU93253.1"
FT                   /translation="MTRNGGRLRTIFRLGLKELASLRRDLAMLALIVYGFTVMIYIPAS
FT                   RGMLELRNGAVAVVDEDRSALSRQIVTALPQPYFLRPDPLPMDQVDGMLDAGRYAFVID
FT                   IPPRFQADFLAGRQPEIQVDVDATAMSQAGIGAGYIERIIREEAAGFGRNGVAPPAAGV
FT                   NLAIRTLYNPNAQESWFVSVMVLINVVNLLSIITSGAALMRERERGTVEHLLTLPLGPF
FT                   EIVCAKIWANGLVVVVAVGVSLTLVVGGVLDVPLAGSLPLFLAATALYLFTCTAIGIFL
FT                   ATVARSMPQLGLLCILVVFPITTLSGNTVPLDSMPEPIQRVMAFFASTHYVKIAQAVLY
FT                   RGAGFSAVWPQFLIMIGIGALFFLLALARFRHTVARQVG"
FT   gene            588136..588552
FT                   /locus_tag="MCA0558"
FT   CDS_pept        588136..588552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0558"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to OMNI:NTL01AT2375"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93252"
FT                   /db_xref="GOA:Q60BB9"
FT                   /db_xref="InterPro:IPR039366"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BB9"
FT                   /protein_id="AAU93252.1"
FT                   /translation="MKFPAFALAASLFLPACSLFHSDETNPHFGKVTGTVSWRDRVELN
FT                   PNAELIVSLEDVTRQDGRPVLVGMAEDTWPGSSPVSFEVSFDRRVVAEDRHYRVRAVVK
FT                   QDGETVLASRHGVPVLTFGHSDRADLELHRVGGP"
FT   gene            589375..589794
FT                   /locus_tag="MCA0559"
FT   CDS_pept        589375..589794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0559"
FT                   /product="conserved hypothetical protein TIGR00149"
FT                   /note="identified by match to protein family HMM PF01894;
FT                   match to protein family HMM TIGR00149"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93251"
FT                   /db_xref="GOA:Q60BB8"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BB8"
FT                   /protein_id="AAU93251.1"
FT                   /translation="MWFQKTIVLKPRSRGFHLVTAEITANLPELARFRQGIAHFFIQHT
FT                   SASLTINENADADVRSDLEAYLLAQVPERAPYYRHTLEGDDDMPAHIKAVLVGNSVTVP
FT                   LRQGRLALGTWQGIYLGEHRNHGGSRSLVATLHGD"
FT   gene            589821..590273
FT                   /locus_tag="MCA0560"
FT   CDS_pept        589821..590273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0560"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL03PA04715; match
FT                   to protein family HMM PF04214"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93250"
FT                   /db_xref="GOA:Q60BB7"
FT                   /db_xref="InterPro:IPR007332"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BB7"
FT                   /protein_id="AAU93250.1"
FT                   /translation="MRRMIFWGLALCAALPLSANERPAPVEAMVYRSPACGCCKKWVEH
FT                   LQANGFAVKDIVKDDMAAVKRELGVPENLASCHTAVIGGYRIEGHVPAADVRKLLEAKA
FT                   PLLGLSVPGMPAGTPGMEAGGRRDAYRVVGFGPDGSVHAVHDYTGE"
FT   gene            590296..591288
FT                   /gene="glk"
FT                   /locus_tag="MCA0561"
FT   CDS_pept        590296..591288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glk"
FT                   /locus_tag="MCA0561"
FT                   /product="glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /note="identified by similarity to SP:P46880; match to
FT                   protein family HMM PF00480; match to protein family HMM
FT                   PF02685; match to protein family HMM TIGR00749"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93249"
FT                   /db_xref="GOA:Q60BB6"
FT                   /db_xref="InterPro:IPR003836"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BB6"
FT                   /protein_id="AAU93249.1"
FT                   /translation="MLLAGDVGATKTVLGLFDCWGDRLVSLSEAIFASTDYASLETVVA
FT                   AFLDGQEERRPEVACFGVPGPVSEGRCEITNLPWVLSERELAAATGVSAVRLLNDVQAM
FT                   ALGMAYRLGEDDWVELNPGAGRPRSGNVAVIAAGTGLGEAILYWDGERYHALPTEGGHS
FT                   DFAPNGPLEEGLLAFLRDRFCGHVSYERILSGSGLANLYDYLRHAGVAPESEALHAALA
FT                   SAPDRAPIIAEWALERRDALCTAVLDLFAAIYGAEAGNLALKSLALGGVILGGGIAPKI
FT                   LPVLQAGRFMAAFTAKGRLSPLLGRLPVRVAIHPQPALLGAAHAASAML"
FT   gene            591414..591845
FT                   /locus_tag="MCA0562"
FT   CDS_pept        591414..591845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0562"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01SMB01173"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93248"
FT                   /db_xref="GOA:Q60BB5"
FT                   /db_xref="InterPro:IPR019291"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BB5"
FT                   /protein_id="AAU93248.1"
FT                   /translation="MFKTWVVAAESSRARIFAIDNRLNPLKEIDDLVHAEGRAKEQDLT
FT                   SDRPGRMLNSSTEGRHDYEKPQDAKQHEAQVFAKRVADRLEQARVNGDCLSLILIAAPE
FT                   FLGLLRQALSGPTAKLVSKTLDKNLVQKTEQEIRSYIFS"
FT   gene            591842..592942
FT                   /gene="ald"
FT                   /locus_tag="MCA0563"
FT   CDS_pept        591842..592942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ald"
FT                   /locus_tag="MCA0563"
FT                   /product="alanine dehydrogenase"
FT                   /EC_number="1.4.1.1"
FT                   /note="identified by similarity to SP:P17556; match to
FT                   protein family HMM PF01262; match to protein family HMM
FT                   PF05222; match to protein family HMM TIGR00518"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93247"
FT                   /db_xref="GOA:Q60BB4"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BB4"
FT                   /protein_id="AAU93247.1"
FT                   /translation="MKIGVPKEIKDLENRVAVTPQGVAALVNAGHEVLVEVAAGLGSGF
FT                   ADEEYMAAGARLVNAADAWAADLVVKVKEPVPSEYPYLKRQTVFTFFHLAGVDPGLTRA
FT                   LLDGGTTAVAYETLEDAQGRLPLLAPMSAVAGNMAAQVGAYYLARFNGGRGVQLGEVMG
FT                   VRHGRVVVIGDGVVGSHAALTAWGMGANVQVMGLVPAKGDALCRRAPGLEFFLSDGARL
FT                   AETLRDADLVVGAVLQPGARAEYIVTDAMVRSMPMGSVIVDVSIDQGGCVETSRPTTHS
FT                   HPVYVEHGVIHYCVTNMPGAYPRTSTLALTEATLPYLLRLADEGEACLRADPGLAKAVN
FT                   TCDGHITCRAAAEDLGLLDRYRPFPG"
FT   gene            complement(592951..593268)
FT                   /locus_tag="MCA0564"
FT   CDS_pept        complement(592951..593268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0564"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93246"
FT                   /db_xref="GOA:Q60BB3"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BB3"
FT                   /protein_id="AAU93246.1"
FT                   /translation="MAIAIPVVDNWYEERDSGRQFRIVALDDTGDTIEIQYLEGDLSEL
FT                   DRASWDQAAIIEIEAPEDWSAPFDDVETDDLGYSDPDLHLPDTDDLTLDDVLEDEDKEP
FT                   Y"
FT   gene            complement(593310..595943)
FT                   /gene="glnD"
FT                   /locus_tag="MCA0565"
FT   CDS_pept        complement(593310..595943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="MCA0565"
FT                   /product="protein-P-II uridylyltransferase"
FT                   /EC_number="2.7.7.59"
FT                   /note="identified by similarity to SP:P36223; match to
FT                   protein family HMM PF01842; match to protein family HMM
FT                   PF01909; match to protein family HMM PF01966; match to
FT                   protein family HMM TIGR01693"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93245"
FT                   /db_xref="GOA:Q60BB2"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BB2"
FT                   /protein_id="AAU93245.1"
FT                   /translation="MDGPNSDRAHDRHAFDRVAACKARIQHNTAELAERFRTGTPVADL
FT                   IRERTAFIDHLLSEAWDRRIGRGATDVALVAVGGYGRGELLLHSDVDLLILLDEAAPSS
FT                   RKQDLSDFLRLLWDIGLKPGHSVRSPAECAEAARTDQTIITNLLEGRLLVGSAALWEAV
FT                   RSETAPERMWSSAAFFEAKMAEQRIRYSKYHNTAYNLEPNVKEGPGGLRDIQLIGWIIR
FT                   RHSDARGLQDLVAHGWLTDAEYRELKEAQAFLWRIRFALHALTGRCEDRLLFDYQRELA
FT                   GLFGYRGETSNEVVEGFMQDYFRTVTGVERLNELLLQLFNEAVLHRDDAFSPTPVNDHF
FT                   QAVNDYLEAVHPAVFREHPLALLEVFLILQKNSALEGVRAATIRLIRQHIHLIDDAFRN
FT                   DPEACRLFMDILRQPGGVTHQLRRMNRYGVLAAYLPEFGRVVGRMQYDLFHVYTVDEHT
FT                   LFVVRNLRRFALEEFQQENPLCYELFQLIEKPELLYIAALMHDIAKGSDGDHSEVGERI
FT                   AEEFCRRHRIGPRETLLVKWLVRHHLVMSMTAQRKDLSDPEVIHEFAQIVRNQNTLNHL
FT                   YLLTVADIRATNPSLWNSWKGALLQELYTSTSWTLRRGLDTPPDYAEQISAAKDEARTL
FT                   LQRFGLAEDAITAVWENIGDDYFLRFLPEEIAWHTTAIAACRPEHLPLVLLRPESLRGS
FT                   VEVFIYERNRDFLFAQTTAVLDQLGLTVLDAKIIASRQGFALLSFNVLERSGTAPEGLF
FT                   RLVQICDRLKEALSGGGAPPPAVSRLATRQIRHFTVPTKVFFHDDPQNRFSILELIATD
FT                   RPGLLSKVGQAFMRTGIRLHNAKISTVGSRAEDIFFITDREDRPLDGEADRAALRRVLI
FT                   EFVGDQ"
FT   gene            complement(595921..596706)
FT                   /gene="map"
FT                   /locus_tag="MCA0566"
FT   CDS_pept        complement(595921..596706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="MCA0566"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /note="identified by similarity to SP:P07906; match to
FT                   protein family HMM PF00557; match to protein family HMM
FT                   TIGR00500"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93244"
FT                   /db_xref="GOA:Q60BB1"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BB1"
FT                   /protein_id="AAU93244.1"
FT                   /translation="MSISIKSAEDIEGMRVACRLAAEVLDMIAPYIKAGITTEEIDRIC
FT                   HDFIVNEQHAIPAPLNYKGFPKSICTSVNHVICHGIPGPKKLKNGDIINVDITVIKDGF
FT                   HGDTSKMFLVGQVKPYARQLVDVTREAMYLGIREVRPGAALNRIGAAIERHASKYNYSV
FT                   VREFCGHGIGREFHEEPQVLHYFEPKLDIRLEAGMIFTIEPMINQGKRHIQMLSDGWTA
FT                   VTKDHKLSAQWEHTVLVTPTGYEVLTLRQEEDFGRTELG"
FT   gene            596940..597710
FT                   /gene="rpsB"
FT                   /locus_tag="MCA0567"
FT   CDS_pept        596940..597710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="MCA0567"
FT                   /product="ribosomal protein S2"
FT                   /note="identified by similarity to SP:P02351; match to
FT                   protein family HMM PF00318; match to protein family HMM
FT                   TIGR01011"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93243"
FT                   /db_xref="GOA:Q60BB0"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BB0"
FT                   /protein_id="AAU93243.1"
FT                   /translation="MTSVTMRQMLEAGVHFGHQTRYWNPKMAPFIFGARSNIHIINLEK
FT                   TLPLFNDAMKYLEQVAANRGKILFVGTKKTMRKVIEEEARRCGMPYVNHRWLGGMLTNF
FT                   KTIKASIARMKDLQAMRDDGRLNRFSKKEALGMMRELEKLVCNVGGIGDMDRLPDVMFI
FT                   IDTGYEKNAVSEARKLGIPVVGVVDTNNSPVGIDYVIPGNDDSIRAVQLYAQSAATAIL
FT                   RGKASGVDFGAVADEFVEMEPETEQGATGETLGG"
FT   gene            597803..598684
FT                   /gene="tsf"
FT                   /locus_tag="MCA0568"
FT   CDS_pept        597803..598684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="MCA0568"
FT                   /product="translation elongation factor Ts"
FT                   /note="identified by similarity to SP:P02997; match to
FT                   protein family HMM PF00627; match to protein family HMM
FT                   PF00889; match to protein family HMM TIGR00116"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93242"
FT                   /db_xref="GOA:Q60BA9"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BA9"
FT                   /protein_id="AAU93242.1"
FT                   /translation="MSITAGMVKELRERTGSGMMECKKALTETGGDLEAAVELMRKQGL
FT                   AKADKKSGRTAAEGRICARVSEDGKAAAIVEVNCETDFVAKGDDFVKFADDVAAVALAS
FT                   SAMTVEELLAGEMRAGATVDQVRREMIAKIGENINVRRFERLSSQDGRIASYLHGTRIG
FT                   VLVELVGGDAELGKDIAMHIAASKPLCCDEKGVPAEVIAKEKEIFSAQAQASGKPANIV
FT                   EKMVEGRIGKFLGEITLVGQPFVKDPDQTVGKLLQSKGASVVRFVRFEVGEGIEKEETN
FT                   FAEEVMAQVRAS"
FT   gene            598774..599493
FT                   /gene="pyrH"
FT                   /locus_tag="MCA0569"
FT   CDS_pept        598774..599493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="MCA0569"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.-"
FT                   /note="identified by similarity to SP:P29464; match to
FT                   protein family HMM PF00696; match to protein family HMM
FT                   TIGR02075"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93241"
FT                   /db_xref="GOA:Q60BA8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BA8"
FT                   /protein_id="AAU93241.1"
FT                   /translation="MTEPVYKRILLKLSGEALMGDQGAGIDAEILKRLATEIDELCQAG
FT                   VEVGLVIGGGNIVRGAEKASEGLDRVTGDHMGMLATVINALAMQDALENLGRPVRVMSA
FT                   LKINQVCEDYIRRRAVRHLEKGRVVVFAAGTGNPFFTTDSAASLRAIEIGADLLIKATK
FT                   VDGVYSADPVKNPEAKFYTRLTYDEALDQRLNVMDTTALVLCRDYKMPLRVMNVFRQGA
FT                   VMRLIRGDDIGSLLVTG"
FT   gene            599501..600058
FT                   /gene="frr"
FT                   /locus_tag="MCA0570"
FT   CDS_pept        599501..600058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="MCA0570"
FT                   /product="ribosome recycling factor"
FT                   /note="identified by similarity to SP:P16174; match to
FT                   protein family HMM PF01765; match to protein family HMM
FT                   TIGR00496"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93240"
FT                   /db_xref="GOA:Q60BA7"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BA7"
FT                   /protein_id="AAU93240.1"
FT                   /translation="MINDIQKRTAERMQKSIEALKHEFAKIRTGRAHPSLLEHIRVSYY
FT                   GNEVPLTQVANVAVEDARSLAVTPWERNMVQAIEKAIMTSDLGLNPSTAGTVIRVPLPP
FT                   LTEERRRDLIKVVRQEAENGRVAIRNIRRDANNELKAALKEKLISEDEDRRSQEQIQKT
FT                   TDQFIKEIDKLLEQKEADLLAV"
FT   gene            600072..600860
FT                   /gene="uppS"
FT                   /locus_tag="MCA0571"
FT   CDS_pept        600072..600860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppS"
FT                   /locus_tag="MCA0571"
FT                   /product="undecaprenyl diphosphate synthase"
FT                   /EC_number="2.5.1.31"
FT                   /note="identified by similarity to SP:Q47675; match to
FT                   protein family HMM PF01255; match to protein family HMM
FT                   TIGR00055"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93239"
FT                   /db_xref="GOA:Q60BA6"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BA6"
FT                   /protein_id="AAU93239.1"
FT                   /translation="MVFSPDNVKPVASAPEDGARMRRIPRHVAIVMDGNGRWAQERYLP
FT                   RTAGHRAGVGAVRKVVEHCAKRGVEALTLFAFSSENWRRPEQEVSVLMELFLSTLERET
FT                   EKLHQNGVRLRIIGDRAAFGEALRERMDAAESLTRSNTGLQLAIAANYGGRWDIVQAAQ
FT                   TLAEKVRRGELSPEQITADRLQQQLALADLPEPDLFIRTGGERRISNFLLWQLAYTELY
FT                   FTPVLWPEFDEEALDLAFEDYAGRQRRFGFTGDQVAGRMP"
FT   gene            600906..601892
FT                   /gene="cdsA"
FT                   /locus_tag="MCA0572"
FT   CDS_pept        600906..601892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="MCA0572"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /EC_number="2.7.7.41"
FT                   /note="identified by similarity to SP:P06466; match to
FT                   protein family HMM PF01148"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93238"
FT                   /db_xref="GOA:Q60BA5"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BA5"
FT                   /protein_id="AAU93238.1"
FT                   /translation="MFKNRLITALVLAPLVIAAVLLLKPTAFSAVWGGVILLAAWEWAD
FT                   VSGVESRTGRIAFLVALGVPMASASFWAPYTVDWLMWPVVAWWFAVGMLLRARPDKALA
FT                   IRLPVGLKLGLGWFILLTSWILFIWLRFNFGAAQALYLLVLISFADIAAYFVGRRWGFT
FT                   KLMPEISPGKTVEGLYGALAVSAILAVAVGLWFKLEPLTIADFVILSLVTVVISVGGDL
FT                   FESLLKRQRGVKDSGSLLPGHGGVLDRIDALLASVAVFYAGSMLLGLFLQTAEPVTIEV
FT                   PTDMEGAPVQVEPIQPESGEAAPEPMGQEEAEPEASDAGAEESAPEE"
FT   gene            601925..603109
FT                   /gene="dxr"
FT                   /locus_tag="MCA0573"
FT   CDS_pept        601925..603109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxr"
FT                   /locus_tag="MCA0573"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.-"
FT                   /note="identified by similarity to SP:P45568; match to
FT                   protein family HMM PF02670; match to protein family HMM
FT                   TIGR00243"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93237"
FT                   /db_xref="GOA:Q60BA4"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BA4"
FT                   /protein_id="AAU93237.1"
FT                   /translation="MKGICILGSTGSIGVSTLDVLARHPDRYRVVALSANGNVDRLFEQ
FT                   CRAHRPRYAAVIRAEAAACLRERLMAAGLGGIEVLAGPEALEQIASLPEVDSVMAAIVG
FT                   AAGLLPTLAAARAGKDVLLANKEALVMSGPLFMAEVARSGARLLPIDSEHNAVFQCMPA
FT                   AYRAGSRAVGVRRILLTASGGPFLHTPLAELETVTPEQAVAHPNWVMGRKISVDSATMM
FT                   NKGLEVIEACLLFNAKPDDVQVVVHRQSVIHSMVDYVDGTVLAQMGTPDMRIPIAHALA
FT                   WPDRFESGAESLDLFAVRQLNFERPDLARFPCLRLAYEAVGAGGTAPAILNAANETAVA
FT                   AFLDRRLAFTGIPRVIEHCMARVAPNAADAIESVLQADAETRKVAQKYIDDLRV"
FT   gene            603214..604467
FT                   /locus_tag="MCA0574"
FT   CDS_pept        603214..604467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0574"
FT                   /product="putative membrane-associated zinc
FT                   metalloprotease"
FT                   /note="identified by match to protein family HMM PF00595;
FT                   match to protein family HMM PF02163; match to protein
FT                   family HMM TIGR00054"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93229"
FT                   /db_xref="GOA:Q60BA3"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BA3"
FT                   /protein_id="AAU93229.1"
FT                   /translation="MLRFSLGFGTPLLRWQRKPDGTEFTLSAIPIGGYVRMVDEREGAV
FT                   APADLPYAFNRQSLPVRFAIVAAGPVFNFLLAILLYWGVFMAGETGIRPVLGPVEAGTF
FT                   AAEAGFEPEDEILAVDGDPTPTWGLAMGKIFERVMDEGVVQVEVKTSAGGRVLRTLSIP
FT                   AHVLDAPEALGDRLGLQPWQPELAPVIERTEPGSPAERAGMKPGDLLLSADGETLRSWR
FT                   QWVDIVRAHPGRMIGLVVERDGVHVSLEIRPDAVNGPNGQVGRIGAVARIPDSLRAAME
FT                   VEYRLGVISALGAAVERTGDYAWLSLKMIGRMLVGKATVDNLSGPISIAQYAGQSAKAG
FT                   LAQFVKFLALISVSLGVLNLLPVPVLDGGHLMFYLIEAVKGGPLSERTQLLAQQVGLFI
FT                   LIALMALAFMLDIERLFS"
FT   gene            604619..605251
FT                   /gene="dsbC"
FT                   /locus_tag="MCA0575"
FT   CDS_pept        604619..605251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbC"
FT                   /locus_tag="MCA0575"
FT                   /product="thiol:disulfide interchange protein DsbC"
FT                   /EC_number="5.3.4.1"
FT                   /note="identified by similarity to SP:P21892"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93228"
FT                   /db_xref="GOA:Q60BA2"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR018950"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BA2"
FT                   /protein_id="AAU93228.1"
FT                   /translation="MKPDSIKPSPLAGISEVIVGPKLFYVSDDGKYLFQGSLIDLKNRE
FT                   DLTEPKLATARLGALEKLGEKNMIVFKPKIGKYVAYVFTDIDCGYCRKLHSELDSYLKE
FT                   GIEIRYLFFPRAGEGSESWDKAVNVWCAKDRNAALTKAKKGEKVEERTCDNPIKEQMAL
FT                   GTAIGAQGTPMIVTGGGNVLPGYVPAEQLARMLKHEKDEGGRQARTP"
FT   gene            complement(605298..607862)
FT                   /gene="mutS"
FT                   /locus_tag="MCA0576"
FT   CDS_pept        complement(605298..607862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS"
FT                   /locus_tag="MCA0576"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /note="identified by similarity to SP:P23909; match to
FT                   protein family HMM PF00488; match to protein family HMM
FT                   PF01624; match to protein family HMM PF05188; match to
FT                   protein family HMM PF05190; match to protein family HMM
FT                   PF05192; match to protein family HMM TIGR01070"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93227"
FT                   /db_xref="GOA:Q60BA1"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60BA1"
FT                   /protein_id="AAU93227.1"
FT                   /translation="MPDPSDLSRHTPMMQQYLRIKAEHPDRLLFYRMGDFYELFFEDAR
FT                   RAARLLDLTLTSRGESGGERVAMAGIPYHAVDGYLARLIRLGESVAICEQVGDPATSKG
FT                   PVERKVVRIVTPGTVTDEALLEERRDNLLAAVARDGAVFGLAVLDLSGGRFTLQQPGSV
FT                   AQLLNELERLNPAEILVSEDEPLTEELSGRRGLTRRPPWHFDPESGRRQLLSQFGTQDL
FT                   AGFGCEHLGLAIGAAGCLLQYLRDTQRSALPHIRSIRAETGTEYIGLDAASRRNLELDW
FT                   HPSGRAEFTLLGLLDRTGSAMGGRLLRRWLHQPLRDRTTLMLRQQAIGELLADRRFEAL
FT                   HDLLRGVGDVERIAARIALKSARPRDLSTLRQTLKALPALRETLHGTESALLGELTGRL
FT                   VDQPELSELLQRAIVDDPPQLIRDGGVIAEGYHAELDELRLLSENADRFLAELEEKERE
FT                   HTGLGALKVGYNRVQGFYIELPRSQADRAPVHYIRRQTLKNAERYVTPELKAFEDKVLS
FT                   ARERALSCEKALYEALLEILGRWLPALQDCAAGLAELDVLANLAERADRLNWVAPRLVD
FT                   APGIRIIGGRHPVVEQVGGTPFVPNDLAFGPNRRMLVITGPNMGGKSTYMRQAAIIVLM
FT                   AHIGSHVPAAEAEIGPIDRIYTRIGASDDLAGGRSTFMVEMTETANILNNATAESLVLM
FT                   DEIGRGTSTFDGLSLAWASAEHLARETRAYTLFATHYFELTALAEECEDVGNVHLDAVE
FT                   HGDKVVFLHAVREGPASQSYGLQVAALAGVPQTVIDNARRKLEQLERQARSAHQQAAPV
FT                   AQLDLFLPPEPHPVVRRLESLDVDGLSPREALNLLFELKQSL"
FT   gene            607997..608374
FT                   /locus_tag="MCA0577"
FT   CDS_pept        607997..608374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0577"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:MT3577; match to
FT                   protein family HMM PF00190; match to protein family HMM
FT                   PF07883"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93226"
FT                   /db_xref="GOA:Q60BA0"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q60BA0"
FT                   /protein_id="AAU93226.1"
FT                   /translation="MTQAGIHHRSAREYYFDERCHITEWWNSAADADVSVARARVEPGV
FT                   TTRLHRLRDTTERYLILEGQGRVEIGGVAPSAVGPGDVVLIPPGVSQRIANTGAGDLVF
FT                   LAICTPRFTPAAYEDLDAEVR"
FT   gene            608463..608538
FT                   /locus_tag="MCA_tRNA-Thr-1"
FT   tRNA            608463..608538
FT                   /locus_tag="MCA_tRNA-Thr-1"
FT                   /product="tRNA-Thr"
FT   gene            608978..609339
FT                   /pseudo
FT                   /locus_tag="MCA0579"
FT                   /note="transposase, IS3 family, degenerate; this region
FT                   contains one or more premature stops and/or frameshifts
FT                   which are not the result of sequencing error; identified by
FT                   similarity to GP:17427589"
FT   mobile_element  608978..609336
FT                   /mobile_element_type="insertion sequence:IS41"
FT   gene            complement(609385..609819)
FT                   /locus_tag="MCA0580"
FT   CDS_pept        complement(609385..609819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0580"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01SS01176; match
FT                   to protein family HMM PF01724"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93225"
FT                   /db_xref="GOA:Q60B99"
FT                   /db_xref="InterPro:IPR002636"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B99"
FT                   /protein_id="AAU93225.1"
FT                   /translation="MNARLHDEDFYTWTHTQAGLLREGRLAELDTEHLIEELEAMGARE
FT                   RRELVNRLTVLLAHLLKWAHQPDRRGNSWRRTIQIQRSDVADVLDDNPGLRPELGAIFG
FT                   KAYAKARLLAANETGLDEHAFPADPPFSVDQTMSMDYWPE"
FT   gene            complement(609816..610124)
FT                   /locus_tag="MCA0581"
FT   CDS_pept        complement(609816..610124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0581"
FT                   /product="site-specific recombinase, phage integrase family
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93224"
FT                   /db_xref="GOA:Q60B98"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B98"
FT                   /protein_id="AAU93224.1"
FT                   /translation="MKALVPAVFNRANQEGITDRPNPAVALKCKLIQSRERFPEPAESP
FT                   QFFAAVADSPLADFFLLAILIGARRSNVQEMRRQDIDAAGGVKAGAQIVPLKKKAKA"
FT   gene            610687..611139
FT                   /locus_tag="MCA0583"
FT   CDS_pept        610687..611139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0583"
FT                   /product="CBS domain protein"
FT                   /note="identified by match to protein family HMM PF00571"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93223"
FT                   /db_xref="GOA:Q60B97"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B97"
FT                   /protein_id="AAU93223.1"
FT                   /translation="MSIGQFCIRDTVIVDKDDTIVEAAKVMRAHHVGSVVVVEEAEGGC
FT                   KPLGILTDRDLVVEILAEEVAPDAVTVGDVMSFELVTAQEQDGLWETLQRMRAHGVRRI
FT                   PVVDERGLLVGIISADDYLEILAGELGELARLLAREKGREEQARSA"
FT   gene            611168..611728
FT                   /gene="ogt"
FT                   /locus_tag="MCA0584"
FT   CDS_pept        611168..611728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ogt"
FT                   /locus_tag="MCA0584"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /note="identified by similarity to SP:P09168; match to
FT                   protein family HMM PF01035; match to protein family HMM
FT                   TIGR00589"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93222"
FT                   /db_xref="GOA:Q60B96"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B96"
FT                   /protein_id="AAU93222.1"
FT                   /translation="MPDLGLTDAESLGHCLFDTGFGVCGIAWRAFEGKDEAPVVTLFLL
FT                   PEATAAGTAAAMARRCGGSPTVPPPAIAEVIEKVRRHFRGDLQDFSRVRVEPDGAGPFA
FT                   RAVYSAARDVPAGQIRTYGELARALNRPAAARAVGQALGRNPVPLIIPCHRILGAGGKL
FT                   GGFSAHGGVATKARMLRLEGVAV"
FT   gene            612033..613547
FT                   /locus_tag="MCA0585"
FT   CDS_pept        612033..613547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0585"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:17428765; match to
FT                   protein family HMM PF02696"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93221"
FT                   /db_xref="GOA:Q60B95"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60B95"
FT                   /protein_id="AAU93221.1"
FT                   /translation="MSTAMPGAFSPPRGLADLPLCPVYSRLGRPFHQPVAATSLPEPRM
FT                   VHFNAALAGELGFGPEAGPQLLEILAGNRPWPGYASSASVYAGHQFGAWVPQLGDGRAL
FT                   LIAEVRTPARERVELQLKGAGPTPYSRGLDGRAVLRSSIREYLASEAMHALGVPTTRCL
FT                   SLVASPQPVARETVESAAVVCRAAASFVRFGQFEYFAGRGQTEPMARLADHVIAEHFPH
FT                   LQGHPERHAAWLGEVIERTARLIAQWQLLGFCHGVMNTDNFSVLGLTLDYGPFGFMDRF
FT                   RWYHVCNHSDYEGRYAYRAQPEVGRWNCERLLQAVSPLLADAPGRAAEIGQDLLRRYAS
FT                   VYHRAVMRGWADKLGLREVRETDAGLIDEFLGLLQRGRGDFTRSFRLLGRIRTDSDAPA
FT                   RGVREAFADINAFDAWVADYRTRLRSEQNVDDEARAGRMNRVNPKYVLRNHLAQIAIDK
FT                   AMLGDYSEVARLAELLRRPYDEQPDMEAYAAEPPDYMRNIEVSCSS"
FT   gene            613633..613947
FT                   /locus_tag="MCA0586"
FT   CDS_pept        613633..613947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0586"
FT                   /product="Rieske 2Fe-2S family protein"
FT                   /note="identified by similarity to GP:1754625; match to
FT                   protein family HMM PF00355"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0586"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93220"
FT                   /db_xref="GOA:Q60B94"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B94"
FT                   /protein_id="AAU93220.1"
FT                   /translation="MAFEDVCKQSLLGEGELVPLTVGKKEIVILWPDGGEPKAYDARCP
FT                   HEGVSLGRGDFNGRILYCIAHGWVFDGRSGRCLQPTGWCMQEYPMRIENGMVQVDVSGA
FT                   "
FT   gene            complement(614137..615693)
FT                   /locus_tag="MCA0587"
FT   CDS_pept        complement(614137..615693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0587"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93174"
FT                   /db_xref="GOA:Q60B93"
FT                   /db_xref="InterPro:IPR025388"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B93"
FT                   /protein_id="AAU93174.1"
FT                   /translation="MAQTNSNQTTASPVSSGAIDRRSKSVGTALFSTLLALSQATWGAD
FT                   RQTEPPSASPTEWAGPADTKITLEAFDRARGEFADWFGNPLVKGKPLPKDYNYSFVGNK
FT                   FQLGLRMTGQPFEAFAQFQDTYIGGLPTNGVGIGAAYYASTPLSTQNGAFLRQGWLRLK
FT                   DMFGVDGLYLNGGRQLFYDGQQGPARHKNLRWIQDYRIAQRLIGPFEYTHAGRSFDGGS
FT                   IGYLTDDLEAVGFGFMPTFGGFESNGMPTIGKVNVAGASLSLRDSENVGNTIGRLSWYY
FT                   YSDDRDILFVDNRPLAAREKAVGRGSAIHTIGGHLAHVEEIGPGVADGTVYAFGQVGNW
FT                   QGQNQRAWAFGVEAGYQFKEVWAAPWLRAGINSGSGDDNPNDDTHGTFFQMLPTAWLYA
FT                   QFPFYNMMNNQDVFVQGMLTPDPKLSLRLDFHALRVNAPQDFVYSGSGATNDTVFGYVG
FT                   TPTGGASNLAYLTHMMINIKPIDHLAFNLFYGHAFGQSIINNQYDGKQGNYGFLEAIVS
FT                   F"
FT   gene            complement(616500..617075)
FT                   /gene="nasT"
FT                   /locus_tag="MCA0588"
FT   CDS_pept        complement(616500..617075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasT"
FT                   /locus_tag="MCA0588"
FT                   /product="response regulator NasT"
FT                   /note="identified by similarity to GP:619066; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF03861"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0588"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93173"
FT                   /db_xref="GOA:Q60B92"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR008327"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B92"
FT                   /protein_id="AAU93173.1"
FT                   /translation="MSLRIMLVDEDDERGAVLQEALAEAGYRVVARLRNEENLAVAVRE
FT                   YKPDMVIIDMEAPGRDTLEQMREVSRDNPKPIVLFSNNRDSEYIRQAVRAGVSAYVVDG
FT                   LSRDRILPIVEVAMARFSEFQVLRRELEDTRARLADRKLVEKAKGLLMKHRGLSEDEAY
FT                   QSLRKTAMARNQRIVDVARMLLALEEFL"
FT   gene            complement(617072..618370)
FT                   /locus_tag="MCA0589"
FT   CDS_pept        complement(617072..618370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0589"
FT                   /product="putative nitrate transporter"
FT                   /note="identified by similarity to SP:P38043"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93172"
FT                   /db_xref="GOA:Q60B91"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B91"
FT                   /protein_id="AAU93172.1"
FT                   /translation="MDNAQETAVGNGIEKPRLTLGFIPLTDCAPLVIALEKGYFRRHGL
FT                   DVTLSRQPSWAAIRDKVATGLLDGAHMLAPMPIATTLGLGGVRKATIAPMSLDLNGNAV
FT                   TVSNALYRRLTAVAGVEPAQRPVSARCLRRLLDRDGEVLRFATVFPFSSHNYLLRHWLA
FT                   CAGVDPDRHVGMTVIPPPQMPRCLAAGEISGYCAGEPWNARAVAQGIGRVLITGHEIWN
FT                   NSPEKVLGVNQDWAEHHPNTLRALLMALLEAAQWLDRPENRPEAAALLANPDYVGVPAE
FT                   ILQMSMTGSFQYAAGEPAVSLPDFNVFHRYAATFPWRSHALWFLTQMLRWGQIAEPLDL
FT                   HAVAARVYRPDLYREAATALGLPCPSGDYKREGIHAAPWTLDTGTSSLVMGPDLFCDGI
FT                   AFDPADPIAYLAGFGLHRLRVRLDDLRREGNPP"
FT   gene            complement(618410..621049)
FT                   /gene="nasA"
FT                   /locus_tag="MCA0590"
FT   CDS_pept        complement(618410..621049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasA"
FT                   /locus_tag="MCA0590"
FT                   /product="nitrate reductase"
FT                   /EC_number="1.7.99.4"
FT                   /note="identified by similarity to SP:Q06457; match to
FT                   protein family HMM PF00384; match to protein family HMM
FT                   PF01568; match to protein family HMM PF04324; match to
FT                   protein family HMM PF04879"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0590"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93171"
FT                   /db_xref="GOA:Q60B90"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="InterPro:IPR041957"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B90"
FT                   /protein_id="AAU93171.1"
FT                   /translation="MSPQFRQTVHTTCPYCGVGCGVLATVTDAGVKIQGDPDHPSNFGR
FT                   LCSKGSALGETLSLGTRLLHPEIGGIRTGWDEALDTVAGRFRETLERYGPDSVAFYVSG
FT                   QLLTEDYYVANKLMKGFIGSANIDTNSRLCMSSTVAGHKRAFGEDLVPGCYEDLELADL
FT                   VVLVGSNTAWCHPVLFQRILAARRADPKRRIVCIDPRRTATAEAADLHLPIRPGTDVLL
FT                   FNGLLHYLRHNDCLDFEFIERHTEGYAAALNMAKETAPTVPSVAAGCGLAESEVAQFYR
FT                   LFAANERTVTLWSQGVNQSTQGTDKVNAILNVHLATGRIGKPGAGPFSLTGQPNAMGGR
FT                   EVGGLANQLAAHLDLDDPGHRRQVQEFWRSPRIADRPGYLAVDLFRAIGEGRIRAVWIM
FT                   ATNPAVSLPDVHAVRRALSACPFVVVSDCERDTDLSRFAHVQLPALAWGEKDGTVTNSE
FT                   RRISRQRAFLDAPGEARPDWWIIAEVARRMGFGAAFDYRSAADIFAEHIALSRIAGAEK
FT                   RRFDLSGLQTAYDELAPTQWPVDAGNPQGTPRLSFDGRLTFVAVRPQAPAHAPDTGYPL
FT                   ILNTGRIRDQWHTMTRTGKTQRLTGHLPEPFAEVHPIDGSRLELTDGALARLESRYGSA
FT                   LVRVRFSAGQQPGTVFTPMHWSESNSRQGLVNALVNPAVDPVSGEPEFKHTPVRVVPYR
FT                   PRWYGFAIARRRIEFPDAAYRVVIPARHCWRHELAGEVLSEDWQRWARERLGPEGDGWD
FT                   DWLEFADPRAGRYRCAWIVQGRIEFALFVSPSHELPPRDWLVSLFGQDALSETARAGLL
FT                   AGRPLSADDDRGRIVCACFAVGENTLRRTIASETLTTAEQVGTSLKAGTNCGSCLPEIH
FT                   ALLAEAQH"
FT   gene            complement(621051..621407)
FT                   /gene="nirD"
FT                   /locus_tag="MCA0591"
FT   CDS_pept        complement(621051..621407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirD"
FT                   /locus_tag="MCA0591"
FT                   /product="nitrite reductase [NAD(P)H], small subunit"
FT                   /EC_number="1.7.1.4"
FT                   /note="identified by similarity to SP:P42436; match to
FT                   protein family HMM PF00355; match to protein family HMM
FT                   TIGR02378"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0591"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93170"
FT                   /db_xref="GOA:Q60B89"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B89"
FT                   /protein_id="AAU93170.1"
FT                   /translation="MPASPEESAMTPWTPIARLEEIPRQGARVVATPEGAIAVFRTLDD
FT                   RVFALLDRCPHKGGPLSQGIVHGARVACPLHNWVIELDSGQAVAPDEGCVRRFETRLED
FT                   GMVAIALPDSLVGT"
FT   gene            complement(621391..623853)
FT                   /gene="nirB"
FT                   /locus_tag="MCA0592"
FT   CDS_pept        complement(621391..623853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirB"
FT                   /locus_tag="MCA0592"
FT                   /product="nitrite reductase [NAD(P)H], large subunit"
FT                   /EC_number="1.7.1.4"
FT                   /note="identified by similarity to SP:P42435; match to
FT                   protein family HMM PF00070; match to protein family HMM
FT                   PF01077; match to protein family HMM PF03460; match to
FT                   protein family HMM PF04324; match to protein family HMM
FT                   PF07992; match to protein family HMM TIGR02374"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93169"
FT                   /db_xref="GOA:Q60B88"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B88"
FT                   /protein_id="AAU93169.1"
FT                   /translation="MSKPKLVLVGNGMAGVRTLEELLKLAPGKYDITVFGAEPHPNYNR
FT                   ILLSPVLAGEKKLDDIILNDEDWYAGHGITLHKGKTVVAIDRGRRRVRTEDGTVADYDR
FT                   LLLATGSTPFILPVPGRDLEGVVGFRDIRDVERMLEASEKHRHAVVIGGGLLGLEAANG
FT                   LKKRGMNVTVAHLLDTLMERQLDKPAAALLQRALENSGLSFKLEAQTEALLGEGRVRAV
FT                   RFKDGSEIPADLVVMAVGIRPNIELAKAAGIHCERGILVSDTMQTFDPQVYAVGECVQH
FT                   RGELFGLVAPLFEQAKVCANHLAEFGIARYRGSVTSTKLKVTGIDLFSAGEYQGGPGFE
FT                   ELLFQDPSRGVYKKLVVRDNKVAGAVLYGDTVDGAWYFQMMRDGTDISAFREHILFGQA
FT                   HVGDSGHGAESHAARLAEDAEVCGCNGVCKKTIVDAIIQKKLFTLDEVRAHTKASASCG
FT                   SCTGLVEQLLQSTLGSDYSVSPAKKPLCRCTDLTHEEVREAVRTHGPKTIPQLMGALGW
FT                   RTPDGCHTCRPALNYYLLCQWPGEYRDDPQSRFINERVHANIQKDGTYSVVPRIWGGVT
FT                   NPRELRAIADVAEKFRVPCVKITGGQRIDLLGVPKARLPAIWAELGKHGLVSGHAYGKS
FT                   LRTVKTCVGKEWCRFGTQDSTTLGIELEKMTWGSWTPAKVKMAVSGCPRNCAEATIKDF
FT                   GVVAVDSGWELHVGGNGGVKVRATDFLCKVQTDEEVMEYAAAYLQLYREEARYLERTAH
FT                   WIERVGLPYVHSRIVDDAEGRKALRARFLESQRKAQIDPWAERAQGAERHEFEPLTLRE
FT                   RNNHACIA"
FT   gene            complement(623850..625637)
FT                   /locus_tag="MCA0593"
FT   CDS_pept        complement(623850..625637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0593"
FT                   /product="protein phosphatase/kinase family protein"
FT                   /note="identified by similarity to GP:4557191; match to
FT                   protein family HMM PF00069; match to protein family HMM
FT                   PF00481"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93154"
FT                   /db_xref="GOA:Q60B87"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B87"
FT                   /protein_id="AAU93154.1"
FT                   /translation="MSVSGQPVLRAAVVTLQGRREDNQDFAAIAEPSPRDAAARGFVAA
FT                   VADGIGGARGGRVAAEVSVRSFMEAYYGLSETLGMQQLLDRCLGSANRWVHAMGRLDPE
FT                   LAHMGTTFSGLIFRGRRAYLVHVGDSRIYRLRGDEPELLTSDHTLSGPGLDHVLYRAVG
FT                   LDPGLRIDYSVYPLEPHDRFLLCSDGLHGSLQQEQIREILQERATPETTAEALARLAFE
FT                   QGSQDNITALVVDVIALPPAEKQSLRLAIESLPLLDLPEVGDEVDGFRLERLLSSGRYS
FT                   ALFLAADTLGQDKPVVVKFPHPRVASEREYYDAFVREAWIGARVKSPWVGEILEQTPGR
FT                   QSRLYSVMPFYPGASLEHELARRPRIGLEAGIDLALKLCKAVHALHRQQIVHRDIKPDN
FT                   VLLDPEGGLKLLDLGIARLPAWDEDQADPIPGTPSYMAPEMFQGERGSIATDVFALGVT
FT                   LYRTFAGGAYPYGEVEPFSTPRFGSPRPLTAHRPDLPAWLDAVLARAIAADPAQRPADA
FT                   VELAYELEAGLEKGGGRRPPRRPLPLYERNPLQFWKAVAALLLALLAMAGLRLSLSCRP
FT                   PSEAASRNNPLIHDNGDSR"
FT   gene            complement(625663..626937)
FT                   /locus_tag="MCA0594"
FT   CDS_pept        complement(625663..626937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0594"
FT                   /product="putative nitrate transporter"
FT                   /note="identified by similarity to SP:P46907; match to
FT                   protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93153"
FT                   /db_xref="GOA:Q60B86"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B86"
FT                   /protein_id="AAU93153.1"
FT                   /translation="MNLKEFKQAGHWPTLLSAFLYFDVSFMVWVMLGPLSLYITKDLAL
FT                   PLEEKFTIVAIPILSGAVFRIILGSMADHVGPKPTGILAQLLVILGLAYVFWFGLHSKL
FT                   EVELLGLLLGVAGASFAVALPQASRWYPPKFQGVVMGIAGAGNMGVVLDSMIVPWLAEK
FT                   FGWQAVFGFLLIPLVIVLTVYAVLVKDAPDKRAPVTLANYASVMKDPDAWWFMFFYSIT
FT                   FGGFVGLGNALPLYFTHWYHVSGIAAGMMVAIVVFAGSMFRPVGGYLADRIGGIRALQI
FT                   LFVVVSLAYLAISFMPEGPAPEALGTAKVAGWSLGELPAQGWGAVAVFFAGTLALGMGN
FT                   GSVFQLVPLRFRKEIGVVTGLVGCAGGVGGFFLAKTLGLSWEIQHGFALGFSVFAVLPL
FT                   LGLGGLMLVRKRWRTTWGAVSGARV"
FT   gene            627295..627783
FT                   /locus_tag="MCA0595"
FT   CDS_pept        627295..627783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0595"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0595"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93152"
FT                   /db_xref="GOA:Q60B85"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B85"
FT                   /protein_id="AAU93152.1"
FT                   /translation="MKRIVALLALGLVPAVSHAAPSHCTAEEKTVFSCSVGEKTVSVCA
FT                   SKELSPTAGSIQYRFGPEGHPEIRLPEPAAHPAAAAKGATLMYSGGGGAFLRFSKGQYD
FT                   YVVYTGSGRGWKKDGVVVDKGGKLIANFRCKGVPVSELGPEFFQGSGVSEDERAFEIP"
FT   gene            complement(627857..628999)
FT                   /gene="thrC"
FT                   /locus_tag="MCA0596"
FT   CDS_pept        complement(627857..628999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /locus_tag="MCA0596"
FT                   /product="threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /note="identified by similarity to SP:P04990; match to
FT                   protein family HMM PF00291; match to protein family HMM
FT                   TIGR00260"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93151"
FT                   /db_xref="GOA:Q60B84"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR026260"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B84"
FT                   /protein_id="AAU93151.1"
FT                   /translation="MTMTTRYTGLIERYRDRLPVSAETRIISLGEGDTPLIRLENIPRL
FT                   LGRRVELYVKYEGLNPTGSFKDRGMTMAVTRAVEEGSRAIICASTGNTSAAAAAYAARA
FT                   GITAFVLIPDGKIAMGKLAQAMMYGSVVIQIKGNFDDGMRLVKEVAGEAPVTIVNSINP
FT                   YRLQGQKTAAFEIVDELGRAPDYHCLPVGNAGNITAHWIGYSEYACGGRDCVTEACAFC
FT                   NGECRFVSGGPVSTSRPKMVGYQASGSAPFLRGHMVDHPETVATAIRIGHPQSWEQAWQ
FT                   VSRESGGWFDECSDEEILAAQKLLTEREGVFCEPASATSLAGALRDIRSGKIPEGSTVV
FT                   LTLTGNGLKDPDTAIAQCTQKPVTIEAELDSVKRAILDAL"
FT   gene            complement(629070..630380)
FT                   /gene="hom"
FT                   /locus_tag="MCA0597"
FT   CDS_pept        complement(629070..630380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hom"
FT                   /locus_tag="MCA0597"
FT                   /product="homoserine dehydrogenase"
FT                   /EC_number="1.1.1.3"
FT                   /note="identified by similarity to SP:P29365; match to
FT                   protein family HMM PF00742; match to protein family HMM
FT                   PF01842; match to protein family HMM PF03447"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0597"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93150"
FT                   /db_xref="GOA:Q60B83"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016204"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B83"
FT                   /protein_id="AAU93150.1"
FT                   /translation="MNPVKIGILGLGTVGGGTVNVLRRNADEITRRAGREIQVCRASTR
FT                   DLTRSRICDTTGIALTDDPYEIVSDPDIQIVVETIGGETPARDLVMKALANGKHVVTAN
FT                   KMLIALHGNEIFAAARERGLMVAFEAAVAGGIPIIKTIREGLAGNKVEWLAGIINGTSN
FT                   FILTEMWEKGRDFADVLQEAQRLGYAEADPTFDIEGVDAAHKLTILASIAFGIPLQFGK
FT                   VYIEGITGITAADVKYAEALGYRIKLLGIARRTPKGIELRVHPTLIPARRLIANVNGVM
FT                   NAVLIKGDAVGPTLHYGAGAGAEPTASAVVADIVDVVRTLTSDPENRVPHLAFQPAAIS
FT                   EIPILPIEAIETAYYLRLSAEDKPGVLADVTRILAAHHISIEAVLQKEMPEGESHLPVI
FT                   MLTQKVTERELNAAVREIEALPTIKGAVKRIRLETLG"
FT   gene            complement(630415..631491)
FT                   /locus_tag="MCA0598"
FT   CDS_pept        complement(630415..631491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0598"
FT                   /product="aminotransferase"
FT                   /note="identified by similarity to SP:P77434; match to
FT                   protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93149"
FT                   /db_xref="GOA:Q60B82"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B82"
FT                   /protein_id="AAU93149.1"
FT                   /translation="MGNPDQPTPQHIVDKLIESSRKGTNHRYSVSKGIPRLRRAICHWY
FT                   LNRYGVELDPDSQAIVTIGSKEGLAHLALATVGPGDAVLVPNPAYPIHPYGFVLAGADV
FT                   RHVPLLPGVDFFAELEMAIKTSWPKPKMLVLNFPANPTAQCVDLEFFEKVVEIAREYKI
FT                   WVVHDLAYADLVFDGYVAPSILQVPGAEDIAVEFFTLSKSYNMPGWRVGFMCGNRELVS
FT                   ALGRIKSYLDYGTFTPIQVAAITALEGPQDCVENIRLMYQNRRDVLCKGLNDIGWPVEK
FT                   PKGTMFVWARIPERYQSLGSLEFAKKMLLDAHVAVSPGIGFGEFGDDHVRFGLIENEHR
FT                   TRQAIRGVRDMMRKDNAV"
FT   gene            complement(631703..632401)
FT                   /locus_tag="MCA0599"
FT   CDS_pept        complement(631703..632401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0599"
FT                   /product="nucleotidyltransferase family protein"
FT                   /note="identified by similarity to GP:4545244; match to
FT                   protein family HMM PF00483"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93148"
FT                   /db_xref="GOA:Q60B81"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B81"
FT                   /protein_id="AAU93148.1"
FT                   /translation="MKAMILAAGRGERLRPLTDHTPKPLLPAGGRPLIEHTLEALVRAG
FT                   FKDIVVNLAHLGWQIRERLGDGARFGARIRYSDEGDHALETAGGIRQALALLGPAPFIV
FT                   VNGDIGTDYDFARLRRAPSGDAHLVLVPNPPHHPQGDFVLTEEQVTPPGDGARTWTFAG
FT                   IGLYRTELFASLPPGRAPLAPLLRQAMDAGRVSGELHPGFWLDIGTVERLKSYDRWLHE
FT                   RRPARSVLAV"
FT   gene            complement(632398..633423)
FT                   /locus_tag="MCA0600"
FT   CDS_pept        complement(632398..633423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0600"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:4545243"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93147"
FT                   /db_xref="GOA:Q60B80"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B80"
FT                   /protein_id="AAU93147.1"
FT                   /translation="MINSSGIATDDRSETLLHWLPTVLGRIPDDVRPISGDASFRRYFR
FT                   VSTGESSLIAMDAPPGREKLRPFIHAAGLLEKAGVNVPRIFAVDETRGFLLMSDFGDVS
FT                   YLQQLAAGDTEALYADALEALVRMQRGIDAAGCGLPAYDETLLQRELELFPVWFLAGLL
FT                   GLELNAAEESLYRRLSLNLTESALQQPAVVVHRDFHSRNLMVTGERNPGVLDFQDAVVG
FT                   PVTYDLVSLLRDCYIAWPEARVRRWLDDYRQRFAEGGAHAETDGETFQRWFDLMGLQRH
FT                   LKAIGIFARLHLRDGKSGYLPDIPRTLRYVLDVAGRYPETAEFRRFLDVRVCPFLNEAA
FT                   A"
FT   gene            633482..636757
FT                   /locus_tag="MCA0601"
FT   CDS_pept        633482..636757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0601"
FT                   /product="putative organic solvent tolerance protein"
FT                   /note="identified by similarity to OMNI:PSPTO0554; match to
FT                   protein family HMM PF04453"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93128"
FT                   /db_xref="GOA:Q60B79"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60B79"
FT                   /protein_id="AAU93128.1"
FT                   /translation="MRVAWLSVPSSWIQAFPGPSLPRFFRIHDPVVLRRRSCLLVRLRH
FT                   WSDGLIVRGPGPASADMEGPPTAAHAAAPLRTAVFLALAASWQQPAVAVGNWNCARSTD
FT                   DKQWECVAKRKDGGADTPAAPGPKAPPTALGEAALSQSNRAAPSTAVSPPTGAAPVAGT
FT                   GLRPPPPVPSAASPSPSTMAGGPTEDEEDEESESAESEKAESTAAPQVAEGGSAGEPGG
FT                   TPPARAPRPETPLAASRFVPSGTVSVRKEAASPQSVAAHAPGAPAGWTCKPQKESRSWD
FT                   CNLVGPDPRGVARPVGAAGEPPEDWAQAATITEYDEQRFDRLLGMMPSNPWAGTCARGK
FT                   RESDAAKDFLLTSKDRLARKRAPVEVHGNYGEMDDQEVATFTGDAEVTRYDQHVKGDFL
FT                   SLNTEADTVNARGSVFYREKGLAFASDTAFMRMEEDKGVLRNSQFIVETMPSRGVARVA
FT                   HMDSDTHSHYETATYTTCPPGNTDWMLHADEVTIDKETGRGDASHAWMEFKGVPIFYTP
FT                   YMDFPVDDRRQSGFLSPTFGQSKVNGFNLSVPYYFNLAPDYDLTLQAREMTSRGPLFGG
FT                   DFRWLTEHQRIRLLGEVIPEDSQTKTTRGQAGFDAMGRWTDSLFTLVDLNYVSDSKYLN
FT                   QLNNTLGLVSNTFVQSQAYADYTYSNGSVRLLGDYYQNIDPSIPTEQTPYYRLPSLRGN
FT                   YNEQIGDSGFRFQANAEVVNFGHGGNNVKGQRLNIRPQISYPIQSPGSFLVPSVALQNT
FT                   TYMLQNQAAGTGSSLNRVAPIFSVDSGLVFDRDFELGSASLRQTLEPRVFYTYVPKINQ
FT                   NDYPIFDSNYYDFTYYQLFRTNRFAGADRLADMNQVTLGLTSRFIDRDTGWERLTASLG
FT                   KVFFITDPSVTLVNPYGANPLGVVLGPDQGQFVYGNYNKSYANVIGKVDTRLTEAFFLG
FT                   GEAQLSPYTGRFERGSVGLQYNDRQNNLMNLSYRYREPLPNQPAIEQAATIGQNTTALN
FT                   NTDISFRIPFLKDWHVIGRWQYSLLYNRTLESLVGLEHETCCWRFTVLGREYLNGVNQS
FT                   NAPTTNTAIFVQMELKGLTRLGDQVDRFLYRAINGYRMPNEDF"
FT   gene            636744..638108
FT                   /gene="surA"
FT                   /locus_tag="MCA0602"
FT   CDS_pept        636744..638108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surA"
FT                   /locus_tag="MCA0602"
FT                   /product="peptidyl-prolyl cis-trans isomerase SurA"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by similarity to SP:P21202; match to
FT                   protein family HMM PF00639"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0602"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93127"
FT                   /db_xref="GOA:Q60B78"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60B78"
FT                   /protein_id="AAU93127.1"
FT                   /translation="MKISSFRKGRWLGALALFAVVCWSMADAAVDRIVAVVDDGVILES
FT                   ELVRKVDEIKRSLRASRASLPPDSVLVRQVLERMIVDKIQIQMAEKMGIQVDDDTLRMA
FT                   VSQIAQRNNLTPDQFRRSLAREGIDYGDFLDQVRSEIAMGRLRASQINNQIKISDREVE
FT                   HYLEAQGGSGAVADREYRLGHILIATPREASPDEVKKARERADRVVKELKAGLDFKDAS
FT                   IRYSDDPQALEGGDLGWRKLSEIPSHIAEVVGGMKDGEVSDPIRSPGGYHIVKMLAMRG
FT                   VGEAKLTKTHVRHILIRPNEVLSDEDAKNKLLALKTRIENGDDFAELARGHSDDKGSAI
FT                   KGGDLGWVKPGALVPPFEEAMNALDENQLSDPVQTQFGWHLIQVLERQESSDTNEVLKN
FT                   RARDELFKRKVDEETELWLRKIRDEAYVEIRLDETPASPGEDAPAGEDSPETFMR"
FT   gene            638122..639114
FT                   /gene="pdxA"
FT                   /locus_tag="MCA0603"
FT   CDS_pept        638122..639114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="MCA0603"
FT                   /product="pyridoxal phosphate biosynthetic protein PdxA"
FT                   /note="identified by similarity to SP:P19624; match to
FT                   protein family HMM PF04166; match to protein family HMM
FT                   TIGR00557"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0603"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93126"
FT                   /db_xref="GOA:Q3V8A3"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3V8A3"
FT                   /protein_id="AAU93126.1"
FT                   /translation="MPPRLLLTSGEPAGIGPDLCVLLSRRPFPCGITVLGDPDLLESRA
FT                   RLLGVPIELRRVVSGDVVPPHEPGVLHVLPTRRQPGTAPGKLDPANAAYVLETIADGAR
FT                   ACLAGHYDALVTAPVQKSVINEAGIAFTGHTEFIAGITGGSPVMMLAAEGFRVALATTH
FT                   LPLAEVSRAITVERLTGVLGVLHEDLVRRFGFSRPRILVCGLNPHAGEGGHLGGEEITV
FT                   IEPVLARLRQDGMDLTGPLPADTLFLPHNLDRADAVLAMYHDQGLPVLKYAGFSRAVNI
FT                   TLGLPIIRTSVDHGTALDRAGTGQIDTGSLEEAVRVAMEMATGRPAESP"
FT   gene            639111..639884
FT                   /gene="ksgA"
FT                   /locus_tag="MCA0604"
FT   CDS_pept        639111..639884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="MCA0604"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF00398;
FT                   match to protein family HMM TIGR00755"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93125"
FT                   /db_xref="GOA:Q60B77"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60B77"
FT                   /protein_id="AAU93125.1"
FT                   /translation="MRHVPRKRFGQNFLRDPGVIQEIVAAVGPAPSDRLVEIGPGEGVL
FT                   TRELLQSGACLEAIELDRDLVAALKRRFAGVGRLRIHEGDAMKFDLRTIATGERLRVVG
FT                   NLPYNISTPLLFHLFDQIDVIEDMHFMLQKEVVDRLCAGAGDDHYGRLSVMAALYCQAQ
FT                   HLFDVGPECFHPQPKVVSAVVRLVPHAVPPDAGMVKQVSAVVVAAFGQRRKTLRNALKG
FT                   LLDETAMVRAGIDPGARAEELSLADYVGLSRQLNP"
FT   gene            complement(639987..640307)
FT                   /locus_tag="MCA0605"
FT   CDS_pept        complement(639987..640307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0605"
FT                   /product="putative lipoprotein"
FT                   /note="identified by similarity to SP:P02937"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0605"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93124"
FT                   /db_xref="GOA:Q60B76"
FT                   /db_xref="InterPro:IPR021793"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B76"
FT                   /protein_id="AAU93124.1"
FT                   /translation="MCSKFRSPQKKESDMMKATKFAVVLMAAGLTVGCASKSDITNLQT
FT                   QIDGLKAEQASIKSTADEALSAAQAAESKAGAAEAAARRAAAAAEETNSKLDRMFKKSM
FT                   MK"
FT   gene            complement(640405..640938)
FT                   /locus_tag="MCA0606"
FT   CDS_pept        complement(640405..640938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0606"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL03PA03756; match
FT                   to protein family HMM PF03734"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93123"
FT                   /db_xref="GOA:Q60B75"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B75"
FT                   /protein_id="AAU93123.1"
FT                   /translation="MLFLLLSSAAPAAQSENPDPWLLVETKPHVLKVMQGDTPVEVFTK
FT                   IAIGQHGAGVDKRRNDNKTPLGEYRIGWINENSKFHRFFGLTYPNPEIAKRGFIRGLID
FT                   EQLVRHILRAHLVEATPPQDTPLGGQIGIHGVGAGNRQVHEMFDWTHGCVALTNEQIDQ
FT                   LTPWVRKGTLVVIR"
FT   gene            641107..642741
FT                   /gene="pgm"
FT                   /locus_tag="MCA0607"
FT   CDS_pept        641107..642741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgm"
FT                   /locus_tag="MCA0607"
FT                   /product="phosphoglucomutase"
FT                   /EC_number="5.4.2.2"
FT                   /note="identified by similarity to SP:P39671; match to
FT                   protein family HMM PF00408; match to protein family HMM
FT                   PF02878; match to protein family HMM PF02879; match to
FT                   protein family HMM PF02880"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0607"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93122"
FT                   /db_xref="GOA:Q60B74"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B74"
FT                   /protein_id="AAU93122.1"
FT                   /translation="MAVEIRKTTPYPDQKPGTSGLRKKVKVFLQGNYLENFVQSVFDTV
FT                   ETADGATLVVGGDGRYFNRQAIQIILRMAAANGVGRVLVGRGGLLSTPAASCVIRKHRA
FT                   LGGFVLSASHNPGGPEEDFGIKFNVANGGPAPESFTDRVYQRSRVIDAYRIVSAPDLDI
FT                   DTPGRSRIGDMEIEVIDPVADYAELMEHLFDFGLIRSGFRSGALTLRFDAMHAVTGPYA
FT                   KRILEETLSAAPGSVVNAVPLEDFGGGHPDPNLVHARELAAVMYSGRPPTLGAASDGDG
FT                   DRNMIMGANCFVTPSDSLAILAANAHLVPGYKDGLRGVARSMPTGRAVDRVAAAMGIEC
FT                   YETPTGWKFFGNLLDARRITLCGEESFGTGSDHVREKDGLWAVLFWLNLIALRKQSVAA
FT                   IVADHWRRFGRDYYSRHDYEGIEVPVAEGIMGRLQDLLAELPGRAFGDYRVTLADDFRY
FT                   VDPVDGSVSEHQGIRIAFDNSSRIVFRLSGTGTEGATLRVYMERYERDPNLHNLPTQEA
FT                   LADLIAIAEDLCQVKKRTGMAQPSVMT"
FT   gene            complement(642970..643443)
FT                   /locus_tag="MCA0608"
FT   CDS_pept        complement(642970..643443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0608"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01SS02055"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93116"
FT                   /db_xref="GOA:Q60B73"
FT                   /db_xref="InterPro:IPR013978"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B73"
FT                   /protein_id="AAU93116.1"
FT                   /translation="MPFSRPSEDNAFLADHIALLRRSFRHCTGRDLVPARMTAPEAARY
FT                   LFRAPLALLSHDTAPDPIFNYANETAMALFGLNWEEITALPSRLSAEAGDQEGREALLA
FT                   RVEAQGYVDGYSGVRISRQGRRFRIQDAVVWNLLDELGAPAGQAAMFEHWQWL"
FT   gene            643518..645416
FT                   /locus_tag="MCA0609"
FT   CDS_pept        643518..645416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0609"
FT                   /product="ABC transporter, ATP-binding family protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0609"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93115"
FT                   /db_xref="GOA:Q60B72"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B72"
FT                   /protein_id="AAU93115.1"
FT                   /translation="MPLVRLSDVGIAFGVKPLLEAAHFQVDPGERIGIIGRNGEGKSTL
FT                   LKVLAGQLTPDGGEVWKQPGLRIGFLEQMPALPASATIYDAVADGLGETGRRIAEYHHL
FT                   SERLADGDTSCLDRLGVLQQALEAADGWSLRRRVEFVLGRLALPGEKPVEGLSGGWQRR
FT                   VALARALVIEPDLLLLDEPTNHLDLETIVWLEQQLLQFAGAVVLITHDRAFLQRVATRI
FT                   VDLDRGKLTSWPGDYRDYLAKKAAALEEEEKRNAEFDRKLAIEEAWIRQGIKARRTRNE
FT                   GRVRALKRMRSERAERRSRQGIARLELEQAERSGKLVFEIEHLSIAFGGVPVVKDFSAL
FT                   VLRGDRVGLIGPNGAGKSTLLRLLLGELQPDAGTVRTGTHLKVAYFDQLRAQLDPDQTI
FT                   VEAVGDGKEWISLNGQQIHVMSYLGNFLFSPERARTPVRSLSGGEKNRVLLARLFSQPC
FT                   NILVLDEPTNDLDLETLELLEELLGEFEGTVLLVSHDRAFVDNVVTSVWVFEGDGVVAE
FT                   YVGGYSDWLAQRPSGVEQTPVAQPAAVRPSAPKPAGPRTRLSYKEQRELESLPAAIENW
FT                   ESRQAELTARVNEPDFYRRDAAEIKRVLQELETLQASLEEGYRRWEALEARAAEAS"
FT   gene            complement(645424..646401)
FT                   /gene="mdh"
FT                   /locus_tag="MCA0610"
FT   CDS_pept        complement(645424..646401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdh"
FT                   /locus_tag="MCA0610"
FT                   /product="malate dehydrogenase"
FT                   /EC_number="1.1.1.37"
FT                   /note="identified by similarity to SP:P10584; match to
FT                   protein family HMM PF00056; match to protein family HMM
FT                   PF02866; match to protein family HMM TIGR01759"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0610"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93114"
FT                   /db_xref="GOA:Q60B71"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010945"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60B71"
FT                   /protein_id="AAU93114.1"
FT                   /translation="MKTPVHVAVTGAAGQIAYSLLFRIAVGDLFGPHQPVILKLLDVPS
FT                   AERVLEGVAMELDDCASPLLQEIEVSSDPAEVFDGAEAVFMLGATPRGPGMERRDLLQV
FT                   NADIFSAQGRALNESASRRVKILVVGNPANTNALIAQRNAPDLAPGCFSAMTRLDHNRA
FT                   TSLLARHCGCNVAEISRVVIWGNHSPTQYPDLHHARVKGKPALSLVDPAWYVETFIPTV
FT                   QQRGASVIAIRGKSSAASAANAALDHMRSWFLGTPKDDWVSMTVSSDGSYGIAEGLMFS
FT                   FPVTIENGRFRIVQDLPLDTFSRERLRLTEVELLEERAMVSHLL"
FT   gene            complement(646613..646819)
FT                   /locus_tag="MCA0611"
FT   CDS_pept        complement(646613..646819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0611"
FT                   /product="putative mercuric ion binding protein"
FT                   /note="identified by similarity to GP:2935549; match to
FT                   protein family HMM PF00403; match to protein family HMM
FT                   TIGR00003"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0611"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93113"
FT                   /db_xref="GOA:Q60B70"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B70"
FT                   /protein_id="AAU93113.1"
FT                   /translation="MATIQLQVTGMKCGGCENTVVKTVAALAGVTSVTASHKENRVDVE
FT                   YDPDRIDPDAIRKAIAGQGYTVA"
FT   gene            complement(646874..647848)
FT                   /gene="galE-1"
FT                   /locus_tag="MCA0612"
FT   CDS_pept        complement(646874..647848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE-1"
FT                   /locus_tag="MCA0612"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /note="identified by similarity to SP:Q56623; match to
FT                   protein family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0612"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93112"
FT                   /db_xref="GOA:Q60B69"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B69"
FT                   /protein_id="AAU93112.1"
FT                   /translation="MRILVTGANGFVGRHLTALLVDQGHWVTAAVRREGAAPPTSIAEM
FT                   RVVGDIGPDTDWDGLLEGVDAVIHLAARVHVMRETGPAPLSRFRQVNVLGTERLARAAA
FT                   RTGVRHLVYLSSVKVHGETSPSGAPFTEAMAPAPEDAYGISKWEAERALAEIAAETGLG
FT                   VTVFRPPLVYGPGVRANFGRLVEAVRRGVPLPFGAVQNRRSLVYVGNLADAVATSLLRA
FT                   DAIGQTFLVSDGPPLSTAELVRSIARAMHRKPRLLSIPPALLRVTGALTGKRAEIGRLL
FT                   GDLAVDDSLLRSRLAWQPAYGLEEGLAATVRKTPARSRGVHRI"
FT   gene            complement(647845..648870)
FT                   /locus_tag="MCA0613"
FT   CDS_pept        complement(647845..648870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0613"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /note="identified by similarity to GP:6690125; match to
FT                   protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0613"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93111"
FT                   /db_xref="GOA:Q60B68"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B68"
FT                   /protein_id="AAU93111.1"
FT                   /translation="MATRVAEHGHIIESAGLRLIPLQLSRRSRNPLTEARLIADLVGLY
FT                   RRERPDIVHHVAMKPVIYGSLAARLTGRRAVVNALTGLGFLFTSDRPSARLLRPLVEAA
FT                   FRRLLNAPVCRTIVENPDDLRQLTDDGVVEPERIRLIRGSGVDLAKFTPSPEPEGPPLV
FT                   VLPARMLWDKGVGEFVEAARRLREAGIRARFALVGQRDAENPSAIAEAQLREWERSGVV
FT                   EYWGFRSDMPQVLAQCNIVCLPSYREGLPVSLLEAAACTRAIVTTDVPGCREAVRHEYN
FT                   GLLVPRGDPAALAAALSRLIADPATRRVMGTRGRARAEEEFSLESVVAQTLSLYHEMLA
FT                   R"
FT   gene            648919..649116
FT                   /locus_tag="MCA0614"
FT   CDS_pept        648919..649116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0614"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0614"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93110"
FT                   /db_xref="GOA:Q60B67"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B67"
FT                   /protein_id="AAU93110.1"
FT                   /translation="MQAEEPVLGDDEQEVRLGHGNALSEYSMKMPGTAGRTPRMKAGPR
FT                   FYTAKPPLWDASPNVPLSPV"
FT   gene            649225..650781
FT                   /locus_tag="MCA0615"
FT   CDS_pept        649225..650781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0615"
FT                   /product="putative alginate O-acetyltransferase"
FT                   /note="identified by similarity to GP:1245347; match to
FT                   protein family HMM PF03062"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93109"
FT                   /db_xref="GOA:Q60B66"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="InterPro:IPR028362"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B66"
FT                   /protein_id="AAU93109.1"
FT                   /translation="MLFNSYGFILGYLPLVWGGFFLVARHSRKLAALWLAAASLFFYGW
FT                   WNVKFVPLLLASIAFNYATGYAIGHARDPRTARYLLAAGIVADLMLLGVFKYANFFIDS
FT                   INDLFGLNIEAAKIVLPLGISFFTFTQIAYLVDVFRGIAKEYDFIHYVLFVTYFPHLIA
FT                   GPILHHKQMMPQFASASIYRPQYSNVGIGLTLFTIGLAKKVLLADSFGEYADPVFAAAK
FT                   DGFEPKFIMAWTGALAYTFQLYFDFSGYSDMAVGLSRMFGVQLPLNFNSPYKAWNVIEF
FT                   WRRWHMTLSAFLRDYLYIPLGGNRLGPARRHVNLMITMLLGGLWHGANWTFVVWGGLHG
FT                   SFLVVNHAWHALRRRFGFPPGEPVGMARVAGVLVTFFCVVIAWVMFRADSLTSGLLVAK
FT                   GCVGLSGLAVSQKLEGIGEILRSHGVNTANGLVFTGWFEGNAALNLLGGVKITLLALTG
FT                   FLLIWGFPNSQTLILPEFRKDHRVLSHPRFTFWLALTSGCMAAVALSSISKISAFLYYQ
FT                   F"
FT   gene            651064..651834
FT                   /locus_tag="MCA0616"
FT   CDS_pept        651064..651834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0616"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0616"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93101"
FT                   /db_xref="GOA:Q60B65"
FT                   /db_xref="InterPro:IPR031811"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B65"
FT                   /protein_id="AAU93101.1"
FT                   /translation="MNVASHNYEQFVCIEQWLEMLESNGVLAGRTVIVESLERFFPSRF
FT                   GNIGTCRKSKSRDKSVVKPFEAFTHGEIPTSRRTGGEIPTDVVYLLKVLKNAVLEALLG
FT                   SDATIHGVAVNAPLTSRDLFSNRRSDRILYYYEDDAEGSWSDEQIGKAVYSISAIQRRI
FT                   EAAEGRFIFVLVPNKSSVYARFIVGRPDADRYTTVIRRLGDAGVATVDMLAPFRGHAEK
FT                   EVDFYLPDDTHVSTKGYRVLGEVISGEMKKMAAR"
FT   gene            complement(652481..652747)
FT                   /locus_tag="MCA0617"
FT   CDS_pept        complement(652481..652747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0617"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0617"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93100"
FT                   /db_xref="GOA:Q60B64"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B64"
FT                   /protein_id="AAU93100.1"
FT                   /translation="MNPDHGGFTRAGLSECRKPQPDRPPSSPPKHQKRHRQAPCPHRNL
FT                   ETADILDPAITSPRNRWGGSPPLRARKTASHTFVSRESNPAGQ"
FT   gene            complement(652744..653844)
FT                   /locus_tag="MCA0618"
FT   CDS_pept        complement(652744..653844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0618"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0618"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93099"
FT                   /db_xref="GOA:Q60B63"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B63"
FT                   /protein_id="AAU93099.1"
FT                   /translation="MRILALTRYDTLGASSRVRFYQYFPYLAEDGIEIETSAFLSNAYL
FT                   VTLYERHDRQLRHIVPAYFRRLQALVRVRHFDLLWIEKELFPWLPATAEAVLKWLGIPY
FT                   VADYDDAVFHNYDGHRNPLFRTLLGRKIDEVMRNAGIVVAGNPYLAERARQAGAAKVEI
FT                   VPSVIDLNRYPEPETARPRDPARPVRIGWIGTPSTAPFLRRVRMPLQRVADAPDLRLVL
FT                   IGTGDTDVGISGAERLAWSEEREYELLETLDIGIMPLADLPWERGKCGYKLIQYMACGK
FT                   PVIASPVGVNAEIVEHGVNGFLASSDGEWMEAITALANDAALRERMGRAAREKVVRTYS
FT                   VQSQLPRLREILASACRPPGCRRSHS"
FT   gene            complement(653841..654776)
FT                   /locus_tag="MCA0619"
FT   CDS_pept        complement(653841..654776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0619"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0619"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93098"
FT                   /db_xref="GOA:Q60B62"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B62"
FT                   /protein_id="AAU93098.1"
FT                   /translation="MPGIDIVIVNWNSGNQLRECLRSIGNLVGEAEPLTVTVVDNASCD
FT                   GSADGLPEPSCPLRVIRNRANLGFGRASNLGAREGSADYLLFLNPDTRLHPGALSIPLG
FT                   FMESETGRHVGICGVQCLDETGGVARCCARFPTAWRLVGQALGLDRLFPRWIPPHFLGE
FT                   WPHDSDRDVDQVIGAFFFVRRAVFEQLGGFDERFFVYYEDLDFALRARRAGWGSRYLAG
FT                   ARIFHRGGGVSRQISARRLHYLTHSKLRYARKHFAGIDAFLVSAAVLLLEPLARSAYAL
FT                   GRGRPGEFADTWKAFGGLYASLCRPGENGR"
FT   gene            complement(654800..656632)
FT                   /locus_tag="MCA0620"
FT   CDS_pept        complement(654800..656632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0620"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0620"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93097"
FT                   /db_xref="GOA:Q60B61"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B61"
FT                   /protein_id="AAU93097.1"
FT                   /translation="MRTVRFRINPTIPRHTLLPGFLTRSRVVKTLRYTALSVFGLPFIP
FT                   LYRHPLGHALKRALGMLLAGEIKKAAMLLLGTLNHTVFYALWVRHPWCEAKIRSKVETS
FT                   HLHTLDIAFVVGSTGSASPDDIEVTLESIRTQDFQGLVSHVAVMEPDLPPLSFRAAVPE
FT                   GSEFVCFLQAGDRLTPDAISRVAACIDGYPKFKLIYSDHDYLIKGKHRCFAEFKPDWNY
FT                   ELSLARFYLQTPVFFSAASLEKLGFSALSGNCALPDVIFKIYENHGSESIAHIPAILCH
FT                   RPYSRREDCGEELEIYGRAVAAHLGRRGEPARIERSREATRGLSVHFPPAPERPLVSII
FT                   IPTRNRADLLRNCIESIEARTAYDHYEILVIDNGSDEAQTLDYFREIAARGVRVIPDPS
FT                   PFNFSAINNRAAEHARGQYLAFLNNDIEVITPDWLGEMLGLAARPGIGAVGARLWYPND
FT                   RLQHAGVILVGGVAGHAHKFLPRGLPGYCDRAVLLQEFSAVTAACMVIRKASFVDVGGF
FT                   DPDLAVAFNDVDLCLRLKAAGYRNVWTPAAELYHHESLSRGNDTAPDKIERFRRECAYM
FT                   RERWGDFLRNDPAYSPNLAWDNYDFSLSWERPKF"
FT   gene            complement(656659..657762)
FT                   /locus_tag="MCA0621"
FT   CDS_pept        complement(656659..657762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0621"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0621"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93096"
FT                   /db_xref="GOA:Q60B60"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B60"
FT                   /protein_id="AAU93096.1"
FT                   /translation="MVAGFTVHSGPHHVPHRDMTHHSRPPGHAPRVTILMPVYNGEKYL
FT                   AAAMESILDQTFRDFILLIIDDGSSDSSLAIARSFGDPRVQVERNPKNLGLVKTLNRGL
FT                   DLVQTEFVARMDCDDIALPDRLEKQIAFLDENPDIGMCGTAYELFHESLRQTIRPPCRH
FT                   EEIVYGLLDDNVFLHSSVIVRMEVLNRHGLRYREDYRLAEDYELWARLARYTHIGNLPQ
FT                   VLVRYRSHPENVSNTNKGEQIATRDRVRLEHLESFGLAPAADQKTLHIDLFSLAFQGSP
FT                   DQLADARRWLEALARAVSTRCGLPLGRLHRDFALLWYSACGRSAHHGLTVLFSYLKSAM
FT                   AWKGPKSYILKLLFRCLMRDPIPAVTK"
FT   gene            complement(657817..658842)
FT                   /locus_tag="MCA0622"
FT   CDS_pept        complement(657817..658842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0622"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0622"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93095"
FT                   /db_xref="GOA:Q60B59"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B59"
FT                   /protein_id="AAU93095.1"
FT                   /translation="MTTPAPVPRITVLLPVYNGEQYLREALDSLLTQTYRNFSLLAVDD
FT                   GSTDSSLEILRSIKDPRLSVKVNPRNRGLINTLNESLDLIQSEYVARMDADDIATPYRL
FT                   EEQLAFMDAHPDVGLCGGYYERFTDTESIVVRPPTTHEDISYALIFDNVMAHNTVMFRR
FT                   SVLERYRLRYDPAFAYAEDYELWVRFARYSRLANLPRVLVRYRFHPANTSSRFRHEQQI
FT                   AAAKIRHIHRTNLGLEPRPGDAALHRQLFDMRFEGDLPELTAAGIWLSKLYRVGVRRCR
FT                   QNPVSTFLEFNKLWYSACGRLADHGLKVFAQFLRQPFGFLGNPAYTLKLAYRCWRRIRI
FT                   A"
FT   gene            complement(658901..659695)
FT                   /locus_tag="MCA0623"
FT   CDS_pept        complement(658901..659695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0623"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GP:11641086"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0623"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93085"
FT                   /db_xref="GOA:Q60B58"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="InterPro:IPR018011"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B58"
FT                   /protein_id="AAU93085.1"
FT                   /translation="MAFHKNLTRVERARLAVTKLICPITRDALRVIPLTDFIFGIYISS
FT                   RYRYVYIDNPKTGCTSLKSAMAELELRGRKSDLDPLNLEVIHYDSSPLKSFVPIFPKPT
FT                   LSNLIKNNYRFVTFVRNPYQRLLSCYLNKFDNSTAKDNPQARRMPRGAAPGSFSEFIDA
FT                   IIGQTDHDMDPHWRSQSINIHYSRVPYAYIGRFENYATDYVTTFHKLGIPADEIPTLRH
FT                   LNKTGAGRASLHEFYDKKSQDAVYARYQDDFVNFGYPYELPD"
FT   gene            complement(659738..661009)
FT                   /locus_tag="MCA0624"
FT   CDS_pept        complement(659738..661009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0624"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:1890598"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0624"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93084"
FT                   /db_xref="GOA:Q60B57"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B57"
FT                   /protein_id="AAU93084.1"
FT                   /translation="MRLPRVLFTRLPTNTRYPFEGQLPLSDSMPRPARASLRNIETNVS
FT                   LTENTGNMLIGESLSRILELNRPRSCHLNLTRLLALGWSAERIRDEIHKHFDLVVFLMA
FT                   NAIRKDFDLGNLADAVSALETDFMVFGIGMQDSLPPTLSTLPEGSQRLLRMFDQKALIF
FT                   GVRGKETENWLHQVGLNRAKALGCPCLYVYPQNLLAVSPPSGGSNAMAIASGHLTNPSI
FT                   RSQKLISLFRDADSHYIMQDEFLTIARTCKDDERLYNDATGRVRTELCRPIFERILGSR
FT                   IPFKNFWYFQNLDAWRVFCAQADFYLGDRFHGGIVAMQAGIPSIFIWNDQRARELTDFF
FT                   ALPNISVADIGDAKAHDLVDSLLTKQAFTEFRDTYRQRLDVFVRTLGEHGIRLDIDSQY
FT                   YTSKREDMRQIVYKTYRKFFRGFN"
FT   gene            complement(661019..662272)
FT                   /locus_tag="MCA0625"
FT   CDS_pept        complement(661019..662272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0625"
FT                   /product="putative polysaccharide efflux ABC transporter,
FT                   ATP-binding protein"
FT                   /note="identified by similarity to GP:15025336; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0625"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93083"
FT                   /db_xref="GOA:Q60B56"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B56"
FT                   /protein_id="AAU93083.1"
FT                   /translation="MSYAIQAESVGKSFILHHQRNRPNDSLRDALAGSLSHLGRSLLRR
FT                   DETDQTEEFWALKDISFGIRPGERIGLLGRNGAGKSTLLKILSRTLEPSTGRIRIRGRI
FT                   ASLLEVGTGFHPELTGRENIYFNGAMLGMSKAEIGRKFDEIVDFAEVEQFLDTPVKHYS
FT                   SGMYVRLGFAVAAHIDPEILIVDEVLAVGDARFQKKCIGKMHEISEEGRTLLFVSHNMH
FT                   SIMQLTQRALVLDRGQMVCDADTRDAVTKYLSADAGEDISLPMRTKVDWIDDVNFRWLR
FT                   QETDIGFNKPLNFQFCFTTEQHTSRLVVTIGFINTIGALVLTCKAELDHLEPGPQQFRL
FT                   RISDHHLTPGTYFVRLDLWGSDEHLLEQDNVCTVDLFSASTDDRLIQSIARRRGDKLGC
FT                   YAPITLQILHASESHQHD"
FT   gene            complement(662275..663102)
FT                   /locus_tag="MCA0626"
FT   CDS_pept        complement(662275..663102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0626"
FT                   /product="putative polysaccharide efflux ABC-transporter,
FT                   permease protein"
FT                   /note="identified by similarity to OMNI:NTL01SS00318; match
FT                   to protein family HMM PF01061"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0626"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93082"
FT                   /db_xref="GOA:Q60B55"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B55"
FT                   /protein_id="AAU93082.1"
FT                   /translation="MSSHPEIIIEAGKSEHHYWRDVWRYRELFYFLAWRDILVRYKQTA
FT                   IGLAWALVRPLFTIIVFTLIFGRLARLPSEGAPYSALVLVGMIPWQFFASAVNEASLGL
FT                   ANKENIITKVYFPRIIIPISGAIVNLVELAVGLAMLAVLLAWQQVAVTLNMLFLPLILL
FT                   PALLLTFGCAVWVSALSVRFRDFRQVVPFALQMGLYISPIAYSAAIIPERWRVWYALNP
FT                   FTGIIEGLRWSVFASSPTPPLQELAISLGIATLATASGIAYFRSIEKRFAELL"
FT   gene            664810..666609
FT                   /gene="recJ"
FT                   /locus_tag="MCA0628"
FT   CDS_pept        664810..666609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recJ"
FT                   /locus_tag="MCA0628"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by similarity to SP:P21893; match to
FT                   protein family HMM PF01368; match to protein family HMM
FT                   PF02272; match to protein family HMM TIGR00644"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0628"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93081"
FT                   /db_xref="GOA:Q60B54"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B54"
FT                   /protein_id="AAU93081.1"
FT                   /translation="MAKLYHPIQKRIVRRSLQGGGELAKRMSLASPPDASPLLARLYQS
FT                   RSVFTPEDLGRSLNELPAPSLLKGMDAMTAELEAAIRGQKSIMIVADFDADGATSCAVA
FT                   MRGLRALGAERVSFIVPNRFTCGYGLTPELVELIFRGGATPPDMLLTVDTGIACHAGIA
FT                   AARARGMKVLVTDHHLPGESLPAADAIVNPNLPGDGFPGKALAGVGVIFYVLSGLRRRL
FT                   RESGWFEGGRQPPNLAELLDLVALGTVADVVPLDRVNRILVHQGLQRIRAGRACPGIRA
FT                   LLEVADAKRGGAATTAGTLGFTLGPRLNAAGRLDDMSLGIACLLADDMNAAKELAERLD
FT                   GMNRERKTIEAQMQADAWAMLRIGAEPLPRQSDRWSGSAAIVFDPAWHQGVIGILASRI
FT                   KDRLHRPVIAFARGEDGLLRGSARSIAGVHVRDVLCAVAARHPGLIVRFGGHAMAAGLA
FT                   LEESRLAAFTEAFEAEVAGVLEGVELEHAVVTDGELPPDDFHLDTARCLRDAGPWGQGF
FT                   PEPLFDGEFDVLGMRIVGEKHLRLTLEVPGAARQVEGVAFFVADPPAWLGCRRLRAAYR
FT                   LDVNEFRGVSNLQLGIEYMEPVS"
FT   gene            complement(666613..667485)
FT                   /locus_tag="MCA0629"
FT   CDS_pept        complement(666613..667485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0629"
FT                   /product="putative phosphomethylpyrimidine kinase"
FT                   /note="identified by similarity to SP:P55882"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0629"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93080"
FT                   /db_xref="GOA:Q60B53"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B53"
FT                   /protein_id="AAU93080.1"
FT                   /translation="MQTGRSPCTTCRAKATFDPIGTSMTTPSHQPAIVLSLSGHDPTGG
FT                   AGIQADIEAVGAIGCRACTVITALTIQDTSNVHAVQPQSPDAFLAQGRALIRDLPVAAV
FT                   KIGLLGSAGIAHCVATLLDELGGGVPVVLDPVLAAGGGTDLASEELIEAVRTELLPRAV
FT                   LVTPNVPEASRLGGGATEAENAERLRLLGCPNVLITGTHAPTDDVVNRLYSSTGKRDYR
FT                   WPRLPYSYHGSGCTLAASVAGYLALGHAMDAAVEWAQRFTWQSLRAGWTPGDGQHLPLR
FT                   GPLGRQAAG"
FT   gene            667623..668132
FT                   /locus_tag="MCA0630"
FT   CDS_pept        667623..668132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0630"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0630"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93079"
FT                   /db_xref="GOA:Q60B52"
FT                   /db_xref="InterPro:IPR032025"
FT                   /db_xref="InterPro:IPR038312"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B52"
FT                   /protein_id="AAU93079.1"
FT                   /translation="MKGCATSSVATSTSSPAQFAKIAEKFCRLVEGFARYEPQDWLALI
FT                   ARELGPLETAVRELAGRAGIGDYSMLADIEQRHRMYVELKTFLDGMDDYWTEADLEAGD
FT                   GVMTGSLSDNVTEIYFALKRGLAHWNKGPAEAGAAVGEWLSGFEVNWGYHLANLRSQLK
FT                   HKATLH"
FT   gene            668226..668840
FT                   /locus_tag="MCA0631"
FT   CDS_pept        668226..668840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0631"
FT                   /product="MotA/TolQ/ExbB proton channel family domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01618"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0631"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93073"
FT                   /db_xref="GOA:Q60B51"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B51"
FT                   /protein_id="AAU93073.1"
FT                   /translation="MLDIIKGGGLLIWPILICSVVALAIILERLWALRTSRILPAELAS
FT                   TVWTLWRNDRLDAGSIRQIALNSPLGAVLAAGLANHKHGREVMQRCIEQAGRQVVHAME
FT                   RYLNTLGTIASISPYLGLLGSVLGMMKVFAGFSAAHGAGNPAVLAGGLSEILITTAAGL
FT                   AVAIPSLMFYRYFRGRVNELSMRLEEEAVRLIAVLHGEREE"
FT   gene            668848..669273
FT                   /locus_tag="MCA0632"
FT   CDS_pept        668848..669273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0632"
FT                   /product="biopolymer transport protein, ExbD/TolR family"
FT                   /note="identified by match to protein family HMM PF02472"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0632"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93072"
FT                   /db_xref="GOA:Q60B50"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B50"
FT                   /protein_id="AAU93072.1"
FT                   /translation="MNFRPQNRDEPELNLIPMIDVLIVLMIFLVMTTTFSRETGLELRL
FT                   PKAQAVPQEEVPKGVDVAVDAEGRFAVNGTPLQDNRLEALREAMKAAAGGQQDPLVIVR
FT                   ADRATQHQHVITVLEAAGQLGFGHIGFAAEAAPEGKP"
FT   gene            669270..670280
FT                   /gene="lpxK"
FT                   /locus_tag="MCA0633"
FT   CDS_pept        669270..670280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxK"
FT                   /locus_tag="MCA0633"
FT                   /product="tetraacyldisaccharide 4'-kinase"
FT                   /EC_number="2.7.1.130"
FT                   /note="identified by similarity to SP:P27300; match to
FT                   protein family HMM PF02606; match to protein family HMM
FT                   TIGR00682"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0633"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93071"
FT                   /db_xref="GOA:Q60B49"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60B49"
FT                   /protein_id="AAU93071.1"
FT                   /translation="MSRSNGVIDAWLQRQWYAEAQPPWGLRALSRGFGAAVALRRGYYR
FT                   RNAKVSLGVPVIVVGNLSVGGTGKTPLVIALVELLRQHGWSPGVVSRGYRGSARAPLEV
FT                   FCGSDPAEVGDEPLLIRQRTGGPVFVSPRRVEAARAVLAAGADVVVSDDGLQHYALPRD
FT                   VEIAVVDGVRRYGNGRLLPAGPLREPVERLASVDFVVCNGGEPGPGESVMTLEGRTAVR
FT                   LADGERRPLAAFAGQRIVAMAGIGHPARFFSHLAALGLNFEPVAWPDHHAYSPDDFRSV
FT                   PEDTPVLITEKDAVKCRRLDDPRIWYIPVSARLDPAFAPRLLNILERFRHGQTTA"
FT   gene            670261..670473
FT                   /locus_tag="MCA0634"
FT   CDS_pept        670261..670473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0634"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:VC1876; match to
FT                   protein family HMM PF03966"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0634"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93070"
FT                   /db_xref="GOA:Q60B48"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60B48"
FT                   /protein_id="AAU93070.1"
FT                   /translation="MDKRLLEILVCPVCKGGLIYLREQQELVCLADKLAYPIRDDIPVM
FT                   LDSEARRLSLEEYDALRQRRAAPVA"
FT   gene            670473..671246
FT                   /gene="kdsB"
FT                   /locus_tag="MCA0635"
FT   CDS_pept        670473..671246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdsB"
FT                   /locus_tag="MCA0635"
FT                   /product="3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.38"
FT                   /note="identified by similarity to SP:P04951; match to
FT                   protein family HMM PF02348; match to protein family HMM
FT                   TIGR00466"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0635"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93069"
FT                   /db_xref="GOA:Q60B47"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60B47"
FT                   /protein_id="AAU93069.1"
FT                   /translation="MPADFTIVIPARYGSTRLPGKPLLELGGKPMIAHVCERALEAGAA
FT                   EVVVATDDARIAEAVDGLPVTAMLTRTEHASGTERLAEVAERRAWSDDTLVVNLQGDEP
FT                   FMDAALLRALAEALGRREDCRVATLAAPIHRPEEIFDPNVVKVVTDGENRALYFSRAAV
FT                   PWDRESFAEGAGVPMPGMPYRRHIGVYAYTASYLRRYVDLEPSPLEHVERLEQLRILWH
FT                   GDRILVVPVEGAPAPGVDTAADLERARRHLSGRTP"
FT   gene            671252..671680
FT                   /locus_tag="MCA0636"
FT   CDS_pept        671252..671680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0636"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:P76631"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0636"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93068"
FT                   /db_xref="GOA:Q60B46"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B46"
FT                   /protein_id="AAU93068.1"
FT                   /translation="MDASAGLWGLFASAFVSATLAPGGSEAVLAYLVHTGYALPAELVA
FT                   VASVGNTLGAMTTWGMGWLWARRRPLEVEAIENPRQRRAVASLKRWGAGMLLVSWIPVL
FT                   GDGFCFAAGWLRLSLVLSVAYIAIGKAMRYAVVAWLAG"
FT   gene            complement(671682..672560)
FT                   /locus_tag="MCA0637"
FT   CDS_pept        complement(671682..672560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0637"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to OMNI:NTL01SM02683"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0637"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93067"
FT                   /db_xref="GOA:Q60B45"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B45"
FT                   /protein_id="AAU93067.1"
FT                   /translation="MCAAGNCRAEVTIMTSKAVLSLLPVIALLLTACAGPAQQGRKQNL
FT                   AGAAPERTSLPKPAFRRPGYLPPFFGGSDQRTVSDVLRDFGPYSVQKLKPYFERAGVAF
FT                   PPREVVLVGLKQEKKLELWARDGSDYRLIRHYDIQAASGSAGPKLRQGDKQVPEGVYRI
FT                   VGLNPNSNYHLSMKLNYPNDFDLYHAQLEGRTQPGSDIFIHGRAVSAGCLAMGDEAIEE
FT                   LFVLTAQVGKENVKVVIAPHDPRTWPLEQTAAGQPEWTRELYATIADEILSLSRPLRVS
FT                   SSRPYSPPYQR"
FT   gene            672721..673398
FT                   /locus_tag="MCA0638"
FT   CDS_pept        672721..673398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0638"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01XF00566; match
FT                   to protein family HMM PF04366"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0638"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93058"
FT                   /db_xref="GOA:Q60B44"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B44"
FT                   /protein_id="AAU93058.1"
FT                   /translation="MLNCIALLAVLLVTPLAWADDRDKANDLLRDATITFNEFVADPNM
FT                   GWFRDNVKDARAVVIAPQVLKLGFIFGGSGGNAVVLAKDKQTGEWGYPAFYTAGAVTAG
FT                   LQIGGELTDVIMMVMTESGMNALLSSKFQLGADASIAAGPVGTGSQVATVDILQFSRAK
FT                   GIYGGLTLEGAVITPREDLNAAFYGRIVDPVDILIRHTVTNPLADRLRAAVAKATLSRP
FT                   VLH"
FT   gene            673420..674538
FT                   /locus_tag="MCA0639"
FT   CDS_pept        673420..674538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0639"
FT                   /product="NADH-dependent flavin oxidoreductase, Oye family"
FT                   /note="identified by match to protein family HMM PF00724"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0639"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93057"
FT                   /db_xref="GOA:Q60B43"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B43"
FT                   /protein_id="AAU93057.1"
FT                   /translation="MTNPLFQPFRLGPHTLKNRMVMAPLTRSRAGQPGNVPTALNAEYY
FT                   RQRASAGLIISEATQVSPQGQGYAWTPGIHSAEQVAGWRLVADAVHGAGGLMFMQLWHV
FT                   GRVSHPALQPGGALPVAPSAIAPTGMAFIVNAEGQGELVPFVTPRVLELDEIPGIVGQY
FT                   RDGARNAMAAGMDGVEVHAANGYLLDQFLNSSSNHRRDAYGGSPENRARLLMEVLEAVC
FT                   GVWGADRVGVRLSPLGTFNDMGDADPEATFGYVAERLNDFGLAYLHVVEPFMAGNAPAA
FT                   TPDPRGEAIMAMIRMSFRGPLIVCGGYDQAKAVACLESGRADLVAFGRLFIANPDLPER
FT                   FRRGAALNGWNEATFYGGGAEGYTDYPSLTDA"
FT   gene            complement(674681..674788)
FT                   /locus_tag="MCA0640"
FT   CDS_pept        complement(674681..674788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0640"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01HP01126"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0640"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93056"
FT                   /db_xref="GOA:Q60B42"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B42"
FT                   /protein_id="AAU93056.1"
FT                   /translation="MVPGVGIEPTQCFHYQILSLARLPVSPSRQSGCQV"
FT   gene            674701..674787
FT                   /locus_tag="MCA_tRNA-Leu-2"
FT   tRNA            674701..674787
FT                   /locus_tag="MCA_tRNA-Leu-2"
FT                   /product="tRNA-Leu"
FT   gene            674950..675120
FT                   /locus_tag="MCA0641"
FT   CDS_pept        674950..675120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0641"
FT                   /product="site-specific recombinase, phage integrase family
FT                   domain protein"
FT                   /note="identified by similarity to OMNI:NTL02YP0740"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0641"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93055"
FT                   /db_xref="GOA:Q60B41"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B41"
FT                   /protein_id="AAU93055.1"
FT                   /translation="MALTDAAVRNAKRSGGKACELSDEKGLYLIVTVKGGKWWRLDYRH
FT                   DGKRKTLSLGT"
FT   gene            676483..676791
FT                   /locus_tag="MCA0644"
FT   CDS_pept        676483..676791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0644"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0644"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93054"
FT                   /db_xref="GOA:Q60B40"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B40"
FT                   /protein_id="AAU93054.1"
FT                   /translation="MNENTASMAEILADLLKLSSDAMANVSEREQLSIAVESLVMSTEH
FT                   ARRARDQIAIALLELEEYRRQNRRLVETCRKWEAIANDLLARLVMVTRPPEHSRRMH"
FT   gene            676937..677161
FT                   /locus_tag="MCA0645"
FT   CDS_pept        676937..677161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0645"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0645"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93053"
FT                   /db_xref="GOA:Q60B39"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B39"
FT                   /protein_id="AAU93053.1"
FT                   /translation="MNAEQFLLALGLVEEGGVWRRKTDGGMVGENTEAALIAMKGDILR
FT                   MAFEPGIDEPLSMKQAMEALRLLSALEKR"
FT   gene            complement(677255..677404)
FT                   /locus_tag="MCA0646"
FT   CDS_pept        complement(677255..677404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0646"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0646"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93052"
FT                   /db_xref="GOA:Q60B38"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B38"
FT                   /protein_id="AAU93052.1"
FT                   /translation="MFNYAVIVTAALAGIVLVDDDPTSVSLEEWVLFAVMIYAASSFMR
FT                   LYRR"
FT   gene            677584..678327
FT                   /locus_tag="MCA0647"
FT   CDS_pept        677584..678327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0647"
FT                   /product="ion transport family protein"
FT                   /note="identified by match to protein family HMM PF07885"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0647"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93051"
FT                   /db_xref="GOA:Q60B37"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B37"
FT                   /protein_id="AAU93051.1"
FT                   /translation="MPANLRSTLSRHVRLPPLHAGRRLKLKRNNFGFLLTGLVTTLITG
FT                   PLLREFSVLAKDQEFLVWLMESVFSLMVLIGVWSLQENRRVFRLGLLLGMLSLLFPVLA
FT                   WDSRSVLLGVLEVLVFLLFCVLSCYLAAQHVFRGKEADINRLSGSVCVFLLIGFIWGFL
FT                   YILLTMLRPGAFQGLDAGESMHVRADELLYFSFATLTTLGYGDITPVTPLARTLSILEV
FT                   VCGQFYLTILVASLVGNFLAGRMQR"
FT   gene            complement(678324..678692)
FT                   /locus_tag="MCA0648"
FT   CDS_pept        complement(678324..678692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0648"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0648"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93043"
FT                   /db_xref="GOA:Q60B36"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B36"
FT                   /protein_id="AAU93043.1"
FT                   /translation="MMHLQAVDDSVHSKRTSPWLLVAETIDRPRARTAVPSPRCMTAPA
FT                   ALARPPIDGQASSSDCSTWTGFCSPAGVIGRRRGYSPSMRMGMMLAWGFIGIFAGSTLL
FT                   AVSHTLLKVWPDTGPEPG"
FT   gene            678684..678902
FT                   /locus_tag="MCA0649"
FT   CDS_pept        678684..678902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0649"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0649"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93042"
FT                   /db_xref="GOA:Q60B35"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B35"
FT                   /protein_id="AAU93042.1"
FT                   /translation="MHHAKRATAGLAEHREQIEVFHIPRNRPGSIPMDARAGTSKPNRD
FT                   HLTPPPALVRKSADAAIPCGPSSRKRE"
FT   gene            complement(684633..684923)
FT                   /locus_tag="MCA0650"
FT   CDS_pept        complement(684633..684923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0650"
FT                   /product="CRISPR-associated protein Cas2"
FT                   /note="identified by similarity to GP:18893192; match to
FT                   protein family HMM PF02647; match to protein family HMM
FT                   TIGR01573"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0650"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93041"
FT                   /db_xref="GOA:Q60B34"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B34"
FT                   /protein_id="AAU93041.1"
FT                   /translation="MLILVSYDVSTETAAGRRRLRHVAKVCLNYGQRVQKSVFECKVNL
FT                   AQMETLKAELLDEIDEKEDSLRIYRITEPLEKNLMEFGKFKAVDFEDTLIV"
FT   gene            complement(685018..686052)
FT                   /locus_tag="MCA0651"
FT   CDS_pept        complement(685018..686052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCA0651"
FT                   /product="CRISPR-associated protein Cas1"
FT                   /note="identified by match to protein family HMM PF01867;
FT                   match to protein family HMM TIGR00287"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0651"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93040"
FT                   /db_xref="GOA:Q60B33"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019856"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B33"
FT                   /protein_id="AAU93040.1"
FT                   /translation="MTVLQNTLYVTTPEAYLRLEGETVCVMIEEQKRLQVPLHHLSAFV
FT                   LFDHVMLSPALLGRCAEDGRSVVWLDRAGRFRARLEGPVNGNILLRQAQFRAAEDGAQT
FT                   LGLARAVLAGKLRNSRQLLMRGARETDDVVERDALVRAAKLIANQVRKLPLAQDLDTLR
FT                   GLEGDVARLYFEALPKVMRAKARAEFPFDCRNRRPPRDRFNALLSFLYALVLSDCRAAL
FT                   ETVGLDPQLGFLHAVRPGRPALALDLLEEFRAPLADRLALTLVNRGQLQASDFDEREGG
FT                   AVLLNDKGRKTVIAAYQTRKQEAITHPLLKQTLPIGLLPHWQARLLARYLRQDVAHYVP
FT                   YLHR"
FT   gene            complement(686049..686681)
FT                   /gene="cas4"
FT                   /locus_tag="MCA0652"
FT   CDS_pept        complement(686049..686681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas4"
FT                   /locus_tag="MCA0652"
FT                   /product="CRISPR-associated protein Cas4"
FT                   /note="identified by similarity to OMNI:NTL01SPL1235; match
FT                   to protein family HMM TIGR00372"
FT                   /db_xref="EnsemblGenomes-Gn:MCA0652"
FT                   /db_xref="EnsemblGenomes-Tr:AAU93039"
FT                   /db_xref="GOA:Q60B32"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:Q60B32"
FT