(data stored in ACNUC30630 zone)

EMBL: AE017283

ID   AE017283; SV 1; circular; genomic DNA; STD; PRO; 2560265 BP.
XX
AC   AE017283;
XX
PR   Project:PRJNA12460;
XX
DT   01-AUG-2004 (Rel. 80, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
XX
DE   Propionibacterium acnes KPA171202, complete genome.
XX
KW   .
XX
OS   Cutibacterium acnes KPA171202
OC   Bacteria; Actinobacteria; Propionibacteriales; Propionibacteriaceae;
OC   Cutibacterium.
XX
RN   [1]
RP   1-2560265
RX   DOI; 10.1126/science.1100330.
RX   PUBMED; 15286373.
RA   Bruggemann H., Henne A., Hoster F., Liesegang H., Wiezer A.,
RA   Strittmatter A., Hujer S., Durre P., Gottschalk G.;
RT   "The complete genome sequence of Propionibacterium acnes, a commensal of
RT   human skin";
RL   Science, e1252229 305(5684):671-673(2004).
XX
RN   [2]
RP   1-2560265
RA   Bruggemann H., Henne A., Hoster F., Liesegang H., Hujer S., Durre P.,
RA   Gottschalk G.;
RT   ;
RL   Submitted (18-MAR-2004) to the INSDC.
RL   Institute of Microbiology and Genetics, Georg-August-University Goettingen,
RL   Goettingen Genomics Laboratory, Grisebachstrasse 8, Goettingen D-37077,
RL   Germany
XX
DR   MD5; 07edd71b6e815c6ca8d7a2429f640ecf.
DR   BioSample; SAMN02603281.
DR   EnsemblGenomes-Gn; EBG00001180105.
DR   EnsemblGenomes-Gn; EBG00001180106.
DR   EnsemblGenomes-Gn; EBG00001180107.
DR   EnsemblGenomes-Gn; EBG00001180108.
DR   EnsemblGenomes-Gn; EBG00001180109.
DR   EnsemblGenomes-Gn; EBG00001180110.
DR   EnsemblGenomes-Gn; EBG00001180111.
DR   EnsemblGenomes-Gn; EBG00001180112.
DR   EnsemblGenomes-Gn; EBG00001180113.
DR   EnsemblGenomes-Gn; EBG00001180114.
DR   EnsemblGenomes-Gn; EBG00001180115.
DR   EnsemblGenomes-Gn; EBG00001180116.
DR   EnsemblGenomes-Gn; EBG00001180117.
DR   EnsemblGenomes-Gn; EBG00001180118.
DR   EnsemblGenomes-Gn; EBG00001180120.
DR   EnsemblGenomes-Gn; EBG00001180121.
DR   EnsemblGenomes-Gn; EBG00001180122.
DR   EnsemblGenomes-Gn; EBG00001180123.
DR   EnsemblGenomes-Gn; EBG00001180124.
DR   EnsemblGenomes-Gn; EBG00001180125.
DR   EnsemblGenomes-Gn; EBG00001180126.
DR   EnsemblGenomes-Gn; EBG00001180127.
DR   EnsemblGenomes-Gn; EBG00001180128.
DR   EnsemblGenomes-Gn; EBG00001180129.
DR   EnsemblGenomes-Gn; EBG00001180130.
DR   EnsemblGenomes-Gn; EBG00001180131.
DR   EnsemblGenomes-Gn; EBG00001180132.
DR   EnsemblGenomes-Gn; EBG00001180133.
DR   EnsemblGenomes-Gn; EBG00001180134.
DR   EnsemblGenomes-Gn; EBG00001180135.
DR   EnsemblGenomes-Gn; EBG00001180137.
DR   EnsemblGenomes-Gn; EBG00001180138.
DR   EnsemblGenomes-Gn; EBG00001180139.
DR   EnsemblGenomes-Gn; EBG00001180140.
DR   EnsemblGenomes-Gn; EBG00001180141.
DR   EnsemblGenomes-Gn; EBG00001180142.
DR   EnsemblGenomes-Gn; EBG00001180143.
DR   EnsemblGenomes-Gn; EBG00001180144.
DR   EnsemblGenomes-Gn; EBG00001180145.
DR   EnsemblGenomes-Gn; EBG00001180146.
DR   EnsemblGenomes-Gn; EBG00001180147.
DR   EnsemblGenomes-Gn; EBG00001180148.
DR   EnsemblGenomes-Gn; EBG00001180149.
DR   EnsemblGenomes-Gn; EBG00001180150.
DR   EnsemblGenomes-Gn; EBG00001180151.
DR   EnsemblGenomes-Gn; EBG00001180152.
DR   EnsemblGenomes-Gn; EBG00001180153.
DR   EnsemblGenomes-Gn; EBG00001180154.
DR   EnsemblGenomes-Gn; EBG00001180155.
DR   EnsemblGenomes-Gn; EBG00001180156.
DR   EnsemblGenomes-Gn; EBG00001180157.
DR   EnsemblGenomes-Gn; EBG00001180158.
DR   EnsemblGenomes-Gn; EBG00001180159.
DR   EnsemblGenomes-Gn; EBG00001180160.
DR   EnsemblGenomes-Gn; EBG00001180161.
DR   EnsemblGenomes-Gn; EBG00001180162.
DR   EnsemblGenomes-Gn; EBG00001180163.
DR   EnsemblGenomes-Gn; EBG00001180164.
DR   EnsemblGenomes-Gn; EBG00001180165.
DR   EnsemblGenomes-Gn; EBG00001180166.
DR   EnsemblGenomes-Gn; EBG00001180167.
DR   EnsemblGenomes-Gn; EBG00001180168.
DR   EnsemblGenomes-Gn; EBG00001180169.
DR   EnsemblGenomes-Gn; EBG00001180170.
DR   EnsemblGenomes-Gn; EBG00001180171.
DR   EnsemblGenomes-Gn; EBG00001180173.
DR   EnsemblGenomes-Gn; EBG00001180174.
DR   EnsemblGenomes-Gn; EBG00001180175.
DR   EnsemblGenomes-Gn; EBG00001180176.
DR   EnsemblGenomes-Gn; EBG00001180177.
DR   EnsemblGenomes-Gn; PPA2408.
DR   EnsemblGenomes-Gn; PPA2409.
DR   EnsemblGenomes-Gn; PPA2410.
DR   EnsemblGenomes-Gn; PPA2411.
DR   EnsemblGenomes-Gn; PPA2412.
DR   EnsemblGenomes-Gn; PPA2413.
DR   EnsemblGenomes-Gn; PPA2414.
DR   EnsemblGenomes-Gn; PPA2415.
DR   EnsemblGenomes-Gn; PPA2416.
DR   EnsemblGenomes-Gn; PPA2417.
DR   EnsemblGenomes-Gn; PPA2418.
DR   EnsemblGenomes-Gn; PPA2419.
DR   EnsemblGenomes-Gn; PPA2420.
DR   EnsemblGenomes-Gn; PPA2421.
DR   EnsemblGenomes-Gn; PPA2422.
DR   EnsemblGenomes-Gn; PPA2423.
DR   EnsemblGenomes-Gn; PPA2424.
DR   EnsemblGenomes-Gn; PPA2425.
DR   EnsemblGenomes-Gn; PPA2426.
DR   EnsemblGenomes-Gn; PPA2427.
DR   EnsemblGenomes-Gn; PPA2428.
DR   EnsemblGenomes-Gn; PPA2429.
DR   EnsemblGenomes-Gn; PPA2430.
DR   EnsemblGenomes-Gn; PPA2431.
DR   EnsemblGenomes-Gn; PPA2432.
DR   EnsemblGenomes-Gn; PPA2433.
DR   EnsemblGenomes-Gn; PPA2434.
DR   EnsemblGenomes-Gn; PPA2435.
DR   EnsemblGenomes-Gn; PPA2436.
DR   EnsemblGenomes-Gn; PPA2437.
DR   EnsemblGenomes-Gn; PPA2438.
DR   EnsemblGenomes-Gn; PPA2439.
DR   EnsemblGenomes-Gn; PPA2440.
DR   EnsemblGenomes-Gn; PPA2441.
DR   EnsemblGenomes-Gn; PPA2442.
DR   EnsemblGenomes-Gn; PPA2443.
DR   EnsemblGenomes-Gn; PPA2444.
DR   EnsemblGenomes-Gn; PPA2445.
DR   EnsemblGenomes-Gn; PPA2446.
DR   EnsemblGenomes-Gn; PPA2447.
DR   EnsemblGenomes-Gn; PPA2448.
DR   EnsemblGenomes-Gn; PPA2449.
DR   EnsemblGenomes-Gn; PPA2450.
DR   EnsemblGenomes-Gn; PPA2451.
DR   EnsemblGenomes-Gn; PPA2452.
DR   EnsemblGenomes-Gn; PPA2453.
DR   EnsemblGenomes-Gn; PPA2454.
DR   EnsemblGenomes-Gn; PPA2455.
DR   EnsemblGenomes-Gn; PPA2456.
DR   EnsemblGenomes-Gn; PPA2457.
DR   EnsemblGenomes-Gn; PPA2458.
DR   EnsemblGenomes-Gn; PPA2459.
DR   EnsemblGenomes-Gn; PPA2460.
DR   EnsemblGenomes-Gn; PPA2461.
DR   EnsemblGenomes-Tr; EBT00001758603.
DR   EnsemblGenomes-Tr; EBT00001758604.
DR   EnsemblGenomes-Tr; EBT00001758605.
DR   EnsemblGenomes-Tr; EBT00001758606.
DR   EnsemblGenomes-Tr; EBT00001758607.
DR   EnsemblGenomes-Tr; EBT00001758608.
DR   EnsemblGenomes-Tr; EBT00001758609.
DR   EnsemblGenomes-Tr; EBT00001758610.
DR   EnsemblGenomes-Tr; EBT00001758611.
DR   EnsemblGenomes-Tr; EBT00001758612.
DR   EnsemblGenomes-Tr; EBT00001758613.
DR   EnsemblGenomes-Tr; EBT00001758614.
DR   EnsemblGenomes-Tr; EBT00001758615.
DR   EnsemblGenomes-Tr; EBT00001758616.
DR   EnsemblGenomes-Tr; EBT00001758618.
DR   EnsemblGenomes-Tr; EBT00001758619.
DR   EnsemblGenomes-Tr; EBT00001758620.
DR   EnsemblGenomes-Tr; EBT00001758621.
DR   EnsemblGenomes-Tr; EBT00001758622.
DR   EnsemblGenomes-Tr; EBT00001758623.
DR   EnsemblGenomes-Tr; EBT00001758624.
DR   EnsemblGenomes-Tr; EBT00001758625.
DR   EnsemblGenomes-Tr; EBT00001758626.
DR   EnsemblGenomes-Tr; EBT00001758627.
DR   EnsemblGenomes-Tr; EBT00001758628.
DR   EnsemblGenomes-Tr; EBT00001758629.
DR   EnsemblGenomes-Tr; EBT00001758630.
DR   EnsemblGenomes-Tr; EBT00001758631.
DR   EnsemblGenomes-Tr; EBT00001758632.
DR   EnsemblGenomes-Tr; EBT00001758633.
DR   EnsemblGenomes-Tr; EBT00001758634.
DR   EnsemblGenomes-Tr; EBT00001758635.
DR   EnsemblGenomes-Tr; EBT00001758636.
DR   EnsemblGenomes-Tr; EBT00001758637.
DR   EnsemblGenomes-Tr; EBT00001758638.
DR   EnsemblGenomes-Tr; EBT00001758639.
DR   EnsemblGenomes-Tr; EBT00001758640.
DR   EnsemblGenomes-Tr; EBT00001758641.
DR   EnsemblGenomes-Tr; EBT00001758642.
DR   EnsemblGenomes-Tr; EBT00001758643.
DR   EnsemblGenomes-Tr; EBT00001758644.
DR   EnsemblGenomes-Tr; EBT00001758645.
DR   EnsemblGenomes-Tr; EBT00001758646.
DR   EnsemblGenomes-Tr; EBT00001758647.
DR   EnsemblGenomes-Tr; EBT00001758648.
DR   EnsemblGenomes-Tr; EBT00001758649.
DR   EnsemblGenomes-Tr; EBT00001758650.
DR   EnsemblGenomes-Tr; EBT00001758651.
DR   EnsemblGenomes-Tr; EBT00001758652.
DR   EnsemblGenomes-Tr; EBT00001758653.
DR   EnsemblGenomes-Tr; EBT00001758654.
DR   EnsemblGenomes-Tr; EBT00001758655.
DR   EnsemblGenomes-Tr; EBT00001758656.
DR   EnsemblGenomes-Tr; EBT00001758657.
DR   EnsemblGenomes-Tr; EBT00001758658.
DR   EnsemblGenomes-Tr; EBT00001758659.
DR   EnsemblGenomes-Tr; EBT00001758660.
DR   EnsemblGenomes-Tr; EBT00001758661.
DR   EnsemblGenomes-Tr; EBT00001758662.
DR   EnsemblGenomes-Tr; EBT00001758663.
DR   EnsemblGenomes-Tr; EBT00001758664.
DR   EnsemblGenomes-Tr; EBT00001758665.
DR   EnsemblGenomes-Tr; EBT00001758666.
DR   EnsemblGenomes-Tr; EBT00001758667.
DR   EnsemblGenomes-Tr; EBT00001758669.
DR   EnsemblGenomes-Tr; EBT00001758670.
DR   EnsemblGenomes-Tr; EBT00001758671.
DR   EnsemblGenomes-Tr; EBT00001758672.
DR   EnsemblGenomes-Tr; EBT00001758673.
DR   EnsemblGenomes-Tr; EBT00001758674.
DR   EnsemblGenomes-Tr; PPA2408-1.
DR   EnsemblGenomes-Tr; PPA2409-1.
DR   EnsemblGenomes-Tr; PPA2410-1.
DR   EnsemblGenomes-Tr; PPA2411-1.
DR   EnsemblGenomes-Tr; PPA2412-1.
DR   EnsemblGenomes-Tr; PPA2413-1.
DR   EnsemblGenomes-Tr; PPA2414-1.
DR   EnsemblGenomes-Tr; PPA2415-1.
DR   EnsemblGenomes-Tr; PPA2416-1.
DR   EnsemblGenomes-Tr; PPA2417-1.
DR   EnsemblGenomes-Tr; PPA2418-1.
DR   EnsemblGenomes-Tr; PPA2419-1.
DR   EnsemblGenomes-Tr; PPA2420-1.
DR   EnsemblGenomes-Tr; PPA2421-1.
DR   EnsemblGenomes-Tr; PPA2422-1.
DR   EnsemblGenomes-Tr; PPA2423-1.
DR   EnsemblGenomes-Tr; PPA2424-1.
DR   EnsemblGenomes-Tr; PPA2425-1.
DR   EnsemblGenomes-Tr; PPA2426-1.
DR   EnsemblGenomes-Tr; PPA2427-1.
DR   EnsemblGenomes-Tr; PPA2428-1.
DR   EnsemblGenomes-Tr; PPA2429-1.
DR   EnsemblGenomes-Tr; PPA2430-1.
DR   EnsemblGenomes-Tr; PPA2431-1.
DR   EnsemblGenomes-Tr; PPA2432-1.
DR   EnsemblGenomes-Tr; PPA2433-1.
DR   EnsemblGenomes-Tr; PPA2434-1.
DR   EnsemblGenomes-Tr; PPA2435-1.
DR   EnsemblGenomes-Tr; PPA2436-1.
DR   EnsemblGenomes-Tr; PPA2437-1.
DR   EnsemblGenomes-Tr; PPA2438-1.
DR   EnsemblGenomes-Tr; PPA2439-1.
DR   EnsemblGenomes-Tr; PPA2440-1.
DR   EnsemblGenomes-Tr; PPA2441-1.
DR   EnsemblGenomes-Tr; PPA2442-1.
DR   EnsemblGenomes-Tr; PPA2443-1.
DR   EnsemblGenomes-Tr; PPA2444-1.
DR   EnsemblGenomes-Tr; PPA2445-1.
DR   EnsemblGenomes-Tr; PPA2446-1.
DR   EnsemblGenomes-Tr; PPA2447-1.
DR   EnsemblGenomes-Tr; PPA2448-1.
DR   EnsemblGenomes-Tr; PPA2449-1.
DR   EnsemblGenomes-Tr; PPA2450-1.
DR   EnsemblGenomes-Tr; PPA2451-1.
DR   EnsemblGenomes-Tr; PPA2452-1.
DR   EnsemblGenomes-Tr; PPA2453-1.
DR   EnsemblGenomes-Tr; PPA2454-1.
DR   EnsemblGenomes-Tr; PPA2455-1.
DR   EnsemblGenomes-Tr; PPA2456-1.
DR   EnsemblGenomes-Tr; PPA2457-1.
DR   EnsemblGenomes-Tr; PPA2458-1.
DR   EnsemblGenomes-Tr; PPA2459-1.
DR   EnsemblGenomes-Tr; PPA2460-1.
DR   EnsemblGenomes-Tr; PPA2461-1.
DR   EuropePMC; PMC1266029; 16159395.
DR   EuropePMC; PMC1590026; 16901339.
DR   EuropePMC; PMC3060682; 21193578.
DR   EuropePMC; PMC3069002; 21483493.
DR   EuropePMC; PMC3473371; 22923697.
DR   EuropePMC; PMC3577713; 23437379.
DR   EuropePMC; PMC3663185; 23631911.
DR   EuropePMC; PMC3848588; 24034785.
DR   EuropePMC; PMC3848858; 24053623.
DR   EuropePMC; PMC4916054; 27358740.
DR   EuropePMC; PMC5531050; 28553940.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; AE017283.
DR   SILVA-SSU; AE017283.
DR   StrainInfo; 681597; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2560265
FT                   /organism="Cutibacterium acnes KPA171202"
FT                   /strain="KPA171202"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:267747"
FT   gene            245..1747
FT                   /locus_tag="PPA0001"
FT   CDS_pept        245..1747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81766"
FT                   /db_xref="GOA:Q6ABL5"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6ABL5"
FT                   /protein_id="AAT81766.1"
FT                   /translation="MSDTPFGDADHPRPAPIHPDAVLPPPMSSQSADNDPTEALNEAWT
FT                   NILTKVSKPNRAWLSNTTPVTMHSSTAMVAVPNEFARDRLESKMRYELEELLSDHFHKA
FT                   IHLAITIDPDLELALGAPDHEDEEEEVPPAQFVPKVTVGVTEPSARPTTTIDDDEGNRL
FT                   NPKYTFDSFVIGASNRFAHAAAVAVAEAPGKSYNPLLIYGGSGLGKTHLLHAIGRYVMS
FT                   YYDNVKVKYVSTEELTNDFINAIGTNRTTEFRRSYRDVDVLLVDDIQFLQSKIQTQEEF
FT                   FHTFNTLHNAQKQIVMTSDRPPKLLEALEPRLRSRFEWGLLTDIQPPDLETRIAILRRK
FT                   VAAEKITVEPDVLEFIASRIQTNIRELEGALIRVTAFASLNQQPVDISLAEVVLKDLIP
FT                   EGRETPVTPERIIAETADYFDISADDLLGTSRAQTLVTARQIAMYLCRELTDLSLPKIG
FT                   AEFGGKDHTTVMHADRKIRALMGEQRQIFNQVSEITNRIKQY"
FT   gene            1868..3379
FT                   /locus_tag="PPA0002"
FT   CDS_pept        1868..3379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0002"
FT                   /product="DNA polymerase III, beta chain"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81767"
FT                   /db_xref="GOA:Q6ABL4"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABL4"
FT                   /protein_id="AAT81767.1"
FT                   /translation="MGQLPISTATPPARTSSPRRRPLPQNVADKGVWQLSTSSTGVTST
FT                   KKRHTSPSLTSLWVWIWGQGLAAAHRSNTGRRSTTKRTLDVDITMGVPTVGKHGYDQHA
FT                   GTMECETPNQGDAVEIRLERDVMAEAVAWAARSLPNRPTVPILAGLLVRAEGDSVVMSA
FT                   SDNETSAQITLSAQVDEPGESLVSGKLLADIARSLPNKPVQITTDPAKMDLVCGSARFT
FT                   LQALPVDEYPDLPQMPAATGTVDASVFSRAVAQVVVAAGRDELLPVFTGVRVEINGETL
FT                   SLLATDRYRMALKEITWNPSATDAEATALVPAKVINETARSMTSGEHVTMNLSSGDSGE
FT                   GLVGFEGDGANGVRRMTTRLLSGEFPKVRHLMDIKATRSVRARTDELINSVRRVSLVAE
FT                   RNTPLRMVINDDSVALSAATGDQAQASEAIEAVVTNHVDGEPTITAAGFNPHYLSDALG
FT                   ALDTPYVHFSFTAPGKPCLVTGLNDFDGKPETDYRHVIMLMRLPS"
FT   gene            3666..4169
FT                   /locus_tag="PPA0003"
FT   CDS_pept        3666..4169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81768"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABL3"
FT                   /protein_id="AAT81768.1"
FT                   /translation="MLRLQAWQTVLAKLCDVDVDTMAKGRGRLQQRWSSPHSDTLPLYV
FT                   SVVTFDQVPFVGLSATSDADPFDIIPDCACDACDHGSEDLLRVLDADLAAVVDGSLVVV
FT                   TGPVVNGEPTFHLVGTGQGCASTWGGDEVGPLAEPEAVIDAIRSGDDPLLPPGCTVLHG
FT                   RPWL"
FT   gene            4227..5411
FT                   /locus_tag="PPA0004"
FT   CDS_pept        4227..5411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81769"
FT                   /db_xref="GOA:Q6ABL2"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6ABL2"
FT                   /protein_id="AAT81769.1"
FT                   /translation="MFVEHLELVDFRSYVRADVPMAAGATTFIGSNGQGKTNLVEAVEY
FT                   LSTLSSHRVSNDTPLVRLGADQAVVRGRVRAGTDDARSLLLEVEINARRANRARINRAP
FT                   LTRPRDILGVLRTVVFSPNDLAVVRGDPSDRRAFLDGLVVTRWPRMAAVKSDYERVLKQ
FT                   RNALLKSLSGKGRSAGAEIGATMDIWDNELATIGAELLSARLDTLSAVMPLTSAAYREI
FT                   APVNDLTTASYKSTIDLEGLWSPPQERESSTPIDRKELANRFLDTLAKRRADELIRGVT
FT                   LVGPQRDDIILHIGEMPAKGYASHGESWSLALALRLGSFQLLRDDGIEPVLVLDDVFAE
FT                   LDATRRDRLASSVVQADQVLVTAAVASDVPEILRGERFDVGGGQVLAYEGNNDD"
FT   gene            5389..5997
FT                   /locus_tag="PPA0005"
FT   CDS_pept        5389..5997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0005"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81770"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABL1"
FT                   /protein_id="AAT81770.1"
FT                   /translation="MRGITMTDGLDEGPTEEDRRLAADHDDEGVDVALAIARAARGEPA
FT                   GTPRHDDDGEVLLPPPRRSAARKRRRRPSTPSWSGPKADGRDPMALGDAFTHLVQSKGW
FT                   GRQVNLHLVLSRWPELVGPTNAEHSRPVKYQGTVLTVRTEATVWATSLRTIAPQLVAEL
FT                   NRRLGEGTVTRVVIEGPSAPSWKHGPRSVPGRGPRDTYG"
FT   gene            complement(6061..7621)
FT                   /pseudo
FT                   /locus_tag="PPA0006"
FT                   /note="ABC-transporter; frameshift"
FT   gene            8304..9491
FT                   /locus_tag="PPA0008"
FT   CDS_pept        8304..9491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0008"
FT                   /product="mannose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81771"
FT                   /db_xref="GOA:Q6ABL0"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016305"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABL0"
FT                   /protein_id="AAT81771.1"
FT                   /translation="MRALTGQVQHYDWGSADAIPAILGTRPDGTPWAEYWLGAHPKAPS
FT                   ALPDGTPLDQWLTHHPDELGAGSREAFGDRLPFLLKILSANHALSIQAHPSREQAEKGF
FT                   AAENEAGVPLDAPNRIFRDDWPKPEMIVALTDFDALCGFRDPSSSLVLLSGLGEVDGLN
FT                   EVLTPLSQNDGLATLVAAVLSGDDDVTPVVKRVVSASRAYLNDGADEDVRSLATTAVEL
FT                   WEDHPGDPSILVALLMNRVRLAPGQQIHLCAGSMHAYLGGTGVEIMANSDNVLRGGLTS
FT                   KYIDVKALLDHANMTPEPCVGEYAQQISPGVGVYHTTFPEFRLWGLEGHNDVLDLPATE
FT                   LGRILLVTEGQLVAHCGTDDCELSRGQSVWLPAGDEVKVTGQGRGFLASAGVGDS"
FT   gene            9733..11805
FT                   /locus_tag="PPA0009"
FT   CDS_pept        9733..11805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0009"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81772"
FT                   /db_xref="GOA:Q6ABQ6"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABQ6"
FT                   /protein_id="AAT81772.1"
FT                   /translation="MSQPEMPESVTDGDTPEDLLIDATDHPDGLDSELPPTAVDGSYDA
FT                   GQITVLEGLEAVRKRPGMYIGSTGERGLHHCVYEIVDNSVDEAMAGYCDTIQVELLDDN
FT                   WCQVTDNGRGIPVKEHPVEHIPTVTLVLTKLHAGGKFGNGGYKVSGGLHGVGSSVVNAL
FT                   AAHFIVEVRRDGYHWRQSFSLGEPDGPLEQLEALGPDDYEGTTVRFQPSDEIFDAIVFD
FT                   YQTLSNRFREMAFLNKGLRIVLTDRRADHADEDGNPVHEDFLYKEGLKDYVRFLTGTRD
FT                   VINPTIISLESHRPEEGMGLEIAMQWNTSYATSVHTFANAINTIEGGAHEEGFRAALTN
FT                   TVNRWGETWGLIKKREDRVSGDDIREGLTAVVSIKLTEPQFEGQTKTKLGNAEAKSFVQ
FT                   KALNEKLSDWFEENPNEGKSIVRKSQAAAQARVAARKARDLARNRKGLLGSTSLPGKLK
FT                   DCSSTSPEECEIFIVEGDSAGGSASQGRDPRIQAILPLRGKILNVEKARLDRALGSETI
FT                   ESIINALGTGVHEDFDLDKLRYHKIILMADADVDGAHIRTLLLTLLFRFMRPVIDAGHV
FT                   YLAQPPLFRLRWTNSPHELAYSDEERDLLREDGLTHGKKLPQVNPIQRYKGLGEMDAED
FT                   LWDTTMDPDKRLLLQVTLEDAALADQMFSILMGEDVEQRRSFIQRNAKDVRFLDI"
FT   gene            11847..14522
FT                   /locus_tag="PPA0010"
FT   CDS_pept        11847..14522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0010"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81773"
FT                   /db_xref="GOA:Q6ABQ5"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABQ5"
FT                   /protein_id="AAT81773.1"
FT                   /translation="MADDEKPDEQNQADRQGLVTGRHVGIQPVEIRDEIQNAYLDYAMS
FT                   VIVGRALPDVRDGLKPVHRRVIYAMYDGGYRPDRGWNKCSRVVGDVMGKYHPHGDSAIY
FT                   DTLVRLAQPWAMRYKLVQGQGNFGSQGNDGAAAMRYTECKMAPLAMEMVRDIDQDTVDF
FT                   QPNYDNKETEPVVLPSRFPNLLVNGSSGIAVGMATNIPTHNLREVNEAVQWSLAHPNAS
FT                   HEELLEACMERIKGPDFPGGALIVGRQGIEDAYRTGRGSVTMRAVIDMEEDKKGRQCLV
FT                   VTELPYMCNPDNLATKIADLVNSGRINGIADIRDDSSARTGQRLVIVLKRDAQPRVVMN
FT                   NLYKHTALQDTFGCNMLALVDNVPRTLRLDQFISYWIDHQMEVIRRRTEYRLAQAEKDA
FT                   HIQRALVKALDMLDEVIALIRRSPNTEAASTGLQELLDIDEIQARAILDMQLRRLAALE
FT                   RQKIIDRLEELERLIADYKAILASEDRQREIISTELAEIVDKYGDERRTRIIAADGDFS
FT                   EEDFIPDDDVVVTITRGGYAKRTRTDLYRVQKRGGKGVRGASLRADDEMAQLFTTTNHQ
FT                   WILFFTNMGRVYRTKVWQLPEAGRDARGGHVAGLLSFLPDEKIAQVMTLRSYDGAEYLL
FT                   LATRKGMVKKTALKAYDSSRQAGVIAVNFRTEDDELIGAEQCSAADDVLLISRKGQAIR
FT                   FSAGDDQLRPMGRATSGVTGMKFRGDDELLSMSIIHSDMPEDDRFVFTATGGGYAKRTA
FT                   VSEYRQQGRGGVGIKAMALSEERGSLVGGLVVSEADEIIAIKTSGQITRSAVSEVPAKG
FT                   RSTMGVKFVSVRGGDAVSIIAVNPEHTVEEEVADESVETVEGDATQAQSGGVVRRSDTV
FT                   DDDRAVDTAGNDMKPEDNGE"
FT   gene            14515..15147
FT                   /locus_tag="PPA0011"
FT   CDS_pept        14515..15147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0011"
FT                   /product="hypothetical conserved protein"
FT                   /note="membrane spanning"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81774"
FT                   /db_xref="GOA:Q6ABQ4"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABQ4"
FT                   /protein_id="AAT81774.1"
FT                   /translation="MSDEKKVTHPGPDDPEAIHWTAGDARRTFHEKGEERPDPRQESDR
FT                   KRTTASTPLRRTDSRGAQGEKAPNQQEPHRSPQAHQPARAPRRTRKARLRLTRVDPWSV
FT                   MKTSLLFGVAGAVIFFIATWIIWGIIGASGAFDSMNKVVNDLISSPSSTSKFELSDYVN
FT                   TGRVLGLTALIGAINAVLFTAISTLFSFLYNLAAQIMGGLEVTLAED"
FT   gene            complement(15246..16214)
FT                   /locus_tag="PPA0012"
FT   CDS_pept        complement(15246..16214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0012"
FT                   /product="L-lactate dehydrogenase"
FT                   /EC_number="1.1.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81775"
FT                   /db_xref="GOA:Q6ABQ3"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABQ3"
FT                   /protein_id="AAT81775.1"
FT                   /translation="MSIAPHLVVIGIGHVGSDVVTNAAALGLFSRISLIDVDKKVRDGQ
FT                   ALDNHQATAVAPAMTTTITAANYDACRSADVIIVSAGPSVLPDSYGGGHDSRNSLAQVN
FT                   SKVIREVMGNICQYTHSAPIILITNPLDVNVHIAATEFDYPTNLVVGTGTALDSARLRR
FT                   HLADWAGVSPDSVQAFMLGEHGATAFPYLSHASIGGLTLAEATTALGLQPLSPDQVGNS
FT                   VVQSAFDILEGKGWTSSGISKAAVSLARAMLLDQRSIHPVCTLADGVLGFHSEVSLSLP
FT                   TVVSGHGVEHHLNIVLDEWEQEKLLVSAKAVREVYESVRPA"
FT   gene            16412..16606
FT                   /locus_tag="PPA0013"
FT   CDS_pept        16412..16606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81776"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABQ2"
FT                   /protein_id="AAT81776.1"
FT                   /translation="MCLSAHDVEAAESCGLGVANVFVVGLVATPHGTTLCCVQDCHSFD
FT                   EDIVDEGLAGIAGDVGRIL"
FT   gene            16732..17739
FT                   /locus_tag="PPA0014"
FT   CDS_pept        16732..17739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0014"
FT                   /product="putative transcriptional regulator"
FT                   /note="LacI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81777"
FT                   /db_xref="GOA:Q6ABQ1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABQ1"
FT                   /protein_id="AAT81777.1"
FT                   /translation="MTHKPTIKDVARLAGVSLGTASRVLNGSSATSEASRSAVHNAAHE
FT                   LGYLSNAHARSLRSSHSGVIGLVVPDIRNPYFAELASVVENACLAYGWATLLCNADESP
FT                   DQFNRYVNTLRRQRVDGAIVTPTGSGGQAVKDLVDDGVQVVCVDREITGSPLPAVTSDP
FT                   WNGMRQAVHHLVDHGHRRIGFITGPQQTSTGLERYQAYRQLLAEHGLEVDEDLVVEGDF
FT                   QEESGRMGARRLLDGGATAIFASDSLMSMGALRTCIDQGVRIGDEIDLVGFDDLPVFSL
FT                   TNPALTVVAQDIDAMGKVAVDLLNRAMSGEPTSSARLDTHLIVRASTRMVKENQ"
FT   gene            17736..19241
FT                   /locus_tag="PPA0015"
FT   CDS_pept        17736..19241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0015"
FT                   /product="ABC transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81778"
FT                   /db_xref="GOA:Q6ABQ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABQ0"
FT                   /protein_id="AAT81778.1"
FT                   /translation="MTTVLRLDHVTKAFGPVKVIQDVSVDVIPGRVRVLLGENGAGKTT
FT                   LIKMMSGIYHPDSGSVVIDDTPVELPTVKAAEARGIATIHQELNLVPQMSVAENIMLGR
FT                   TPSRGGLVNWGLMRAQARAALERIGLDVSPDRLVGSLSTAHQQLVEIARALSMDARVLI
FT                   LDEPTAALTRKESGQLFEVMDDLKTKGVAMVFISHHLDEIPRVGDDVSVLRDGTLVGEV
FT                   PARTSERELVTMMVGRDIDDQFPRHRGEVGEVLLSVTGLSRERAFQDVGFDLHAGEVLG
FT                   LAGLVGAGRTEVLRAIAGADKYDSGTVRVRGKELPKGKISRAIVDGIGHVPEERKSQGL
FT                   VLDASVNENLGYATMKSTSHAGLVDRSGQRRRAQNVAEKLRVRMASLDQPVRNLSGGNQ
FT                   QKVVIGRWILADSSILLLDELTRGVDVGAKVEIYQLINAVTDAGGAVLMVSSELPEVIG
FT                   MSDRILVMSHGRAMGILDAKTATEDAVMELAVASVDPVDEKTG"
FT   gene            19324..20301
FT                   /locus_tag="PPA0016"
FT   CDS_pept        19324..20301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0016"
FT                   /product="ribose ABC transporter"
FT                   /note="permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81779"
FT                   /db_xref="GOA:Q6ABP9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABP9"
FT                   /protein_id="AAT81779.1"
FT                   /translation="MTTTSTATTQRPSVGRKVGSWSLNHGALVGLIILCIALFIATPVF
FT                   LTVPNIINIGIQAAVVAIMAFGMTFVIVTSGIDLSVGSVAALSAMVSAWMFSNAGLPSW
FT                   LTLIIGLLIGLLAGAVSGLAIAYGKLPAFIATLAMMSVARGLTLVISGGTPVATSDAVN
FT                   QLGADVGPIPVPVIMLALAGVVCWFMLSRTVLGRSLYAIGGNEEAARLSGIPVRRILVT
FT                   VYALAGVFAGLAGLVLAGRLSSAQPQAGFGYELDAIAAVVIGGASLSGGSGKASGTFIG
FT                   AVLLAVIRNGLNILNVSSFWQQVVIGCVIALAVGFDVFRSKKES"
FT   gene            20350..21291
FT                   /locus_tag="PPA0017"
FT   CDS_pept        20350..21291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0017"
FT                   /product="periplasmic sugar-binding protein"
FT                   /note="putative ribose-specific"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81780"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABP8"
FT                   /protein_id="AAT81780.1"
FT                   /translation="MKFKSTKVLATAVAVTIIATGVAGCNRDGGAGSSASGTVVFAVST
FT                   QTNPFFVQLVDGAKKEAKAKGVNLQVQDASDDAATQANQLANAVSTSAKVVIVNPTDSD
FT                   AVAPSVKALNKAKIPVITVDRSSSSGDVASFIASDNIAGGIDAAKKLAEIMGDKGEVIH
FT                   LQGTPGASASRDRGKGFSEEIAKHPGIKVVAKQTANFDRSKALDVTTNLMQAHSKATGI
FT                   FAENDEMAIGAISALGSKAGQSAKVVGFDGTADGIKAVKAGTMGATIAQQPAFLGKTAV
FT                   DQAADILAGKQVSKTTPIKVVLVTKDNAKDYE"
FT   gene            21288..22217
FT                   /locus_tag="PPA0018"
FT   CDS_pept        21288..22217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0018"
FT                   /product="sugar kinase"
FT                   /EC_number="2.7.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81781"
FT                   /db_xref="GOA:Q6ABP7"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABP7"
FT                   /protein_id="AAT81781.1"
FT                   /translation="MSGATAKVTVVGSINADMRVGVERFPGPGETLAGGEATLTPGGKG
FT                   ANQALAAARCGVQVAMVGAVGKDPTAETALSLLSEGVGLDGVVRRDVLTGTAVVMVADS
FT                   GENSIIVIAAANGTVDAQTVRAQAERIQDADVVVCQGEIPPDGIAEAARGAKRFVFNLA
FT                   PVVDVDPEVIRMADPLVVNEHEAALVALALGSTTSRLEDDPDAALRELLNLGCRSVVIT
FT                   LGSAGCIVGGPEGFDAVAAATVKAVDTVGAGDAFVGALAAELARGRTLVEGCRFATAVA
FT                   TLTVTKPGAQASYPSADEVESIRRGEHA"
FT   gene            22214..22597
FT                   /locus_tag="PPA0019"
FT   CDS_pept        22214..22597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0019"
FT                   /product="high affinity ribose transport protein RbsD"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81782"
FT                   /db_xref="GOA:Q6ABP6"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6ABP6"
FT                   /protein_id="AAT81782.1"
FT                   /translation="MKKSGLLNPQLCAAVARLGHTQTFVVADAGLPIPHEVPVIDLAVV
FT                   LGTPRFQEVFDAILDEVVVDGATIAHEALGHEPESWVRERIEEVHTVSHEDLKKALPNV
FT                   SFVVRTGETTPYSNVIVRCGVPF"
FT   gene            22692..22768
FT                   /locus_tag="PPA2408"
FT   tRNA            22692..22768
FT                   /locus_tag="PPA2408"
FT                   /product="tRNA-Ile"
FT   gene            22780..23049
FT                   /locus_tag="PPA0020"
FT   CDS_pept        22780..23049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81783"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABT4"
FT                   /protein_id="AAT81783.1"
FT                   /translation="MVTRGIVTFRGVASAMCSRLCAMSVWGPLEFGRGWQRIRTAVEAA
FT                   MKADYTDQVVRPALGEWVDESMATTRGSSVLLLFIFQPFQKQLL"
FT   gene            complement(23201..23677)
FT                   /locus_tag="PPA0021"
FT   CDS_pept        complement(23201..23677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0021"
FT                   /product="PTS system, galactitol-specific IIA component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81784"
FT                   /db_xref="GOA:Q6ABT3"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABT3"
FT                   /protein_id="AAT81784.1"
FT                   /translation="MSVLLNTDLISVNIEAPDRNQVLTVMADKLNGVRVAKEGFLDALL
FT                   KREEIYPTGLPISCGVAIPHTDPQYVTRDALAVTTLHTPVLFGQMGGSEEDEVPVSVVI
FT                   LMALSNADDHLNMLQNIVKSIQDDNLMQTIRSATKPEEVVSIVRPLIPADTEDS"
FT   gene            complement(23734..24990)
FT                   /locus_tag="PPA0022"
FT   CDS_pept        complement(23734..24990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0022"
FT                   /product="PTS system, galactitol-specific IIC component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81785"
FT                   /db_xref="GOA:Q6ABT2"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR013853"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABT2"
FT                   /protein_id="AAT81785.1"
FT                   /translation="MSIIKGILDVGAVVILPIVMLILCLIFRIPFGKSLKAGLMIGIGF
FT                   SGLSLVIGFLMTSVQSAVDYYRHMGGGFTTVDVGWAAVGAASFGVPFAAPAILLVVLIN
FT                   VVMILAKMTNVLNVDIWNFIHFLVPGTLAYALTNNAWIGLGVVLVLSVIDLIVAQHIAP
FT                   KWQEYYGLTGTTCSTLSYITSAWPIAIGLNWVIDKIPGVRKIDISMEKFGDRLGFFGDT
FT                   AFIGLIVGIFLGLMTRQPWQGVLVMGMGIATVLVLLPRMVSVMMEGLSTVGEGAKTFMK
FT                   RHLGKNKDGSERELSIGMDVALALGDPAAITITVLMIPLCIAFAFIIPGMNYFPVGMLT
FT                   VIVYMMPMICLACNGNMFRSLIIGAIYMFFVEWGASFFAPEATAMMHATGVHVSGSVTD
FT                   AFFGYNLPNIIISAIHRMF"
FT   gene            complement(25011..25313)
FT                   /locus_tag="PPA0023"
FT   CDS_pept        complement(25011..25313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0023"
FT                   /product="PTS system, galactitol-specific IIB component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81786"
FT                   /db_xref="GOA:Q6ABT1"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABT1"
FT                   /protein_id="AAT81786.1"
FT                   /translation="MASEVKVLVACGSGIATSTVAQEKVKEILRDAKIPAKITKGTVGQ
FT                   LPVLQNGVDVIMLTTRYGKPLNKPVIQVFGLISGINEDAVAEEIISTCRDILNQS"
FT   gene            complement(25303..25686)
FT                   /locus_tag="PPA0025"
FT   CDS_pept        complement(25303..25686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0025"
FT                   /product="alcohol dehydrogenase"
FT                   /note="putative galactitol-1-phosphate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81787"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABT0"
FT                   /protein_id="AAT81787.1"
FT                   /translation="MAEMMNAALMYGPGDIRVEQMPKPTCPPGRFVLRVDAVGLCGSDI
FT                   RNLTTDSRKGDYPFIYGHYGATSVQVQKAFELVINDKFPAEQVISKVLPLSRINDAIEF
FT                   TRTGEALRVVLVPDGKESEHHGK"
FT   gene            25961..27854
FT                   /pseudo
FT                   /locus_tag="PPA0026"
FT                   /note="transcription antiterminator, BglG family;
FT                   frameshift"
FT   gene            complement(28427..28711)
FT                   /locus_tag="PPA2391"
FT   CDS_pept        complement(28427..28711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA2391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA2391"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81788"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABU0"
FT                   /protein_id="AAT81788.1"
FT                   /translation="MAHASSPPVRSLTLPKHDHRVNACSLIGHAEIRWRYPYEFFVERP
FT                   MVVVDNSHDAKMLWVQQCSDYSDQVIARRTSLYLQCHDKLSQIVEDKAY"
FT   gene            complement(28718..29083)
FT                   /locus_tag="PPA2390"
FT   CDS_pept        complement(28718..29083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA2390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA2390"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81789"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABT9"
FT                   /protein_id="AAT81789.1"
FT                   /translation="MQHPGAIDQVALFQVTHDAPQKAVRDLDVLGSDAVGAGYSHSDLR
FT                   EKFEKSVTALRRASTQSRRNSGMSRGDDNGVEDIEPSSDHRLKSQHKLSCSWHLRPGSG
FT                   MPWSSCRNTTRPSPKVA"
FT   gene            complement(29313..29984)
FT                   /locus_tag="PPA0029"
FT   CDS_pept        complement(29313..29984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81790"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABT8"
FT                   /protein_id="AAT81790.1"
FT                   /translation="MDVTTLQTQGERAVATSAHTIEPPVHDGAGRWPLSIVLMPPPPAE
FT                   SVLAALTQEAIYLAGTDHLHSGAVGCAHVTVRALENRRPVPPQDPFAVSCASALDRACA
FT                   HHAPLFMKLERLLITPGGVLALLHPTSPDADEFRTYTLGHELRPNAYREGILSPRDLWY
FT                   VSLLHFRGPIEHPKDLVTWSHQQPAPITWAFPDAALCTYEITTTAMRPRIRHTAAFGRA
FT                   I"
FT   gene            complement(30008..30586)
FT                   /locus_tag="PPA0030"
FT   CDS_pept        complement(30008..30586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0030"
FT                   /product="putative phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81791"
FT                   /db_xref="GOA:Q6ABT7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABT7"
FT                   /protein_id="AAT81791.1"
FT                   /translation="MDSTVAVESVWSAWAERNSIPTADVLAWCHGRNVAATITHFLPHI
FT                   TPETLQSMVSAQLDQECTQLDSVKPAVGGRELLIWLDAHRIPWGVVTNAPRRLALARLG
FT                   AATIDPPLLVTLEDVEHGKPAPDGYLHGARSCGVAPTRALVVEDSASGLAAARSAGTVV
FT                   VAVGGRRDADVVCHDLVDLHRLLVQIRSK"
FT   gene            30784..31542
FT                   /locus_tag="PPA0031"
FT   CDS_pept        30784..31542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0031"
FT                   /product="transcriptional regulator"
FT                   /note="DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81792"
FT                   /db_xref="GOA:Q6ABT6"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABT6"
FT                   /protein_id="AAT81792.1"
FT                   /translation="MQRLFRQKMIINSLGTSPTSVDTLVELTGASPATIRRDLTDLEGH
FT                   GQLRKVHGGAVAVNLRGTPMPYSLRSAENAESKTAIAQLVSRLVTDDMSVIIDNGSTMV
FT                   AVAQALQERPITALCLSLRAALPLGEGGVATVSTPDGTLMPESLRYAAASCLRALGEFR
FT                   ADVAIVGTCSASPAMGLTVTTHQDAQVKRAILASSARVVLAATGDKLSRTSSFRFGDIE
FT                   DIDDLVTTRDAPQVTLDAFRVAGSRVYVAD"
FT   gene            31730..32152
FT                   /locus_tag="PPA2392"
FT   CDS_pept        31730..32152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA2392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA2392"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81793"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABT5"
FT                   /protein_id="AAT81793.1"
FT                   /translation="MPPEVAMPSYAHRQRRTQEGKDQYHSRSGHDRDGSPHTQHHDRCH
FT                   GWSGDRNRGRPGYYRRAQTTFVIEGVSIVQSCPVGAGKLLWRPGAPFRSRVGHAARRLI
FT                   ESMTLKESVPIHRVRRCEVLVIVQVIFEFPDLYLCL"
FT   gene            complement(32158..32895)
FT                   /locus_tag="PPA0032"
FT   CDS_pept        complement(32158..32895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81794"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABU5"
FT                   /protein_id="AAT81794.1"
FT                   /translation="MVKEQRPCIIGNVAISTTLHLAPNDIGAFTDTDELRILMESAQSH
FT                   GYFNPPPLENREYLIEEPIGVVVSDTSQPEYLTLRLDSHPEHHILGRPGMKIMLVLADA
FT                   LRLIGLSTPQSIDVECVYFNPRDWDLLNPEPDDHIHMIGTLSREVCRWMSPHLTHTWHA
FT                   TATTNPDLDPHLAQNTINRWFPPDFEYPWLGHTPQAHQETLTWHMPDDITALGWLFDLI
FT                   TLLQGQPPQHIHATPNEQKIRPW"
FT   gene            complement(32889..33428)
FT                   /locus_tag="PPA0033"
FT   CDS_pept        complement(32889..33428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81795"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABU4"
FT                   /protein_id="AAT81795.1"
FT                   /translation="MIPVVYVSKPAAALLALTLALAVPATASASPTTSPSPTASGNSDL
FT                   RPEQGSAKVASKAASFTSQVDDPHYSSSHAGSVNVHGWWLDDHDNFTGMKARVTVYLWA
FT                   KKGSQWVQVNKIPTKKNPVTVYAGGGGGKRASGSVSCRSHKPTWYHGQVDVDIIDAIDT
FT                   SNRPNSHDVELNCQPW"
FT   gene            33561..34619
FT                   /locus_tag="PPA0034"
FT   CDS_pept        33561..34619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0034"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /EC_number="2.6.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81796"
FT                   /db_xref="GOA:Q6ABU3"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024892"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6ABU3"
FT                   /protein_id="AAT81796.1"
FT                   /translation="MSQDRRDVVRGLPLYKQGASHGENAVKLSSNENPFEPLPSVVEAV
FT                   TRTLPRFNRYPLMSAEEVRSTIAGHFGVDVSQVAVGAGSTEVASQLMHALAGAGDEIIF
FT                   PWRSFEAYPILTKVAGATPIPVPLTVDLRHDLDAMADAITDRTRVIFLCTPNNPTGTVL
FT                   HTDEVVEFLARVPENVVVVMDEAYCHFNRDDAAVDGLTLLEDHPNVVVLRTFSKAYGLA
FT                   GLRIGFAISTPEISDDLRRVATPFTVTTLAQQAAIASLAAEDELNERVNRIVAERTRVF
FT                   DELTRQGWKIVPSQANFLWLATGDDTDRIDEVMVSHGVFARCWSEEGIRLSIGLDAEND
FT                   RAIEALSQAVKG"
FT   gene            complement(34623..35500)
FT                   /pseudo
FT                   /locus_tag="PPA0035"
FT                   /note="similar to phospholipase; frameshift"
FT   gene            35552..36118
FT                   /locus_tag="PPA0037"
FT   CDS_pept        35552..36118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0037"
FT                   /product="acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81797"
FT                   /db_xref="GOA:Q6ABU2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABU2"
FT                   /protein_id="AAT81797.1"
FT                   /translation="MTRPRDVPPCDGPAQVRKVEVCPLVEEDLEWLWHWNVEVVDPQWK
FT                   QWDGPYFGPDDDRSFAEFAEEWRSGLMSGHRAVVTVDGQRAGFVSRFEEPPTGGGWWEV
FT                   GIVVFRPTLWGRGVGRRALRLWTEATFATTDAQVVTLTTWSGNGRMIHCAGAVGYRECG
FT                   RIPQARSWQGRRWDLVTMALLRDDL"
FT   gene            36132..36791
FT                   /locus_tag="PPA0038"
FT   CDS_pept        36132..36791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81798"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABU1"
FT                   /protein_id="AAT81798.1"
FT                   /translation="MRRGVVTSVLLACTLVSGCSTLKPLTEPQPTPTVSASKVPQGIDA
FT                   HPAWAVPVARSGKKLGHFGDDRIRIEVDQAAIAKAPEDSIMVNPQDGTPVVSKGSSIVL
FT                   VRYIVTNVSKAPINLGLGTVTITARYPDWTWRQPLVSVLAPRADAAHKIVTTPFAPGTA
FT                   RPPYVLGLGESFMVGANYPYETAEQLDVTATVVVCDTAGAVDPGLGWTITGKVHLA"
FT   gene            37044..37682
FT                   /locus_tag="PPA0039"
FT   CDS_pept        37044..37682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0039"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81799"
FT                   /db_xref="GOA:Q6ABJ9"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABJ9"
FT                   /protein_id="AAT81799.1"
FT                   /translation="MSVTTTPISARATTPSPRLRRSPRLIVIGVLCACLGGLGGAVAWH
FT                   RASHADQVLVMTRAVGQGDIVRNADIGLTSVAVDRAVATIPASQLDKIVGRHALVDLSP
FT                   GQLLGSHSVGELRVAPGRARIGLKLAAGRLPTVSLPAGARVTVIETSPDKDTGTVSNLS
FT                   TADAVVVAAPKATNDHGSWLVDVEVDSGNAARLADLASLDRIALVERGQ"
FT   gene            37682..38500
FT                   /locus_tag="PPA0040"
FT   CDS_pept        37682..38500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81800"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABJ8"
FT                   /protein_id="AAT81800.1"
FT                   /translation="MSIILLTSPGGAPGLTTTALGLALTWPRDVVLVDADPCPGHVIES
FT                   GYLTGRIPPRPGLIGLATAFRDGADPVQTMWEETIPLPHDSGDRMVRLLSGYGHLGQAS
FT                   LMGAAWSSLASAMIDLGQAGVDVIVDAGRLGPETLPGSLVSRASLIGIVTGSRLRQLAG
FT                   LSMRAEEVEAMSSATTGTVGLVIVGPGRPYNSREIGHQFGLPVFGDVVFNAHAAAVLSD
FT                   GEPAGKRWSRGHYVTSMQSMAESMRERIRRADQAITGPEILSTSAMGVAS"
FT   gene            38497..39975
FT                   /locus_tag="PPA0041"
FT   CDS_pept        38497..39975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0041"
FT                   /product="secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81801"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABJ7"
FT                   /protein_id="AAT81801.1"
FT                   /translation="MTIDHAVSRYAQDAPVVPLDDGKDLAGVLSRISPSPHVSPAAVSP
FT                   RPNPRRFEAKDIDWRTVVSLRRKASERISSERASHRERTGVDLSGDDVRMLGRSIVRQA
FT                   VESHAEKLTAEGQALWSAQTKDAYVRAVMDAIFGYGRLQPLFEIQDAENIEINGCDRVF
FT                   VQYGDGRREPGPVVADDDAELVEAIRFLGESANPPRPFDDAHPTMTVALGSQYRLHAIG
FT                   FGLSYRPSVVIRHHTLTRVTIDDLVNTAMMPHHVGVLLRAAVLARRSIVIAGDQGAGKT
FT                   TLLRALVDAIPPTERFGTLETDYELLTHLNPDRDNMVAFQATVGLGEKVDGHCVGEFTV
FT                   ADLIPEALRQNLSRLVVGEVRGVEAAAMFEAMQAGAGTMSTTHSHSATSTMDRLAGRVA
FT                   MGGVMTIEEAYRQIAHNITFLVHVTLVDDTWRGGTRTRHITEIRQLTGALENGRPVTHL
FT                   TYAAPTPTSPGVFHPDPALVAELSHYEPEVTRWV"
FT   gene            39966..40847
FT                   /locus_tag="PPA0042"
FT   CDS_pept        39966..40847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0042"
FT                   /product="membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81802"
FT                   /db_xref="GOA:Q6ABJ6"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABJ6"
FT                   /protein_id="AAT81802.1"
FT                   /translation="MGMNAAIAALLGGLLVGGVVMVGIGIAPIHQLSTGQSTSLWTRVD
FT                   NWFSRLPRRSRVHGLTGLGIGVVGYVVTEWAVVLVIVPVLAVVVPALLADPPRHDLDVM
FT                   RALERWVRLVSGSASTGKSVIDAIRATRRQAPELLIEPLTRVVARLDSRWDTRAALQGL
FT                   ADDLDSADADQVIAAIMMAAERGGTGATGTLDALAASLQERIRAAREIRVERAKPRVVV
FT                   RQVSIIIGVVLAGALILGREYLVPYRTGVGQLLLCCYAGLYLAGLIALSRRSKPRRRAR
FT                   ILLRRAGEANYG"
FT   gene            40840..41742
FT                   /locus_tag="PPA0043"
FT   CDS_pept        40840..41742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0043"
FT                   /product="membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81803"
FT                   /db_xref="GOA:Q6ABJ5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABJ5"
FT                   /protein_id="AAT81803.1"
FT                   /translation="MAESTVILAAICGALLACAPVFVVSGRRNAPLRLSDALAGLSDYG
FT                   RQDAVVGPVAEGGRLERWGTRAAIRWPRMVSERSRRTLILQGRTPGDLVIEKAVMAMGG
FT                   MLVPALARAVAAACGDTLPVTPVGLAVVLAVVGWFIPDTRIRSRSKAVRQDAAEAVLVY
FT                   VDLVTLARLANQSAPRALVEAAQMSDHPVLARIRMTLERSRLEQQSPWAGLDELSDELD
FT                   LPELAELVEVLRLDDQGASLAGALRARVHEMRDAHLNQEKVEAQTASESLTIWMVIPVL
FT                   VLGLVLITPPLLIMAGVAS"
FT   gene            41739..42401
FT                   /locus_tag="PPA0044"
FT   CDS_pept        41739..42401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0044"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81804"
FT                   /db_xref="GOA:Q6ABS9"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABS9"
FT                   /protein_id="AAT81804.1"
FT                   /translation="MTTFRTLESPTCCGVHDVTGKAGANDQGGRHETRQYRCFGRSADD
FT                   RGDTPSRRETRRERTQPVNRKRHLVSGGGLDSDGGCHRDQGLCVVKLAEMSRGRSEHRQ
FT                   CRERGVSESLQWSLVWPVVLLVVVAVIQTAVVLQARATVTEAARAAVRVQALRGSHAGE
FT                   AEATARDVAQTSKVTDVTVTVSTTDSLVRVDVEGRAAALFGAVVAVRGHAVAVEEGT"
FT   gene            42398..42907
FT                   /locus_tag="PPA0046"
FT   CDS_pept        42398..42907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0046"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81805"
FT                   /db_xref="GOA:Q6ABS8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABS8"
FT                   /protein_id="AAT81805.1"
FT                   /translation="MIRPFHGRALLPQDRIDQIRYRRCNACQNRRHWCCRGAVAVEAAL
FT                   ILPALLMIAAVATGSWRISEVKADAQSAAQVAARAGSVASSVGEGIAVGQRVGLAELAG
FT                   TRCSNPAIAVDSSDLTLPVGFAGTASARVSCTIKLSDLLVPGMPGSFHIESVAHSTLDS
FT                   HRERYS"
FT   gene            42904..45666
FT                   /locus_tag="PPA0047"
FT   CDS_pept        42904..45666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0047"
FT                   /product="hypothetical membrane-spanning protein"
FT                   /note="LysM domain"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81806"
FT                   /db_xref="GOA:Q6ABS7"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABS7"
FT                   /protein_id="AAT81806.1"
FT                   /translation="MKISPVRARIHGALAMVALLLLVVGSPAALVAWGHLDATTVLSPA
FT                   GWLAPDDGSIFLTVVTVIGWAAWTVFCVCVVAEAVGMATSQRHHVKLPGLGAIQGIAAG
FT                   LLVASLTVLSPLTRSAVPPAPVSLVATAAAAPQPAPEAQVDSDSRHDEDVMTVTVGPHD
FT                   DLWTLAETWYGDGTSWRRIVAANPDVDVDHLVVGQRLALPGATVTVPAGHTGAGRPIDT
FT                   EQLNQIAPPSEMSKIRTITVEQGDTLSGIAQTQLGDASSWPAIWHLNEGIIADPDHIEP
FT                   GWELVLPDSPTVDKRASDQHTNEQGGKWEKSTPAETPTTESTPPVLPEGGGDTTATVNE
FT                   TKVEPHTAAGADQEVSVAEVGQSPAEILRTALAGLSLFLAGGVAGTVTTRRRQQLFTRP
FT                   LGRRIPPVSGEPRRAKRVLDAAADQLDESASSRDTAALAMTPTTVVLGTCDPQTPVVVD
FT                   LADVGGVLAVNAARDLATAMVASISLSLVAAPWSGGIDIVAVGEDLAWLAHTGSDDVQL
FT                   ADEDEVVEGLAGLSNEASEYPATITRVVLSLSPLNLPSPASLAAAGIVIVMPGVGGQKI
FT                   TVTDCDHAEFHGQSFTPQIVTSPMRRAVVELLETTARSDTEPAPWWEPRRGDEEGSDPP
FT                   PVMDKPCAVLPPSDAHLTVEEETVLTSTMTSDVAHLPATGGQVPSPILRLLGPVDLLGA
FT                   RGNPPTKARRQCLEYCAWLLCHPGARSVQMADALMVAEPTRRSNVSRLRRWLGTDDAGR
FT                   AYLPEGYDGSLRLADAVTSDWERLELLVSGGVSTAPLANLVSALDLVRGAPLADAAPGQ
FT                   WHWAEEWRIDMIQMVRDIGVEVARRAMEIRDVELASRALARATVACPEDEVLLVARIKL
FT                   ADELDDRGEVERLVYVLSRQARRLGVDLSEETITVLQEVMEGHARARVV"
FT   gene            complement(45713..47125)
FT                   /locus_tag="PPA0048"
FT   CDS_pept        complement(45713..47125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0048"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81807"
FT                   /db_xref="GOA:Q6ABS6"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABS6"
FT                   /protein_id="AAT81807.1"
FT                   /translation="MDPPRVFFGSPFRIDRGQPEGDHVFWQNLRHLWRRRDFRKILGVR
FT                   VATQAADGTLQVGMASYVLLSPEQQPDAWSIAMVLAITLLPFSIIGPFVSVVLDRWSRQ
FT                   RILVYTDGLRCLIAVGLGILVWNGARDKPSHLALLIGLLIAMSLNRFLLTALVAGLEYT
FT                   IDKRDYLTASSIMPTIGPLGLMIGAVVAAAVRMIAGRHIPVHHADTIIFCISAALFAVS
FT                   VALGLQFSRRELGPPPVDRSRTMRAVAGDVVDGFRYLGKVPLVGHSLTLIGAQRVLFGV
FT                   YSVAMILGYRNRFHVQSDINGAMADMTVWAVAMGAGFVLSAGFMPVLVHRLGMRRALMA
FT                   LLTATAVIQAFPGATPNRWGLLVAGFFVGLFAQSLKAGVDTICQAHITDGYKGRVFIAY
FT                   DMVYNAMFVAGSALAALVLPIQGLSGPHIVGLAIAYAVVAVVFALTTRAHGNDVFDKGS
FT                   ALGGLPAANPEE"
FT   gene            47426..49135
FT                   /locus_tag="PPA0049"
FT   CDS_pept        47426..49135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0049"
FT                   /product="formate--tetrahydrofolate ligase"
FT                   /EC_number="6.3.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81808"
FT                   /db_xref="GOA:Q6ABS5"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6ABS5"
FT                   /protein_id="AAT81808.1"
FT                   /translation="MIGAMTMKSDLEIAREAHLDPIEKVAARAGIDEKYLEPYGRGVAK
FT                   VDLDVVTHNRDHSCGKYVVVTAMTPTPLGEGKTTTAVGLAQGLEKIGKHSVLALRQPSM
FT                   GPTFGIKGGAAGAGYSQVLPMEKLNLHLTGDFHAIGAAHNLLAAMIDNHLHQGNELDIE
FT                   PHSISWRRVVDINDRALRNTIVGLGSRVDGVPRETGFDITAASEVGVILSLATSLSDLR
FT                   ARLGRIVIGYNRSKEPVSAEDLHAAGSMAVILKDALKPNLLQTTENSPVLVHAGPFGNI
FT                   ATGNSSVIADRVGIGCGDYLLTEAGFGADMGAERFFNIKCRIGGMRPDAAVLVATVRAL
FT                   KTHAGRYKVIPGKPLPPAMLEDNPDDVLAGAANLRKHIEIVREFGVSPIVALNVFPTDH
FT                   PDEIDAVRKVAEAAGAHFASSTHVVDGGDGAVDLAHAVVAACDHKADFRYTYDLEDSLV
FT                   EKLTKVATKVYGADGIDIAPAAAKELAHFEDLGYGTFPVVIAKTHLSLSHDPSLKGAPT
FT                   GWRLPVREVRAAVGAGYIYAICGDMRTMPGLGRHPAAERIDIDDNGETIGLF"
FT   gene            49241..49654
FT                   /locus_tag="PPA0050"
FT   CDS_pept        49241..49654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81809"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABS4"
FT                   /protein_id="AAT81809.1"
FT                   /translation="MPYPQLVTSKRAEDARLRIEFEERARRQEAVQAQRLIDDFLVMAR
FT                   AQGMTPVPLRAQLMDGHEARTDKRGWYLNAKHSLAIGENGEYYHLVVTGGFAERLRGVK
FT                   LHPSLPPMHIGRGGRDGETGELKEFLTWLIDSR"
FT   gene            complement(49651..50181)
FT                   /locus_tag="PPA0051"
FT   CDS_pept        complement(49651..50181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81810"
FT                   /db_xref="GOA:Q6ABS3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABS3"
FT                   /protein_id="AAT81810.1"
FT                   /translation="MRRMLFAVTKFKRVMALLGVIYLVTVGGLYFVLADRSDNFIHDGQ
FT                   IIQGTVTAVYSHRSVSTGATKYLMHAEGGNVALISYTYDGATDTVWSNPYRDIKKYHVG
FT                   QKVDLVIRATPNHPDDAIVTVRDHTILGLRLIPWGFLASAVIMTAWFGRDYLRSKRRRR
FT                   LGGQRHAPAAVEA"
FT   gene            complement(50197..50871)
FT                   /locus_tag="PPA0052"
FT   CDS_pept        complement(50197..50871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81811"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABS2"
FT                   /protein_id="AAT81811.1"
FT                   /translation="MTFTSTTPRRLRSLWQELCSHPRAPWRTDLICRGCYPEDLPQRLR
FT                   QDDAAALRALIAARSGAGQTSEFAGMALIQAILPTLVTIANRDHQACLDDYIGEAWVVI
FT                   VTFPLSRTNKVCTNVALDCLHAISSRRQHSSPEAPAESIDISAPEMQEPGQVASDLLSA
FT                   AEELGIITPTSAPVLRSVWVEALDCTTAAQRHNTSPTAVRARCSRASRAMRQHRDELLA
FT                   AS"
FT   gene            complement(51068..53539)
FT                   /locus_tag="PPA0053"
FT   CDS_pept        complement(51068..53539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0053"
FT                   /product="ABC transporter associated permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81812"
FT                   /db_xref="GOA:Q6ABS1"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABS1"
FT                   /protein_id="AAT81812.1"
FT                   /translation="MFTEALRELRHHPGRLVATLIAIAVSVGFLVGISMFVRTQGVALG
FT                   KEQAVATSKADVVVDTGGAVADPDEVTRTIKETQGVAAVDTVLSTSMPAAHGHDSVMID
FT                   LHQVPAEPFRWSTVKDGSWPSKADEVALSEDAAKRLQASIGDTVAFSGHDLKVVGITDD
FT                   PSALQTAPAYVGQLPGQTPDTWVVKAKDGTAPGQLVTNLEKTLPKIKDAPQFNKDDAGA
FT                   TISTADSFQKKTINSLTEDFDVTKYMLMVFGAIALLVGAIIITTTFLILLAQRRRQIGL
FT                   MRAVGASSGQVRRRVLAEAIVLGVLGSMLGVVLGILLTVAGTAYTGALAFGLAWPWGDI
FT                   IVEFLIGIVITVLAAFLPALRATRVAPLEALRPVPTVEQKRRIGIARIVVCSLLAVAGI
FT                   ALSVGAIVGTGTSIITMAILSAMCLSLTLLIATPLYVPWLIRAMGFLLRPLGPTARLST
FT                   SNANRNPTRTSLTAVALMLAIGLSVTLQVGISTTRTTVMDQINEHFPIDLTLTNRPSYD
FT                   PNTGQETASTLDTSALKTVQDLPNVKDSIVLKGGFAESDLSPHAHMLSGNPDEIAKVAP
FT                   SIAKEMKPGVALITSIDNPPQTMTFTSSKGKVTLKVTKVHGLSEGDVVVNQEDLKRIVP
FT                   SVTDQSIWVHLDDRSNLASTLTVMMSMSSSSSQHMDIGGGALIGGIVELILKVLLMVMT
FT                   ALLGVAVLIALIGVANTLSLSVLERRRESALLRAMGMQRRGLRLMLLYESIQVGMAGVI
FT                   VGIVAGFYFAWLGIRSVFRVASDTIPVHFSIDWPWTLSLIAICLVAACLASVLPGRRAA
FT                   KAIPTEALADE"
FT   gene            complement(53539..54573)
FT                   /locus_tag="PPA0054"
FT   CDS_pept        complement(53539..54573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0054"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81813"
FT                   /db_xref="GOA:Q6ABS0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABS0"
FT                   /protein_id="AAT81813.1"
FT                   /translation="MKGIMSDHDRPYESDEPQHSLDHAIPSEPGSFEPPRYGTSSEWSG
FT                   DSLRPIGEQDRELGQPWGLQAPAPQPPHTAKPFPAHPFNTATPAQRGGLAPGLLNTPIE
FT                   TDAAAGMQLTKIFGEGETRVTALNSISVRFTRGTFTAIMGPSGSGKSTLMHCLAGLDRI
FT                   TSGQVFLAGMEISNLPDAKLTTLRRDNVGFIFQSFNLLPMLTAEENILLPLDLAGRKPD
FT                   RALWDQLITGLGISDRLKHRPSELSGGQQQRVACARAMITKPHVVFADEPTGALDSKSG
FT                   ANLLGYLRHCVDDLGQTIIMVTHDAKAASYADRALMLLDGRIVDDIASPTAESVSEAMA
FT                   GLEG"
FT   gene            complement(54681..55337)
FT                   /locus_tag="PPA0055"
FT   CDS_pept        complement(54681..55337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0055"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81814"
FT                   /db_xref="GOA:Q6ABR9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABR9"
FT                   /protein_id="AAT81814.1"
FT                   /translation="MPDPIRVILVDDQSLVRSGFRMLIESEDDMEVVSEASNGLEALDV
FT                   LRRMPVDVALMDIRMPQMDGVEATRRITASPLDTKVLILTTFDLDEYVYAALKAGASGF
FT                   LLKDARPTELLSAIRNVADGDAVVAPSATRRLLDHVVPTLPNDPKAADKRLSVLTDREK
FT                   EVLVEIAKGATNAEIAQTLYMAEGTVKTHIGRLLSKLECRDRVGLVLFAHEVGLL"
FT   gene            complement(55356..55967)
FT                   /locus_tag="PPA0056"
FT   CDS_pept        complement(55356..55967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0056"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81815"
FT                   /db_xref="GOA:Q6ABR8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABR8"
FT                   /protein_id="AAT81815.1"
FT                   /translation="MLRFARTCLWSFTASQQELRFMCGVTLDDRDMKYYYAVLTHGITR
FT                   KLDILLLTVAVALGFFGLDAWVILPESHTPLVKSLGIPAASWLVALILGLILRPFPTKL
FT                   TGKVDANAMEAAIAKKTIMAFCGMTWPALILFVLAFLLYLPRSFVLLAMIAHGATLFLL
FT                   LHSTDQRLEQFAETWCGDHYDPANPEIDTFLHGTRSVSFD"
FT   gene            complement(56040..56870)
FT                   /locus_tag="PPA0057"
FT   CDS_pept        complement(56040..56870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0057"
FT                   /product="sugar transport permease BglB"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81816"
FT                   /db_xref="GOA:Q6ABK4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABK4"
FT                   /protein_id="AAT81816.1"
FT                   /translation="MRRRVHIGAFFRHLFLILGGLISLFPFYWMFVLASRPSSVIYKYP
FT                   PVLTPGNRLGENVHTITDKVNIWAAMANTALVATTVSVLVLLISSLAAFAFAKFDFPGR
FT                   NVLFVIVLATFLLPTQLATIPQFVLMSKIGWVGDLKAVIVPSLASSFGVFWLRQYATNA
FT                   IPKELLEAATLDGCGFWHQYVHVCLPIIRPAMAFLGIFTFIGSWNDFMWPLIVLNDPSK
FT                   LTLQVALSQLKTAHGTDYGMLMASSLIAVVPLLVVFVIGAKQLIAGISEGAVKS"
FT   gene            complement(56867..57763)
FT                   /locus_tag="PPA0058"
FT   CDS_pept        complement(56867..57763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0058"
FT                   /product="transport permease"
FT                   /note="putative cellobiose-specific"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81817"
FT                   /db_xref="GOA:Q6ABK3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABK3"
FT                   /protein_id="AAT81817.1"
FT                   /translation="MRKALPIYAALSPYFFFFLVFAAIPMIFTLLLAFTDWSGLGSAHF
FT                   VGLENFTYLISDHLFYKSLGNTLILWAMGTIPTLIIATIVALMLNKTMRFSTTYRVIYL
FT                   VPNITSMVAMGILFSSIFSSQFGLANAVRNLLGQENIAWLQNEWGIKIAISSLTVWSFV
FT                   GYNALLILAGLQAIDKTQYEAAAIDGANGWQTFFHVTLPQLRAIVLFITLMSTIGSLQS
FT                   FTEAQVLTSSQSAGAASAGGVNNSGLTMVLYFYSVAFQENRYGYGATIAWGVFVVVLFF
FT                   SIINWLVTREHDRKVAR"
FT   gene            complement(57848..59152)
FT                   /locus_tag="PPA0059"
FT   CDS_pept        complement(57848..59152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0059"
FT                   /product="sugar-binding protein"
FT                   /note="putative cellobiose-specific"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81818"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABK2"
FT                   /protein_id="AAT81818.1"
FT                   /translation="MNLSRRHLLSGGFAGLGVLGVSALTGCSTSTEPKSDTGAGDAKKL
FT                   VLWMWPEGFDKQTLATVAKAQPSYNLRQDIIGGDFKQKLTTTFTAGSGLPDLTGVKGED
FT                   IAFFRDHAGYFVDLNTLGAKDIESDYLGWKWAQATTTDGKQLGIPSDIGPTALFYRADI
FT                   FEQAKLPSDPDQVAAQMTTWDAFIEFGTKLLAAKKKTYLVRNAAGLFGTIWPQSGKGFI
FT                   DEKKTFIGDQDHIRNAWDITVKALKAGIIATIQSDTSDAAAAVNEGRLPADFGASWHLA
FT                   DLMVDAPQTKGKWRVCAHPGPAINQGGSFLSIPAGASDPKASFAAIRELLSVKSQIREY
FT                   VHNGNFPVSPKAYDDPKVSGPVDFLGGQHAAKVFGKAAESVRPLFEDSNSGAVSAPFAA
FT                   QLERVESSGKNPETAWHDAVSEAKRIARQLHLTVR"
FT   gene            59132..59323
FT                   /locus_tag="PPA2395"
FT   CDS_pept        59132..59323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA2395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA2395"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81819"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABK1"
FT                   /protein_id="AAT81819.1"
FT                   /translation="MTTRQIHEVPPWVERESSLTKSLNNVQMSAGRGPVPSWCERLLGE
FT                   YLGLVYPPRIQGVTTVCN"
FT   gene            59565..60251
FT                   /locus_tag="PPA0060"
FT   CDS_pept        59565..60251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0060"
FT                   /product="operon regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81820"
FT                   /db_xref="GOA:Q6ABK0"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABK0"
FT                   /protein_id="AAT81820.1"
FT                   /translation="MRTVDVARNLNVSMATARRDCIALENKGIIERSWGGIQLVTSVDD
FT                   HFVMNHHTQAKAAIARKATELIHDGDTIIMDIGTTVHHLSGLLTGRSITVLTASLPVFE
FT                   TLRTAPDVTVVVLGGVWSERYQCFDGQFVADALTRHQADLAFLGCSGVSANGRVRDTSR
FT                   SQAYIKQAIIAAASRSYLLVDSEKFPGVGAHSPFTLEEVSGVITTGPLPPDFDAHCEST
FT                   VEVITA"
FT   gene            60248..61636
FT                   /locus_tag="PPA0061"
FT   CDS_pept        60248..61636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0061"
FT                   /product="putative glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81821"
FT                   /db_xref="GOA:Q6ABV2"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABV2"
FT                   /protein_id="AAT81821.1"
FT                   /translation="MKLTILGGGGFRVPLVFKALAHDTSPQRVTELRLYDTDPLRLGVI
FT                   ETVVAQLARALPHAPSVVATTDLPTALAGTDFIFSAIRVAGTHGRALDESMCLARGVIG
FT                   QETVGAGGISYALRGIPVVLDLVEQITRYAPDAKVINFTNPAGVMTEVMQRRLGDQVVG
FT                   ICDSPVGLARRILTTLQRAGLAPADLGSLFDGDGRIHIGYSGLNHLGWLTSLNVDGVDV
FT                   LPRLLERPDLIESFEEGRLFGADLVQALGAVPNEYLHYYYYSRDDLAADRKAEAPRGAF
FT                   LEAQQNQFYTQAQHTDDVAGLWEATRLEREETYMATNREVSGEFERDEADLETGGYDKV
FT                   ALAIMHAIANDVPAELILNVANHGALPDLPDEAVVEVPCRVDGAGIHRLPTPALPDHAR
FT                   GLVVNAKYVEQRTIDAAVNHSRTAALLALSHHPLVDSVHVAEQLLDDFADAFDGLEYLK
FT                   DAHA"
FT   gene            61629..64757
FT                   /locus_tag="PPA0062"
FT   CDS_pept        61629..64757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0062"
FT                   /product="glycosyl hydrolase"
FT                   /note="putative alpha-mannosidase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81822"
FT                   /db_xref="GOA:Q6ABV1"
FT                   /db_xref="InterPro:IPR000602"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR011682"
FT                   /db_xref="InterPro:IPR015341"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="InterPro:IPR037094"
FT                   /db_xref="InterPro:IPR041147"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABV1"
FT                   /protein_id="AAT81822.1"
FT                   /translation="MHDHTELIQDRIGHLKERLEREITEKICPLQVTAWQVPGEPVSFK
FT                   EAAAANYQPFPPGTWWGAPWSTWWLHVTGTLPASHAGEEVDLSVDLGFVGDWAGNQSEA
FT                   MVYTANGRPLKALNPRNHRIGLNHGALAARFTKEGEPLIGADGDVELWVEAAGNPDMTQ
FT                   HLGGPTELGDRRTAGHEPLWQFKGAELSVRRNEVWGLWLDIDVLDGLMRQLPAESTHRA
FT                   RLLRGLEQAADEVDHQGIVAGAGPARQILAGYLDSGANSSAQQMTAIGHAHIDSAWLWP
FT                   LRETRRKVVRTFSNVVALAQEYPDFHFACTSAQHYAWLQESSPELFERVQEAIERGQWH
FT                   PVGGMWVESDANLPSGESLVRQFTSGLRWMREHLGVRPDCLWLPDSFGYTGALPQIARL
FT                   AGMRWFFTQKLSWNTANTLPHHTFWWEGIDGTRIWTHFPPVDCYDCVVSAQEVKKAEAN
FT                   FKEKGVARRSILPFGYGDGGGGPTAEQVERARRFADLEDAPQVRLGSPDDYFDQAQEDH
FT                   PQASVWRGEMYLEFHRGVYTSAHPLKNGNRRAEVGLAAAEWLAVMAARTGHPYPYQQLE
FT                   QLWQRTLLLQFHDILPGSSIAWVNQEAIAEFTAIRAELNQLMDDAWQALLQASGGETVG
FT                   VSLVNPSQADRREVLTVSDRPVLVQVPAMAAKSLTDAVVDPEHPVHVQRGRDAIRMTNG
FT                   LVDVCIDTRDGLVNSIVDLVSDRELLLSGQRANRLVLHPDYPDCFDAWELQQQYRHSGD
FT                   PVDRVTDLRVTESLLRAQVRVERHADQSSFVQTITLDADSRAVEFSVDVDWAERARVLK
FT                   VDFPLDVAARSSRDEIQFGHIGRPIEANTSWDDAHFESCGQQWMLLAEPRYAVALVNQS
FT                   SYGHDVSPAGGDEHTPTMGVMARLTLLRSPQSPDPHPDQGCHHLVYSLLTDARVESAHV
FT                   EAARLNQPLQVRSGTVELPSTARIEPVHGTAVIDAVKQAFDGSGDLVIRIHEAEGARSR
FT                   VRLLLDRDGCVSEVDLLEDPIDEPTQQLPASTCSRVELTLRPFQILTLRVSQR"
FT   gene            64754..65809
FT                   /locus_tag="PPA0063"
FT   CDS_pept        64754..65809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0063"
FT                   /product="hypothetical membrane-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81823"
FT                   /db_xref="GOA:Q6ABV0"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABV0"
FT                   /protein_id="AAT81823.1"
FT                   /translation="MKLLLVCIDGLRLDIALPEALQRDPGFTHPDHPADPRFVRGVGQG
FT                   EPVPEHPAPALDHTLPVDRAPKNLAPTLARLVRGDDRSQGTIIPMWMTPPTDSAPGWTT
FT                   ILTGATHEQCNVWWNEFVGHDLARHPDILSQVFFANPSARTLAAATWDAFVSPYGPGPI
FT                   IHQRVDQQRTGQHQLFGPDLSQGIDRADEQVSSWAAWHLLHEGPDAAVVYFEGVDHAGH
FT                   SFGADSEQYQQAVGHVDELTRHLVKAVAERHEQLGEQWLVAVTTDHGHKPEGGHGEDEV
FT                   EVRRSFLAAHHIGGTLPEPLLRTAALRSHEVTPLLLQAMGVHPGHMDASDVGVLRDVEP
FT                   IGPSREMDFEW"
FT   gene            65803..66447
FT                   /locus_tag="PPA0064"
FT   CDS_pept        65803..66447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0064"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81824"
FT                   /db_xref="GOA:Q6ABU9"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABU9"
FT                   /protein_id="AAT81824.1"
FT                   /translation="MVTMYPPQQVDAVLFDMDGTLLNTLSAWCVASEHLWGTSLADADS
FT                   AKVDGGTVDDVVELYLRDHPQADPQATVERFMDILDANLAGNTEPMPGADRLVKRLSGH
FT                   VPIAVVSNSPTRLVRDGLASQGWLELFDTVLGVDEVAAGKPAPDPYLTAARRLGADPSR
FT                   CVVIEDSAFGLRAGRAAGAWVLTVGRRLKGQGDMWVSGLDDERVTSWEPHR"
FT   gene            66444..67739
FT                   /locus_tag="PPA0065"
FT   CDS_pept        66444..67739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0065"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81825"
FT                   /db_xref="GOA:Q6ABU8"
FT                   /db_xref="InterPro:IPR008313"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABU8"
FT                   /protein_id="AAT81825.1"
FT                   /translation="MRACELTPALRQRLDEIGAKISQGVGKGLDEAMGRQAASRFVAWM
FT                   TDTWTRTMSRDEHGVFVVTGDIPAMWLRDSSAQLWPFLIMCDLPEVTRQIGDVIARQWH
FT                   CIDVDPYANAFNSGPTGAHFDADDLDVADELWERKYEVDSLAFPVDLAWRYWQATGSPE
FT                   HLNGAVHQGCIRIIDVWSLEQDHARSTYRHVRPAEPSDTLGRDGSGTPVGHTGMTWSGF
FT                   RPSDDACRYGYNIPAQFMAMRALRQIREFCRVWDDEDLVERATKLADEIDAGVRQFGIV
FT                   EDHLAYEVDGLGSVLEMDDANMPSLLSLPLTSDLGRDDPLYQSTRRWVLSAANPYLFSG
FT                   PAARGIGSPHSPKGYIWHIGLAVQGLTGDDAEARDCLETILATDGGTGWTHESFDPTDP
FT                   TRFTRGWFSWSNSMACLLMMNVAGIDAIIGAN"
FT   gene            complement(67723..69261)
FT                   /locus_tag="PPA0066"
FT   CDS_pept        complement(67723..69261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0066"
FT                   /product="glycosyl hydrolase"
FT                   /EC_number="3.2.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81826"
FT                   /db_xref="GOA:Q6ABU7"
FT                   /db_xref="InterPro:IPR015882"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025705"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABU7"
FT                   /protein_id="AAT81826.1"
FT                   /translation="MPTNDTLIRGLCPQPRQVQLTEGQFPLPSVLTWTGPDEVINAVTI
FT                   LTERLAPALDVVRATSHTDDASLTVIVDPALEAEGYRIDIDAQVRITVGSPSGARWAVQ
FT                   TLLQLLTPWVYGPGPLALKHLCLPKGVIVDAPHHSWRGAHLDVSRHFMPTSFIMNFLDV
FT                   LAVHKLNRLHLHLTDDQGWRLPVPGWPRLTTVGAWRPGTVRGHQPPPDDNGCDDVAEHD
FT                   HIPHGGAYTVDQLRAIDERAQLLGITVVPEVDLPGHTESVVAAYPELGCGAPISHPRTA
FT                   FGVSEHHINLTDAALGFCRDVLDAVMEIFPNSPIHIGGDECPGKEWFGHKPTRTRLAEL
FT                   GITTPHQAQAWFERQICGHVVAAGRQVIAWDEVLEAGAPEEVTVMVWRDADDIARAAAA
FT                   GHDVIAAPARHTYLDHGMETGPQAPVTIDAPMTMNDVAGLHDVLAAVNSPHLLGGQFQL
FT                   WTEYLCTPAQVEDAAFPRGTSIAEQLWTGNPARPLSELEAQTRRLTAMGVNWHR"
FT   gene            69367..70302
FT                   /locus_tag="PPA0067"
FT   CDS_pept        69367..70302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0067"
FT                   /product="putative carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81827"
FT                   /db_xref="GOA:Q6ABU6"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABU6"
FT                   /protein_id="AAT81827.1"
FT                   /translation="MSVNRHPRLLTAGITFRDLVISGIDELPGLGEERYGTDFVTTWGG
FT                   VANTARIGASLGARVQLLTGLGDDPNSEMCRRELTEWGIDLTPSPINPGWTLPVTMSQA
FT                   CGTERAMTTVETALPAPLPAPNLDGVDVIVTHVSVPADAWLHDAADAGIPVIADHGFEE
FT                   GYEPGLLDAVSGCTCYTPNAAEAMHLTGVDDPVRAARALAERVPVVVVTCGGDGIVGVD
FT                   SRTGEEVHVPAVNINPVNTTGAGDAALAGLAWCWGWQVPLARKLDVAALVGAIVTSRVH
FT                   GTAGPLTPEDVLAWVPRAPERLGFLPELLG"
FT   gene            complement(70321..71691)
FT                   /locus_tag="PPA0068"
FT   CDS_pept        complement(70321..71691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0068"
FT                   /product="putative two component sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81828"
FT                   /db_xref="GOA:Q6ABN7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABN7"
FT                   /protein_id="AAT81828.1"
FT                   /translation="MEDTGSQTLPTENRSTGSRGAGVRARLNRFNPSRNNVPQINIPGM
FT                   EEVLDPKLDDGRPADTERAWWGDVTLTLIMAVVTIAPYLVSLVEWPRPEYIAALLSSMV
FT                   MVASLPMRREHPLLMMTLVAIGAAIQFFFVPFPVLSIFVVPIASYSVARWVDGHQSRWV
FT                   LWVGAVGSVIGPMRWIPTIAAGYDPSSGTPWVLLVLAMTVCAGLVLTPYAVGRRLRESA
FT                   LIDSQQRIVKAQRYRAILAEREQQARVAEERTRNEIARELHDIVAHSLSVMIVQAEGGK
FT                   ALATKKPEKAPEVLETIAETGREALLEMRRIVGVLRQDTDAEFSPSPSLAEIPDLVDKS
FT                   GVKVELKVTGEEPVVSQALGLVIYRVVQEALTNVLKHAGPSAHATVTLAYSPTAIYVEI
FT                   LDDGYGAAVQGDGRGHGLQGMRERVTSMGGQLSAGPRKEGGFRVMAKLPVQADSRQR"
FT   gene            71871..72860
FT                   /locus_tag="PPA0069"
FT   CDS_pept        71871..72860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0069"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81829"
FT                   /db_xref="GOA:Q6ABN6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABN6"
FT                   /protein_id="AAT81829.1"
FT                   /translation="MKILITGGAGYIGSTVGSACEEAGHEVVVLDDLSAGRREFVRDRT
FT                   FYEGDIADQDLLDRVFSENQIDAVVHCAAKIIVPESVDEPLTYYGNNVGKTVALLKGME
FT                   RNGVHRILFSSSASIYATDEEFKVTEESALDPGSPYATTKFMVEFILRDAAHASDLKAL
FT                   SLRYFNPIGSDPKLRTGQQIEHPTHVLGKMIDAWMEGSTFTVTGVDWPTRDGSGIRDYI
FT                   HVWDLARAHVAALEHLDEVTTDDPYQVFNIGTGSGVTVKELVKAFEEGTGKSLNVVYGP
FT                   PRPGDVAGAYTVSRRAKDLLGWSAELTQADGIRDAIAWLPERKKILGY"
FT   gene            complement(72933..73748)
FT                   /locus_tag="PPA0070"
FT   CDS_pept        complement(72933..73748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0070"
FT                   /product="regulator putative TetR-family"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81830"
FT                   /db_xref="GOA:Q6ABN5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABN5"
FT                   /protein_id="AAT81830.1"
FT                   /translation="MLQRSWPAGNTTPRDRGARRTSSPLGWNHTNTTRYTYVSEVASYP
FT                   IHPPHEWLHVHCLGILMTTTSDTPPISARRAATQARLADAAVAVFARKGVPGSTVEEIC
FT                   EEAGFTRGAFYSNFTSKDDLCTTVLRRYAEKNLATLGSSLDFPNDGHEALRDRIHGIIA
FT                   LFASTVGSDPLTAMAILEITIEAARNPRLRQAYRQVGDAITPALCHMVEQALREHAATA
FT                   TIAVSDLVEVTQAVFDFRVLAAMASGRQADIDRMTNQLTMMVLTFVHPM"
FT   gene            73685..76414
FT                   /locus_tag="PPA0071"
FT   CDS_pept        73685..76414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0071"
FT                   /product="putative membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81831"
FT                   /db_xref="GOA:Q6ABN4"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABN4"
FT                   /protein_id="AAT81831.1"
FT                   /translation="MSSLLHDLGVWCFRRAKTVVALWLVLLALLGVGVAALHGDYDDFF
FT                   TIPGAPSQVAYDKLQVAFPQASALSANVVVTVPDGTNISSKLIRSRIEKGVDELKDLPL
FT                   VTGATSPWNKYVTGMVNKDHTAAVIQVELGQNNAVTFPDSGRHDLIRVGNEIQSDLPSG
FT                   SHVYVGGQAFEATLPSLSITEVIGVGVALVVLSVTLGSLVAAGMPIVTAVLGVGVTYSG
FT                   MAILTRFTTVNSVTPMLAVMLGLAVGIDYALFILSRHRDQLRDGAEVQESAARAVATSG
FT                   SAVVFAGATVVIALIGLSIARIPFLTVMGIFAAIGVALAVVIALTMLPAFMGLMGERLR
FT                   PRRSRADTKARTAGEKERSGGIFGWWVRTVTRVPLVTILVVVVGLGALAVPMKDLHLSL
FT                   PTAAELPASNTARQTYDVLEQKFGPGFNGPVIVTADVVSSHDPMRIVNGLKADIEKIPG
FT                   VDTVALAVPNRNADSAMIQVLPTTGPADEATNNLVRTLRDHETQWRDTYGVDTAVTGLT
FT                   AIKLDVSQRLGAALLPFGIFVVGLCLVLLTLVFRSIAVPIKATVGYLLSVLAAFGVSQL
FT                   VFNRGIGLQVVNLDRLVPIISFMPIVVMGILFGLAMDYEVFLVSRMREEYVHTGDAKGA
FT                   VTRGFIGSGKVVTAAAVIMISVFVFFIPEGMNAIKEIALALAVGILTDAFLVRMTLVPA
FT                   VMALLGDKAWWLPGWLDRRLPRLDIEGEGIAHEEKLAAWPTADHTEALHAEGIGVEGLF
FT                   EGLDLHVEPRQVQAVVGSQNSVSAVLLAIGGRLPLDHGRMRSGGLLLPERASRVRRVTW
FT                   FLDASAPDFVDELRSAMTVLTHLPRRPSKRPRLFLIDHADRIVDPITRDLLESLVREAG
FT                   EAAVILGAQRRGRIDWLSPQIIHNLAEHHFESSSGGTR"
FT   gene            76411..78780
FT                   /locus_tag="PPA0072"
FT   CDS_pept        76411..78780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0072"
FT                   /product="membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81832"
FT                   /db_xref="GOA:Q6ABN3"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR023908"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABN3"
FT                   /protein_id="AAT81832.1"
FT                   /translation="MMTERSHSTIRLRWPAVVVLVLVPLLVVAGLVGTTWHTTDRLGRV
FT                   KAAVVNEDKAVKVRGQLVPMGRQLTAALMDSGSHTTDGHTVDWTLTDAQGAAEGLRDGT
FT                   YSVVVTIPESFSADATSFSANDVNKAKQALIDVTASQNSPVTDTTIAELTAQVARRSLN
FT                   TTLTSKYLENVYVGFNRFAEQMARMAGAAAKLDDGATKLADGTKRSSAGAATLASGMTK
FT                   LSGGAQRLSANGGKLTDGVSQLSGGLTTLSHKGQQLSQGADGLASGVATYTDGTGKVVD
FT                   GIGQLSAGLTTMDEKIAAATGKIDPSQLDKLAGGAGQLADGIDQFTGNLVGYRTEIRQY
FT                   ASGKKTAELSKEALSRGEADFLRRCMRSHTAQECHDLVPIVRDAMTDGYALGVRAGSGV
FT                   AVKAMAIKDPNSGKSIDDGIDELADGSSRLSRGVNEFTTQLRTGLPKMVRQVTRLHEGI
FT                   HQAATGAQALASRSQQLKAGGVKLSSGAATLAHGVDAYTAGVSKAAGSTPKLQNGVNQY
FT                   VDGVDRLSDGLAKAATGAGTFASGMTKLDSGARKLTKGTGVFSSQLAAGAKKVPTYSQN
FT                   DRTKLADVVSAPVNGDGPAIATSVAVVAVLLVLGAWIAALATWLVARTVPSGALTSSRS
FT                   TLGLLARTMSVGAVVSVAVSGGLAVIGGTALGLSVPRSIGLGSLLLLVGVMFGLVNHSL
FT                   AAWLHGLGRLISVVLVTATVAAGLASTVPAPVRWADAVSPLNPALRAVQAVVAGQNPAF
FT                   GSLVAVVAWAVVALVASMGAVGRRRQTSAKALLGSG"
FT   gene            complement(78966..80411)
FT                   /locus_tag="PPA0073"
FT   CDS_pept        complement(78966..80411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0073"
FT                   /product="hypothetical protein"
FT                   /note="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81833"
FT                   /db_xref="GOA:Q6ABN2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABN2"
FT                   /protein_id="AAT81833.1"
FT                   /translation="MTMTPPIEPGTADQRIPSLTVPEPLGATPGRLTTAAILSMTLRAS
FT                   AADHSTWRLPVVAFAVIATIILDVTGGAVMMWHLPGDNSGFYKLTSTIAVILLVLPLMT
FT                   LAASAARLSARRRDDRLSSLRLVGASSHLLRVVALTEAGLQALVGSILGITGYVLCLPL
FT                   LGQLSFNGGKVGADSILLRPIPVAGVILTLVLLALVSSAIGLRKVDVSPLGVRMRSQPR
FT                   SVSWVRLAIGGAIVLLIVFSKAVLGFLGHQTGMVGVYVFIAVILAAVVELANIIGPKLL
FT                   AMYFQHRLQRAKDATDLVAARQVLENPRAAWTQVASLGAVCVVGMLGGTGAAMMQTINN
FT                   DPPATKSARIVGGDLQTGVILLIIFAFATVACSVGVNQASAILDRRSVEVGLDVVGMDL
FT                   QTQDKVRRITVISPMRFAMVTGIIATGLLLVPATGIALITRPATVLVTVATIVAGAGMV
FT                   RLGLWATRPTLRRVIDDGLARTE"
FT   gene            complement(80414..81175)
FT                   /locus_tag="PPA0074"
FT   CDS_pept        complement(80414..81175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0074"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81834"
FT                   /db_xref="GOA:Q6ABM0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABM0"
FT                   /protein_id="AAT81834.1"
FT                   /translation="MDAMLTTTRPHPRAADTTIRGAHLRALGLTKTYGMTRALDHIDIA
FT                   IPAGQSVAVMGPSGSGKTTLLHCLSGILSPDSGSIELALPDRTVNVENLSNEGRAKLRR
FT                   QSLGFVFQQGMLVPELTAVENTALPLMLNGVSRTDAVRYATQWLESMGLGGMEDRRIGQ
FT                   LSGGQAQRVAIARSQVIDPSIVFADEPTGALDSATAIEVMAILLSATTGRGRTLVVVTH
FT                   DEDVARRCQRILHLHDGRIVSDDVRHSDGRW"
FT   gene            81438..82250
FT                   /locus_tag="PPA0075"
FT   CDS_pept        81438..82250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81835"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABL9"
FT                   /protein_id="AAT81835.1"
FT                   /translation="MQGGGMEIIDYFGLWEHDRSCDPQRRTLEEEREFWRCYARVYDQH
FT                   AGETGGSLAQIAAVTEIVEPGSSVLDVGGGTGRFAIPLAQRGCRVTVLDRSEDMLSVLE
FT                   SSAEEKDVEIDVVHQEWPADLGCQFDSVMAAWSLYWNLDLQASLQAMVRQTKKHLIIID
FT                   TTGSPTVWDHALAVARGGGIVASQARHLLFAGGLAQLGIPAEIRVLEEYRVIGETELER
FT                   EIDAHGGSKVAAMEYLDTHAVRIRSGWRYKRTVGLIHAQGKNIPARNL"
FT   gene            82471..83481
FT                   /locus_tag="PPA0076"
FT   CDS_pept        82471..83481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0076"
FT                   /product="periplasmic binding protein"
FT                   /note="putative hemin-binding"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81836"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABL8"
FT                   /protein_id="AAT81836.1"
FT                   /translation="MVRKRVRMTALIAAMAMPIFSLVGCGSAVTDPSISKASTATLPVM
FT                   QGHTSYPLTVTSCGVSQVFESAPKRAVTLTSTATETMLELGLEKRMVGTAYQRNRPIGS
FT                   QYKKAYDSIPILASGQPSMEKLLSVNPDFVYSGYPDGFSKSNGHTREDLKKLGIKTHLS
FT                   PVGCSDQVKNLEDETKEIRTIGQIFDVNDKAEKAVRRFNSKVSSVKNSVKGKDRPKVFL
FT                   YNSGIEAPITVGGWAYASVMIDAAGGENIFAHEPLRWGKMSWEQVAKADPDMILIYDYK
FT                   TPSVDQKIKTLKSIPALKDTKAVKNNAFPVISLSLAQPGPRSAEGIEQLAKQFHS"
FT   gene            83628..84650
FT                   /locus_tag="PPA0077"
FT   CDS_pept        83628..84650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0077"
FT                   /product="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81837"
FT                   /db_xref="GOA:Q6ABL7"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABL7"
FT                   /protein_id="AAT81837.1"
FT                   /translation="MVLILVFVTVLLFVLGTALSIGSVQVPFTMVWKVVAHRVFPEGVI
FT                   SVEWTPAIDRIVADTRLPRVLLAAVAGMALTTVGTVVQALLRNPLANPTILGVSSGAAT
FT                   GAIAVMRFGLLIGGTVSLGLAAFGGAFLTLLLVIMVARQRQTMTAGTLILTGTAVSALL
FT                   SAVNNFMVLTSPDPQLASQVLFWSLGGFGAAKWENLLFPSGVLAIGIILCLAQASNLNI
FT                   LLAGEESAGSLGLNVNRFRTWMFAVAAAIVGVTVAVCGVVGFIGLVMPHITRLCVGADH
FT                   RRILPIGLLLGAIFTVLADLGARMVIRPQELPVGIVTALVGAPFFLFLLRRNGGRRKND
FT                   "
FT   gene            84643..85410
FT                   /locus_tag="PPA0078"
FT   CDS_pept        84643..85410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0078"
FT                   /product="permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81838"
FT                   /db_xref="GOA:Q6ABL6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABL6"
FT                   /protein_id="AAT81838.1"
FT                   /translation="MIKGAKLVVDNLGVDIDGHCIVDGVNFCARPGDVVGILGPNGSGK
FT                   STILRSIFHSRKPARGSVTLDGVDVWSRDAKWSAQHICVVLQETPAELPLTCGEIVRMG
FT                   RAPHKRSWQSLGAGDLELCHAAMEVMEVDNLAGSSFSRISGGERQRVTIARALAQQTGM
FT                   IVMDEPTNHLDIHHQLKLMHLLRRLNATTVIALHDINLAGRFCDTLVLMSGGSCVACGA
FT                   PSTVLSPNVLDDVYHVKTDVVRQPNGTVHVTIL"
FT   gene            85493..86950
FT                   /locus_tag="PPA0079"
FT   CDS_pept        85493..86950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0079"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="putative succinate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81839"
FT                   /db_xref="GOA:Q6ABP5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABP5"
FT                   /protein_id="AAT81839.1"
FT                   /translation="MMTNDRSLPSDLPTQLLIDGEWVDAEASRTFDVINPATEKPLVAI
FT                   ADASVDQGTDALDAAVRAQHSWADTAPRERAEILRKTFNLVTERKDDFARLMTLEMGKP
FT                   LAESYGEVTYGSEFLRWFSEEAVRIRGDYGLLPEGNIRQLVTKRPVGPCLFITPWNFPL
FT                   AMATRKIAPALAAGCTVVIRPASATPLTTLLLAKTFLEAGLPAGVLNVITGLDHAVTDA
FT                   ILEDPRLRKLSFTGSTGVGANLLGKAAKHVLRTSMELGGNAPFIVFDDADLDQAIIGAK
FT                   GAKMRNMGEVCIAANRFIVHESVAEEFTDKMIEMMSGLVVGDGLDEKSEVGPMITERDR
FT                   EKVDGLVRSAIEAGATLRCGGEIPEDKGWFYPPTVLSGVPADAEIMQTEIFGPVAPITT
FT                   FRTEEEALALANSVPVGLAGYVFTSDTARILRMGQKLETGMIGANLGVFSNAAAPFGGV
FT                   KESGLGREGSYQGIEEFLETIYVALPA"
FT   gene            86995..88281
FT                   /locus_tag="PPA0080"
FT   CDS_pept        86995..88281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0080"
FT                   /product="chloride channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81840"
FT                   /db_xref="GOA:Q6ABP4"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABP4"
FT                   /protein_id="AAT81840.1"
FT                   /translation="MVTSRIRFVAAVVLTGLASGLIGGLTSELSHLIEVCAFGVPFSSS
FT                   TTGVGEVVMWRRLVAPIMGALIAGLTWRWLRPFPSGSITSVRQAIDSPTRLRPVETIVD
FT                   ALAQLVVVGSGSSLGREAAPRQMAALAAQGLSDTFRVDVATRRVVLASAAGAGLASVYN
FT                   VPVAGALYALELTVRPDLRTKRGWGQVGIAGVISVLSTVTAWLLNHDRPIYRSPAATVT
FT                   GPGLGWMVLVVAVSTVVGAGMGVLFGEMKRRVPVTSRLWWTVPLGSAGVTAIALAAPQV
FT                   VGNGQVIVNLVLAHPVAPASLVILLVGKILATTVALRSGAAGGLLTPSLSAGALVGALV
FT                   AVVAGIDAPSQIAMMVIVGAGCVLSMTQRAPLFAAAFALELTRAGALGIPVVVAAVMLG
FT                   WTGFVLVSRRGLGLHGRIGRAPGHTSDPR"
FT   gene            88336..90702
FT                   /locus_tag="PPA0081"
FT   CDS_pept        88336..90702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0081"
FT                   /product="carbohydrate phosphorylase"
FT                   /note="putative glucan phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81841"
FT                   /db_xref="GOA:Q6ABP3"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABP3"
FT                   /protein_id="AAT81841.1"
FT                   /translation="MTQDLASAIAFQVRSTSGRSVTASTPMEVWQGLSACVVGRIADDW
FT                   QATDAAYKAERQEHYFSAEFLMGRALLNNLSNLGLVNETREALASFGIDLSEVLEQEPD
FT                   AALGNGGLGRLAACFLDSCATLELPVTGYGILYRYGLFKQLFDNGFQTEHPDPWMEEGY
FT                   PFVIRREEQQRIVRYADMWVRAIPHDMPITGYGTRNVGTLRLWKAEPMEQFDYQAFNSQ
FT                   RFTDAIVERERTSDISRVLYPNDTTFEGKVLRVRQQYFFCSASLQEIVDNYIEHHGEDL
FT                   TGFAKYNSIQLNDTHPVLSIPELMRILLDEHGMGWDEAWEVVTHTFAYTNHTVLAEALE
FT                   KWEMQIFDRLFPRISEIVREIDRRFREDMNKRGVDGQTIEYMAPVSGNQVRMAWIACYA
FT                   SYSINGVAALHTEIIKRETLKEWHAIWPQRFNNKTNGVTPRRWLNQCNPRLASLLSEVT
FT                   GSDTWVKDLSVLANYTDSVDESVYDRINEIKHANKVDFAAWVAEREGVKIDPDAIFDVQ
FT                   IKRLHEYKRQLLNAFYVLDLYFRIKDDPSLNVPKRVFVFGAKAAPGYIRAKAIIKFINE
FT                   VARLVNNDEDINGRIKVVFIHNYNVSPAEHIIPAADVSEQISMAGKEASGTSNMKFMMN
FT                   GALTLGTLDGANVEILDAVGDDNAYIFGATEEQLPSLKRDYDPRWHYENVPGLKRVIDT
FT                   LTDGTLDDNGSGWFHDLRQSLMEPGWEVPDVYYVLGDFASYRDVKDKMAADHADARGWA
FT                   RKAWVNVTKSGRFSSDRTIRDYAEQVWKLEPVRAE"
FT   gene            complement(91144..91779)
FT                   /locus_tag="PPA0082"
FT   CDS_pept        complement(91144..91779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0082"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81842"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABP2"
FT                   /protein_id="AAT81842.1"
FT                   /translation="MLAWVILADQVDSRRHNDEVPHLLTALTSPGLLVSPTGYTVGTPQ
FT                   WVLPPERTSGDEVQALTTDPASLIHAVWTSGSGPWRIGVSHGEVDTPLPDSTRAARGPA
FT                   YISAREAIDECRRRRAAIHVFADGTDGMRRFSQVAQVVVDLARRLRPAARDVAKFYDLS
FT                   MSSDETARALGISTSAVSQRLTRARWEYLVGIRQLAVDLAQEAQWPSP"
FT   gene            complement(91967..94183)
FT                   /locus_tag="PPA0083"
FT   CDS_pept        complement(91967..94183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81843"
FT                   /db_xref="GOA:Q6ABP1"
FT                   /db_xref="InterPro:IPR012711"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035080"
FT                   /db_xref="InterPro:IPR035356"
FT                   /db_xref="InterPro:IPR035363"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABP1"
FT                   /protein_id="AAT81843.1"
FT                   /translation="MSSSTSQTTSRAGRLTLPVEKGMDAQVAELLERLQADAVRNSDGT
FT                   ELPEIVNKLATKIYQTYFVGRGDQDWAQTHPRELTRIYLMSERTPALADGELSIDLMTN
FT                   WFVDQVYPDTDCDVERWWQVIDRTTGDVIAPGAWHVDPADLSVTMDQAQAGHVYTVGFL
FT                   AVQRWDPTQMYNYLTNGWADDPQRIKESPYDIRYPQTWQHVRHALDQWLADNPQVDVVR
FT                   FTTFFYHFTLVYGSDGTERFVDWFGYSASVSVPAMEAFEKRFGYPLQAEDFIDEGWYNS
FT                   PFRVPRKSFRDWVSFQHEFVTSRMAELVEQVHAAGREAMMFLGDNWIGTEPYGPHFAHT
FT                   GIDAVVGSVGSGATCRMISDIPGVRYTEGRLLPYFFPDVFYPGGDPVTEANASWLAARR
FT                   AIVRSPLDRIGYGGYLSLAVQHPEFVDRMEEIVNEFRAIHAAAAGQRPIATGPRVAIVN
FT                   CWGALRSWQTHMVAHALHYRQAYSYLGVLESLSGLPLQVDFLSFDDIRNGVPEGVEVLI
FT                   NVGAAGTAFSGGSEWADERVTSAVRRFVAAGGGLVGVGDPTAHPARGAVYQLSDVLGVD
FT                   RELGWGLSTHRPMHTSDHHFVTLDLSSRLDVGEGTPDVFCASATTTVLAAHHEQVDLAV
FT                   NQFGCGRAVYLAGLPYSSQNARLLHRALAWAGHREDAFTTWTSSDVRAEVAVYPHSDRL
FT                   LVINNSLDQVTTTVSTPTTVREVHMEAAGHLWFDLELHPLDIPG"
FT   gene            complement(94313..95524)
FT                   /locus_tag="PPA0084"
FT   CDS_pept        complement(94313..95524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0084"
FT                   /product="transcriptional regulator, Rok family"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81844"
FT                   /db_xref="GOA:Q6ABP0"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABP0"
FT                   /protein_id="AAT81844.1"
FT                   /translation="MHSAVVGAEPIDHGTMRTINLALLLGTLRSGPISRAELSRRTHLS
FT                   KASITSLAAELAARGLVREGSPDRNGTVGRPGTMLTLEGARVCGVGLEINAEYLAVCVV
FT                   DLCGTVLYDRAQPFDVASLPISDVLDEVAGIMRDTLEQLHSARRHVAQVMVSAPGVIKQ
FT                   PAGTVHLASNLGWRDVPLRSQLLQRLDADISLQVENDAKLAAVAEYRRYEDSDVRDLVY
FT                   LSGDIGVGAGIIAAGQLMRGWSGFSGEVGHLHLDPRNLPCHCGRTGCWEARVGLPEFLA
FT                   HTGDRLGAQPIDRLLTQIQDRATRGDQQVLNALDDLATSLAEGLSVVIDMLNPRVVVLG
FT                   GYFSWFTDFLIPPIAADLTARRLDPGAGALLAGAQLGMVSSAHGAALTALDSVFVNPLS
FT                   VPQC"
FT   gene            95889..97232
FT                   /locus_tag="PPA0085"
FT   CDS_pept        95889..97232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0085"
FT                   /product="periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81845"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR022387"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABN9"
FT                   /protein_id="AAT81845.1"
FT                   /translation="MQLTRRAFMVGLAASAATVPLAACSPGSRTTASTSGGAGKASGVI
FT                   KVAAFENAYGAAIYKQVAEAFEKATGAKVELTVSKTIDQELTPQVAAGNFPDVVFMGVG
FT                   GKTGFTDKFVQNKSLEPLNDILKITNKGETTTIGDKLLPGMVGNLTTNPYDDDRLMLAP
FT                   TFMAPAGLVYNKTLFTKNGWTLPATWDEFFALGDEVKAKGVSLFTYPTAGYFDTFFFAL
FT                   LSSIGGDDYFKKVMSYEKNIWTGSEATQALNLVGKLLTQYTLPQTVGYANNQDYTKNQA
FT                   ALMADKALFCPDGSWVAGEMKDAPRSAGFAWGLTTVPAMKKEDRHLTSFIESVWIPSGA
FT                   KNKASAKTFIAWLYSDKATGLFAKAGAAMPTKTGTKGLPAEVAPFYTVYDEPGLKSTIG
FT                   GFKSAKAVPGIDMKTALLDSVDSVASGKLSVKDWQAKVNEASNKLGGY"
FT   gene            97276..98211
FT                   /locus_tag="PPA0086"
FT   CDS_pept        97276..98211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0086"
FT                   /product="putative permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81846"
FT                   /db_xref="GOA:Q6ABK9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABK9"
FT                   /protein_id="AAT81846.1"
FT                   /translation="MTLPIATVPAGRRARRRTPMGGGGPFAALCILPALVLYVLFLVYP
FT                   TLNVFHMSLFDWNGLGNAPSFIGLDNFAALIHDPAFVRAFENTLFILVVVTIVTICSSI
FT                   FIAAVLTRETLVGAGWYRFVLYLPSVLSIVVVAAIFSAVFDQNNGLVNGLLQALGLGHG
FT                   PVWLGDQNVVMYSVAIAMVWQSLGYYVVLYMAGMSSVPVEIYESASLDGAGRMTQLGSI
FT                   TIPLIWSNIRTTLTFFVLSSVNLAFVLVKALTDGGPNGSLEVLLNYMYKQAFTNSAYGY
FT                   GMAIGVVTFLFSFLVAMLISHVTRREVLQY"
FT   gene            98211..99092
FT                   /locus_tag="PPA0087"
FT   CDS_pept        98211..99092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0087"
FT                   /product="permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81847"
FT                   /db_xref="GOA:Q6ABK8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABK8"
FT                   /protein_id="AAT81847.1"
FT                   /translation="MSAVPTPSRADRRYRLAAHALLVIISILIIVPVAWVVMAAFKTKP
FT                   EFFGSPWRLPDGLHWQNFVDAFVTAKMGIYFTDSLFVTVLGLVFSLSVAIPAAYAIARV
FT                   PFRGRALVEGFLMAGLFINVNYIVVPIFLMLLGWDQALASWLPNGFFIDNLAVLALVYA
FT                   ATSLPFTVYLLVSFFRTIPAIYEEAAALDGSSRLRTMLSIMVPIARPAISTVILFNFLS
FT                   FWNDFIISLTLIPGEHKTLQVGLLNLFQAQRAAADYGRLYAGMVIVMVPVLLLYATIQK
FT                   RLVTGIGGGGLK"
FT   gene            99230..100351
FT                   /locus_tag="PPA0088"
FT   CDS_pept        99230..100351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0088"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81848"
FT                   /db_xref="GOA:Q6ABK7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABK7"
FT                   /protein_id="AAT81848.1"
FT                   /translation="MPWASSSPCSVSTTADTCDMSASGFSPPLTGRAPTMADVAKRAAV
FT                   SPQTVSRVVRGQTNVSEVTRLKVELAIDELGYRRTGIARALVTGHTMTLGVLTQGSVAY
FT                   SRAAYVDAMTSAARRHGYYVAAASVTSTAPEAVCQSIEHLRQQGVDGIVVAVPVYDVDA
FT                   LAQAARGLPAVVFGGSSSEAVPDGFSDGTGHHAVCIDQERIGVLATEHLLGLGHDTVWH
FT                   VAGPSTWADASGRQAGWAATLAKHGRPEPPVLIGDWSAESGWRLGTLLARMEEVTAIFA
FT                   ASDDMAFGILRALVDRGRRVPEDVSVVGADDVPLAAFAPVALTTVRQSFQDLGTAAIDL
FT                   LVDMVERPDREHHGVLMEPELVLRSSTAPRHAG"
FT   gene            100341..102530
FT                   /locus_tag="PPA0089"
FT   CDS_pept        100341..102530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0089"
FT                   /product="conserved protein, glycosyl hydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81849"
FT                   /db_xref="GOA:Q6ABK6"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR016518"
FT                   /db_xref="InterPro:IPR027414"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABK6"
FT                   /protein_id="AAT81849.1"
FT                   /translation="MLAESWRLHYRSPAAKWEAHGLPIGNGRLGAVLRGEIARDVVQFN
FT                   ENSLWAGSNNYANGLCGVADDVFDTSMHGFGRYLDFGRVTISFADLDESTVSGYERALD
FT                   LRHAVAYACFDAGGVRHQRSAFASREADVIVLRYSASAPFGCTVRLESAQGVPSRVAGD
FT                   TSVVFDGVLGNGLRYCASLVLLECDGRSIAHGDRIVVEDATTLALVLDAGTDYALSAVA
FT                   GWRGVNPRPVVDERICSATALGWERLHDAHVTKLSAVMDRCRLRWGRPVPELDAQPTDV
FT                   RLRRYRDGAADVGLEQLAVVLGRYLLVSSSRAEGLPANLQGLWNDSNDPAWGSDYHTNI
FT                   NVQMNYWGAEVTGLSEEHIALLNFMEEVAVPSRSATRAMCGPDVPGWTARTSQSPLGGN
FT                   GWQPNTVASAWYAHHVYEHWAFTRDDEWLRTRGLPMLAEICRFWEHQLVERDDGMIVAP
FT                   AGWSPEHGPREDGVAYDQQIVWDLFTNLLECSRALGVEDDLYYRVERLRDRLAPNQVGC
FT                   WGQLQEWQDDRDDPTELHRHTSHLFAVYPGRQITTDTPELQAAALVSLKARCGEPPPVA
FT                   GAPTVAPFRAEMVVGDSRRSWTWPWRAALFARLGDGYRAGEMVRGLLTYNMLPNLWTTH
FT                   PPFQVDGNLGLVGAVAEMLLQSHDGRIRLLPALPPAWEAEGEAIGLRARGGYRVSMQWR
FT                   DGQVIWFEIVADRGHAEDVIVVVNGREHRIRPDKR"
FT   gene            102809..104017
FT                   /locus_tag="PPA0090"
FT   CDS_pept        102809..104017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0090"
FT                   /product="6-phosphofructokinase 2"
FT                   /EC_number="2.7.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81850"
FT                   /db_xref="GOA:Q6ABK5"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012829"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABK5"
FT                   /protein_id="AAT81850.1"
FT                   /translation="MIATMDRSVVGAIHGRMGTTRHRSGVVMSKKKKVGILTAGGDCPG
FT                   LNAAIRGFGKAAIRQHDMELIGIQDGFLGLAGNRTISLDPRALSGILTVGGTILGTSRD
FT                   KVNHMIIDGEERDMVPTIVENYEKLGLDALVTLGGGGTAKNAYKLAKAGLNVLHLPKTI
FT                   DNDIVGTDDSFGFSTALEIATEAIDRLHSTAHSHHRIILAEIMGHRAGWLALGSGIAGG
FT                   ADVILLPEVPYKLDSIVQAVENRQKQGLNFSVIAVAEGARDEADSAAMAGAQALVDASK
FT                   TSETKAAAKKAKKDLEHSMRDNTLKLATQLEEATGLESRVSILGYVQRGGIPCAHDRLL
FT                   ATRLGTVGAKLVDDGEFGIMVAAQGGDATTVPLKDVAGKVKYVPADHPWVKAARQVGTG
FT                   LGD"
FT   gene            complement(104055..104636)
FT                   /locus_tag="PPA0091"
FT   CDS_pept        complement(104055..104636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0091"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81851"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR025159"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABN1"
FT                   /protein_id="AAT81851.1"
FT                   /translation="MSTRHDDTASLVDPGSQKRIDEVADALRRRGGSATSAELASDLGI
FT                   HPSTARFHLDRLVEQGRVEATRRHRATRGRPHTVFTLVSDEGPRAYRLLAQMLVDEVAI
FT                   SNNPTAMAMRIGQRWGRHRRGDLIAVLDDMGFSPAAEEGGIVLRHCPFLDLARDHPQVV
FT                   CSLHCGVVEGVTGQAATIDANPGVRCVIHT"
FT   gene            complement(104633..107374)
FT                   /locus_tag="PPA0092"
FT   CDS_pept        complement(104633..107374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0092"
FT                   /product="conserved membrane protein"
FT                   /note="Cu-oxidase domain"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81852"
FT                   /db_xref="GOA:Q6ABN0"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABN0"
FT                   /protein_id="AAT81852.1"
FT                   /translation="MPEITSAPVGRKPDTNKRSWHRKASRPVSGWLVALLIVAVANPWI
FT                   PQSRWLLVHMVTLGVATTSIMVWGQYFTEAILHNNLTDTDRSRQVLRIRLLAVGIVITC
FT                   IGMVVTWPWITVTGAAVIGSTLTWYAFALGHQVRHALPGRFDSTVWFYCAAACLLPLGA
FT                   TLGAIMAFSPTEPWRTRLLVAHQALNLLGFVGLTVVGTLITLWPTVLRTKMQPAQDRHG
FT                   KISLCVMFVAVAATTTGALCRLWWLAALGVTAHIVGICIVLGDLVACAAHEPPRDFPGF
FT                   TMGAAICWMLVWLAWLAWKLASNGTRLLADDIFTLSVPVIVGFLLQLLIGAMSYLMPMV
FT                   MGGGPKIVRATNAKMHAYGALRATITNAGLLLWVLAMGTWTRRIGMVLTVVGLATFLPA
FT                   TAAMVRTGVPMLKEKGRQMAARKAASEKGEAPDPDNGPAQAAPVASLDRSATSKPAEPA
FT                   PTAPPDRRSFVGAFAGLATALTAAAVGHHLDQTTLTNDTNGSAAVVGHVAPTGHTTTVN
FT                   ITAKGMKYHPSTITVPAGDQLVVEITNKDPNQVHDLQFANGAHSSRLAPGDHATVKVGV
FT                   ITGPTEGWCTVVGHKSMGMVLDVQVDGMSGVHDRDDHVDSADPRRRIDLTKAPGKDFRT
FT                   RDAVLPPLMTGRVHRMTLIAQESVQEIAPETTIDAMTYNGRYMAPVIHARIGDEIRVHL
FT                   VNRGTMGHSLDFHAGTVSPTRVMRTIAPGQELDYNFTLHRAGIWLYHCSTAPMSAHIAA
FT                   GMFGAVIVPPHDLPRADREFYLVQSETYLSEHNGAEVNTAKIANETPDLTMFNGHANQY
FT                   VFEPLKARVGGRVRIWVLAAGPSRGCSFHVVGTQFDTVFKEGAYTLKRGNPEGGGCQAL
FT                   DLASAQGGFVEMVFEEPGRYTFVNHSFVEMERGAKGFIEVTT"
FT   gene            complement(107367..108500)
FT                   /locus_tag="PPA0093"
FT   CDS_pept        complement(107367..108500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0093"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81853"
FT                   /db_xref="GOA:Q6ABM9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABM9"
FT                   /protein_id="AAT81853.1"
FT                   /translation="MPTSSAGSHRAWLMVGAGISLLAGLDGALLLLGVWSPVMSTRLSK
FT                   WHGPLMVLGFVGTVICLERAVALGHRLAYLVPAMSGFGVIVLLAPLPFDSARAGLALLT
FT                   LAQLGLLTIYVPLWRRSHDDAVVIQGAGAFCAAGAAALLTTGAHVSQIVGWLACYMILT
FT                   ICGERLELSRLTMARNRALSALCLAVVAALLVSVVSPAIGWRVLGVVLIGLAVWLCRHD
FT                   VARGGLRRGGQAAYIGTLLMIGYLWLATAGIVCTIQGPPTSRNGYDAVVHSLFLGFTMG
FT                   MILGHAPIILPAVLQVRLEWTTWFWLPAFLLEASLLVRIGIGDGLDRSAAVQAGGTVNV
FT                   LSLLTLVAVIATHIQPRTRARTHLKSTPRSRSGEDHA"
FT   gene            108930..110402
FT                   /locus_tag="PPA0094"
FT   CDS_pept        108930..110402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0094"
FT                   /product="aspartate ammonia-lyase"
FT                   /EC_number="4.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81854"
FT                   /db_xref="GOA:Q6ABM8"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABM8"
FT                   /protein_id="AAT81854.1"
FT                   /translation="MTEIRIEEDLLGKREISNEHYYGIHTLRALENFQISRGCMNDEPD
FT                   FIRGMVQVKKATALTNKQLKVLPSDVADAIVAACDAILDDGRCMDQFPTDSFQGGAGTS
FT                   INMNTNEVVANLALEMLGYPKGTYDVIHPNDDVNKSQSTNDAYPTGFRLGVYALLEGLK
FT                   RAVADLADSFDAKAEEFADVLKMGRTQLQDAVPMTLGEEFDGYAHNIRAELDRLDIGSD
FT                   LLVEVNLGGTAIGTRINTPDGYAELAAEKLAEVTGYPIRPSTNLMESSYDNGAYIAVHS
FT                   IIKRLAAKISKICNDLRLLSSGPRAGLKEINLPEMQAGSSIMPAKVNPVIPEVVNQICF
FT                   KVFGNDVTVCFAAEAGQLELNVMEPALSQAMFESIHLLTNACDTLRSKCIDGITANVER
FT                   CREYVTNSIGIVTYLNDVIGHHQGDLIGEEAARTGKSVREVVLEHDLIPEERLDEIMST
FT                   QNFLHPRYSGRTYEPSDRGLPEDPRTFVSERC"
FT   gene            110409..111707
FT                   /locus_tag="PPA0095"
FT   CDS_pept        110409..111707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0095"
FT                   /product="C4-dicarboxylate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81855"
FT                   /db_xref="GOA:Q6ABM7"
FT                   /db_xref="InterPro:IPR004668"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABM7"
FT                   /protein_id="AAT81855.1"
FT                   /translation="MMLFIQLAVVLLFIFLGARKGGLGIAYAGGAGVIVLGLLGCKVDP
FT                   GTGIPWDVIGVIISVISCVAAMEVAGGLELLVMLSERILRHNPKRITFLAPTVTFFMTV
FT                   LCGTGHVAFATLPVIAEVAKEQKVRPSRPLSIAAVASQIGICASPISAAMVAMAAIVGP
FT                   LGVSYPKLVLVSIVGGYVGSMIGAVVSSKLGCELELDPVYLQRLEKGQISHREADNYNI
FT                   KPYARRSLIIFVVSLVVVMAYAAAITAVDKPPLPRGAAIMTFMMTAALVIATLCKVPLN
FT                   EITSQATYKSGTSAAICVMGVAWLGNTFVSSNIDTIKAAGSGVIHSAPWLLFVVLFLAA
FT                   SLLYSQAATTVTFMPVAAALGLPASVLVGCFAAASALFLLPTYPTVVAAVEMDDTGTTR
FT                   IGKYIFNHSFLIPGIVSISAACLASYGVMLVVG"
FT   gene            complement(111808..112098)
FT                   /locus_tag="PPA0096"
FT   CDS_pept        complement(111808..112098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0096"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81856"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABM6"
FT                   /protein_id="AAT81856.1"
FT                   /translation="MGCMSETTVTKNDQQSRYEAYIGGELAGFAEFRREGDVIVMPHTE
FT                   TFEAFSGKGVGSALARFALDDIACQNLSVRPDCTFIKGWLDKHPDHPVNVI"
FT   gene            112227..113678
FT                   /locus_tag="PPA0097"
FT   CDS_pept        112227..113678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0097"
FT                   /product="catalase"
FT                   /EC_number="1.11.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81857"
FT                   /db_xref="GOA:Q6ABM5"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABM5"
FT                   /protein_id="AAT81857.1"
FT                   /translation="MPIDPSKPSTNTNGSPAPSDEYSLTVGADGPVVLHDAHLIDTLAH
FT                   FNRENIPERKPHAKGSGAFGHLEVTADVSEYTKASFLQKGRETPMLARFSTVAGELGSP
FT                   DTWRDVRGFSLKFYTDEGNFDMVGNNTPVFFMRDPMKFPHFIRSQKRLPNSGLRSPNMM
FT                   YDYWSLSPESAHQVAYLMGPRGIPLSYRTMNGYSSHTYSWVNAEGKITWVKYHFISDQG
FT                   VHNMTADRAKAIVGDHPDIHREDLFNHIADGDYPSWTVKVQLMPYDEAKDYRFNPFDIT
FT                   KVWPHKDYPLHTIGKFTLDRNPENFFAQIEQAAFSPSNTVEGTGLSPDRMLLGRVFAYN
FT                   DAARNRLGVNYEQLPVNRPTTPTNQYTFDGQMAFEHSGSAPTYAPNSYGRDFATGYRTG
FT                   SEATWEADGELVRSAQTRHAEDDDFGQAHALVHDVFSDAERDELVDTLVDLMTNFDMEE
FT                   PVIGNALSYWRNIDAGIAEATEGRI"
FT   gene            complement(113716..115461)
FT                   /locus_tag="PPA0098"
FT   CDS_pept        complement(113716..115461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0098"
FT                   /product="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81858"
FT                   /db_xref="GOA:Q6ABM4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABM4"
FT                   /protein_id="AAT81858.1"
FT                   /translation="MSTPRSLPLATAAQVRQEVHRAARGVRGYFIGAIVVITAASLLDL
FT                   TVPVATGWIIDAAKAHRPTSALLTPALVMAAAVIGSGICNGAAQSLTPSFFTTIITRLR
FT                   ESMIAVGLGLDQQRVEKAGTADLVSRASDDVTAVRDAANGALPRLVNTMIMVIVSVGAL
FT                   ASLHPLFFVPVLLAGVLYGLAIREFLRTAPPVYRAERNASTTQSQRILSTIHGVDVVRA
FT                   FGLENLRTRAVANGSWQAIRWNLRGRFLGNTLVVRLLAGEAVATIGVAWTGYLLVTTDR
FT                   LSVGAAATAVLVLLRLFSPVRFLLMFLNNLQAAWVCLQRVVGVIQARHDKPAVSERYQR
FT                   GPTSIHVDQVSFGYQDGPDVLHTVSLDIPAGHTVVLVGESGAGKSTLAALVAGLLEPRQ
FT                   GSITMTSGHARTVLISQEIHTFSGTLFDDVALGLAGQAEDWPDERVRDAVLAALERVGA
FT                   DWVEQLPHGVDTVVGRLGIRLSPAQAQQVALARALLADPPVIILDEATAEAGSSGATAL
FT                   DRAAAEAVRGRTALVVAHRLSQVTMADEVAVMDNGRIVEVGAPEQLRQSDGPFAALWRV
FT                   WSNQH"
FT   gene            complement(115458..117224)
FT                   /locus_tag="PPA0099"
FT   CDS_pept        complement(115458..117224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0099"
FT                   /product="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81859"
FT                   /db_xref="GOA:Q6ABM3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABM3"
FT                   /protein_id="AAT81859.1"
FT                   /translation="MIRTPRRHWHPKLGWLPHIPRQTPPPIDAPLIDVTHAHDGRAVVR
FT                   RMARDGRRWLLPGSVSSAFVSLVNIGVPMALGRAIDDGVVAADAAALTGWLALVALAYL
FT                   VRAIAQTIRMQTNVGAGLAEHDLRIQALERITAPEGIGGRSRLPGDLLAVVVTDVRAVS
FT                   RAFIALTSIPGNVVTLLGALISMTLINGWLALATVCIVPLLILLSVKGVAPVKRSTRRE
FT                   RRAEAAVAGSAADLTSGLRIIQGLSAQRRATARFRTASRQGLDATLRTRRVKGVYTGTI
FT                   NASVGVFITALTVLAGWLTLAGRISVGELVTVVGLAQTLGPPLRALGVDTATMLATAHA
FT                   SGDRFCELRDSPAAWQIHPDDGARTTPGDGPVELHIPVRDFQLDVAGGTHVGVMAPQSV
FT                   CDALAEAIDHGSETVLNGVPASRLNPAQRRRLVLVAPRSPELFDDTARANIVLDSQTTV
FT                   ARLNAVVDAAALDTVVAVLPRGLETEVGEGGRHVSGGQRQRLALARALLHSPDGLVLID
FT                   PTTSIDAVTTATIARKVRQLRAGRTTIIATTSPALLDQMDEVVLLDADGRQIARAPHRE
FT                   LLARDDYREMLS"
FT   gene            complement(117221..118207)
FT                   /locus_tag="PPA0100"
FT   CDS_pept        complement(117221..118207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0100"
FT                   /product="magnesium-chelatase subunit ChlI"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81860"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABM2"
FT                   /protein_id="AAT81860.1"
FT                   /translation="MAQRPVYPFCAIVGQEEMKLALILATISPDLSGVLIRGEKGTAKS
FT                   TAVRGLAALLPQHREIPGPYHLSPDEYPTHAVALNLPEVMPEPRTVQVPVVELPVGATE
FT                   DRVTGTLDMETALREGRRRFEPGLLAAAHRAILYVDEVNLLDDHVVDLLLDSAAMGVNT
FT                   VEREGVSVTHPARFTLVGTMNPEEGELRPQLLDRFGLCVTVSGEDDPDKRTEVIRRRMA
FT                   FEDDPGGFSRTWEQDGHKLSERIQRATELVTQVVISDETLTTAARTCINAHVDGHRADI
FT                   MMVRAARTLAAWNGCTEITTEDLSQAARLVLPHRMRRQPLESVGRAV"
FT   gene            complement(118209..120173)
FT                   /locus_tag="PPA0101"
FT   CDS_pept        complement(118209..120173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0101"
FT                   /product="magnesium-chelatase 67 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81861"
FT                   /db_xref="GOA:Q6ABM1"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="InterPro:IPR041702"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABM1"
FT                   /protein_id="AAT81861.1"
FT                   /translation="MTYPFTAVVGQDEARLALLLCAVNPRIGGVILSGEKGTAKSTVVR
FT                   GLVELLPGHIMRTLALGTTEDRLVGGLDLEATLVAGRSVLQPGLLSEVDGGVLYIDEVN
FT                   LLDDHLVDLVIDACAGTVRVEREGLTASLPSRFVLVGTMNPEEGALRPQLLDRFGLCID
FT                   VHGESDPAVRAEIIRRRLDHDADPAEFDHRWQSDQNRQAAVIERARHIVAGVRLDEVVT
FT                   ELISCLCRQNHVAGHRADIVMAEATRAHAALVGRGVATEDDVLTISEMVLRHRRRVETP
FT                   SESPPPRNQHPDDQPDQPEQRPREPERPDPDVEKWQAGENLATPPSSSGEQQPEYHDGP
FT                   QNQRDDGQHDPRKQPSGSGEQVVAAGDPFAVRPLEPSQDRFARRACGRRLRTRSNDRRG
FT                   RYVSARPTDRPDDLALDATLRAAAVHQKSRRATERPDLAVHVKPIDWRAKVRAGRAASC
FT                   VIFVVDASGSMGSRGRMTASKGAVLSLLLDAYVKRDRVCLIGFRRDRAEVLVPVTSSVE
FT                   VAQHGLAELPVGGRTPLSAGLIKACEVVRPLLLKDPGLRPLLILVTDGRGNVSLDGRPN
FT                   SQATDEAIRVATKLGVDTRLSWVVIDTEDPRGIQLSRARDIATALGGPCLRIDDLRADD
FT                   LVNVVSRLDPSHQSPRKDR"
FT   gene            complement(120173..124195)
FT                   /locus_tag="PPA0102"
FT   CDS_pept        complement(120173..124195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0102"
FT                   /product="cobalamin biosynthesis protein CobN"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81862"
FT                   /db_xref="GOA:Q6ABR7"
FT                   /db_xref="InterPro:IPR003672"
FT                   /db_xref="InterPro:IPR011953"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABR7"
FT                   /protein_id="AAT81862.1"
FT                   /translation="MPRRLPIPSRGQCPCRPGTAPDSPHLPHRQHSRPSGKCIMTTLSF
FT                   FSATGGELTLVSQALSRLRTRGLDITLFGRTKDQITDPELARAFAQAAARSDAIVLSFH
FT                   GGTTSCPAWPALVEAWKNRRESGLPLPWIHIQPTSGDDDGLLAAQDWASGLDDGTWRGL
FT                   IGLLEMGGPDNVEAALRILVDRVRGGSAPIPDVIPAPTEGIWHPRHGLFTNLAEYRHHL
FT                   DPDLPTVGITFPRSYWLEHNTAHIEALIEAIKGLDANTVPFFCLRLPDARRGNPSMAQT
FT                   LETLLRDDDGNRVIDTLIDVHGMSMTAGVPANADAYPKLGVSVLHALTSYAPLAAWKAQ
FT                   GMGAMDVATQAAQPEFDGALITKFLATREVDRVDDLTGAVVPHMVPVPGRPEAMAELAL
FT                   SWARLARTSANQRKVAIVFHHHPPRNDRIGCATGLDTFESVHRLLVRMAEDGYDVPEQF
FT                   DSADDLAQVLLSSLTCDQRWLTPEQMYQRAEVHADLATSRSWYRALPASVRESMDRAWG
FT                   PHPGSLFVHHDEFSFAGHLDGNVLLTIQPPRGNFEAVTDSDIHDPLLPPPHHYLAHYRW
FT                   IRDVFKADAVIHVGTHGSLEWLPGKGLGLSEECYPELALDRMVNIYPYIINNPGEGTQA
FT                   KRRSAAALIDHLTPPMRQAELYDSTAEIDRILREYAGAQSQSPQRARLVAEQVWDAVTK
FT                   AGLDTDLGLTSADVDADPVEVLDRVHHHLLDLQDREISDGLHVLGQVVAGHDDPIAAKV
FT                   EYVAQLTRQPNGPVPSLREAVLNAWGTSLDEVSARAGEPVPVTADLPDGLTGRQLMSEA
FT                   HRRCVKLLTPVVVRHRDRHPDDTEAHDLAAQLCHEQLGAERGDVIETLTWVLTDLMPRL
FT                   DATNNEIDAIMTALDGGFVAPGPSGAPSRGNAHILPSGRNFFSLDPQTMPTPTGWREGV
FT                   ELADQLLRGYAEAHPDQPWPRTVGVVVWGTPNMRSGGADIAEILYLMGVRPVWESSGLV
FT                   SGLQIIEPCELGRPRIDVSPRISGLFRDAFPNLVEMIDRAVRMVAALPEPDDDNMLRAH
FT                   VEADVVEMTARGIDVEQARRKATLRVFGCPPGGYGAGVEELIETKAWQDKADLGRAYIA
FT                   ASSHAYGEGVLGQVETERFTASLKRMDVTVKNEDTREYDMLSCTDFYNYYGGLIAAATT
FT                   VRGEAPMSLVGDSSDPTRIATRTTTEEARLILRSRILNPSWIEGLQRHGYKGAGDLSAV
FT                   LDILIGWDATADVVDDGLWERVARRYALDPAMQEWFRQVNPHALHNIVDKLLDAAQRHV
FT                   WEANPSTVEELENTYADIEGTIEEVSDDPAIAPNTRVGAPPQNPAGGLDLSELGLI"
FT   gene            complement(124075..125169)
FT                   /locus_tag="PPA0103"
FT   CDS_pept        complement(124075..125169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0103"
FT                   /product="conserved radical SAM superfamily protein"
FT                   /note="putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81863"
FT                   /db_xref="GOA:Q6ABR6"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABR6"
FT                   /protein_id="AAT81863.1"
FT                   /translation="MTVRYLVLWPTAACDLTCPYCYRRDRRGGRMPVEVADTALDLVAE
FT                   GVRTTGQPAHVQLAGGEPTLVPSLIEHVAKRVVEIRWGKVTCGIQTNAARLDGDIIAML
FT                   KRHSVRVGVSVDGPPPVHEKTRGSAAQTFRGLLALAHADIPVRVTTVLSALNVDHLDGL
FT                   AVTLAALPNVTGFGLDPLVAIGSATGRDELVPCDEAVINGITTLHRRLAQINALRATPL
FT                   RWRELETVRTALRRGPVPTTSAVDPAGRTLLPVANHPYCHAAVGESMAVAPDGSVYPCS
FT                   QAVGDMASRAGTVHSIDWESLRRRFSQDRHTLRGPCHRCALAGRCPGDCPSRVEANALA
FT                   DPEQRRTPLTCLIDSTLARLESAS"
FT   gene            complement(125166..126167)
FT                   /locus_tag="PPA0104"
FT   CDS_pept        complement(125166..126167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0104"
FT                   /product="ABC transporter"
FT                   /note="putative ferrichrome-specific"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81864"
FT                   /db_xref="GOA:Q6ABR5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABR5"
FT                   /protein_id="AAT81864.1"
FT                   /translation="MTGLTLSNLTVGYRSGRHVTRVLSGVTGSVAAGQMIGLVGPNGAG
FT                   KSTLLRSVAGLQPSLAGEVRINGTPTSRMSRRQVAQALSTVLTDRVSVARLTCRDVVSL
FT                   GRHPHSGIGGRLRPHDHAVIDESLTAVGAADLADAFIGELSDGQRQRVMVARALAQEPS
FT                   ILLLDEPTSFLDPPGRIALLGMLREVCTARNIAVVVCSHDIEPVMRYADTLWVAGHDTD
FT                   VVIGAPEDLARNGALEAAFRTEGITFDLRTLTFWQSDSGRPVARVVGHGVDADLARHVL
FT                   TRSGYRVVEQPGDKVLTIGVTDEGWAVDDCVLPTLSQLHEHLIGRHRERARS"
FT   gene            complement(126164..127303)
FT                   /locus_tag="PPA0105"
FT   CDS_pept        complement(126164..127303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0105"
FT                   /product="transporter (putative iron (III) permease)"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81865"
FT                   /db_xref="GOA:Q6ABR4"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABR4"
FT                   /protein_id="AAT81865.1"
FT                   /translation="MRHSHQETSQSREAPGQDVRDHRDVRSRQTQGRRGLPLPVRFTIL
FT                   AAIFVAVTLAGLALGSVNIPLGDVMTVVTGGTNVDPVSMTIIHDVREPRTITALLVGAA
FT                   LGMSGLEMQTLFRNPLADPYVLGISSGASLGVALVVLSTSASAGAATFASGLGIGPDLL
FT                   IMVAAALGAAVVLLIVMLAGRFIHSSTILLLLGVMIGYFVSSGVTVLLSRASPELIAQY
FT                   TRWQFGSYHGVTWQNLRVMVPIIVAMILASLLLAKPLNALLLGERYAQTMGMNLKVVRT
FT                   LLVASTAILAGAATAFCGPIGFLGIAIPHLTRGVLGTADHRHLLPGCILTGSSLALMAD
FT                   ILAQLPGDDVLPVNAVNAVFGAPVVMVILIRWYREAEAT"
FT   gene            complement(127386..128630)
FT                   /locus_tag="PPA0106"
FT   CDS_pept        complement(127386..128630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0106"
FT                   /product="periplasmic-binding protein of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81866"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABR3"
FT                   /protein_id="AAT81866.1"
FT                   /translation="MSINRLVAGLAATTMCVATLTGCSHSEQSGSSANTSSSGSSRQGC
FT                   IKDFDPSKDYFGDKATFGDARDITVSYHKSYKVVTLKHPSNTATKPVQYVLVQCGAPDP
FT                   HLDGELAKAQRITIPTTKVALGSTTLPMKFQMLGKLDSVAGMVNVDRVGNPDTRQALKD
FT                   HKVASFAAGDNATEINTEKLAALRPDLFIFNLVSGSDNTSKIDKIKEMGIPVVAEPNFL
FT                   ESTPLGRAEWIKYDSLFVNAEKTANQKYDEIAEKYHATAKRTAKVKTRPTVLHGSQYKG
FT                   VWYIKPNENYAIQFLRDAGGEYVFKDLHGVASRKLDTEAVIKQAHDADFWIDGPEKSSI
FT                   PQILKADPRLKSLKALDNGNMWDATPRADPKHGNDYWQTGVVRPDLVLANLTAILHPEL
FT                   DRDHQFHFYRKATAK"
FT   gene            complement(128687..129955)
FT                   /locus_tag="PPA0107"
FT   CDS_pept        complement(128687..129955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0107"
FT                   /product="periplasmic-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81867"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABR2"
FT                   /protein_id="AAT81867.1"
FT                   /translation="MSTPRTMPRRISALITLFVAPALALTGCSGSSNRTTSLNTSTATP
FT                   SVGTGANMSGCIKSGEFDKDKDYFGDKATFTGARNVHVSYHKSYKVLTLGEQDRPAQTF
FT                   VLLQCGAPKPALTGDLAKAPIIDVPVKRVVASSTTQIPVFHTLGALDSIVGVNQIEQIY
FT                   RGPARKALEARHIPSYGSSRMQIDTEKIISLKPDAVLAASSEVGEFKQVQSAGIPVLQD
FT                   LDYLESTPLARAEWMKAYGILLNKEGAATKSFDSIAERYAEVAKKAKNAADKPSVLVGQ
FT                   ETKGQWYVPGADSYMIKFMTDAGASDVMAQAVKGNGATPTDAEVVFKYGSKADFWLNGN
FT                   YMSMTTWHGKDDALKQNPRYANLSAFQHGNVWNPSKRTAPDTGNDFWQSGIVQPDVVLA
FT                   DLTYIFHPDLMKGYTPYYYTKLS"
FT   gene            complement(130239..131012)
FT                   /locus_tag="PPA0108"
FT   CDS_pept        complement(130239..131012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0108"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81868"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABR1"
FT                   /protein_id="AAT81868.1"
FT                   /translation="MTAPNRVPSRCLSITRLRDLLLADIPASRLVIACDTIGGIGPRPD
FT                   DSYPADPVWCAHLGARVPLLEVLCAGARPLVLVDTLCQDSASAQPMIAEFRRCALDAGI
FT                   DPDAVTGSTEDNVATTQTGVGVTIIGVMHHEDVPKSLDGDVLVCVGAPISAPNDDVALG
FT                   RREIVGVTEVKALMASGKVHDCVPVGSHGVAWEAKQLASTAGLRVAFQPTDVDLTRSGG
FT                   PATCVVMACAKTNLEQLHALVNPERPWAVIGHLRS"
FT   gene            complement(131052..132836)
FT                   /locus_tag="PPA0109"
FT   CDS_pept        complement(131052..132836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0109"
FT                   /product="myosin-crossreactive antigen"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81869"
FT                   /db_xref="GOA:Q6ABR0"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABR0"
FT                   /protein_id="AAT81869.1"
FT                   /translation="MTNFQDIYQHSYPVSPDGNPFVQNDLGRYTQNHPVPPDDVAERKA
FT                   YLVGSGIASLLAAAYLIRDAQMPGENITILEEMSEPGGAFDGAGDTEKGFIARGGREMG
FT                   QHFECFWDIMKDIPALEMPEPYSVLDEFRIVNENDPNINPCRIINSCGHKRDASKMELN
FT                   KKGQLDIMRLLLAKESDTYYKSIEDWFDEDFLQSTFYLLWKTMFAFEQWQSLTELKRYM
FT                   HRFLQYLPGFSNLSCLRFSRYNQHDSFVVPLVKWLTEKGVNFQYDTLVYDVDLEITAHR
FT                   KIARGILWRDKEGGEHRIDMSAKDLVFVTNGSLTECTGYGDMDTPAPYHKDMQAGWELW
FT                   RNLVRRSPAFGRPDVFCGDADKTVWQSISFNFIGRDHPFLKKIKELTGNDPLSGRTVTG
FT                   GIITAEDSSWCISLTMNRQPQFHGQPEDWGVAWAYGLYPFEKGDVVNKTMLECTGEELL
FT                   KEYCYHFGLLDQFEEVKAHTKVRIATMPWITAFFMPRGKGDRPEVIPDGCVNLACLGQF
FT                   VETPDDCVFTTEGSARTAMMAVYGLLDLDRDIPPIWPTQYDIRSLLASAKTLNNGRLPG
FT                   SWLLSKLLKNTYYEDILP"
FT   gene            132955..134664
FT                   /locus_tag="PPA0110"
FT   CDS_pept        132955..134664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0110"
FT                   /product="putative thiamine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81870"
FT                   /db_xref="GOA:Q6ABQ9"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABQ9"
FT                   /protein_id="AAT81870.1"
FT                   /translation="MFGQFSAAERTSWWGGILAHGHGVRLGGAEITPVEPDLVRTGEGM
FT                   SEMTISDALAERGTIPRVLSIAGTDPSGGAGTAADTKSIIAAGGYAMAVVTSLVAQNTE
FT                   GVRAIHTPPTDFLVQQLAAVSDDVRIDAVKTGMLGTAEIVDAVATFLDEHRPLVVVVDP
FT                   VMVATSGDRLLAPDAEAAMREFCRRATVITPNIPELAVLCQSEPATTPEQAVEQARRWA
FT                   AETGAAVVVKTGHLNSQRVDNMWVTTEGAMHVAPAARVETTNTHGTGCSLSSALATRLG
FT                   AGDTPGDALAWVTDWLHEAIQYGSALNVGKGHGPVDHSHRARRLAEDASAVAWFAPIDP
FT                   LESPQGLVVSAEPAPDAVVAPAGPWTTALWQASGDIARRIEDSDFVAVLVDGTLSKPAF
FT                   EFYLGQDAQYLTYYSRALASLAARAVDPEESVWWAQSSQACLVEEAELHRSWLGDHIDV
FT                   VAGPVTLAYTDFLLARALGDDYVVGTAAVLPCFWLYAHLGAKVPHVPDDHPYASWLQTY
FT                   GDPEFVEGASHTIGLVEKAFQNASAVTRARAAHAYLTACRHELEFFDQALRV"
FT   gene            134788..135018
FT                   /locus_tag="PPA0111"
FT   CDS_pept        134788..135018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81871"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABQ8"
FT                   /protein_id="AAT81871.1"
FT                   /translation="MVHCPTATVAARPEGTPWVLDSTTIGLAPVRTRMAREFLDAGPDV
FT                   AGEVAAARAGGPGSFRVQLRDALDKAARTAK"
FT   gene            135027..135680
FT                   /locus_tag="PPA0112"
FT   CDS_pept        135027..135680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0112"
FT                   /product="thiamine monophosphate synthase"
FT                   /EC_number="2.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81872"
FT                   /db_xref="GOA:Q6ABQ7"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABQ7"
FT                   /protein_id="AAT81872.1"
FT                   /translation="MTLDLRCYLVTSGIDRHTIETAAAAAGAGAGMVQVRAKELSTRDL
FT                   LSLVLQVGEAVRRANPATRVVVDDRADVAWAAIRARGNVHGVHVGLTDLPVRDARAMLG
FT                   PDAIVGYTTGTLDLVRSAEPFADALDYVGAGPFRPTPTKESGRSPLGVQGYPALVGASS
FT                   LPVVAIGDVQVADVPVLAATGVAGVAMVRAIMASDDPAAVVRQVVQSFDEVRVS"
FT   gene            complement(135938..136897)
FT                   /locus_tag="PPA0113"
FT   CDS_pept        complement(135938..136897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81873"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABJ4"
FT                   /protein_id="AAT81873.1"
FT                   /translation="MRENFELELRSNGGVARIVRDSPLRGQADRSVARGDTVRILPGVV
FT                   AATGAARHVTTMIQALKLWHRGATLVGMAALVLLGLKNPVTQRRWDYTGIQAIEAFSPT
FT                   RRLRRPRIWVHRWHVPHHFTIEEEGIRVAIPEVSVIILAIQGQWDWVCQALRQRLVTPA
FT                   SCRAVRKALTGRYSKAEVDRALADIDLNPWSIPELELARILRATGITGHKPNHQVWVGE
FT                   GNYRYVLDQAFQAEMLGVEMEGRSVHGTPEGYEAMMVRSAHLEQAGWRILHTTPTMLRR
FT                   DPKFVLDWIINHLHKRHRPKTTLTNQVLRQIMNSAVPA"
FT   gene            137230..137457
FT                   /locus_tag="PPA0114"
FT   CDS_pept        137230..137457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81874"
FT                   /db_xref="GOA:Q6ABJ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABJ3"
FT                   /protein_id="AAT81874.1"
FT                   /translation="MLGKRQDPAHPHMGSVGKRDSGRVTRFRWVVVPQPAPRKPRVVVK
FT                   EPVMLDVIWLLGVIALFILLALCVKGVDAL"
FT   gene            137543..139213
FT                   /locus_tag="PPA0115"
FT   CDS_pept        137543..139213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0115"
FT                   /product="potassium-transporting ATPase A chain"
FT                   /EC_number="3.6.3.12"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81875"
FT                   /db_xref="GOA:Q6ABJ2"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6ABJ2"
FT                   /protein_id="AAT81875.1"
FT                   /translation="MTWICFLAGLALLAIALGIAQHHLGTYMARVFTSDKDTRVETWCY
FT                   RVMGVNPRAGQTWKSYARAVLAFSFCGVVFLYALQRLQPWLPWSLGKGSVNPAVSFNTA
FT                   ISFVTNTNWQAYSPEATLGHFVQLAGLCVQNFVSAATGIAIAVALIRGFVGHGEHTIGN
FT                   FWVDLTRCTLRILMPIAAVAAFLLIAGGAVQNFTGFLHVTGVAGGNQVIPGGPVASQEA
FT                   IKELGTNGGGFFNGNSSHPFENPQPWTNMLEIFLILLIPFSLPRTFGKMVEDVRQGRAI
FT                   LAAMVVLFTVNLCAMAAAEFSGHGTAARLAGAPMEGKEQRFGLAQSVLFANSTTMTSTG
FT                   AVDSMHDSFTAIGGMFTLLNMMLGEISPGGVGSGLYGMLVIAVIAVFIAGLLVGRTPEY
FT                   LGKKIGPREMKLSDLYILVMPTLVLCGVALSLAVPGLRSSVNTSIANPGEHGLSELVYA
FT                   FTSAANNNGSAFAGLDASTNWLCAALGAAMLLGRFVPIILILALSGALVEREPVPVTAG
FT                   TLPTHNALFTTLIVFTAILVTALVFFPVLTLGPLAEGLI"
FT   gene            139216..141330
FT                   /locus_tag="PPA0116"
FT   CDS_pept        139216..141330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0116"
FT                   /product="potassium-transporting ATPase B chain"
FT                   /EC_number="3.6.3.12"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81876"
FT                   /db_xref="GOA:Q6ABJ1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABJ1"
FT                   /protein_id="AAT81876.1"
FT                   /translation="MTVIPSNSRSRGLTGTQARQALPGALRKLDPRFQWRNPVMFLVWI
FT                   GAVLTTIIAGLELLTGVTDGGVSVGFSMAIAVWLWLTVIFANLAESIAEGRGKAQAESL
FT                   RKTRTATSAIRVDGWDERNDPSAEHTTTTEVVSSELRYGDVVVVAAGQTIPGDGDIVWG
FT                   IASVDESAITGESAPVVRESGGDRSAVTGGTTVLSDRIVVKITSKPGQSFVDRMIALVE
FT                   GSGRQKTLNEIALNILLASLSIVFVLVTLTLNPIASLAARPVSVTVLVALLVCLVPTTI
FT                   GALLSAIGIAGMDRLVQHNVLAMSGRAVEAAGDVTTLLLDKTGTITYGNRRASEFIPMP
FT                   GVSDKEIRDAAARSSLADPTPEGTSIVDLAREQGFVPDACGEQGKVVPFTAQTRMSGID
FT                   LPDGTKIRKGAGSAVRAWLTESHINMDIDTLAHMDRRVDSVSQSGGTPLVVAVRTPDHS
FT                   GKVLGVVHLKDIVKEGLTDRFAELRRMGIRTVMVTGDNPLTAAAIAKEAGVDDFLAEAT
FT                   PEDKLAYIRKEQEGGRMVAMTGDGTNDAPALAQADVGVAMNTGTSAAKEAGNMVDLDSD
FT                   PTKLISIVGIGKQLLITRGALTTFSIANDIAKYFAIIPAIFMATYPGLSALNIMGLHSP
FT                   ASAVLSAIIFNAIIIVILVPLALKGVAYKPAGASKILARNLRIYGLGGVVAPFIGIWLI
FT                   DLIIRLIPGF"
FT   gene            141343..141948
FT                   /locus_tag="PPA0117"
FT   CDS_pept        141343..141948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0117"
FT                   /product="potassium-transporting ATPase C chain"
FT                   /EC_number="3.6.3.12"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81877"
FT                   /db_xref="GOA:Q6ABJ0"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABJ0"
FT                   /protein_id="AAT81877.1"
FT                   /translation="MIISSRTRTVLVGLRSMLLFTVIVGVVYTGLMTGLGQLMLHHQAN
FT                   GSQLEVNGKVVGSTLIGQSFTDKGGRPLPKYFQPRPSAAGDDGYDAGSSGGSNMGPENP
FT                   DLAKAIKERRSQVAAFNHVDADRVPADAVTASSSGLDPHISPEYANIQIARVAKARHLD
FT                   KAVVRRIVDDNTTGRQLGFLGETKVNVVTLNAELDRQH"
FT   gene            141989..144481
FT                   /locus_tag="PPA0118"
FT   CDS_pept        141989..144481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0118"
FT                   /product="two-component sensor, KdpD"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81878"
FT                   /db_xref="GOA:Q6ABI9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABI9"
FT                   /protein_id="AAT81878.1"
FT                   /translation="MAVRGRLRVLLGAAPGVGKTYAMLDEGKHLRAGGSDVVIAVVETH
FT                   GRAATAAMTEGMEVIPRHYVECRGIELPEMDLDGVLAQHPDVALVDELAHTNAPGSRNE
FT                   KRWQDVEELLEAGIDVISTVNIQHIESLNDVVEQITGVPQRETVPDTVLRRASQVEVVD
FT                   LAPQALRDRLSSGKVYPAERIDAALSNYFRLGNLTALRELALLWVADEVDHALADYRSE
FT                   HGIDSRWEARERVVVALTGGREGETLLRRGARIAVRAGGGELLAVHVTTEDGLRSPHPG
FT                   ELARQRGLVDKLGGSFHQLVGDDIPETLIEFAKSVNATQLVIGASRRGKLSRLLTGHDV
FT                   EADIIRASGAIDVHIVSHDAQAKALRLPRMGGSLSTRRRIAGFAVLAVLGPLLTLLLVS
FT                   SRSPEALTTDVLAYELLAVVVALVGGAFSSLIAALASGFALDYFFTKPFYTVTVNEPLH
FT                   LVALLLYLLTAALVSVVVDRAARKTRVARRAAAESGLLQSVAGLVLRGEDAVESLLSRA
FT                   TEAFGLSGARLMTDGKVVANWGTTSDQVTEHRIDDHTVVEFHGPEPDASERRLMSVIAA
FT                   QLGTALEQHQLEETAKAVEPLAATDRVRTALLSAVGHDLRRPLAAATAAVSGLRSEWSK
FT                   LSDQDRADLLETADEALSQLANLVTDLLDVSRLQSGVLGVSVMPVDPAEVIMPALDELS
FT                   LGPADVEIDLGSDVPEMVADPALLQRVVVNLLSNALRYEPAGSRVRLAESSFANQVEIR
FT                   VIDHGPGIPEDRRDDVMVPFQRLGDTDSSVGLGLGLALSKGFVEGMDGTLALEDTPGGG
FT                   LTMVISLPRVGVEEASVQ"
FT   gene            144478..145161
FT                   /locus_tag="PPA0119"
FT   CDS_pept        144478..145161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0119"
FT                   /product="two-component response regulator, KdpE"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81879"
FT                   /db_xref="GOA:Q6ABI8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABI8"
FT                   /protein_id="AAT81879.1"
FT                   /translation="MRILIADDDPQFLRALRITLGARGYEVLLARDGQHALEMAIDHKP
FT                   DIILLDLGMPRLDGVKVIEAVRGWSSAPILVISGRSGSAEKVEALDAGADDYVTKPFSM
FT                   DELLARIRVLTRRIGQDEVDEEPIVAFGSVWVDLAAHTVTRDGANVRLTPTEWRVLELL
FT                   IRNEGRLVTRQTMLSQVWGSEHVTDTGYLRLYISQLRKKLEPEPSRPRYLITDAGMGYR
FT                   LVLDP"
FT   gene            145165..145689
FT                   /locus_tag="PPA0120"
FT   CDS_pept        145165..145689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81880"
FT                   /db_xref="InterPro:IPR027580"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABI7"
FT                   /protein_id="AAT81880.1"
FT                   /translation="MHIIMHMPTRNVYVSDEDQNLFQEAAELAGGFSPAVSEALREYVK
FT                   RRKLMRGGAEQVEVDLRTDGIDHRVSFMGRRLVKVQRDHEQGCRIDTVYATARKQFAVV
FT                   SKVRRVLPSWAGGKEDLWSHPETWDKEFWTVGDRTLKVFANLDELRTADGELAERVDSA
FT                   LHVAPYEVLDI"
FT   gene            145752..145958
FT                   /locus_tag="PPA0121"
FT   CDS_pept        145752..145958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81881"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABI6"
FT                   /protein_id="AAT81881.1"
FT                   /translation="MTVFARQKRFVTDQWTYYVESLTALARPHELCVRWSRGVYRALKR
FT                   PPEPCVVDFRGQSVRSLEMAQHF"
FT   gene            complement(146176..146254)
FT                   /locus_tag="PPA2409"
FT   tRNA            complement(146176..146254)
FT                   /locus_tag="PPA2409"
FT                   /product="tRNA-Ala"
FT   gene            complement(146394..147767)
FT                   /locus_tag="PPA0122"
FT   CDS_pept        complement(146394..147767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0122"
FT                   /product="peptidase, M16 family"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81882"
FT                   /db_xref="GOA:Q6ABI5"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABI5"
FT                   /protein_id="AAT81882.1"
FT                   /translation="MKTCNERPLTSRPTVRPGSPWSFPQCLVETLPTGLTVVRVPMPGQ
FT                   RIVTMEIGLEAPLCAEPAGLEGLAGLVVRTADESTGPHPGAAFAEAMESIGASYDGSAG
FT                   LAGSHVGVDVPVTRFDAAAELFVELLNTTSLVEEDIARQIDAARASLAQTSQRGSSLAE
FT                   MAAARALWPVGSRSSLPTIGTLSSVEKLNAAAAREFWAAHWTISDAVLVVAGEGVEDLD
FT                   LSIFKEWTTSGSPSQVAPLQPRLDGPRVILVDRPDAVQADVRIQQATVGRSHPGWAALK
FT                   VACGALGGTFGSRLNQVLREDKGWSYGVGMSSRPLPDGGVATVAGSFRTEVGADAVAEA
FT                   LRILTSSDDLRADEVDAARDHSVGIAPLQYDTAGAVAHQVAALVGAGLAPNWVDDHLAA
FT                   VASARASAGEWSVNRAWRELLIPDSWRIAICGQAEELAPALAERGLEAVIVSPAEVLS"
FT   gene            complement(147767..149039)
FT                   /pseudo
FT                   /locus_tag="PPA0123"
FT                   /note="protease; frameshift"
FT   gene            149143..149664
FT                   /locus_tag="PPA0125"
FT   CDS_pept        149143..149664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0125"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81883"
FT                   /db_xref="InterPro:IPR035169"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABI4"
FT                   /protein_id="AAT81883.1"
FT                   /translation="MPHGARSTCGGFFENAPSNTGAAKSSEQRRTLEGMQTQRNVVSHA
FT                   LQRRHTLEALRSPQVDLSAPTACDADPMLVRAAMHHGEPLNHDCPVCESPRLALLRHAF
FT                   GHQLGQYSGRIRTLDELEEMEHQFGEFHVYEVEVCPDCLWNHILVDYVLGDGRRRRPPR
FT                   HQPTVEDIYG"
FT   gene            149657..152002
FT                   /locus_tag="PPA0126"
FT   CDS_pept        149657..152002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0126"
FT                   /product="putative penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81884"
FT                   /db_xref="GOA:Q6ABI3"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABI3"
FT                   /protein_id="AAT81884.1"
FT                   /translation="MADHKPARASKRHAPATGGGAGRARRAAGRPSRHPRLGKFLRGLV
FT                   IAILSLVLIAVVGVFVAYERTELPDPNRDFQTNTSFIYYRDGSRLGSFSVQNRQSIPYE
FT                   TMPKTLRDAVVSAENRTFWSDPGISVKGMTRAAWAIARGGEMQGGSTITQQYIKVLYLS
FT                   QERTMGRKFKELLLAVKTGKEVSKKGILAGYLNTIYFGRGAYGVQAAARAFFYTDASKL
FT                   TLSQSAVLAAVLNSPSNFDPSGGVGARERLLQRYRYVLDGMLEAGNITQAQHDEAYRQL
FT                   PKFPKVPDYNRWAGTDGYLMKLVYDELIARGFSDQQIKGGGLKVTTTLDRKDQQAAVAA
FT                   GQKYKKVAGRNAGPEGAKNLHPALASVDVSSGGVLALYGGDDYISNTRDWALTARPAAS
FT                   TFKTYAAIAGMRHGFSLRSRLEGNAFTPDGDSTEVHNENDRNYGTVSLRQAIAKSINTA
FT                   FVDMVSRIKNGPRAVVQAATDAGLSQGTGWDLNNRIALGTAEVSPLAQAGGYATIANDG
FT                   KRVTPHIVDKVVDQSGKVLCQAPTPSKQTIEADISHDVSYALQSVVEEGTGRIVAGFDH
FT                   HVAGKTGTSGVGHGVTSAWFVAYTKQISTAVMFVAGDSGNENLNRYAREGATGFHGGDY
FT                   PARTWLDYMQTAMRGMPNKSFAAPDWVNLSGKHYGSTNRPQVSVEDDSDRDRSNQNDPE
FT                   SLGRPSPTPTRTSASSPEPSSAPSREQSSEPSATRTASAHTHTSKPTQTSQPAHTSRPT
FT                   HTSTHTSRPTSGETTHGGNQLSGRAQNG"
FT   gene            152012..153559
FT                   /locus_tag="PPA0127"
FT   CDS_pept        152012..153559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0127"
FT                   /product="conserved membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81885"
FT                   /db_xref="GOA:Q6ABI2"
FT                   /db_xref="InterPro:IPR016570"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABI2"
FT                   /protein_id="AAT81885.1"
FT                   /translation="MTIPDPKDDAMAARRCAVAHPNDGSPGYTARRGLDVPRGSRVSQL
FT                   GLDRRIGGRMGRHAWPRGVFFDPGPWAIMSAIVVWLLTIYRVTPCVQHDVAKAVDPYQR
FT                   QCYSDIPTLYRSSGMGHGGSLFANPDIAQTPLVTVLMAFCRRVVWAFGAEVSPKATDQQ
FT                   VLDAANAYWGVAQIVLFVAFLAVAISVMLLGRGSDTNLPVDDKGRPTQARRRSWDVFWV
FT                   VLCPAVYLAGLIDFSMVPVALATTSMLAWARRRPWLAGILMGLACAGSLQAAVVAFAVL
FT                   VCCLRATRLPELGRYLLAGSLVLVVCHVIAVCLGLHTWWAYLRSTFWSGTGLGTIWYVI
FT                   QDSSGGTIPGIGWITGTLTVGGLLGLAWLSMTVPRRPRIAQVACVALLILFITNKVYSP
FT                   QWMLFLVPLAALARPDLRDWAVLMVGECFYSLAVWAHLGGLSLPGGSDADVVYWASVVL
FT                   RLACEMWFAWGVLDDIRRPWNDVVRVGYADDPTGGVLDYAPDPAPEPVEDSSAEVAR"
FT   gene            153556..154731
FT                   /locus_tag="PPA0128"
FT   CDS_pept        153556..154731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0128"
FT                   /product="membrane spanning protein"
FT                   /note="DUF409"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81886"
FT                   /db_xref="GOA:Q6ABI1"
FT                   /db_xref="InterPro:IPR007315"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABI1"
FT                   /protein_id="AAT81886.1"
FT                   /translation="MTRTGRATARRFAPTADGRLVAQTWLGSRAILLVVAVVVMTGYHR
FT                   TFSQVTGNWDVQHYMSIARNGYADPLEMAFFPGLPALLKGGSFLGTPMEVTGVLLGLIG
FT                   SALAAWALFRIGGMLPACLWLIAPATVFTMVGYTEALFCAAAFWAWERARAGRWWAAAL
FT                   LAGLACTFRVSGLFLIGALAVLAVLGDRDEGRPTSQAARRRRLIDVVNRLSTLLVPTAV
FT                   LVAFVVWLHRLTGSWTAWSQAQTNGWRRGFTTPAETLRHTLPATHADTWRSLYGAGASG
FT                   VAVVFRLELVSVALGVLVFVYCLVRRRWASASWVGIQVVAFSIGYWYMSVNRATLLWFP
FT                   LFVALAEVTRGPSKPPGLVLLWRGIMGIVIAIDLAVMVWWGWRFFTGGWAS"
FT   gene            154728..156065
FT                   /locus_tag="PPA0129"
FT   CDS_pept        154728..156065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0129"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81887"
FT                   /db_xref="GOA:Q6ABI0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABI0"
FT                   /protein_id="AAT81887.1"
FT                   /translation="MRRTAFIGPGRYQQAIGSLTSWGLVALVVVEALADFRHGLTSPPW
FT                   IVSSYLIVDVLIILACGPALWLRRHDLGRAGRWMLGGALGFMVWAIVSASFCPLPNLGP
FT                   GPVARLLLVMAPVTAVATLLAGLSVAAGLTIRSSGRMVIERLWWPAAAMTCVSYLQWPR
FT                   AMKVHGSTRLATGMGGSAVLHVALLLACGVLVAAAVAGCRRVASGILATGALVAVILTG
FT                   SRAGLACATLFVLGCAIGLVVWRRSRVVRRAGHRRMVWGALVALAVVVIGMVIVVPGLR
FT                   RMLNPSDPMRSRTLRTGIQVWSSDLNHVFFGLGSGRLWPWYLYDCHARQEPWRELMTTQ
FT                   WGPTLSSAHSTVLAVLVELGLLGFVLLLPVLLGPVVELVRRLFDGTGSPAEVVLRWAVV
FT                   ATLPAFLVDTYLVKNFGVSMWWWVVTLSSVAWTDQRPPSTSRQNSG"
FT   gene            complement(156026..157288)
FT                   /locus_tag="PPA0130"
FT   CDS_pept        complement(156026..157288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0130"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81888"
FT                   /db_xref="GOA:Q6ABH9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABH9"
FT                   /protein_id="AAT81888.1"
FT                   /translation="MAHRESTLILLTNTYPLSRGEEFLENEIDHVGRAFDQVVIIPIQA
FT                   GPADVQTRAIPSNAQVMHIARSSPRGLDRALAAVKGLVRLPPSGVDWAATRRQPRLLVS
FT                   DAHFEACAQTALDSILAKLPNLRLTSESHVTIYSFWLHITARTATLLAEQLRAQGVTVD
FT                   RVISRAHRYDLYPSVAPRHHIPERRLLLQSLDGICPVSEQGTRELQTTWPQYAGKIHTR
FT                   YLGTSDPGPTAHCRRDPFTIVSCAHLVPVKRMIRMPAILARVRASGIDARWTHLGDGPQ
FT                   MDTLREEVTVHRVTDAVTLLGHVDNTQVMATQRDLKPSVFVNLSSSEGLPVSMMEVASL
FT                   GIPIIATGVGGVGEIVSSDNGHLLPAEFTDAQASDALVQLARLSEDEYQQVCQASRQVW
FT                   EEKFRASVVYPEFCREVLGGR"
FT   gene            157556..158683
FT                   /locus_tag="PPA0131"
FT   CDS_pept        157556..158683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0131"
FT                   /product="putative glycosyl transferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81889"
FT                   /db_xref="GOA:Q6ABH8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABH8"
FT                   /protein_id="AAT81889.1"
FT                   /translation="MPQTGADREVRRCIYHVPYPLDPNTTFGGQKRAVAMLKALTQWGE
FT                   VWVVAGDARQRRRQIQVVMNAIRAGTRFEFCYSESSTMPTTLTEPHHLPTHPLEDFAFL
FT                   TRLRRHGIPVGLFYRDVYWKFPLYGEGVPKAKQLVAQAMYRYDLLAYRQCLDVLFLPSL
FT                   RMGEWVDVGDRVKKVALPPGHDIDETPTATPPSPLSMFYVGGLGSLYDLRAFCEAVASV
FT                   PEASLTICTRPKEWEQARKDYEPLMGNNIKVVHANGKKELEPYFAAANVAVLAMAPHEY
FT                   RDFAAPLKLFEYIGNGKPIIATEGTFVGDVVTRDELGWTVQASVNEFAALLEQLTQHPE
FT                   RVDEACDRVMAARDQHTWAARVEELVTALAAVDQR"
FT   gene            158680..160002
FT                   /locus_tag="PPA0132"
FT   CDS_pept        158680..160002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0132"
FT                   /product="hypothetical membrane spanning protein"
FT                   /note="putatively involved in polysaccharide synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81890"
FT                   /db_xref="GOA:Q6ABH7"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABH7"
FT                   /protein_id="AAT81890.1"
FT                   /translation="MSVAERTAARPLDRQEMASRATSGVWLGAVAAVLVMRLPMGFLLF
FT                   LIVPWVILAVQTRFASSLRVTPLVAVEVCCMVASGMAVVLFHPGLLTDTGNSAFIMLAV
FT                   IGVTLVVFRSAEPGRTARQVLSGLYWGAILVWLIGMGEIVTGVKLLPLLYPRANTLGAV
FT                   SKNRWVVTATYPNYNDYGVVMAMLFTAVLARLWFNPRRGAIRLGRLFVLATCLVMILIG
FT                   GSRGALFGCICAVMLLFVLNVRRLHTAAIGVRAFVWGGALVIVLGTGLWMSPYVQDHST
FT                   AERGTIMANALSMTLSNPAALLLGYGSLSEYQARASALYGHVLMDPHNLLLEIVLRYGA
FT                   IAMILFVVCWLWILVRGFLPRRPVADWQAAFGLTVVMLFPVLGVVPSSTLRYHVTWLYL
FT                   VAASSITAETVAANSASAGRPTLSPEAVTQTERSAGGPGAA"
FT   gene            complement(159976..160752)
FT                   /locus_tag="PPA0133"
FT   CDS_pept        complement(159976..160752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0133"
FT                   /product="hypothetical protein"
FT                   /note="putative Wzz (lipopolysaccharide biosynthesis)"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81891"
FT                   /db_xref="GOA:Q6ABH6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABH6"
FT                   /protein_id="AAT81891.1"
FT                   /translation="MSSLPSEPTVAQSGSSAIEREGTTDSSTQPPRPRNPGQPIDLLGF
FT                   LKGLGHHWLAGLITFIVAAGLLVGYSLLMAPRNTVGTVAAHAHVMVTLPEPRTEAQATV
FT                   ESATVDQIMSNYVALTTPDPIVNAAVKYLHDGTTADDLKAGASVYWGGGGTVIAVYAMG
FT                   TNQNQAIERANAYARAFAEKANDLVPSSLASLPQPKLTIVQPAFPSDPNPNAPATNKNS
FT                   TKLSSPMVGVAAGLILGLVVMGVLEYRSSRRSRAPR"
FT   gene            160926..161543
FT                   /locus_tag="PPA0134"
FT   CDS_pept        160926..161543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0134"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81892"
FT                   /db_xref="GOA:Q6ABH5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABH5"
FT                   /protein_id="AAT81892.1"
FT                   /translation="MGEPRIIDTADLDDGVTIGDGSSIWHLSQVRSEAVLGQNVVVGRG
FT                   AYIGEGVHVGDNCKIQNYALVYEPAKLEDGVFIGPAVVLTNDHFPRAINPDGSLKSADD
FT                   WEQVGVTCKRGCSVGARSVCIAPVTIGEWATVAAGSVVTKDVPAYALVAGVPARRIKWV
FT                   GRSGFPLDPDGENKWIDSRTGDRFIEDPATDTLTLVSEGEQA"
FT   gene            161627..162739
FT                   /locus_tag="PPA0135"
FT   CDS_pept        161627..162739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0135"
FT                   /product="aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81893"
FT                   /db_xref="GOA:Q6ABH4"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABH4"
FT                   /protein_id="AAT81893.1"
FT                   /translation="MTAQFIPPAKPILGDDERKAVDEVIASGMVAQGPQVHAFEDEFSS
FT                   QVVDGVHCVAVNSGTSALHIGLLASGIGEGDEVIVPSFTFAATGNSVALSGAKPVFADV
FT                   DPVTFTLDPASIEASITDKTAAIMPVHLYGLPANMAEIVAIATKHGLKIFEDCAQAHAA
FT                   SIDGKHVGTFGTFGAFSFYPTKNMTSGEGGMITTSDPEIARKAAMLRNQGMEKRYANEY
FT                   VGLNNRMTDIHASIGRVQLTKLAGWTKTRQENAAFLSSNITEAITPAVPEGYVHVYHQY
FT                   TIRLEGATGEERDRFVTALKEEHQVGSGVYYPIPNHRLPSLAPYAPGLELPNTEKVAAE
FT                   CVSLPVHPSLSQADRERIVAAVNTCAKAGA"
FT   gene            162739..163731
FT                   /locus_tag="PPA0136"
FT   CDS_pept        162739..163731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0136"
FT                   /product="NAD-dependent dehydrogenase"
FT                   /EC_number="1.1.1.18"
FT                   /note="putative myo-inositol-specific"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81894"
FT                   /db_xref="GOA:Q6ABH3"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABH3"
FT                   /protein_id="AAT81894.1"
FT                   /translation="MANLRAGMVGIGSMGKNHVRNLRAIDGVDLVAIADASGKDPFGVA
FT                   GDLPVLPDVDAVIETGIDYCVVAAPTKFHEEIGLKLAEAGVHALIEKPLAYDTAAATRL
FT                   AEAFESKGLVGAVGHIERYNPALQSLRKRLENGDLGDLYQVATRRQGPFPARIADVGVV
FT                   KDLASHDIDLTAWVTQREFELVAARTMFKAGRDYEDMVSATCQLSGGLMSNHLVNWLTP
FT                   TKERRTFVTGEKGMFVADTLTADLTFYSNAKVATVWDDIANFRGVAEGDVTRFAIPKPE
FT                   PLRTEHENFRDAVLGKESDIVTMTQGATVVQVCEAMITSAATGEFVKIS"
FT   gene            163833..165215
FT                   /locus_tag="PPA0137"
FT   CDS_pept        163833..165215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0137"
FT                   /product="hypothetical protein"
FT                   /note="putative bicarbonate transporter, Ict family"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81895"
FT                   /db_xref="GOA:Q6ABH2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABH2"
FT                   /protein_id="AAT81895.1"
FT                   /translation="MTPIFRLHDSPDGSSAVTLLRSVAPIQWFSGAAEVIVACLFVTCT
FT                   FVTVAQPVFDNGACQLMLPLFAVAALVLEALCIVRDVRGVPSPREWSRSLTIVTCSFVA
FT                   LLVWAAVSIPFHEHLIYDDSMGVTRDLPLYALVMPLAEATVTLLVAIFACRMIAVGNLE
FT                   GALWRLSMLMAIANPIDLVREYVEGNTTGWRVATRLGGAAICHVLLILALAVAVDAVIR
FT                   HRHRILSSVAAVSHLGCLAASGSRAGTISLALFVIGLVFFGRSYRTRSRKQRTVIAMLG
FT                   LLTAGVAIWLVSTVRSGSLVDPARARTWALAGRVVVDSPSHFLVGTGYGTIWPWFAVES
FT                   TFMPESSHGMRRTLYGYSLPHAHSLIAQVVGELGVIGLALILVCLGTVIAVCVKGIRGG
FT                   YPLLSLGVLATMPAFLMDTYLIKNFPVALFWWIFTLALCRLVTTGDADVEGDSGYREEK
FT                   YA"
FT   gene            165419..166996
FT                   /locus_tag="PPA0138"
FT   CDS_pept        165419..166996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0138"
FT                   /product="dipeptide/tripeptide permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81896"
FT                   /db_xref="GOA:Q6ABH1"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABH1"
FT                   /protein_id="AAT81896.1"
FT                   /translation="MSLEPLDVDAEGVAAATKARGFRPKHLVTGPSRDDKSFLGHPGGL
FT                   PWMLQVEMWERFSWYGMRAILVYFITDTLAHGGLGLPINAGQVVMASYGAAVLLMTIPG
FT                   GIFADRILGPWMSTLCGGLIIMTGHVILAIPQVVTSWIGLICIAIGTGFIKPNLSTVVG
FT                   GLYDDGDPRRDQGFLYFYMSINIGSLFAPIVTGLLKDHYGYHVGFIAAAIGMALGLIAF
FT                   FHGRSKLREFAFDIPNPLAPGEGRRMVLRALGIAVVGAVLAIGFKALLGEWTSAIAYAL
FT                   FAFASVTALSYFLTMFRSPKVSDRERGHLWAFVPLWVGQVLFTMIFEQAAGKMPTFAKD
FT                   NTDGHIVGSWSVEPEQYQTINPAAVLILAGLLGMWFRRREGKFPNTPQKFAISVFIIGI
FT                   TALIMGFGFRSWPGGNRLAPWWFLAVVFVIQTVAELFMNPIGLSTATKLAPKKFASQNM
FT                   TLWLLASACGQGLASVTIERTKNLGDVVFYYSLGIVTILVAVVLFVIAPWTQAKMKDVD
FT                   SVAEEGDA"
FT   gene            167045..168424
FT                   /locus_tag="PPA0139"
FT   CDS_pept        167045..168424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0139"
FT                   /product="reductase, ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81897"
FT                   /db_xref="GOA:Q6ABH0"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABH0"
FT                   /protein_id="AAT81897.1"
FT                   /translation="MPCQGVYAWCGNPVSGGDGCHPSWQDMPLRADMPYEAWPSAKSSL
FT                   EPSKRQGRQVTLVGVCIVSTMNPILGADMTTYQYLIVGGGMAADSAARGIRDIDKKGSI
FT                   AILSADVDAPYPRPALSKKLWTDPEFTWDQADLATVADTGAELRLGTEVLSIDRDGKTV
FT                   LTASGQVFGYQKLLLVTGLTPSRIDDDGDAVLYFRSARDYQQLRALAQPGHQFVVVGGG
FT                   YIGAELAAGLVQQGCEVALVTPDPTLGGSQFPAQIASEYQKLFADAGVHLVTGKRVCSV
FT                   RKHEAAEVTLDDGTILQADDVIAGLGASPVTKLAEEAGLTVNDGVIVDEQLRTNDPAIW
FT                   AAGDIANYPDPVLGRTRVEHVDNAIAMGKAAGRIMAGSKDSYTHTPMMYSQIFGVRWEA
FT                   VGTLDSSLATTSVEAGDGQVVYYLSDGKPVGVLLWNLPGRTDKAVTVLADPPEDLSTAI
FT                   S"
FT   gene            168440..169240
FT                   /locus_tag="PPA0140"
FT   CDS_pept        168440..169240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0140"
FT                   /product="putative ketoacyl reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81898"
FT                   /db_xref="GOA:Q6ABG9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABG9"
FT                   /protein_id="AAT81898.1"
FT                   /translation="MDLGLNGRTALITGADSGIGWHTAKLLLAEGAKVAITDLDSDELT
FT                   QAAQALDVADDRLVALPADVTDADSLAKLHQQVKDALGPIDILVQSAGVTGAQGKFHEI
FT                   DEEGWRSTLDIDLMGPVRVLREFLDDLRTGGWGRVVLLASEDGVQPYDDEIPYCAAKAG
FT                   VLALAKGLSRTYAREGLLVNAVSPAFIHTPMTDAMMNKRSKELGVSFDEAIESFLDQER
FT                   PYMELKRRGEPEEVAAVIAFLCSDKASFVNGSNYRVDSGSVATF"
FT   gene            complement(169304..169561)
FT                   /locus_tag="PPA0141"
FT   CDS_pept        complement(169304..169561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81899"
FT                   /db_xref="GOA:Q6ABG7"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABG7"
FT                   /protein_id="AAT81899.1"
FT                   /translation="MASKTVKVGSSVGLHARPAAVISQEAAKLSSTVTLAAEGGEPIDA
FT                   KSVLLIMTLGASAGDPVTVASDNEDDVNTIADLVASNLDA"
FT   gene            complement(169597..171609)
FT                   /locus_tag="PPA0142"
FT   CDS_pept        complement(169597..171609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0142"
FT                   /product="phosphotransferase system"
FT                   /EC_number="2.7.1.69"
FT                   /note="putative fructose-specific IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81900"
FT                   /db_xref="GOA:Q6ABG6"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABG6"
FT                   /protein_id="AAT81900.1"
FT                   /translation="MSTPLITPELVSLDANLGSTKTEVITSVAGLIAAAGRADADGLAH
FT                   DALDRESKSPTGMPGGFAIPHCRSAAVSQVSLGFARLSPAVDFNGPDGPADLIFMIAAS
FT                   EDGGADHMKLLTKLARALVNPEFVEQLRQAPDAQTVVDLIGGVVEPKEEASTSSATALP
FT                   APGHAAVTNAASDTPRIVAITACPTGIAHTYMAADYLRAAGKKLGVDVKVEPQGSTATE
FT                   PLSTDDIEGADAVIFATDVGVKGRERFAGKPVIESGVKRAVDEPEKMISEAVAASKDPH
FT                   AHRVPAGHGEQQEPEQAGSHIGWGKRIQQALMTGVSYMIPFVAAGGLLIALGFLFGGYE
FT                   IAKDGMDIALHNTFSNLPTPTAHALGGSATMTYIGAVLFAVGQAAFGFLLPALAGYIGF
FT                   GLADRPGIAPGFVAGAVAGVTGAGFIGAIIGGLLGGFVAYWFTRLNPPRWLRGLMPVVI
FT                   IPLVGSLVAGGLMYVVLGRPLAALTNALNNWLGGMSGASAVILGIVLGLMMCSDLGGPI
FT                   NKAAYLFATTNLAVTNVGSLKVMAAVMAAGMVPPLAMALSTTLRPKLYQPAERENGTAA
FT                   WLLGASFISEGAIPFAAADPLRVIPSMMVGGAITGALSMALGAASKAPHGGIFVFFAID
FT                   RVWAFILAIVVGTLVAALLVTALKASARRKAAAAA"
FT   gene            complement(171619..172569)
FT                   /locus_tag="PPA0143"
FT   CDS_pept        complement(171619..172569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0143"
FT                   /product="putative phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81901"
FT                   /db_xref="GOA:Q6ABG5"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR022463"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABG5"
FT                   /protein_id="AAT81901.1"
FT                   /translation="MIVTVTLNPSIDRTAPIAGPLRRGQVNRLGSSTEVAAGKGVNISR
FT                   VLRGAGIETCAVVPAGAKGRLTLGLNHDDIPHQVVPVAAAVRTNLTITEPDGTTTKINE
FT                   PGADLSPEELTAVEEAIVEKSSGAQWVVLSGSLPPGVPTHWYATMTDRLHEIGVKVAVD
FT                   TSDQPLQELAARLPDCAPDLVKPNSVELGQLCGIDGDSLESAATRGQFDDVVVAARGLH
FT                   GIAEVIVTLGGTGALLITEHDAWHARPEPVEVKSTVGAGDSSLAGFLLARTRGDQPENC
FT                   LRAAVAWGTAAAALPGSTMPTPSQADAIHVSLTHL"
FT   gene            complement(172897..173658)
FT                   /locus_tag="PPA0144"
FT   CDS_pept        complement(172897..173658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0144"
FT                   /product="transcriptional regulator, DeoR-family"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81902"
FT                   /db_xref="GOA:Q6ABG4"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABG4"
FT                   /protein_id="AAT81902.1"
FT                   /translation="MYPAERHKWLIDTARETGRVSVAEASTALGVVPETIRRDLDQLCN
FT                   QKMLRRVHGGAIPIEFDLLGDQPLATRDSSAVTQKEQIARAALSHLPSDKGSIILDAGS
FT                   TTGRLASIMPSTRRFTVFTNSSPIASTVATHSNCDVHLLGGRLRPTTQATVGNVDAIAR
FT                   LRVDVAFMGTNGISPTHGLSTPDADEVATKAAMVANAHHVVVLADSRKMGAESTMRFAE
FT                   LGDVDVIITDSGVTPHQVEMLHKAGVDIVIA"
FT   gene            173823..175121
FT                   /locus_tag="PPA0145"
FT   CDS_pept        173823..175121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0145"
FT                   /product="putative UDP-N-acetyl-D-mannosaminuronic acid
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81903"
FT                   /db_xref="GOA:Q6ABG3"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABG3"
FT                   /protein_id="AAT81903.1"
FT                   /translation="MKIAVVAMGKIGLPLAVQFAEKGHDVIGVDVQQRVVDEINKGNEP
FT                   FPGEAFLDEKLKKLVPAGKLTATTDYSQAIPGADAIVLVVPLFVNDETWEPDFGWMENA
FT                   TKSLAEYLTPGTLISYETTLPVGTTRNRWKPMIEEISGLSEGKDFHLVFSPERVLTGRV
FT                   FADLRRYPKLVGGLNDEGTAKGIDFYQQVLDFDDRDDLPRANGVWDMGTAEAAEMAKLA
FT                   ETTYRDVNIGLANQFGKYAAANGIDVYKVIDACNSQPYSHIHRPGIAVGGHCIPVYPRL
FT                   YLWTDPDATIVRTAREANMTMPQYCVDQAASVLGDLSGKKIVVLGASYRGKVKETAFSG
FT                   VFPTVDILAKAGADVSVHDPMFTDEELGKFGFKAYHIGDPVDGALLQADHPEYAELTPA
FT                   DLPGIKVLVDGRHVVDPAVWGDVEVIVVGDGEA"
FT   gene            175105..176364
FT                   /locus_tag="PPA0146"
FT   CDS_pept        175105..176364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0146"
FT                   /product="hypothetical protein"
FT                   /note="putative WzyC, O-antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81904"
FT                   /db_xref="GOA:Q6ABG2"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABG2"
FT                   /protein_id="AAT81904.1"
FT                   /translation="MTGRPEYSGSFLDKIVEGLLVLLPPAALLGPWAGSGRVFGYRILV
FT                   VLLVGCAVTGWIYPIWVRRFSRAACAIVVVAVAWAVTGVVGAMRLGPRRDLSSLMGAGL
FT                   ALAGAWSVARLISDRHIRRERALRDVAIGWAVAVWVGAPLAVWEILTARHLGTYADGAW
FT                   RNHPGLYRQPATWLTNPNLYAVFLAVGSVWVGVVGVRSATRWVRIAAIATAVTGLGLLL
FT                   ATDSRIIYAALLLAVMVRLWAVRRWRWVLPGVVMAVVVVIVVTHLHQAGLVWHRFIGVL
FT                   IHHNDEGPSSFAVRTTLLAWGLALVMEYPLLGAGPGGYRANILAAPKRWFPHGKSDPHN
FT                   GILEIASQYGLVVTALVAVCWCLAIGRCWRSRRWWGAALITAMPVLSLANSTYLVQSVN
FT                   QLGWLVCVLAASSSRQETPQ"
FT   gene            176483..177598
FT                   /locus_tag="PPA0147"
FT   CDS_pept        176483..177598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0147"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81905"
FT                   /db_xref="GOA:Q6ABG1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABG1"
FT                   /protein_id="AAT81905.1"
FT                   /translation="MRILIVGAASSIHTVRWVNGLVKRGHEVHLASVHPVGRHSIDSRV
FT                   RIHLAPHGGKAKYVVNAGWLRSVAAGVQPDIVNVHYATGYGLLARLAHIDAPTLLSVWG
FT                   SDVYDSPRANPLMRHMVRSNLVSATRIASTSHCMARVTRDLVNKPISITPFGVDTEILT
FT                   PPDRRRDANDGDGVVCIGTIKALHSKYGIGELIRAFSRVHDERPNTVLHIWGGGPDENP
FT                   LKVLARRLVPDGSVEFRGAIDHSEVRDALGSLDIFAALSTLDSESFGVAIIEAGACGLP
FT                   AVVSDADGPAEVVEDGVTGLIVPRGDVIASATALMQLVDDVELRRRMGGAGRHHVVETY
FT                   SWERSLDLMELAYRDTIDDAARQHCSGRHGG"
FT   gene            177696..178769
FT                   /locus_tag="PPA0148"
FT   CDS_pept        177696..178769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0148"
FT                   /product="putative UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81906"
FT                   /db_xref="GOA:Q6ABG0"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABG0"
FT                   /protein_id="AAT81906.1"
FT                   /translation="MRVVSIVGARPQFVKLAPVAKAFAAEGIDHKIIHTGQHYDVNMSD
FT                   SFFVELGIPNPDLHLGVGGGSHGVMTGRMLEQLDPVLEDMDPDWVLVYGDTNSTIAGTL
FT                   SAVKMHLPVAHLEAGLRSFNRRMPEEHNRVLTDHAADLCLAPTEVAMGHLADEGLASRA
FT                   VLVGDVMTDVCLQVRDSVLANPRPVPGVEAGEEYVMATIHRADNTDDPKRLAHILDALG
FT                   SLDRKVILPVHPRLRARAESDGFTVARGNLTTIDPLAYPDMVNAVTNAAGVITDSGGLQ
FT                   KEAFLLGTICTTVRTETEWVETVENGWNVLDPDAEHLGEYATRPHPEGDPGYPYGDGKA
FT                   ARNVATVLLKTGERDRS"
FT   gene            178769..179890
FT                   /locus_tag="PPA0149"
FT   CDS_pept        178769..179890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0149"
FT                   /product="putative glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81907"
FT                   /db_xref="GOA:Q6ABF9"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABF9"
FT                   /protein_id="AAT81907.1"
FT                   /translation="MANSSRLGRVVSLSTVHHGHDNRVFNKEAKALVAAGHDYHLVISA
FT                   DRDRIDQGVPVVALHREEGRVRRLVVSQREAWRHLQALQPEVLHIHDPELIPLALVWRW
FT                   RHHCKVIYDAHEDLIGQVDTKPYLGAVTRPLAKMAARGLVGLAERSADAVVAATPTVGE
FT                   RFRRASVTVVRNYPWLGNYTVPPKPVPGQLVYVGDLSEERKLSFMIEVTRTVRKQVPQA
FT                   HLVLAGRVLPRCQETVEHAVAEGFVEHLGLVAPTEVPQVLASAQVGLVFLKPLPNYVAS
FT                   LPTKLFEYMASRVPFAASDFPAWREMFDGYGAGIFVDTEDAAATADALSELLADPQRCR
FT                   EMGCAGRRAVESGLNFESQAEALIDLVAGLLEG"
FT   gene            180035..181060
FT                   /locus_tag="PPA0150"
FT   CDS_pept        180035..181060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81908"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABF8"
FT                   /protein_id="AAT81908.1"
FT                   /translation="MSTPAGVVHRTENGWRKSAPPTTTFSVRNLGERLDRRGVARIYRH
FT                   SYVRGQADRAVARGEAVRILPGVVAASAVARDPRIIIRALLLWHRDIVLVGKAALIMLG
FT                   MKAPGTTRPMDFYGVKDVEAFSTTRCLTRPGIRVRRWHIPHWFITEREQIRIATAEVSV
FT                   LILAIQGEWGWVCEALRQRVVTPESCRQARKSLTGRYPKTKVDAALADICLAAWSIPEL
FT                   EMGRVLRAPGITGHKPNHKVRVGDRYYYLDRAFEAEKVALEIDGRSVHGTIDGFEATMM
FT                   RSAHLDRHGWKVLHVTPTMFREDPRFVLDWLASHLHRRHRPKTMFTEFALRRIMSGAAP
FT                   A"
FT   gene            complement(181406..181702)
FT                   /locus_tag="PPA0151"
FT   CDS_pept        complement(181406..181702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81909"
FT                   /db_xref="GOA:Q6ABF7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABF7"
FT                   /protein_id="AAT81909.1"
FT                   /translation="MKKMSKPEVNPEEINKGTLVAVAVAAVAVIGIALKAMRKGPKDRK
FT                   TGSQDPSLFENLATRKPSGGRVTQRRDPRADGHATPMGGTGRVSTAPDFYSYK"
FT   gene            complement(181699..183081)
FT                   /locus_tag="PPA0152"
FT   CDS_pept        complement(181699..183081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0152"
FT                   /product="putative NADH dehydrogenase"
FT                   /EC_number="1.6.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81910"
FT                   /db_xref="GOA:Q6ABF6"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABF6"
FT                   /protein_id="AAT81910.1"
FT                   /translation="MGINNLLSDIGLPGLGCKPVLTDSKPRVVIVGAGFGGLAAAEKTA
FT                   EAGCDVTLIDRNPYTTFQPLLYQVATGGLNPGDVTYRLRSFAANNGPHTHFRRACVTGI
FT                   DTENRIVEVDNGDPISYDYLVLSQGVGANFFGTPGAAENSYTIYTRASSLRARDAIFTY
FT                   LEDLDTQRDKTFDVIIVGGGPTGVEMAGTLAEMKSIGIPAIFPDVSTDRVHVTLVEMAN
FT                   HLLMPFDPALRHYTRRQLQKRGVDVRTNTAIAEVREDSVLLKDGQTLPADMVIWAAGVG
FT                   AHKSVTNWGFEQGRGGRIATDGTLLVKGQDRIFAVGDGAINTEDPKPQLAQPAIQGGEC
FT                   VARQIVHLELGEPLEKFEYNDKGTMATIGRNSAVVQLSEKLKFTGIGAWLTWVTVHIFT
FT                   LLGGRNRLQAMINLGARYIAFHREAGAIVGDVLSEEGKENMNKNALRDDDEKGAKPIDG
FT                   KE"
FT   gene            183208..183855
FT                   /locus_tag="PPA0154"
FT   CDS_pept        183208..183855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0154"
FT                   /product="MutT/Nudix family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81911"
FT                   /db_xref="GOA:Q6ABF5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABF5"
FT                   /protein_id="AAT81911.1"
FT                   /translation="MPHLHTQPHGHDVTISAWILRQFPSDGVRRRQWKALVHKHRKMNL
FT                   WIQPGGHVEHTENPWQALAHELHEETGYSIDQLSVLQPWDRLPDGIHDLMHPTPVLLNT
FT                   HSPYPGHFHSDIVMAMVAHGDPAEKPRPGESQELQWVSPDEFAALPGAEPDAVMIMTMI
FT                   VERVADSWLAIPATRWSLADAPAEAMTDRSVAEATAPDPLDDRETLGWGTAQ"
FT   gene            183837..186353
FT                   /locus_tag="PPA0155"
FT   CDS_pept        183837..186353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0155"
FT                   /product="ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81912"
FT                   /db_xref="GOA:Q6ABF4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABF4"
FT                   /protein_id="AAT81912.1"
FT                   /translation="MGDRSVTRNCGPDLVRVGAGLPVAAYRDEITTALHGGRAVIVAPP
FT                   GTGKTTFVPPLVASRCSGRVIVTQPRRVAARAAARRLATLTGTRPGEFASHTVHGESTT
FT                   TRDTKVEFVTTGVLLRRLLSDPDLTGVDAVVLDEVHERHLDADLVVAMVCEVAQLRDDL
FT                   TIVAMSATVDSSGWAAFLGGVEPAPVVEVASALHELEVEWAPAAGAAVESRGVSREFLG
FT                   HLGTVTVDALDRHTEGSALVFVPGAREVDHVVADLRSRLAGIDVVGLSGAMSAREQDHA
FT                   LSDPGNVRRVIVSTAVAESSLTVPGVRLVVDSGLSREPRLDRGRGMTGLVTVRESRASA
FT                   VQRAGRAARLGPGVAVRCLRAQDWAGMNADPTPEVDHADLVASLLSLAVWGSPRGEGMA
FT                   LPTPLPQDRVAAAEEELRDLGAVDAEGRITARGRHLATFPLDPRLARALTDGAAIIGSR
FT                   RCAEIAAMLGLEDGQVDFVGQWRQLRSGRHPEAAMWRREADRLARLINDVPPTDITDDD
FT                   AVATVVSLARPGWIARSRGVGSTSYLLACGTGVDLPRNCPPGLLGQPWLAVARTSRITS
FT                   GALIRAAVPLSESAALESGEAMLTNDTPVTWDGGKVRGRRVSRLGAIELSSTPVRPDPV
FT                   RARHVALEAVRSGGLDVASLTKNGESLRRRLALAHRVFGDPWPDVSDEALLACAEEWLD
FT                   LDALAAGRGSDAASGLRGLLGWQESARLDEVAPETITVPSGSRIRVDYPEPGSDTSPVL
FT                   AVKLQECFGWTDGPTVCDGRVRVVLHLLSPARRPLAVTDDLASFWASVYPAVRVENRGR
FT                   YSKHPWPEDPMTATPTKRTNRALRGN"
FT   gene            186661..187290
FT                   /locus_tag="PPA0156"
FT   CDS_pept        186661..187290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0156"
FT                   /product="putative ABC-type transporter, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81913"
FT                   /db_xref="GOA:Q6ABF3"
FT                   /db_xref="InterPro:IPR017195"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABF3"
FT                   /protein_id="AAT81913.1"
FT                   /translation="MTNDKLTMRYRTIDIVTPVMIVVAFGVIFLGYGAVYSLLKPATSV
FT                   YLPIEGILSGIWFLPALLAGLIVRKPGAALLSEVLAAAIEAALGGPWGAGTLISGVVQA
FT                   LPMELCLLVVAYRKAGPKLVLVAGALTGFAEAIYERISYYPMFRFGDTIVYFVFMIVSG
FT                   ALLGGLVAWGIVRGLAAAGALSPFAVSRELRGGKSPRSTISSRNLS"
FT   gene            187287..189386
FT                   /locus_tag="PPA0157"
FT   CDS_pept        187287..189386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0157"
FT                   /product="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81914"
FT                   /db_xref="GOA:Q6ABF2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABF2"
FT                   /protein_id="AAT81914.1"
FT                   /translation="MTDVLTHADHVDEVSSRRAVPVDVEGMTVGVPDRDEPILGPIDLH
FT                   LGAGSRVLVSGPSGAGKTTLLHAIGGLLEEESYDLTGRVNTWSGDVNVGLLQQEPIHSV
FT                   VAATCGRDIAFGPENHRVPREDIWPIVEDSQRRARFTMPMDHSTTKMSGGQMQRLAIAG
FT                   ILATNPGLLLLDEPISMLDEESATAIRDEIARMAHDRTVLVVDHHPDQWRGVLDQVVEL
FT                   TDHGTLKKIWDFEDFLDSREATSLPSHTSTAGEVVASTSSLDAHRPQSDDVLLRGVTMS
FT                   ARRGHITVVSGPSGVGKSTLLRLLAGLDVPASGELTLPDQTAWVPQNPENYLVARTAAD
FT                   ELFASPMVPEDADLRDLVRTFGLKSILDSHPMTCSGGEKRRLAIAAALAQRPDLLLLDE
FT                   PTVGLDDDRGASVLSAIRAAADSGVAVVVSSHDRQVIAMADEVVDVASYRVPDPTPNER
FT                   PGEKPAFLTTINPLVAFLIAIAGIFGSLFVRSPLVGAVGLIPAAVMAPMCSRHVKPLVV
FT                   RTVPVLIAAVMLVWTTLLLHSGFTDPSAWSEATRQGLRILVFVLPGALASAAIDPTRLG
FT                   DALAQQTHLSQRPVVASMAGVVRMGHLGDQWHIQSDVRNLRGLGPKRSLSSRITYLSSM
FT                   TFAMVLYAMRSSEVLSRAMDSRGFATATRRTYAVESRWRARDLWGVVLAAFVVAVPALA
FT                   AVLFG"
FT   gene            complement(189399..190574)
FT                   /locus_tag="PPA0158"
FT   CDS_pept        complement(189399..190574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0158"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81915"
FT                   /db_xref="GOA:Q6ABF1"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABF1"
FT                   /protein_id="AAT81915.1"
FT                   /translation="MPQRKVSVINHYAFPPGSGGITRNFDMFSRLRGWQPHFYAANINH
FT                   TSGERMTVDDPRYTLVPIPQYKGNGVKRVLGWVAFAAGAGARALARPADVIFASSPQIL
FT                   SPAVGMVVAALRRKPFVVEVRDLWPESLVSGGALKEGSALHKVLQGLEKTIYAHARQIV
FT                   VVTKGWEDHFREIGINVDKITVVPNGADLAEYEVKESREELRKEYGISGFTAVFSGTHA
FT                   NYVGLDLIVDAARRLPDVNFLLVGAGARKQWAIDEVAKLRLTNVTFHDQVPKSELVRIL
FT                   SACDVGLHTVSPQSVFDKGMSPNKLYDYMAAGLAVVSNAKVPIRDVISDDEVGACVDPT
FT                   DLVAGIERVRDADEATMKRWHERARELMANKYSLQASVDKLARVLEKALYR"
FT   gene            complement(190665..191084)
FT                   /locus_tag="PPA0159"
FT   CDS_pept        complement(190665..191084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81916"
FT                   /db_xref="GOA:Q6ABF0"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABF0"
FT                   /protein_id="AAT81916.1"
FT                   /translation="MSHPSHFTAPSPSKRHPLRTLSRLGVGGLLAYAGVGHLTFVREEF
FT                   QAQVPDWVPVDDDTVVWLSGAAEIILGAALLSGRHKKFWGRSAAAFFAAIFPGNVGQLV
FT                   EHKDGFGLDDDRKRTIRLLFQPILVGLALEGTRED"
FT   gene            191062..191460
FT                   /locus_tag="PPA0160"
FT   CDS_pept        191062..191460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81917"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABE9"
FT                   /protein_id="AAT81917.1"
FT                   /translation="MKCDGWDIDPPDDQKRYSIDDNSWKFWFCFVVEAVKVARGPLRNP
FT                   FTTAGPRVRWPVVWTDSGSGRSWRSDRFPELVAGTFKMTSSRGDHVTASRTSIAAQPVG
FT                   STPRLCGSALAIGYRYSPERWCGISVGE"
FT   gene            complement(191680..192687)
FT                   /locus_tag="PPA0161"
FT   CDS_pept        complement(191680..192687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0161"
FT                   /product="dihydroorotate dehydrogenase"
FT                   /EC_number="1.3.98.1"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81918"
FT                   /db_xref="GOA:Q6ABE8"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABE8"
FT                   /protein_id="AAT81918.1"
FT                   /translation="MSDLHTKYMGLTLRSPLVASAGPIQQKVDGVRALADAGVGAIVMY
FT                   SLFEEQVRHEEARQAEIELEYMDSFAESLSFFPTVASNEGGITERYLAHLEASANAVDI
FT                   PVIASLNGATNGGWVDTAKRMENAGAAGIECNIYMVPGDLEQSAEEVEDRHVEIVQAVK
FT                   DAVSVPVAVKLSPFFSALGNMATRLDAAGADALVMFNRFLQPDINVETMQVEPGVWLSS
FT                   PADARLPLTWIAVLSGRIGASLAASSGVESANDVVKYLLAGADVVMTTSALVRHGAGYA
FT                   TELQKGLESYLQRKEVDLDTLRGTLAVPNDASTAEYERNGYVAALEKAKTTYGS"
FT   gene            complement(192711..196325)
FT                   /locus_tag="PPA0162"
FT   CDS_pept        complement(192711..196325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0162"
FT                   /product="pyruvate-flavodoxin oxidoreductase"
FT                   /EC_number="1.2.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81919"
FT                   /db_xref="GOA:Q6ABE7"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABE7"
FT                   /protein_id="AAT81919.1"
FT                   /translation="MANSSDSRVRTIADGNTAAASVAYRCNELCSIYPITPSSPMAETA
FT                   DEWSAAGRKNIWGDIPTVMEMQSEGGAAGAIHGALQGGALSTTFTASQGLLLMIPNMYK
FT                   IAGELTSTVFHVAARSLAAQGLSIFGDHQDVMACRQTGFAMLCSSTVQECHDLALISQA
FT                   ATMRSRVPFMHFFEGFRTSHELNVLEMLSDDDIRHFITDDLVHAHRERALSPAHPFIRG
FT                   TAQNPDTHFQAREAANKYYEKVPSIVQSLMDEFAQVVGRQYHLVEYHGDPEATEVIVCM
FT                   GSGARTIEHTIDHFNARGHKLGLVELHLFRPFPTAEVVKAIPETARTVAVLDRTKEPGS
FT                   NGEPLFLDVLAALSEAHSRGTRNSMPIVSGGRYGISSKEFTPGMVAGIVAELELESPRP
FT                   RFTIGIDDDVTGISLPWEPLDIEDPTTIRAVFYGMGSDGTVGANKNTIKILGSDPNTYA
FT                   QGYFVYDSKKSGSKTTSHLRFGPKPIEAPYLVSQAGFIGIHAWGILESMDVLTMAREGT
FT                   TVLLNSPYSADEVWDKLPDTMQRQVLDKHLDLWTIDALSVARKVGLRNRTNTILQTCFF
FT                   AISGVLPKDEAIAKIKDSIQKTYGKKSQKIVEMNHAAVDASLEHLHQVKVPDQMTANHS
FT                   LIPAVREDSPKFVKNVTARMIEGFGDLLPVSALPDDGTYPAGTTKYEQRTLSDVIATWE
FT                   PNACIQCGNCAFVCPHGVIRSKYYPQSQLEGAPESFQSAELNAAGLPESCYTLQVVPDQ
FT                   CTGCGLCVEACPAHPVGEPDRKAINLEEHLDKTVQRENVKFFETIPVNDRSRVDFATVR
FT                   GTQFLEPLFEFSGACSGCGETPYVKLITQLFGDRAEVANATGCSSIYGGNLPTTPWGKN
FT                   ASGRGPAWSNSLFEDNAEFGLGMRMAANVQTELARRRLQEVSSQLDPEFVEDLLHAPQL
FT                   TEHDLQSQQHRVKELQAKLADMEQTPAVRDLMSVADHLLRRSVWIIGGDGWAYDIGSGG
FT                   VDHVLASGRDVNVLVLDTEVYSNTGGQASKSTPLGAVAKFASAGKPTAKKDMALQAIAY
FT                   GSVYVARVALGADPQQTLRAFREAEAYPGPSLIIAYSHCIAHGYDLRNGLDQQYKAVHC
FT                   GHWPLMRYNPVLADEGRNPFLLDSPKPDETWREYTKLELRYRMLQKAHPEEAERMLDLG
FT                   QRQVERRYAEYAEMASRTAEDFAVDARMSEFAASSNRA"
FT   gene            complement(196341..198128)
FT                   /locus_tag="PPA0163"
FT   CDS_pept        complement(196341..198128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0163"
FT                   /product="dehydrogenase, GltD family"
FT                   /note="iron-sulfur cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81920"
FT                   /db_xref="GOA:Q6ABE6"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABE6"
FT                   /protein_id="AAT81920.1"
FT                   /translation="MSAETMTSDTTDPNGYVIRENQDITARPDLARTTGRVTPTRTRRP
FT                   VYLDMLPPCNAGCPAGENIQEWLRLIKAHEEEKAWRQLTADNPFPAIHGRVCYHPCEVA
FT                   CNRADLDGAVSIHSVERYLGDLAIEKGWTFTRPTEPSGHRVLVIGAGPAGLSAAYHLAM
FT                   LGHDVEIHDAGDKVGGMMRYGIPEYRLPREILDAEVARLTDLGIKIVLNHPVNDLMEEK
FT                   AKGRFDAVFVAIGAHLSKRVDIPTVDASRMVDAVSFLHNVAAGEKPLIGRRVAVYGGGN
FT                   TAMDAARVAKRLGAEESIVVYRRTAEQMPAHAEEREEAEREGVQMNWLRTITDVGDDLT
FT                   VEVMELDEDGKPHGTGRYEKLEADTVILAVGQDADTSFLHKMPGMRFRNDVVDVNPSTL
FT                   MTDVPGIFAGGDTVPSERTVTIGVGHGKRAARQIDLWLNRESGYPTAKNTTVGFNDLNL
FT                   WYFGDHLRRHQPELDPTQRVGFDEVVGGLTDDQAHFEAGRCLSCGNCFECDGCYGSCPE
FT                   DAIIKLGKGHRYEFNYDKCTGCATCFDQCPVHAIEMIPEGTDPATVQGSGNPTPGWAVR
FT                   PEPNPQRSASLKFTVDSEN"
FT   gene            198350..198724
FT                   /locus_tag="PPA0164"
FT   CDS_pept        198350..198724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0164"
FT                   /product="conserved protein"
FT                   /note="DUF77"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81921"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABE5"
FT                   /protein_id="AAT81921.1"
FT                   /translation="MCPRCQTRWFPGRWCKTGTMIVAFSLVPSGGRASREDGGVADAVA
FT                   AAVRVVRDSGLPNHTSSMFTEIEGSWDEVMDIVKRATEAVAQYGTRVSLVLKADIRPGR
FT                   TGEMTAKLERLQGELDKQHN"
FT   gene            complement(198746..199567)
FT                   /locus_tag="PPA0165"
FT   CDS_pept        complement(198746..199567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0165"
FT                   /product="regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81922"
FT                   /db_xref="GOA:Q6ABE4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABE4"
FT                   /protein_id="AAT81922.1"
FT                   /translation="MNYWRLRINSPTRIPAMTQTRDAGSSRPDPHAGHQASVTHSSTAS
FT                   KSGGFSVVMRHIDDEILAGRWVNGSRLPPERELAASLSVSRGAVREAIRALEAQGILSS
FT                   GTGRSNGTRVDARPSDAMGRILRLQLALDVVSFADLTETRIALEKAACAAAAKVRAPVP
FT                   LTRATDLLVQMHDAMQPDSFNALDTAFHVALAEAGDNRLMRDLTVAIREAVHLPILEAE
FT                   HSLIGWEQWRDDLVCDHQEMLAAIENGDSERAAKVTEAHIRNTYDTLLIDR"
FT   gene            199902..201590
FT                   /locus_tag="PPA0166"
FT   CDS_pept        199902..201590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0166"
FT                   /product="putative L-lactate permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81923"
FT                   /db_xref="GOA:Q6ABE3"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABE3"
FT                   /protein_id="AAT81923.1"
FT                   /translation="MVLLQTFTPSANPLGSQWLSALLAVLPVLAMLITLGALRWKAHLA
FT                   GLFSWGVALIVAITAFPMPIGMAFSSSVQGFLYGLFPISWILLGAIWMYQVTVISGRFD
FT                   DLRRTFFLISDDPRVLGILIAFCFGGLLEALAGFGAPVAIAAAMLIAIGFGKLRGAITA
FT                   LVANTVPVAFGAVGLPVLMAAKTGGLDVAMVAPVTARVCAVLCLVVPFLMLAIMDGRKG
FT                   VRECWPFGLFVGVVFGVTKVIVGGTPVYNLTEIFAAVVTVALSLLFLKVWKPKGGREAA
FT                   ERIGIPIDPTVEIESVEAQEVDTSDLTGSRIFMALVPYILVIVVFGIAAIPAVKDSFKA
FT                   ADVKMAWPGLSGLMTAGGEAAAHQTYTWQWLSQPGFLLAIVAILVGFIYRVPLADVTKE
FT                   LWINAKKMKFSMLTIGLVVALAYVMGDSGQTLALGMFIAGAGAVYPFLAPILGWIGTYV
FT                   TGSDTSANILFSGLQSSVGQQVGAGSYLGMESMRHLLVGAGASGGVVGKMISPQSLTIA
FT                   ATAIGLAGGESVILRKVFKFSIILLVLMCIIVGLMSTPVLGWMVP"
FT   gene            201645..202439
FT                   /locus_tag="PPA0167"
FT   CDS_pept        201645..202439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0167"
FT                   /product="conserved protein"
FT                   /note="similarity to fumarate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81924"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABE2"
FT                   /protein_id="AAT81924.1"
FT                   /translation="MTTTTSPGARATLPGLPGAGMTVGLFITCINDVMFPQTGVAVTTL
FT                   LERLGCKVEFPREQTCCAQMTTNTGYFDEGIPTVRQYVRAFGDYDYIVAPSGSCVAAVR
FT                   DQHPMLAEYAGDSGLAKEVEHTSQCTYDLPEFLVDILGVTDVGAYFPHRVTYHPSCHGK
FT                   RLLNLGDRPYELLRHVKGMTLVDLPMAEQCCGFGGTFCIKNPDMSAAMANDKARHVRET
FT                   EAEYVVAGDNSCLMNIGGVLSRQNSGVKPIHIAEILANTEED"
FT   gene            202443..203978
FT                   /locus_tag="PPA0168"
FT   CDS_pept        202443..203978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0168"
FT                   /product="putative iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81925"
FT                   /db_xref="GOA:Q6ABE1"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABE1"
FT                   /protein_id="AAT81925.1"
FT                   /translation="MSTELRRVTYGNHGVARLTPAPDKPGTYMGMPKFSKAVKGELNLS
FT                   VQRKNMRNATMTIRNKRAMRVSESPDWQDLRDAAESIKNRVGRHLDHYLVEAEKNLTAN
FT                   GVHVHWARDGEEANRIVAQIAKDKGVDEVVKIKSITSQETDLNEYLEEQGIAAWETDLA
FT                   ELIVQLGHDRPSHIVVPAIHRNRAEVREIFLHEMKNYGRPAPEDISENPPELTNAARLH
FT                   LREKFLRAEMAVSGGNFVLADTGSLVIVESEGNGRMCLTLPDTLVSIVGIEKVLPSFDD
FT                   LEVFLKLLPRSATGERMNPYNSVWSGVTDGDGPQEQHVIFLDNGRTDVLADTLGREVLR
FT                   CIRCASCINICPVYERAGGHAYGSVYPGPIGAVLNPQLRGVEHPVDRGLPYACSLCGAC
FT                   NEVCPVKIPFTDILLKLRNKVVKSEKADRIPQDYEVAGEMGLMKTASWAFSDHKHFEAI
FT                   QVGSRGVGRVLRGKKMGPVPVPVAERWLKYRDVDAPPADTFRTWWKKNREAQR"
FT   gene            203975..204655
FT                   /locus_tag="PPA0169"
FT   CDS_pept        203975..204655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0169"
FT                   /product="conserved protein DUF162"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81926"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABE0"
FT                   /protein_id="AAT81926.1"
FT                   /translation="MTTISTDPVARTEILARIRRASTDITNSDPVADVPIEWEYGTGID
FT                   MDDVVGTFVEKVIDYKATVVRVKGADVPQAVVEGLRSTGAEHSAVVPVGLDKSWVGAIK
FT                   TAGFDARLDDPQLSKKELNDTDAVVTGAACGIADTGSIVLTHVEDQGRRAITLVPDRHV
FT                   CVVKASQVVSDVPEAIQIVKPAVHEGHPLTFISGGSATSDIELSRVDGVHGPRRLYVIV
FT                   VDDR"
FT   gene            204847..205509
FT                   /locus_tag="PPA0170"
FT   CDS_pept        204847..205509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0170"
FT                   /product="putative ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81927"
FT                   /db_xref="GOA:Q6ABD9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABD9"
FT                   /protein_id="AAT81927.1"
FT                   /translation="MTVELAPGRTVLLGPNGAGKSTLFSLCSGSRAPTSGRIGLAGMAE
FT                   ASSRTLRRRVGLMRQNVLPMPGFTVREQIIYCGWLMGMSTREATVRADDVIAAVNLTEK
FT                   ADDRTSRLSGGQLRRVGLAQVLVGEPEVLLLDEPMAGLDPAQRVRFRAVLEHVPDDRVT
FT                   VVSTHQVDDLTDSYDRVIVLSCGRVVFDGTPKEFVDLAPECSQRRAEMAYLGLVADE"
FT   gene            205506..206735
FT                   /locus_tag="PPA0171"
FT   CDS_pept        205506..206735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81928"
FT                   /db_xref="GOA:Q6ABD8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABD8"
FT                   /protein_id="AAT81928.1"
FT                   /translation="MRLTTRLRTAPGVWLAPLMVVAFIMVVNDTAGEPYWLAQVAGDAG
FT                   RTMVVNALCALAGALEGHRLRTVALRSNRVRSWWRVLLGPIVTSAAMTTVLSVVFMARH
FT                   GFAPHTLGWSILGVTVLSTWAWTVAGIALGLWLHVAVAAPIALATPLVWVTFPPGMSIY
FT                   WLRHLTGSWIGCCTITQTLNPLVITGTLRVELGLLVAAVVVVSARAAQHGRRLLLSLGG
FT                   CVLVIGFIAGAVQVRHLDAFPTIDRELSVTCRTVEGADVQLCLLPEHEAERSLMASSIK
FT                   RVFPIWKRAGIGLPSIYSEQALPGHKDAVEISVSPDMPDAAFAIARLATATGHCFCPPA
FT                   STSPTEVIQYEGRIDAWLREVARASGMEVVGAGVDAEDVTWAERLRTKDPTTQAVVVTR
FT                   MQKYLRDCYR"
FT   gene            206732..207325
FT                   /locus_tag="PPA0172"
FT   CDS_pept        206732..207325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81929"
FT                   /db_xref="GOA:Q6ABD7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABD7"
FT                   /protein_id="AAT81929.1"
FT                   /translation="MRYWMRSRLAWLQLALACVFAAVCARTDPDEVAVPAIFGSFGAVV
FT                   VFSNLFGLVLTILYAVGLSRADLSVEDRSPRQTGILDAALGLALSGIMVLGLFGGPANA
FT                   QVIRDVPILLAMTMIAARWMPRNVSALPAIAYFFVGLLAGRQRNEREGWWNWPVADAAG
FT                   PVSVGWIIATTVCGVLALSLPVRTVRRRCEADLG"
FT   gene            complement(207350..208954)
FT                   /locus_tag="PPA0173"
FT   CDS_pept        complement(207350..208954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0173"
FT                   /product="transport ATP-binding protein, CydCD"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81930"
FT                   /db_xref="GOA:Q6ABD6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014223"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABD6"
FT                   /protein_id="AAT81930.1"
FT                   /translation="MNARTTQLLKTLLRDVPRGRWLLVLSTLLAACASGASVALMGVSA
FT                   WLLSRAAEMPPVLYLEAAAVGVRFFGISRGVFRYAERLVGHDLALRMQGALRMRVYDRL
FT                   SRTTLLGRRRGDLLVRVTADVDAVLDMVVRVIVPACASSLVIIGTTVLLARFSLTSAAV
FT                   LLLSALLAAVVMPAITQRLSRAADSSLVPLRGQLADRTRELAHCAPDLVAYGAQDAILA
FT                   DVLEVDSRLRTAEQRAAWGRGLGTAGQILAAGLAVVSALWIGGNAVADGRIGGRILAVL
FT                   VLTPLALHEVFGAFTGAAQTHTRAKAALQRVVEVLDAPQVGVGDSPTAAASEEKPSLVI
FT                   EGLTVGWPGNQPVLSNVNLHVVAGESVAIVGRSGIGKTTLAATIMGLIPPLTGTVTTTG
FT                   RVRYLAQNAHVFATSISENVRIGCKEATEDEVLTALSRAGLAIPPRRVVTEDGSSLSGG
FT                   EAQRLALARVLVNHGTPADPATHDLLILDEPSEHLDVETSEALMSDLWATTSGTAKVVI
FT                   THDPLVMARCDRVWHVG"
FT   gene            complement(208951..210591)
FT                   /locus_tag="PPA0174"
FT   CDS_pept        complement(208951..210591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0174"
FT                   /product="transport ATP-binding protein, CydCD"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81931"
FT                   /db_xref="GOA:Q6ABD5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014216"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABD5"
FT                   /protein_id="AAT81931.1"
FT                   /translation="MAAPLDPRLVRRARATLPFLAGLCVVGVATALLILAQAWLLSRGV
FT                   SSVFAAHHLDGVAMWCGLLAAVFCGRACLAWLQESLAHRASASVKSQLRRDILQARLSR
FT                   PTDATMPSGTLISLMTTGLDALDGYYSKYLPQLVLAVIVPAVLATAIGLNDLTSLVIVV
FT                   VTIPLIPVFMALIGWRTEAAVAKRFKVATRLANHFADLVAGLPTLQVFGRARAQLEGLR
FT                   RTEAANRSETMRTLRISFLSSFILELLATLSVALVAVTVGFRVAAGGMDLRTSLFILIL
FT                   APEVFLPVRQVGVLFHDAADGMAAAEVSFGLIESGRPTAPKSDVEIASPREVPVVISGL
FT                   THTYEGTDRAAPDGLSLRIEPGSVVALVGHSGGGKTTALSCLLGFIDPDSGSILVGDRE
FT                   LIGADESVWQSWRRQLAYVPQVPAMMAGTVAENIRLGCSDAPEAMLRDALDRCGAAAIP
FT                   LNKRIDDDAEGLSAGERRRVALARALVRVEQAEAGLLVLDEPTAGLDADTEATVLEAVR
FT                   ASGASVLVVSHRRNIIAAADVVVDLEVLA"
FT   gene            complement(210595..211668)
FT                   /locus_tag="PPA0175"
FT   CDS_pept        complement(210595..211668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0175"
FT                   /product="cytochrome d ubiquinol oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81932"
FT                   /db_xref="GOA:Q6ABD4"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABD4"
FT                   /protein_id="AAT81932.1"
FT                   /translation="MLPVLETTAHSPLTIVWFVLITVLWVGFFFLEGFDFGVAMLLPFL
FT                   GRDDKDRRLMVNTIGPTWDGNEVWLLTAGGATFAAFPGWYATMFSGLYLPLLLVLLGLI
FT                   VRGVAFEYRSKNPSSSWRNAFDWMATIGSFLPTLVLGVGFANFVRGLAVGPHSTPDGGT
FT                   APLVTTSFWGLFTPFALIGGILFVVLFCAHGANFVALKTMGDMHDRARKTSAKLGWIAT
FT                   VVALVWALMFNIMYVTRDGRQVLTWIICLLVVVLLAAGSAVVAKGREGLAFLCTALGIA
FT                   LMIVACMFAMYGNLGYRPSGIAFDMWIASATGRTLKIMTISACVFVPIVLAYQVWSYWV
FT                   FRKRLTREAIPDTAVAA"
FT   gene            complement(211681..213201)
FT                   /locus_tag="PPA0176"
FT   CDS_pept        complement(211681..213201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0176"
FT                   /product="cytochrome d ubiquinol oxidase subunit I"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81933"
FT                   /db_xref="GOA:Q6ABD3"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABD3"
FT                   /protein_id="AAT81933.1"
FT                   /translation="MDAQLIARWQFGITTVYHFFFVPITIALSMLVAVMQTVWLKTRND
FT                   RYLRLTKFYGKLFLINFALGVVTGIVQEFQFGMNWSEYSRFVGDIFGAPLALEALVAFF
FT                   MESTFVGLWVFGWEKLPKGVHLACIYLTAIGTMISAVFILAANSWMQNPVGASYNPVTH
FT                   RAELTDFGAVLSNPVFKATFVHQISSSYTVAGALIAAIAFWHLAKVARGRTTSQISDAE
FT                   EVESVRTWRWASKFGAWVLIVACVGVVLSGDYQGKVMTDAQPMKMAAAEAAYQNTSDFS
FT                   VLTIGNKDGSEEVWALKIPGMLGFLGNGKWGSQVKGINELKSYQVHEYTYHRKDGSQTP
FT                   LQASYQNVLRQKIDANGIKLEPNVPLSYWTFRIMITLGMIGGLIGLVMLIAMRGGRNPK
FT                   PHGWLTLFMIALPLLPLFAISFGWIFTEMGRQPWIVAGVLPTTAAVSPNVSAGSVLFST
FT                   IAYTVVYGILAVVEVGLFWKALKEGLPELSTRDQPVTEGEDTPLSFAY"
FT   gene            complement(213336..214889)
FT                   /locus_tag="PPA0177"
FT   CDS_pept        complement(213336..214889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0177"
FT                   /product="putative aminoacid permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81934"
FT                   /db_xref="GOA:Q6ABD2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABD2"
FT                   /protein_id="AAT81934.1"
FT                   /translation="MAEVKNSQLTAHNDTDMAKDQTKVLQRTLNRFDIVFLIVSAVVGL
FT                   EMLGSVSAEGPETFTWLVFLIIVFLIPYSLIFAETGSAFVGEGGVYLWTRRAFGRPAAA
FT                   VTSVFTWITQPVWVGGSMAFLNAEAARNHLVHFSAGSAGDYLFKLAFIWLTVFAAILSL
FT                   AKAKWIPTAGAFFKISFLCLFLVTAAVYATQHGVQPLSLGSFSPTLRGFITLTPLLLFA
FT                   FLGFEGGSSASGEMRNAQHDVSVSVLRSATMAGIFYLLPVATILLVLPPSDIDGVSGLL
FT                   KAVNTVFSVYGPAAEPMMVLALVMFTLANIGQGAAWMIMSDRMQAMAAADGSFFGGFFG
FT                   KFHPRLGTPVHVNLLSGIVSTLFMLAAMELTGSSADLFNVVLGVAVTTYLFSYLLIIPA
FT                   AAKLRLSEPDVERPFRAGPNWFFILMCVVTTTFVAFGSWVSIFPGTLEALVGMPHDFSK
FT                   AQGVSYVSFEALTLGTLAFIIVMALIGYWRGAPLRRSGISTESLNQTSTEVHRRERTCD
FT                   "
FT   gene            complement(215000..217000)
FT                   /locus_tag="PPA0178"
FT   CDS_pept        complement(215000..217000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0178"
FT                   /product="putative ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81935"
FT                   /db_xref="GOA:Q6ABD1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABD1"
FT                   /protein_id="AAT81935.1"
FT                   /translation="MTGKDAQQAPTRNEQAEIARASSQQGHRGSQVTEKPISFGPSLKR
FT                   LLGQLKPHRITLTIVVIMATISVAFNVIGPKILGRATDVIFGGIVGKQIGKHIPAARGM
FT                   TAETFINTLGQASHGGDRGKIITLLQQYPHVVIGSGIDFHRLGVIIGWALGLYACAALL
FT                   MFLQGFLLNTAIQRSMYDLRRQVSAKLDKLPLSYFDGQPHGELMSRMTNDIDNVSQTLL
FT                   QTLQQLLNALLTIIGALIMMFWISPLLAVISLVVIPIAGVIAGLIGKRAQGQFAQMWKA
FT                   TGELNSRVEEAYSGHALVKTFGRSRAVAQEFHERNEELRQATAKAQFVSGLIQPVMFLL
FT                   GNANYAIIVLIGCLRVAKGQMPLGNVQAFIQYSRMFTQPITQIASMANLLQSGVASAER
FT                   VFQVLDADELSTDAHGSLPATKGRVVFDHVRFSYNPDKPLITDLSLVAEPGQTIAVVGP
FT                   TGAGKTTLVNLLMRFYEIDDGTITLDGVDISAVPRAELRSRLGMVLQDTWLFSGTIHDN
FT                   IAYGCPEASEEDILNAARAAHVDHFVHTLPDGYDTIIDDDGSNVSVGQKQLITIARAFL
FT                   AAPDLLILDEATSSVDTRTEMLVQEAMANLRKERTSFVIAHRLSTIRDADLILVMEHGD
FT                   IVEQGGHSELLEHQGHYYELYQAQFAAASHE"
FT   gene            complement(216997..218733)
FT                   /locus_tag="PPA0179"
FT   CDS_pept        complement(216997..218733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0179"
FT                   /product="ABC-type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81936"
FT                   /db_xref="GOA:Q6ABD0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABD0"
FT                   /protein_id="AAT81936.1"
FT                   /translation="MLAKLVTRHLRAYRLHVAVIIVMQVCAQIAALSLPTINADIINKG
FT                   VVTADTGYVTTHSLFMLAIALGQTICQVIAVYLAAQVAMGTGRDIRDAVFTRTLGFSAR
FT                   EINKFGAPSLITRTTNDVQQVQMLVFMTLAMLIGAPIMMMVGIIMAVRADVSLSWIIMV
FT                   AVILLAIGAGLIVSRMGPLFKRQQKRIDDLNRVVREQITGIRVVRAFARERHEAARFDA
FT                   TSSSLRDIQVNVGRTMAAMFPLVMLIMNLSQIAVFWFAATRIDDGQTEVGILASFTTYL
FT                   MLILISVMMAVMLIVMWPRASVCANRIEEVLHTSSSLTIDPEPVMALPDAPTLLEFRDV
FT                   TFSYPGASEPVLHDISFTLARGTTTAIIGSTGSGKSTLVNLIPRLVDVTHGQVLVNGTD
FT                   VRRYDPETLWSCIGLVPQRPYLFGGTVASNLRDGRCDATDEELWNALHVAQSDDFVSHM
FT                   DGKLEATITQGGTNVSGGQRQRLSIARALVKDPDIYIFDDAFSALDVATDSRLRAALEA
FT                   NHGDAAMLIVAQRVSTIRNADQILVLDAGHIVGRGTHDELIKSCPTYLEIVDSQLSVEE
FT                   AA"
FT   gene            219005..220114
FT                   /locus_tag="PPA0180"
FT   CDS_pept        219005..220114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0180"
FT                   /product="hypothetical protein"
FT                   /note="DUF955"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81937"
FT                   /db_xref="GOA:Q6ABC9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABC9"
FT                   /protein_id="AAT81937.1"
FT                   /translation="MSEDMREIGERIKSRMPEGMTQQSLAEAMEMTPDALSRMLNGKRG
FT                   ITMTELGKAAEVLGASAHWLVTGHKDPYAMRFAARHTYDFDTHRHINEGREKDREVLDH
FT                   IAEVYRAAHGSLRASSVVLPKTAKQMREALGDGFVNDFAARVKEVLDVDVMKRSGLSTD
FT                   YSLCIVGRRVVVLNKQFWARTTWSLAHELGHLVQGHLDRDGDIAGEADEKQANAFAAEL
FT                   LLPEKWMRNFNWPALTRADVARMVWEAKVSAAAMRVRIETLRLKASDEVREALELTTPK
FT                   LLTLARTSAAERYRDVFVPDWSPTVIAALLEETEKGNADPMLTSRVLGVPVDDIDFPEP
FT                   PSEEEMVERYERTMLDRRRRDDGAGESAL"
FT   gene            220111..220665
FT                   /locus_tag="PPA2393"
FT   CDS_pept        220111..220665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA2393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA2393"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81938"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABC8"
FT                   /protein_id="AAT81938.1"
FT                   /translation="MTIEDGIGWTWVSNQDKEALRGLQSFQCTTDRPKSPGGRALRHPK
FT                   PWELEVQSYFRDRGCGRAKKRGTRRLLLARRSGVIVAAADTEVSISKDGDGSYVNFFIC
FT                   AVAINVSERGKGGRLARELVQVLKDCAVQKAREGGLPRAKVYGRIDANNEPSVHLVDDM
FT                   GFELEQMESVHLQTWSTMLGV"
FT   gene            220963..222495
FT                   /locus_tag="PPA0181"
FT   CDS_pept        220963..222495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0181"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81939"
FT                   /db_xref="GOA:Q6ABC7"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABC7"
FT                   /protein_id="AAT81939.1"
FT                   /translation="MSSDTASSQSPDVSEQMQVRLDKRARIIADGGQAYPVDLLRDHTL
FT                   VQVRQKYTDDTGELTLAPGEETTDEVTVGGRVVFVRNTGKLCFASLQDGFTETSNGERL
FT                   QIMLSKAEVGDESLAAWKSDVDLGDHVWVRGRVVVSRRGELSIMAAEWRMASKALRPLP
FT                   TLHKELSEESRVRRRYADLVVREESRQMVRTRAVITRAVRRALDERGFLEIETPILQLV
FT                   HGGAAARPFNTHLNAFDIDMSLRIALELYLKRTMVGGTDRVYEMGRVFRNEGIDSSHSA
FT                   EFSMLEAYMSWGNQFTIAEVIKDIIMAVADALDVHQIETPKGTIDLDGQWRWVSVYPGL
FT                   SEKLGREVTLDTPLEELQSIAAEHEIEIDQSWEAGKVVMELFGELVEPGLINPTFVCDY
FT                   PAIAQPLARPHRDDPRMVEAWDLIIGGMERGTGFSELVDPVIQREVLTKQSLAAAAGDP
FT                   EAMQLDEDFLEALEFGCPPMGGLGLGVDRLVMLFTNAGIRETILFPLLKPEH"
FT   gene            complement(222534..222815)
FT                   /locus_tag="PPA0182"
FT   CDS_pept        complement(222534..222815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0182"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81940"
FT                   /db_xref="GOA:Q6ABC6"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABC6"
FT                   /protein_id="AAT81940.1"
FT                   /translation="MPESKVRPQAKKKAQAKDRATMDERRAEKKAAPVDRSWVPKVFVP
FT                   LFLLGVLWLIVYYIAGNQIPGISDLGDWNILIGMGLMAAGFGVATLWK"
FT   gene            222937..223767
FT                   /locus_tag="PPA0183"
FT   CDS_pept        222937..223767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0183"
FT                   /product="membrane spanning protein DUF881"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81941"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABC5"
FT                   /protein_id="AAT81941.1"
FT                   /translation="MSDGNDPDDVRPDDASVDIDEDRSQATTDPSIQDVRSDSRHPRLA
FT                   RSATVIVMALAGLMMTTAAINSRGHDLRPERDTDMATLVRSQASHNAALQKEAAGLRAQ
FT                   VEDFSKANQTPGVTSSVISSASALAPSVGLGAVSGKALRVTLDDAPLSENPDGVDANML
FT                   VVHQQDIQMVVNTLWSGGAEAMTIQGQRVISTTAVKCVGNTVVLHGVAYAPPYVIEAIG
FT                   DLNAMQKALDTSEAVRIYKEYVSAYQLGWSVERAGQVTMPAYTGAVAVSHATPR"
FT   gene            complement(223855..225753)
FT                   /locus_tag="PPA0184"
FT   CDS_pept        complement(223855..225753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0184"
FT                   /product="putative serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81942"
FT                   /db_xref="GOA:Q6ABC4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABC4"
FT                   /protein_id="AAT81942.1"
FT                   /translation="MSAESWLSGRYELQNLIGRGGMADVWKARDHRLGRDVAVKKLRTD
FT                   LASDDTFQARFQREAQSAARLNHPNIAAVYDTGETKDPATGLPVPFIVMELIDGHTLRD
FT                   VLRDGRKILPRRALEFTQGVLDALSYSHAAGIVHRDIKPANVMLTREGYVKVMDFGIAR
FT                   AVADTSATMTQTAAVIGTAQYLSPEQARGETVDNRADIYATGCLLYELLVGRPPFIGDS
FT                   PVSVAYQHVREIPAPPSSLDAEITHQMDAITLKALAKDPADRYQTAKQMRDDIDRLLSG
FT                   REPFAMQNYADSGADTEEQTHLIPAAATDPVPATAAQQDEASPASAESPQEPEEPHRKR
FT                   WPVIVVTIVVVVLLALLGFGLHKILNSSSQPSPAPTPSRTVKMVKVPAVTGLSQQGATS
FT                   TLENAGLKVQVDHVQKDQATANQVVSQSPAANEKVPAGSDVKITVNDGPKQLTIPRNIV
FT                   GLPKDDALKALKDAGFSDSQIKVTNDDPKTEPNSAKAGAVDAVSPEAGTTLAPDQQVTL
FT                   TIATGKSVVPNLKGMSVQEANSAAGSSGFSISVERQVTSSAAPGTVFGQDPDYGAIANR
FT                   STAIKVLVAVAPPAPEPTREPPTNSAPSEEPSSSSIAPVPPAPTTAVPTTSSSSGR"
FT   gene            complement(225800..227227)
FT                   /locus_tag="PPA0185"
FT   CDS_pept        complement(225800..227227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0185"
FT                   /product="putative penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81943"
FT                   /db_xref="GOA:Q6ABC3"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABC3"
FT                   /protein_id="AAT81943.1"
FT                   /translation="MNRQIRAVSLLAGLMFLALMVNLTGSAMFRQASLNNDPHNVRVRD
FT                   AEFSQNRGNILVGSRPIATTTSSNGKFAYQRVYLSGPKYAPITGYYSYYYGRSMLEQTQ
FT                   NAQLTGTSDAQWLSRITGTLSGHKPEGGSITTTINAKAQDAAWNGLKGKKGAVVALDYT
FT                   TGAVLAMASSPSYDPNELASHHLNDTTRAWKNLVADPSSPLSNRATREIYPPGSTFKLV
FT                   TAAAALQNGYHPNSMVDSPENWILPGTRTPLTNETNCGGSRITLTHALDISCNTAFGKV
FT                   GVSLGQDKIRDQAERFGFGKVVNSDVSSVASRFPQNLTDAQLAQSSIGQFDVAASPLQM
FT                   AMVTAGIANDGKLMTPYLTAQVRASNLQVVSEHHPKQMSQPMTKESAEQLKAMMVSVVN
FT                   NGTGKRARINGTTVGGKTGTAQTVQGKAPYAWFVGWSDNPHVAVAVFIQSLDTAINEIS
FT                   GGRLAAPIARDVIEAMR"
FT   gene            complement(227224..228615)
FT                   /locus_tag="PPA0186"
FT   CDS_pept        complement(227224..228615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0186"
FT                   /product="putative cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81944"
FT                   /db_xref="GOA:Q6ABC2"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABC2"
FT                   /protein_id="AAT81944.1"
FT                   /translation="MSIGQEFDDGTVVIQAKRRWTELFMLLIAWAIGFGGWVLTELNIN
FT                   HVLPDTWTTVGGVWLAVAIVAHIFVRIVIPYADPVILPIVFTLNGLGLAMIHRIDYIPD
FT                   PHYHRMDAQALWTALGIVLFVATLLILRDHRNLQRYPYVLFIVGLVFLMLPLVPGLGMA
FT                   TLGSRVWIHVGSYTFQPAEVSKVVLAIAFAGYLVDNRDVLSRAGHKILGITLPRARDLG
FT                   PIAVMWVATMLVIVYQNDLGTGMLFYGMFVVMLYITTERVGWAILGAVSFLGGAVLAYT
FT                   CFGHVRVRFDSWLHPFSNYTQNYQIIQAQFGLAWGGLAGRGWGLGRPGMVPLAWSDFIA
FT                   TSIGEELGVTGLMAVIVLFFILTARGMRTSLGCRDDFGKLMVAGLSFTLALQVFAIIGG
FT                   VTRLLPLTGLTTPFMSQGGSSLIANWVIVAIIMIVSHRNRKPADDFAATVPAPDPQQAI
FT                   TGGTR"
FT   gene            complement(228612..230099)
FT                   /locus_tag="PPA0187"
FT   CDS_pept        complement(228612..230099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0187"
FT                   /product="putative protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81945"
FT                   /db_xref="GOA:Q6ABC1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABC1"
FT                   /protein_id="AAT81945.1"
FT                   /translation="MAFSLDIRCHSEIGLVRRNNQDSGYVSPRMLVVADGMGGAAAGDL
FT                   ASTVAVRHVAKADRRFSGEGSPARPQGEEMLTVLSGAVADANDELADLVAWDSSLEGMG
FT                   TTFCGAMFSGTQLGIVHIGDSRGYLLRQGRMKRMTHDHSWVQSLIDDGRITPEEAAVHP
FT                   HRSLLLKVLNGQPQHIPDTQIVDLRLGDRILFCSDGLCGLVNDDTIGEHLNTTNLDDVV
FT                   DLLTTDAHAGGGTDNITIVVAEVVEADPNLDASEPHIIGAATTRKVPEHEVTAPLPLDQ
FT                   PASATNNDGKSTVLFDSEAEESMRYAPVDSMTRHRRHWLWPVVILAFVAVVVGGIFGAR
FT                   AYLNTQYYVGTDDDTVAIYQGSPDNLAWIQLSHVTEKTNIKTADLPRYYRDRVLGNIRV
FT                   SSMDSAHATVAELRTGAQQCKVIREAATAPPPTKPATPPSTPPQPSASGPTANAHHTPQ
FT                   PSAVPTPAMPTPTSAMPSPSAAGHEVDLPAVTSGDCQ"
FT   gene            complement(230103..230591)
FT                   /locus_tag="PPA0188"
FT   CDS_pept        complement(230103..230591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0188"
FT                   /product="conserved protein containing FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81946"
FT                   /db_xref="GOA:Q6ABC0"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABC0"
FT                   /protein_id="AAT81946.1"
FT                   /translation="MSEFLVTLLRIAYLAILWIFILFVTNVIRTDIYGHRVPRNAGEAA
FT                   VETGRRSKGRRTRRREPAPIPTGLQVISGSRAGTFVPLANGVTVGRGNDCTLPIDDDYA
FT                   STHHAEFSPGIDGAWFVEDLASTNGTHVNGERIENPTRLSVGDEVRIGRTTMTVTGRR"
FT   gene            complement(230594..231283)
FT                   /locus_tag="PPA0189"
FT   CDS_pept        complement(230594..231283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0189"
FT                   /product="conserved protein containing FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81947"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABB9"
FT                   /protein_id="AAT81947.1"
FT                   /translation="MGFLDKVEKSIEGAVSGVFARAFRGEVEPVEIAGRLQRELDSEAQ
FT                   ILSRDKSLVPNDFVVRLSSRDYERLVPYTKTLNAEIIPTLRDHASERHYVFNGPIHIRY
FT                   DLDDALPVGKFTVLTGENHAKAVSDRRAPLVLEVDGVRHPLTPPGLTIGRGSDADIRIN
FT                   DPGISRLHARINVWPQGNDIGLSIEDLDSTNGVTVNGVKVTSTELGDGSRIEIGSTRML
FT                   VHSPTRI"
FT   gene            complement(231455..232498)
FT                   /locus_tag="PPA0190"
FT   CDS_pept        complement(231455..232498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81948"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABB8"
FT                   /protein_id="AAT81948.1"
FT                   /translation="MHLNLGLAKTINRATHVTRGFRRIVMVTAAGEGRPGRLVADLTNE
FT                   FSRRGIDVSQLPIEGSEDTASSMPAPAHKVLAKWSRHRQGTARHELVESLDHQCALIVT
FT                   DPRRLDEIVGLQAQSDRPVVVLLATDPDDAPDKLAEIVDVVVTPNPQTEPWEHLGVPVH
FT                   SIGVPATGGGPAPGDRPNRIALLGPCTDEQLADALLAFDHACQVVPGWSLEICLDDESR
FT                   ARSAVAARRDVGIHPAGSENTVMNQSELALVMTRKEDLASRILDAAGAGLPAAAYADTP
FT                   AAADILSRCGYPAAGELSSALAQGMADAPLRRIQREYVAEVLADHAGAKIGEAWLDLMF
FT                   NVGRSHH"
FT   gene            complement(232572..233534)
FT                   /locus_tag="PPA0191"
FT   CDS_pept        complement(232572..233534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0191"
FT                   /product="hypothetical protein"
FT                   /note="phosphotransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81949"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABB7"
FT                   /protein_id="AAT81949.1"
FT                   /translation="MKPSRVRWDQLPDSVHHRVAEILGSPVSVDHVQTHGTTPGVASRV
FT                   VTADGSHAFVKIGHPAINEAIPSLNRREATLLSLLPDTAPAPRLLGRIDVDGWVGMVTS
FT                   DIEGPHPDLPWSDEDIDTTLASLSRLTEVTADFHQQWEPFSARLQNTPSVWEQFMADTP
FT                   TDLDPWLIERLPDLAGRVERLARHAYGDTVIHNAVRSDNVLLRTSGTVLVDWSHAVIGP
FT                   AWVDAAGLIVDIIHTDPIDAPRWNRADDLVKRVAAEFSPSTHGGPAVEPIVDFLVAILG
FT                   LSERECRNPDPAGMPQFREFQRERASRLRAWLWASEHLA"
FT   gene            complement(234127..234828)
FT                   /locus_tag="PPA0192"
FT   CDS_pept        complement(234127..234828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81950"
FT                   /db_xref="GOA:Q6ABB6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABB6"
FT                   /protein_id="AAT81950.1"
FT                   /translation="MFIDNSAGPREFGPNDDASLELPAEGAYRVQEALRVMGWDPHHPR
FT                   VFSQARGLVPVWLPLTAEITWGMLSIFLSNSDGIRDSIGGWFCFIFFLGTPVWILSDVT
FT                   LRRYGVDYDKIWTRFGPFFYHQIRFTDITRFDIGGHRYKIWAGKTKINIDYHRYDYALV
FT                   HLRLAEELHHRHIQLPQANITDPNWDEQAQIWRNILAADAYREHRDFYNTNPEQLAHLN
FT                   ALTPPPHHYDN"
FT   gene            complement(234838..235749)
FT                   /locus_tag="PPA0193"
FT   CDS_pept        complement(234838..235749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81951"
FT                   /db_xref="GOA:Q6ABB5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABB5"
FT                   /protein_id="AAT81951.1"
FT                   /translation="MHHITDPISHWWTAHKDRILSRDFLIGAGLVIGGIAVAATGVGGP
FT                   LLAAAISGGLISGGFSASSQKYATGDVNWGTVSKEALIGFVVGGVGAGTTNLVGTQVLK
FT                   HSDTAAAAITKFSVRDEVRFAQTGLKGILNANTAANNALKLAAKSGDLDALETMYIHHF
FT                   AGSAASNFAASNTQYIMDTAMSHDKHFSASGLAQANGNAIFGVVLSARGNAMARPNISF
FT                   NNGCFKRGPALLTDTMGVKQQFSTFGHELVRGAIADATTQEISTAMNGQDPHDFADGFS
FT                   KKTAHTLGNAAHTSFPGLHTSK"
FT   gene            complement(235924..236754)
FT                   /locus_tag="PPA0194"
FT   CDS_pept        complement(235924..236754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0194"
FT                   /product="putative RHS related protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81952"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABB4"
FT                   /protein_id="AAT81952.1"
FT                   /translation="MPGDSPTSPPPTITTTGDHDGGLVCGYVHDGRVTRVARDAQGRVT
FT                   GIEGPSGRWSYGYNEAGSLISATGPRTQHNWTHDAYGRLTSHATSGTDTTFAWDQEGHL
FT                   AQTCTRAHGHATATQYRYDAAGRRVSATSSDGQEERYSWDGRGWLSDITTDATTVSTHV
FT                   DALGRASRITTKGQQVRVDWDLVTGAPTSIDGRPVLPLPGGRILGATPIGDTNLWREVM
FT                   PTDPDNPYQPTTVAIEGVPETIRMAGNALVVDGHPWWERASTTQLPPPFCLLTR"
FT   gene            complement(236696..237961)
FT                   /locus_tag="PPA0195"
FT   CDS_pept        complement(236696..237961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0195"
FT                   /product="putative RHS-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81953"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABB3"
FT                   /protein_id="AAT81953.1"
FT                   /translation="MARLCGVKDPDGAHWRASYNIIGELTSLTDPPGVSLHATTTAHQA
FT                   QVTNAAGRVIAADQFDDYGRIVSRTDVFGATSSIDYNTAGLPAVLTDPLGAPTRFDYDQ
FT                   VGHLSAITSPTGLQERYSYDAAGRLASTTDPTGAVTRYLYDADSRLTGIIDPTGVATEY
FT                   SWDPVGRLVETRAGEVVTFTADYDVCGRPTRTWDPVTGTRNFRYNTAGRLITAVDAAGQ
FT                   VHRYTWDKRGRLVTTTNAAALTTYRYNQLDQIVESTDPAGGTHRYTWNPAGRLTSHTGP
FT                   DGITTSYDTRGGTETVTIDGQVSTRKWWDLEARQLHIDDHTDPAAPLHHTISVDARGLV
FT                   CDHTTTDGDGKVISRHRWDWDGEGRLTRADDTRATVSYTYRGDGLPTRITHSALGAASL
FT                   AWDSAGRLTDVTTPDHHDHWGS"
FT   gene            complement(237966..239921)
FT                   /locus_tag="PPA0196"
FT   CDS_pept        complement(237966..239921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0196"
FT                   /product="RHS-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81954"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABB2"
FT                   /protein_id="AAT81954.1"
FT                   /translation="MEQIGGLMPASALEALYEHFCASCQYGSLTVGGLFGQYQRWMGLN
FT                   DADVAWLEAVGRAFAAAGGSGSVILADVALEAGLRAAGVSVTRADIQVSSPTLSGIDPA
FT                   TGYIEDPVNSATGNFVLPETDVVFGGPSQGLAISRMYNSTLAAAYDEPEACGVLGPGWS
FT                   TILDQRLIVTDEQARWVRDDGREIVFPLTGRNGASGSPTAEGCHTVEGPWRAAQDNVWI
FT                   SRGDAADLAGVQGATVAGPVWIVADNTGSRLIFTAEGAWVGSTSGAGDGVWIERHDGVI
FT                   TSMHSEWGRSVDLFYAQGRLAKAVASDGRSVSYAYDSQGRLVEVTRPDGVHHYQWDGWL
FT                   LSQVIDASGVAQCVNTFDALGRIRTQRDATGHLTRFTYLPGGVTVADDGQGHHSNTWIS
FT                   DARGRTVGIIDADGQRTSMRYDRYGNLVGATDRAGKVIRHTYNERGHRTRTTLPTGGVI
FT                   EYGWDEADRLTTISTAGTLRARLDYDGTQLTPVRLADPHGTTVTMSWDRGLLRHLTDAT
FT                   GANISVDYDKYGQIMAITNGVGATWQISHDEAGQISQILTPLGYRTEMTHDQAGRLVER
FT                   IDPDGACWSYDYDEAGHLETATAPDGGRTRYTWGPDGQITTITDPTGATTTLAHDEVGD
FT                   LAGIGLPDGGQLGIPA"
FT   gene            240186..241112
FT                   /locus_tag="PPA0197"
FT   CDS_pept        240186..241112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81955"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABB1"
FT                   /protein_id="AAT81955.1"
FT                   /translation="MMRTWLPTTVRSWHECWPFRTRLYCLIVAGRNNDLRTLYSHWTGQ
FT                   IRKSRLGVLLVPDADYDGDLLDVRLPRHPAATVNKGTLKYSLTYRTIKQPLSGDVLEVV
FT                   TSARSCPDATWDGTAKVVPHSPALTSIDAKCGWTITLKTLPQEEPVTVTAKFPATEAAI
FT                   SNQANLQTWLQNQQQATDKALNNDAVTSTAYSLQRLQTMRIKIPPRVKEGSAIPVTILG
FT                   TWPGGENEMTPIYTTPFSSNPTSILTDITGGKLENVRLTDRCSGAVSITPDGHDVSALH
FT                   PASCSIGAEIGNYQVQESPITIVAGGS"
FT   gene            241522..242385
FT                   /locus_tag="PPA0198"
FT   CDS_pept        241522..242385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81956"
FT                   /db_xref="GOA:Q6ABB0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABB0"
FT                   /protein_id="AAT81956.1"
FT                   /translation="MVLLAPVVMGAAKFNYGMEIRDEDHVRSTFVYGVSRADLEEAGKK
FT                   PSDFSDCDKTFDVSASEKQHGVKAEFVEDKEYVGCKFTMTTTADDARGAGLGLTFDADK
FT                   VSLSIGRKFFEDARLDKIKVGAFKVSVTFPGKVISHSGSSSVDGNTVTWTDIKDSTSGL
FT                   KAVGERPTGAATAGPSFWKGFGRHGIRGGIIGLIAGIASYFGNKRRAKKKRAKSGGATA
FT                   TAQYPGYGQPQPQEWQAPGQNGHQYGESMNSGGNQPYMQDGRYIGDPWNANSTNTSGFN
FT                   EKPNPR"
FT   gene            complement(243319..243765)
FT                   /locus_tag="PPA2367"
FT   CDS_pept        complement(243319..243765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA2367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA2367"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81957"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABA9"
FT                   /protein_id="AAT81957.1"
FT                   /translation="MENEEIEAPYRIISLSEIGPLVLGKWSQIYVGSKCIGRPGDLSFK
FT                   PSKYDYIPDTQLKIQMVEPFLLSIQKPIYAIQSVKFVRIYSTETISYTRINHADDTSRI
FT                   TGSNYVDIFDYTNRTILNAWSWAFSHEPVEPKWWHHIVPKTWLR"
FT   gene            complement(243747..244361)
FT                   /locus_tag="PPA2368"
FT   CDS_pept        complement(243747..244361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA2368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA2368"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81958"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABA8"
FT                   /protein_id="AAT81958.1"
FT                   /translation="MGNYHWITSPGPHNAETYLEQVGGETLSGAAFGGITATIGGKTYD
FT                   TLPDSIPTGHFGPHNTALGVRKEPTTFLARYHRNGQLNLSQATSFRGATFKSKIAIKPI
FT                   TTYRSWSNPDYEVGSYVSRTRPAGPLQTQLDLALAPQWRNTAENVTKLEIPRFAPFYEG
FT                   AAGVQPAKAIEDSDTLGQLPGGGNQILITDEQVKNQWKTKK"
FT   gene            complement(244591..245037)
FT                   /locus_tag="PPA2394"
FT   CDS_pept        complement(244591..245037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA2394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA2394"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81959"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABA7"
FT                   /protein_id="AAT81959.1"
FT                   /translation="MEIQEVERPFREIDISQVGPIIINSLTQINLDTGCIGKPGDLFFS
FT                   PIKYDYIPNTRLTITMSEPFILDIKKPQYAIQAVWFVRVYAAGPISHYAMHEGQKRSEI
FT                   TGIHYVDIGDYTKRSLFNGWSWAFSHEPIEPSWWHHLIPDKWLY"
FT   gene            complement(245019..247880)
FT                   /locus_tag="PPA0199"
FT   CDS_pept        complement(245019..247880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0199"
FT                   /product="RHS-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81960"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABA6"
FT                   /protein_id="AAT81960.1"
FT                   /translation="MERDLAGRIVALVSPTGLRTSYSYDACGRMVDVTDPAGRVTRYSY
FT                   TSDFQVATVTYPTGETARYEYDAMGRVVLSHVPGAGVSQYRYDPCGRLVFSCDLVYGQR
FT                   HFSYDLAGQLVAATNPAGGVSRYGYDRCGRLVTRTDPGGGLTTYQYNECGQMIAATDPL
FT                   GRVTEYTWDKSGTLAAITRPDGTVVSRRLGPKGVEEYIDDQLVSRILITPTTRTVTIDD
FT                   YTDPAFPWRHLLGYDPRGLLLTHSVAPVPGDESIVDEGPLTSSEQWWYDAEGRRVRHLT
FT                   LTGDSIDYAYTNTGVLGSIRHSRLGEVSLEWDAVGRLAKLGSPLDQQQWGYTDGFVTSH
FT                   TSSRGSTTISRDEMGRVLRVSAPYGDFRYGYDDSGSLTSADGLDGSSRRWVYDTAGRLV
FT                   TTTCQDAGTSQTCHYDYDLAGELVSTVTQLGPGDSTVETHYRYDPCGRRIEAASSAGMR
FT                   EEFRWDSRGWLAGVMTFRAGRSHEFATHVDAFGCLTDVSGPAGRTPIAWDLATGEPQLV
FT                   QVGGIPALPLPDGSVLTPVSADSDQDEPWRRPATDPLDPYTLIQEHLTAGISMTGGHLG
FT                   VAGLAWMGARVYDSTTASFLTIDPLAAPPGSLWEAASYGYAATNPLALADPLGLRPVTD
FT                   AQMRQFASTIDTRNLWDRHIRNVFSWETLGGVALATAGGLLMCFGAEVPGAMLIGAGGD
FT                   MVFQQVVRGHVDYGEVALSGALAPTGGSGLSEIAGLGTRTLLTRGIEAGTTQGYVMGNY
FT                   HWVTSPGPHNAETYLEQVGGETLSGAAFGGITATIGGKTYDALPDSIPTGHFGPHNTIL
FT                   RVGKQPETFIRKYQRNGKLDFGQATSFRGATFKSKIAIKPITTYRSWSDPDYEVGGYVS
FT                   RTRPAGPLQTQLDLALAPQWGNKANHISEYEIPQFAPFYEGAAGVQPVKAIEDSDTLGQ
FT                   LPGGGNQILITDKQVLDRWKSKK"
FT   gene            complement(247886..250678)
FT                   /locus_tag="PPA0200"
FT   CDS_pept        complement(247886..250678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0200"
FT                   /product="RHS-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81961"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABA5"
FT                   /protein_id="AAT81961.1"
FT                   /translation="MVDFSVFGDYQNPVEFNFSTAEGFSSQLRWTSQRINIFDARTSLV
FT                   ESIASRGFRGFFATVFTQNIHICSADATALSEALTTAADMVDYLAEQARLENKRRQQVR
FT                   DFAAQHDDFGDHVRDFFTGVDVPPNLTPAEPPSPQLLHPPVTGDRQQDRSIRGSSGGIS
FT                   AADPKDLISAAQVLGETAAQVPSGSVLAGWFDDFTSQCKYGTVEVGDLFVQLDRWRGLN
FT                   DGDVEWLHAVAKAFQAAGSGVITLPNSALRAALRAAGTPLWRTDLDITSPGLSGIDPRT
FT                   GYVEDPINSATGNFIEPETDLAFAAASSPLALSRMYNSIQAVRGQGGVFGPGWVSILDQ
FT                   CLLVKPGCVEWVREDGRHIAFAVEAAPTAVLPTTNQLPNPAEEDEKPVEQWRAQGENLW
FT                   LSRVSASQLPEFLRDPATSKWVWVISDNRGGRWVFTEGGAWVCSGSSQRDVVHTVREGD
FT                   RVTAMETSWGHKITVSYGGARVVSAISSDGRCVRYSYDDENRLVQVDGPDGSRRYEWDD
FT                   TLITTVVDACGNAECINSYDGRGRITSQQAANGRTVHFRYLPGGVTAASDADGTNANTW
FT                   ICDPHGRTTGVVDAHGGQVSMTYDSFGNMVRCVDRAGNVTSHRYDQRGRLTHTDLPTGG
FT                   TIDCSWDDLDRLVSTTLANGAQTTFEYDGTERDPVRVTDPCGGVTVAEWKDGLLLRATN
FT                   PVGVSLRFSYDHHAELVRVEDAHGEASRLIRDEAGRIVETISPGGATTRFSYDDAGRLA
FT                   AVVTPDGATWEHRYDVAGHLIELVAPDSGVTKWEYHPDGQISRVIDPLGRVIEHSYDHL
FT                   GNLAGMQLPDGSAWSFIHDALSRLTQVVAPDEARWTYAYDVDGNLSGVTDPAGFARPGS
FT                   LLTVSLPAPPRIVTGTNSTASMPIPTVLLLPSPMSLAPSRSSRVICVADRLSFRTSLAR
FT                   "
FT   gene            complement(250798..251520)
FT                   /locus_tag="PPA0201"
FT   CDS_pept        complement(250798..251520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81962"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABA4"
FT                   /protein_id="AAT81962.1"
FT                   /translation="MTKKLTKTCLLGVVGIMAISLAACGDKTNSSSDTPANPSPSTKAV
FT                   KRISKDDFTKAFSHKKIDGHTFVIQDNSQLRPVVDNLDKTLSQAKISPAGCDAALRQSS
FT                   LGLTSHEISDTLVAVSDKPSTRIIVTTAMSDRQKKAYKSQEEQTSKCGHTTLSTQGVNH
FT                   GLEINIKASPIKGYENISKQAALFDVSIKRSTGTSDHGYQAYIWLNNDQAIRIFGRDAG
FT                   IVKSTLQSATKALGIAKK"
FT   gene            complement(251723..251810)
FT                   /locus_tag="PPA2410"
FT   tRNA            complement(251723..251810)
FT                   /locus_tag="PPA2410"
FT                   /product="tRNA-Ser"
FT   gene            complement(251890..252255)
FT                   /locus_tag="PPA0202"
FT   CDS_pept        complement(251890..252255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0202"
FT                   /product="putative heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81963"
FT                   /db_xref="GOA:Q6ABA3"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABA3"
FT                   /protein_id="AAT81963.1"
FT                   /translation="MTRIDVWLWSVRVYKSRSLATAAVKGGHIRLNGDPVKPSHDVKPG
FT                   DTVTIHTPGWDRVLKVVNPITKRVGAKLAVEAYEDLSAPRPAYLSAPLARRDRGTGRPT
FT                   KKDRREIDRLRGRDSRY"
FT   gene            252517..252894
FT                   /locus_tag="PPA0203"
FT   CDS_pept        252517..252894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81964"
FT                   /db_xref="GOA:Q6ABA2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABA2"
FT                   /protein_id="AAT81964.1"
FT                   /translation="MPGRRVAMDDQRRIITTDRAGSIWAGITWCSLLLFIVAGIIGMMA
FT                   QTMLPANLGYPQLHDSGVPTWLTWTVVGLDVVAFFIPPLVTTSCGRKAKRLGHPVRSAV
FT                   QISWATFTVVTVISFLLVFFG"
FT   gene            252962..255835
FT                   /locus_tag="PPA0204"
FT   CDS_pept        252962..255835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0204"
FT                   /product="DNA polymerase III subunit gamma"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81965"
FT                   /db_xref="GOA:Q6ABA1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABA1"
FT                   /protein_id="AAT81965.1"
FT                   /translation="MDERAPEPGMENEAVEPEVFEQDGPDLFGDEESPRPVMPPDEATP
FT                   DDDLPSDPCDPGLLDGPETPEEPDGLETDEDEEDGADVIERVQELIGEAPDSNPDDDLP
FT                   ELPLALYRRYRPETFDEVIGEDHVIEPLKRAILNNRVNHAYLFSGPRGCGKTTTARILA
FT                   RALNCEQGPTPTPCGTCQSCRDLACGGPGSIDVIEIDAASHGGVDDARDLRERAFFAPV
FT                   HSRYKIYIIDEAHMVTPQGFNALLKLVEEPPPHVKFIFATTEPEKVIGTIRSRTHHYPF
FT                   RLVPPKVLVEYLAELCGKEGIDVDHAVLPLVVRAGGGSVRDSLSVLDQLLGGAADGHVS
FT                   YEQAAALLGYTPEALLDEIVDAFAAGDAHQVFATIDKVIEVGQDPRRFAEDLLRRMRDL
FT                   VIVSAVPDACRSGLIDVSPEQATRLAHQVSGFGAGELTRAAEVLATGLTNMRGTTAPRL
FT                   HLELMCSRILLPGADTDGRGIHARLERLERRIGVSGPVEEVERAERPVTAQPPTRYADT
FT                   PQQASPPQHWPAENLQNPERRSAPEHHDAPSPGQRPSGRPRPSRKDYRPGNQLAEQPPS
FT                   NQHGDDGQMSQGPRQQGGPSTSQRQQPRPQDHQPSQRDRQDTPPAQPQQPSAEQGGRAD
FT                   DAINITTLRREWPQVLEAVKDGGRVAWMVLNQYAQVLEVHGNQATLGFSNIGARENFAA
FT                   GNYPKVLHDAVVKVLGVDLAFTAVVGEPPAAVRPESHPAEFQSGPAAQEPPDDDPWEQG
FT                   PHHQDSTRGGEPSDPTHPGRDPQGRPGDRQAISDDASKDAPPPPVTSSHPSEAGDDDPA
FT                   PDATTEDQSADVRDEVVESGPVAGAPDPDSGGAAEPKPDLVPGQDHVEAAGRAESARQI
FT                   DPGGASSQGRPSAAAVSTAHRWSERAKGSVRPLEVTSRSAQVEEPPDDGGEWDDTVVEE
FT                   SNESPIDLIMRELGGVVIDTDGDSTAR"
FT   gene            255945..256268
FT                   /locus_tag="PPA0205"
FT   CDS_pept        255945..256268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0205"
FT                   /product="hypothetical protein"
FT                   /note="DUF149/YbaB family"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81966"
FT                   /db_xref="GOA:Q6ABA0"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6ABA0"
FT                   /protein_id="AAT81966.1"
FT                   /translation="MTTGGFDLGGLDIGALLAQAQSVQNQLEAAQNQLAESNFEGTAGG
FT                   GLVRATVTGTGELDALTIAPEALEDTDAETLADLVVAAVKDATGQARAMQQSLMPQMPS
FT                   LGL"
FT   gene            256299..256904
FT                   /locus_tag="PPA0206"
FT   CDS_pept        256299..256904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0206"
FT                   /product="putative recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81967"
FT                   /db_xref="GOA:Q6AB99"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AB99"
FT                   /protein_id="AAT81967.1"
FT                   /translation="MYDGPLQELIDALSRLPGIGPKGAQRIAFHILDAPAEEANELADA
FT                   LREVKEKAKFCKICFNVSSDEVCQYCRDPRRDQSMICVVEESKDVIAVERTRQFRGLYH
FT                   VLGGAISPLDGKGPADLHIRELCQRLADETVTEVILATNPNLEGEATATYLSRLIAPMG
FT                   VTVSRLASGLPVGGDLEYADEVTLGRAFEGRLHVGVGA"
FT   gene            257012..257587
FT                   /locus_tag="PPA0207"
FT   CDS_pept        257012..257587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0207"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81968"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR018309"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB98"
FT                   /protein_id="AAT81968.1"
FT                   /translation="MSIKFAILALLAEKPRHGYEIKNEFDRRTNHTWPLNIGQVYTTLD
FT                   RLERDGLCYRGEETPDGRVIATISPKGREEVRRWFTTPIAPANPPRNELAIKIALAATS
FT                   KDVDVATLIQDQRHATMHQLQECRQARRSVAEDDLAGQLLVDGMIFAAEAEIRWLDHCE
FT                   SKAVQASHARPHQPAEPVTDGSKAVQEA"
FT   gene            257593..258375
FT                   /locus_tag="PPA0208"
FT   CDS_pept        257593..258375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0208"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81969"
FT                   /db_xref="GOA:Q6AB97"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB97"
FT                   /protein_id="AAT81969.1"
FT                   /translation="MTSTPLHAADQITPTMQRTVLSLDHVSRSFGEGEQRVDAIVDVSL
FT                   GVNPGTFAAVMGPSGSGKSTLLGLAGGLDQPTSGTVSVCGEPLGGMSRDDLARVRRRQL
FT                   GFVFQDYSLVPTLTAVENVSVPLELDGVSATRARKAAEIALERVGVPELVDRHIEKMSG
FT                   GQRQRVAIARGIVGDRRVLLADEPTGALDSVTGDEIMALIRTLADEGVAVVLVTHEARH
FT                   AAWADRVIFLRDGRLVDESQVVSDPMELLNDNPKRGRW"
FT   gene            258375..261014
FT                   /locus_tag="PPA0209"
FT   CDS_pept        258375..261014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0209"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81970"
FT                   /db_xref="GOA:Q6AB96"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB96"
FT                   /protein_id="AAT81970.1"
FT                   /translation="MSARTTPEMPTSAVRLSGDAIARGRPHRRLINRLAVRDIGRHKLR
FT                   SLLIVMLIALPVAIMSGLGVLLRSDGSVSGSQALNNYGDADMVISPISNWDGHCSQQGP
FT                   TNTYCDDGAEPDAHQRAQQQTALANLRLPGHKLHPLRTTEASVSWRLATLSATVKAMDL
FT                   TTMRPYRMEFPRGPMPTGNNIWVTTGAAKDYGWSVGSRVTVNGHRYTITGVVREEWPGN
FT                   GPTFWVAPRSPLARGGELTYYVNGASLTRQQVEKLNASGVGVADRRAEESASQGDTFER
FT                   DMFALILAAGVLSAIVVATIAAAAFAIGARQQRRMLALLGITGAARRDLMGVMIHQGLL
FT                   LGLTGALLGVGLGVGMGNGAVAIIRMVYPDYITYGVDWGYAAVGSVVGLLAALTACWFP
FT                   ARDVARQDALMGVKHAESAARPARRPTLAIVIAAIGLLAGVGGVIYGRRGTTGDVMVRL
FT                   NIGIIVTIVVLYLAAVSAMPWLVDKVSGRKSSRLPIRFALRDLNRNRGRAVPGVAASMA
FT                   ITVLACAAVTFCDSLAIQDKAEYVPEFGDHIGVLAGEHDDEVRTSDDRVAGEIKRVTAV
FT                   FGPHVKYLRPEEPVTCGQDGKYCTSSLEVTPKVPNGAMSSTVAIDDGTLYELLTGEKAD
FT                   GRVMKALDDGVVLFSPDATRVSQAIISDHDERHSTGTTVLPAIHAPHHALGYGVPNLIS
FT                   RRTAAKVLGVSPDNVKTQSTTVWLRLPHIPTAKEGDRLQHSLMDVTGSSSEFIWEEGYS
FT                   DVFGTVMRWSAVVGTLLAVCVGAVVLVLTLSDSRGSRTAIASVGASKATLRRMVAAQAL
FT                   VTTGLGQVLGFLVGFVPVAVMTCVGPRWPMPMPLPWLALIVFAPPVLLALVTMVAVPVP
FT                   RPRMQRLD"
FT   gene            complement(261018..262853)
FT                   /locus_tag="PPA0210"
FT   CDS_pept        complement(261018..262853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0210"
FT                   /product="conserved membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81971"
FT                   /db_xref="GOA:Q6AB95"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB95"
FT                   /protein_id="AAT81971.1"
FT                   /translation="MAEKRSGARSGSASRNHLRSWHGDDPIPRTADGIDARIFRPGQAS
FT                   AQPATPPQSSATPSKPPVDEDNPTKIAPVGSLSRSWPLTRSRTTSPHNGQAKLRHSRPP
FT                   RAHRTRRVPLEKLFRARTPVEPTLALNLGDAEMAIMQARRVVDLVTRVAVMAISVGGSA
FT                   SEAVAIALRITATYGVTVHIDITNTSVIVTQHRGLDEDPITALRVVRSRSNDYQRLGEL
FT                   QLLVDDICDKTVSLEEAADRLAAITRSPRLYRQWFVTMNIGLMGAGLSTLFGGTVMDGV
FT                   LSFFSTCIVDATVQAMARKRITNFFAQAAGGAIATAFALIVMVYMAASNHPLPLSPSLI
FT                   VAAGIVSLLAGGSFVAASQDALDGYVVTSSGRFLEGFVQTGGVILGVITAMWIGLRLGV
FT                   PGYISPALGFSTNPVLQMVAAAVIAVTFGVSSHAGYRTLAICAALGAAAWAGYLLGMQL
FT                   TGSVSAASGLAAMVAGFIAGLGAKRWKVPQLGLVTIAIVPLMPGVMMYRALYMIVNAQN
FT                   ETGGTSSAGWTLFLEALLVGVALAVGGSFGALLARPFTLPKDLRSRLATLASWGAGQAV
FT                   PRERRRRRSQPPADPHHPALNNTETDPTVTGTWAR"
FT   gene            262964..263764
FT                   /locus_tag="PPA0211"
FT   CDS_pept        262964..263764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0211"
FT                   /product="conserved protein, putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81972"
FT                   /db_xref="GOA:Q6AB94"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB94"
FT                   /protein_id="AAT81972.1"
FT                   /translation="MLIATDLDGTFLTPDATVSPRNWAAVKAAEAAGIHVIPVTGRAIG
FT                   GLRVIGPVFHRYALVSNGAVGTDMSTGETLFTETMSARTVKSYVDQLTAECPGVVFCAE
FT                   VGDSSVFLVEEGYDEIVPAFESENDPAEHVLVSRKELCSSEAVKLMIVHPTVPASDIYQ
FT                   LSRRLRVPGVHATWAGFTVAEAGPADVTKASGLERICQLLGEDRANVVALGDGANDVEM
FT                   LQWAGVSYAMSGAKPEAIAAADRRAPSCEEDGFAVVVEELLASR"
FT   gene            263774..264583
FT                   /locus_tag="PPA0212"
FT   CDS_pept        263774..264583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0212"
FT                   /product="conserved protein, putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81973"
FT                   /db_xref="GOA:Q6AB93"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB93"
FT                   /protein_id="AAT81973.1"
FT                   /translation="MLIATDLDGTLLTPDGTISPRTRDAIRVAEKAGVPVVPVTARQIY
FT                   GIEKWRDDLGRWALCSNGAICWDLQARTVLFRQLMPGAVANEFAHRLLDAAPGTRFLTI
FT                   KDDGLTFASQRGYAELTTFADHSREPSDMPALDLDEVLDGDCLKMVARHPNLSVEELAA
FT                   RAASVGMADEVHVTTSGKPMLEISAKGVAKDSGLSMLCDHLGIDRADTVAFGDGANDVE
FT                   MLAWVGDSYAMAHAVPLAVAAARHRAPSNAEDGVAQVIEKLLSMRER"
FT   gene            264701..265600
FT                   /locus_tag="PPA0213"
FT   CDS_pept        264701..265600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0213"
FT                   /product="putative ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81974"
FT                   /db_xref="GOA:Q6AB92"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB92"
FT                   /protein_id="AAT81974.1"
FT                   /translation="MLSRRRPSERRALGYEDKQREESNGCRRDPSGHLSRRNWVRQVRA
FT                   FMWLEFSPDPMVTQTLQLEGVHFSYPRCKSRLFTELNLILGDTGPTVLLGLNGAGKTTL
FT                   LRLCAGEFQPSAGLIAVDGGKDPRSVVSLMPQQIRPIPGFRVVEQVAYSAWLGGCSSSQ
FT                   SEKRAIMALEAVQLEDRLKDKPNQLSGGQLRRVGLAQALVGEQPIVLLDEPTAGLDPAQ
FT                   KHVFRNLLTELGATRSFVVSTHDTSDVDSMYNRVVILHEGHIAYDGSTDEFLMHGAGSS
FT                   HAAEAAFLDVVGVSEQAR"
FT   gene            265597..266802
FT                   /locus_tag="PPA0214"
FT   CDS_pept        265597..266802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81975"
FT                   /db_xref="GOA:Q6AB91"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB91"
FT                   /protein_id="AAT81975.1"
FT                   /translation="MTWHLLLRRSYGVRLVPVMLLMWWYGAFGNPPARSAIERASSILY
FT                   AFMMVAGPVALSTCLELRRFTEGQILKRLSKRSRLRIVAPWWEIAVLPSTIAVGVFVLL
FT                   SGSGDQIVKMSLIGVVWMLAWGVFGAVIGMSWPLALSAPTALLIPFILVLYGPAVSVLE
FT                   MRYLVGYYMDCCNAGEMLDPQVLAAGMTMACGVLVVSMVAFIASRGRHHSSVIVTVILI
FT                   IGLVSTVLIGFREVEGVGAFPAVPRTGTQTCLKDPTVCTWDAHDLQLLGPIVQKADAAW
FT                   RANGVHVPRAYRQGIGQSTQTIVWWSASAEDVSESALPALSAVAEGLAVAPCQVRQDEV
FT                   ETWVEDVQERVVAWLVEHSGIEVRDTALSPETREWLKSIDRLPIEKQVSIIEHDRARLR
FT                   TC"
FT   gene            266814..267404
FT                   /locus_tag="PPA0215"
FT   CDS_pept        266814..267404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81976"
FT                   /db_xref="GOA:Q6AB90"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB90"
FT                   /protein_id="AAT81976.1"
FT                   /translation="MLGWRAWARNRSLLSLLAATVVCCVLIGLTSEVIIAIPPFLTGRG
FT                   VDVSNAAVVPLCVVIVQGWCLSRRDTRLEAGSERRTALADCLLSTTPAVLVGIVAYVGN
FT                   LPVGMVATRNTVGLSGVTLLANALGVTRLSSLPATIWVLMSLLAGSTASFEAPWSWPVK
FT                   DRTDVLSAVLSVALCLLGISASLVKPRPWRNRG"
FT   gene            268050..271394
FT                   /locus_tag="PPA0216"
FT   CDS_pept        268050..271394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0216"
FT                   /product="putative isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81977"
FT                   /db_xref="GOA:Q6AB89"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AB89"
FT                   /protein_id="AAT81977.1"
FT                   /translation="MTDVNPVRSDNCRQYNNVPPQIDLPAMDHEIIDLWARQHTFDKSL
FT                   EATKDGQPWTFFEGPPTANGQPGTHHVEARVFKDIFPRFKTMQGFRVDRKAGWDCHGLP
FT                   VELAVEKELGFSGKPDIEKYGVEPFNAKCRESVTRHVDAFSELTERMGYWVNMDEAYWT
FT                   MSPSYVESVWWGLKRIWDKGLLGEDHRVAPYCPRCGTTLSDHELAQGYQDDRDPSIYVR
FT                   FPVTSGPLAGRAKLLVWTTTPWTLVSNTAVAVHPEVRYVVAHRDPVPEGSDAVATASAE
FT                   DPASQDLIIAEPLFEKVLGEGWSLTGESFLGSQMELWTYERPYNFLEWPKTERVTVDGR
FT                   PTPADANFVVLADYVTVEDGTGLVHQAPAFGADDLQTCRRYGLPLVNPIRPDGTFEESV
FT                   PLVGGQFFKTADKPLCEDLDRRGVLFRLEMHWHSYPHCWRCDTHLIYYAQPSWYIRTTK
FT                   VKEQLLAQNEVTTWYPETIKHGRFGDWLENNIDWAVSRSRYWGTPLPLWRNDDDRSDVI
FT                   CVESLAELSQYVGRDLTGMDPHRPFIDEVTFTRDGHTYHRVPEVADAWLDSGSMPFAQW
FT                   GYPHVPGSKEKFESHYPGDFICEAIDQTRGWFYTMMAVGTLVFDESSYRNVLCLGHILA
FT                   EDGRKMSKHLGNILLPIPLMDSHGADALRWFMAADGSPWSARRVGDETIQETVRKVLLT
FT                   YWNTVSFQVLYARANGWSPAQGTQHDADPARGFGGVVPPAVGSRGFGGVVPPAVTERHV
FT                   LDRWLVSATNVLVRDVTEALNNFDTQRVGNLIAQFVDELSNWYVRRSRRRFWDGDEGAL
FT                   WTLHETLETLTKLMAPMVPFITERVWQDLFVTTNPHGPESVHLASWPVADDSLIDESLS
FT                   ESMDLARRIVELGRGARAEAKAKIRQPLSRALISGAALAKLDEDLQAEIRSELNVMALD
FT                   SFTAAGDLVDHCAKGNFRALGKKYAKATPKVAAAIAAADPEWLASELAIKGSVEMDVPE
FT                   VEGGKAVVTADDVIVSERPREGWSVVNEQGETVALDLEITPELARAGQAREVIRFVQDS
FT                   RKKAGLDVSDRITLAWSASADLATAIEEHAEQISQEVLAVQMSREPRADDWAVEPDLGL
FT                   AVKVVKV"
FT   gene            complement(271509..272459)
FT                   /locus_tag="PPA0217"
FT   CDS_pept        complement(271509..272459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0217"
FT                   /product="conserved membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81978"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR021144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AB88"
FT                   /protein_id="AAT81978.1"
FT                   /translation="MADVDDDLYAETVLHLDGHHARACIAGDHTNVFLVSRDDEVLESK
FT                   ERPAAGHVPPTAALLQGLSLAKIYDFATTVDIERIEFITEAERLNSALVDAGRDGSYGI
FT                   GEGAAILGSIDRGMASDDLCTRMTAYTAAASDARMGGAPLPAMTNSGSGNQGIVATVPV
FT                   TVAADYAGVDHERRVRALALSHAVALYAHAGLPVLSAFCAATTAAMGAAAGICLVLDGS
FT                   YSAVERAVASMTGDVVGMVCDGAGCSCALKVSASANAAGRAALLSLAGRRVPGTNGLVH
FT                   DDVDAAIRGIGRLGTEGMKQTDPEILSLMMAKQTV"
FT   gene            complement(272440..272847)
FT                   /locus_tag="PPA2396"
FT   CDS_pept        complement(272440..272847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA2396"
FT                   /product="conserved protein"
FT                   /note="DUF1063"
FT                   /db_xref="EnsemblGenomes-Gn:PPA2396"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81979"
FT                   /db_xref="InterPro:IPR021144"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB87"
FT                   /protein_id="AAT81979.1"
FT                   /translation="MQKTRCQTPLSPSEINNLIEALHQGVTPATGCTEPIALAYAAARA
FT                   KRALGSDAKQLDSLHIDARVSPNIMKNGMAVMVPRHRTARPRDRRSGGSPRRQPRCGAS
FT                   GPGRRQRRRGREGASPSRFRSRRTHCGRCGR"
FT   gene            complement(272911..274326)
FT                   /locus_tag="PPA0218"
FT   CDS_pept        complement(272911..274326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0218"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81980"
FT                   /db_xref="GOA:Q6AB86"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB86"
FT                   /protein_id="AAT81980.1"
FT                   /translation="MPLPLRPCWIIMDTSTTTCSMQGKEYANIIKIRISTKLIPMNTLV
FT                   TVDRPASMTEQEWRKAIKFDSTDWGWIIMSIGMAIGAGIVFLPVKVGLVGLWVFLVSSV
FT                   IAYPAMYLFQRLFINTLAESPECKDYPSVISGYLGKNWGFFIGILYFIMLVIWVFIYST
FT                   ALTNDSASFLHSFGVTKTVWSHNPFYGLVVICIMVAIASRAEKILFRISTVMVLTKLSV
FT                   VTFLGLAIIGSWNLANVGAFPSLGYLVKQTIIMLPFTLTSILFIQSLSPMVISYRAHYR
FT                   SIEVARHKALRSMNIAFSVLFITVFFYAISFNLTMGHDVAVKAYNQNISTLAMVAQGMG
FT                   GTTVKIFSLILNIFAVMTAYFGVFLGFREACQGIAMNVLRRLIPEERINKKIVSWSILV
FT                   FAILVSWGAILLNAPVLSFTSICSPIFGMIGCLIPAYLVFKVPSLHKFRRPSLILIIAT
FT                   GILLVVSPFLAFS"
FT   gene            complement(274536..275456)
FT                   /locus_tag="PPA0219"
FT   CDS_pept        complement(274536..275456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0219"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81981"
FT                   /db_xref="GOA:Q6AB85"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB85"
FT                   /protein_id="AAT81981.1"
FT                   /translation="MDTTTTIGWGIAGTGRIARTILKDFAHVPGARICAIASRSAARAD
FT                   AFADLVTQNLSCPRPDTHDSYVDMITNPTVDVVYVATPHPQHRPIALAAIDAGKAVLVE
FT                   KSFAATAHAAAEIAEAARAKRVFAMEGMWTRFLPVVTEMIDAVNNGAIGEPTGIQGDLF
FT                   ALRDYDPDDRLFSPALGGGVTLDLGVYALDFAIRLFGEPTEVIARGNHFPNGVDSDASM
FT                   LLTFPKNKFATLAISFTSDGPGRMTIQGTDGWIEVEPRFHHPSRILIHRRGVIPEIHNT
FT                   PALGRGYAHELMEVCQCLRADAPRA"
FT   gene            275563..275862
FT                   /locus_tag="PPA0220"
FT   CDS_pept        275563..275862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0220"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81982"
FT                   /db_xref="GOA:Q6AB84"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB84"
FT                   /protein_id="AAT81982.1"
FT                   /translation="MESNEADDWTLQANCRGMADALFPDGKEQRRARRICTDCRVRPEC
FT                   LAEALDNRLEWGVWGGMTERERRRLLRERPDVTSWRDVLLADRGTLTKTARVKS"
FT   gene            276029..276484
FT                   /locus_tag="PPA0221"
FT   CDS_pept        276029..276484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0221"
FT                   /product="putative translation initiation inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81983"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB83"
FT                   /protein_id="AAT81983.1"
FT                   /translation="MSATTRCAELGITLPPVAAPVADYVPAIQTGSQILTSGQLPFVDG
FT                   ELTAVGKVGDAVSAEQAAEAARAAALNAIAAAAEVAGGLDAIKRIVRVVVFVNSAPDFT
FT                   GQAGVANGASQLLGQVFGEHGRHARSAVGVATLPLGSAVEVELTVEV"
FT   gene            complement(276567..277268)
FT                   /locus_tag="PPA0222"
FT   CDS_pept        complement(276567..277268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0222"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81984"
FT                   /db_xref="GOA:Q6AB82"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB82"
FT                   /protein_id="AAT81984.1"
FT                   /translation="MANVVATAATQPFFATLGAASAARIMAMCEASVCPRNTVIFEAGD
FT                   SADNLYLVVEGKVKLTRSTTADDLTPRDSLLWLMGPSDMFGELSLVDGGTRSTTATTVT
FT                   RCSLLKTPGAQMRELVKGRHDVALAMLGRLSERLRRADDNTAHFVSGDVPSRLAYTLLD
FT                   LARRFGTANPSTGHIVVRHDLTQHELAQAVGSSRETVNKALTDFAARGWIAARPKVVTI
FT                   MEPEKLASRAN"
FT   gene            277186..278112
FT                   /locus_tag="PPA0223"
FT   CDS_pept        277186..278112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0223"
FT                   /product="putative endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81985"
FT                   /db_xref="GOA:Q6AB81"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB81"
FT                   /protein_id="AAT81985.1"
FT                   /translation="MAMIRAAEAAPRVAKNGWVAAVATTFAIRTSPLMSTCIVRPFVAG
FT                   RVPTLWQLSHSVLTPGLDSPPMLSSMAASPSASRPQREDCRACANEVRALLAKAYPDAH
FT                   CELNYAGPYQLLVATVLSAQTTDRRVNTVTPTLFNRWPGPQALADADIGEVETVVAPLG
FT                   CGPTRAARLVSMGAKLVDNFDGAIPDDLDSLVTLPGVGRKTANVVLGNAFGIPGITPDT
FT                   HVMRVSRRLGWTDATTPAKVETDLAELFDPSEWVMLCHRLIWHGRRRCHSRRPACGVCP
FT                   VAEWCPSFGEGPTDPEEAATLVREPRR"
FT   gene            278109..278696
FT                   /locus_tag="PPA0224"
FT   CDS_pept        278109..278696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0224"
FT                   /product="conserved protein"
FT                   /note="putative thiol:disulfide interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81986"
FT                   /db_xref="GOA:Q6AB80"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB80"
FT                   /protein_id="AAT81986.1"
FT                   /translation="MRGMKVFSAVMAALMFAGCGGDAGMAHQREDAGIPGCSHLPSGPI
FT                   AKSSGPATEGRPMPDHGLQCLGEGPTVSMSRATSRGVTVVTIWASWCRPCRSEAPLIAN
FT                   AYRRYHDRVHFLGIDYAESDASEAISFAGDAGLTFPHLQDPDSTIQGAWQISGVPVTFI
FT                   VRDGTIVTRHSGQWRSQRELDSAIDKVIKRTP"
FT   gene            278693..279349
FT                   /locus_tag="PPA0225"
FT   CDS_pept        278693..279349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0225"
FT                   /product="conserved protein, putative NTP
FT                   pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81987"
FT                   /db_xref="GOA:Q6AB79"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB79"
FT                   /protein_id="AAT81987.1"
FT                   /translation="MSHLSALIASLGRDDPDFSVGRRPGGGRSSAVLALISEEGNDIVL
FT                   TRRPLSLRHHAGQVALPGGRAENTDETIVDTALREAHEEVGLDRRLVTVRGVLPTAHVA
FT                   ASGSDVTTVIATWSGAGTVGVVDPAEVAMVQRVRLADLANPAARATTRHPSGYRGPAFV
FT                   LPDIFVWGFTAHVLDALLDRGGWSRPWDRERMVEIPEGYLGARRLPEEMTPNDIP"
FT   gene            complement(279430..279966)
FT                   /locus_tag="PPA0226"
FT   CDS_pept        complement(279430..279966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81988"
FT                   /db_xref="GOA:Q6AB78"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB78"
FT                   /protein_id="AAT81988.1"
FT                   /translation="MADKLPVGDTIDNLKTDGQKLVQDSKALVTAEIKPAAKHAGIGVG
FT                   MFGGAGYFGIVGALLLWLCGAFAFSLMWQHIGNWDILLSLVVGFATMAVVLFILAGILA
FT                   LAGKGQISQVKAPTGIVDEAKSTLTAVKSAVARGKYNATARSSIDASEIPSPAAPVAAD
FT                   GTSAPRRASGATERD"
FT   gene            complement(280063..281325)
FT                   /locus_tag="PPA0227"
FT   CDS_pept        complement(280063..281325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0227"
FT                   /product="putative sodium:proton antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81989"
FT                   /db_xref="GOA:Q6AB77"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AB77"
FT                   /protein_id="AAT81989.1"
FT                   /translation="MTDSRKNKRPRKSILRPVTGPNALHLSDIFRNETTGGMLMLAATV
FT                   AALLWANLGHHSYHFFRELALGPLTIEQWAADGLLTVFFFIAGLELKREFVEGSLSRPA
FT                   DALVPIVAAVCGMVFPAGIYTLFNVLASDGHPAGWAIPMATDIAFALAVLAIVGAGLPQ
FT                   AVRAFLLTLAIADDLGSIIVIAVFFSTGLDIWWLAGAIACIGLWGVMQHFHVDNGWWYV
FT                   PIFIVGWWCMLRSGVHATIAGVAFGLLTRTEEDVLDDPVDRWQHKVEPWSAGVVVPFFA
FT                   LMSAGVHVSGKTFLALWTHPISLGIVCGLILGKVIGITLGSCLTARFTSAELGRGVVWR
FT                   DIIAVAVLAGIGFTVSMLMTDLSFPKNHEFADEAKASVLMASFLAAILGGAMLHHRGKS
FT                   HAMRQTKHSHEVPVAAGTCND"
FT   gene            complement(281493..282452)
FT                   /locus_tag="PPA0228"
FT   CDS_pept        complement(281493..282452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0228"
FT                   /product="putative methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81990"
FT                   /db_xref="GOA:Q6AB76"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB76"
FT                   /protein_id="AAT81990.1"
FT                   /translation="MSPPGQHYAQADAPQRPVLVQESSYLQLSSEAAEFVTQCQICGKP
FT                   CQLADEPLWTTLATTIPSTIGAMAVSSAPHLPSGSFEWLTAGRVDPGSRVVVLCPTVAH
FT                   CRAVASHGADVLAVHRDPDTAEKLNRIPGVMAVCGSPESLPLNSSSFDAVLVHQGFHEL
FT                   APGLALPEIARVLRPGSVLGVSWLVRDDTVPWVKRLAALLRTVDENAMSGDYGTESVHE
FT                   LISSKYFPEDEHTTKRLWVPVNRDSLVAMAAARPAVRALDSDARSNVLTKVAALADDSA
FT                   GTSGLRLPYQLECWRAWVDHDELTTPIRPHDDGLTITL"
FT   gene            282461..283438
FT                   /locus_tag="PPA0229"
FT   CDS_pept        282461..283438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81991"
FT                   /db_xref="InterPro:IPR022521"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB75"
FT                   /protein_id="AAT81991.1"
FT                   /translation="MVTRDSRLAEVVGSVAASGGVGVEVLGGREAVSRAWSRNGPLLVG
FT                   ADMAGSVMAWGLSPRSGTYVVGFDAEEAARWSAGLSASVIVVPRANQVLTEILHDELAT
FT                   TSRATVVQVNSSGGGTGVSTLASGLAWAAARSGIKVGLVELNPSAGGIDLLLGIERKDG
FT                   WRWPELASARGVTTDLGSHVPSLDGVEVVSAGRVGVHVPPAARRAVVDSLAGDHDLVVV
FT                   DPGGLDTPEVTVNVKVGVVAADLRSVMTARGQNLPDLLVARRGPGRSMPDEDIESVLGV
FT                   RPDMTIKDDRRLARGQGDGEAPWVVASRRWRSGCAELVDQVMGS"
FT   gene            283435..284601
FT                   /locus_tag="PPA0230"
FT   CDS_pept        283435..284601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0230"
FT                   /product="putative secretory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81992"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR022399"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB74"
FT                   /protein_id="AAT81992.1"
FT                   /translation="MSGEEPDLKLVEQVRRRLAGLARDWTPMDVAHAILDCGRVASDKT
FT                   VLAVVEELRRTSTGAGRLDPLLAMDGVTDVLVNGPNQVFIDRGQGLELTDVTFSGPEEV
FT                   RALAVRLAAAVGRRLDDGNPWVDARLPDGTRVHAVLDVLARPGTCLSLRVPSRRCLSLD
FT                   DWVTGGSMAPGCRRMIDTILSRKLAFLVTGGTGTGKTTLLSAMLTSLPSDQRLVIVEDS
FT                   REIWIDHPHWVSMEARAANSEGKGSVTLTDLVRQCLRMRPDRIVLGEVRGAELRDLLMA
FT                   LNTGHEGGCGTVHANGVAEVPARLEALAALGGLSREAASAQITAALHTVIHVERGERGR
FT                   RVAEIGVFVDVEGRAVVLPAVRWDADGVMTLGDGAGRLSQLLGMEVAR"
FT   gene            284598..285368
FT                   /locus_tag="PPA0231"
FT   CDS_pept        284598..285368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81993"
FT                   /db_xref="GOA:Q6AB73"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB73"
FT                   /protein_id="AAT81993.1"
FT                   /translation="MTVIGASLLMGLAVWIAMPSATRKQEGRHLPAWSGIPVGFVVAWL
FT                   LFGASGVVWAVMTVVVGEAVLVVVRRQRRRAQILKGGREVARATRALAGRVSVGEIPSV
FT                   ALEHVADDVEVLAQARRAQAVGGSVSDALIATSRQPGMAGLVPLAHAWHLAATTGAPLA
FT                   PAAKSVAEGTARRARLEATLDSELAAARASGRIMGLLPLVGLLMGHVVGAHPTVFLTTT
FT                   WLGRACLLGSTLLACVGVLWSESLADRVAKEALP"
FT   gene            285404..286114
FT                   /locus_tag="PPA0232"
FT   CDS_pept        285404..286114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0232"
FT                   /product="hypothetical protein"
FT                   /note="putative Flp pilus assembly protein TadC"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81994"
FT                   /db_xref="GOA:Q6AB72"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB72"
FT                   /protein_id="AAT81994.1"
FT                   /translation="MIMAAIAAWLVVPATARTRTQARKPPPAWLAPRPGAPASHIRVLA
FT                   GLVAACAVLIGVPWPFPAAAGLSVLVGTVMWWGSGRLESSGHRRMEQHRAAQLPEALLM
FT                   LSSAMEAGLPLRSAVTTVAESLEGPCAEDLRRLASSLAAGVPDSRAWNDLASVEVWRDP
FT                   AQDVSRAVDSGEGISELLSAHAAQLQVAAAEKTEKKARKAGVDAIGPLVCCHLPAFLLV
FT                   GVVPIIAGMVLGAL"
FT   gene            286323..286610
FT                   /locus_tag="PPA0233"
FT   CDS_pept        286323..286610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81995"
FT                   /db_xref="GOA:Q6AB71"
FT                   /db_xref="InterPro:IPR025338"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB71"
FT                   /protein_id="AAT81995.1"
FT                   /translation="MSENTDPTTEPVISARSLDLVGATDVVEPRHRGRYRAARNKIIDR
FT                   GMATAEYAVGMLAAVALALVLLKVVTHQEVFTKLLKLVVSIIGKAKGMLP"
FT   gene            286703..287017
FT                   /locus_tag="PPA0234"
FT   CDS_pept        286703..287017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81996"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB70"
FT                   /protein_id="AAT81996.1"
FT                   /translation="MTVEMAVSLIAATLVVATSCWVVGLVVVEDACRTTAAQVARQVAR
FT                   GDTASARQAESNAPTGAKVSTTTSGGWVNVTVQVDRSLGRIGPVHLRGQARSPMEPGQT
FT                   "
FT   gene            287017..287421
FT                   /locus_tag="PPA0235"
FT   CDS_pept        287017..287421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81997"
FT                   /db_xref="GOA:Q6AB69"
FT                   /db_xref="InterPro:IPR021202"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB69"
FT                   /protein_id="AAT81997.1"
FT                   /translation="MNLALSRIRTRGTKAGGERGSGTLLLAAVGVGFIAAVWMSLLITG
FT                   WWSATHRAEETSDMAALAAGGAQAIGEPGCPVAERTVKANGAELVSCVVHNTENGSSVT
FT                   VEVGVQLHRGWELPGMPTRVVKSSRAGPME"
FT   gene            287537..287773
FT                   /locus_tag="PPA0236"
FT   CDS_pept        287537..287773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81998"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB68"
FT                   /protein_id="AAT81998.1"
FT                   /translation="MELGRITVIPDAHRTGKLYLYRELRMVPGMAPSEVISAQAAEDDL
FT                   GQLSVTSLSVNRCESPTWGAELPRVVLGMLQGR"
FT   gene            complement(287834..290098)
FT                   /locus_tag="PPA0237"
FT   CDS_pept        complement(287834..290098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0237"
FT                   /product="putative helicase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81999"
FT                   /db_xref="GOA:Q6AB67"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR022307"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB67"
FT                   /protein_id="AAT81999.1"
FT                   /translation="MSRLLTSPQVVYLDHREAAAGHTCEWPSWFPEDCRQAVEAAGIHR
FT                   PWQHQARFAELARAGRHAAICTATASGKTLAYLLPIMAATASATPVVPESPTPGLPASL
FT                   RDSLHRNSALYLAPTKALAHDQERVCREVGPRDWLVSTLDGDSDEAERRFAREQARYVL
FT                   TNPDMLHHTVLPSHARWAGLLGSLRYVVIDEAHRYRGVFGAHVAQVIRRLRRLCRMHGA
FT                   DPVFLLSSATSTNAAEAGTRLLGVEKVEVVDEDCSPHPGRDVVLWQPAESISTDATGLV
FT                   ADLADAGLQTICFVASRSLAEVISAHAQDRVTSGARVTAYRAGYLPEDRRRIEARLQDG
FT                   SVRAVVATNALELGVDISGMDAVVIAGYPGRLSALWQQAGRAGRSGRDALVVLMARENP
FT                   LDQYLFEHPELLFSSSVESTVLHPDNPYVLGPHVAAAAQEAYLSPADEEFYGSAFAGIC
FT                   KTLTGQNVLRRRGNRLFWTRPERAVDAIDLRSAAGKGIDIIDVSTGRVIGGVDEAAADR
FT                   TVHPGAVYLHQGDQWLVDEYNPVEHHALVHQDLPGYWTQPQSASTVRILREERRRACGP
FT                   GYVACGQVELTEQVVGYLRRDEITNDVWDSVALEMPTHTMITQACWWVIPDKVVDDLKF
FT                   DAVHLAGAAHGAEHTAIGLLPMYSPCDRWDVGGVSTVMLPDTGACTIVVHDGQAGGAGF
FT                   AEAGFEKAEEWWHATIMRLAQCGCESGCPACVVSPKCGNANQMLDKAAAAALTAAMDPL
FT                   A"
FT   gene            290122..291639
FT                   /locus_tag="PPA0238"
FT   CDS_pept        290122..291639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0238"
FT                   /product="putative transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82000"
FT                   /db_xref="GOA:Q6AB66"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB66"
FT                   /protein_id="AAT82000.1"
FT                   /translation="MERSRAKIATMGRHLTVDEIEQLRHIFTDIGYVTDPVMAAIGDSG
FT                   QLGLTRNSTTPALRALAGRTDALAGAIRLWLLQQPVPVEQLAPLPLQALTEAGIVSIAG
FT                   STARALVDVRPYGSPDDGASGWTVSDLTPGLDKAITKIRPDYVLGVSPASVSLTQMAVP
FT                   THVGSALDMGCGCGVQSLHLSRHADHVVATDVNPRALEMAQLTCRLSHADVDIRDGSLY
FT                   DPCGHDTFDLIVTNPPYVMAPPSRDGQRLIYREGGFCGDGLVEAVVRGAPARLNDGGML
FT                   QVLANWAHIGDQPWSERLATWVEETGCDLWVVEREHLDVCEYIETWLTDAGLDGSAQWR
FT                   SRYDEWLSYFDNLDVTGVSLGWITLTKAGRDDPDLCFEEWPWQVAQPIGGTMARRAQAV
FT                   IWAHLSDEDLLARRWRIAPNVDSETTGRPGATDPEHVVLRQRRGLCRAVEMTTASGGVL
FT                   GACDGELTLAQITDAVSAILEVDHDALLIEVLPLVRECLRYGILETA"
FT   gene            291732..292019
FT                   /locus_tag="PPA0240"
FT   CDS_pept        291732..292019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0240"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82001"
FT                   /db_xref="InterPro:IPR018720"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB65"
FT                   /protein_id="AAT82001.1"
FT                   /translation="MTDHQEIPLTETHHCSCGESDTELPELDVRTIPHAIRHGAVIGAF
FT                   AQLQPGASMVLIAPHNPLPLLSQLEQIGSVGVEYLVEGPDEWHLKLTKQA"
FT   gene            292242..295031
FT                   /locus_tag="PPA0241"
FT   CDS_pept        292242..295031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0241"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82002"
FT                   /db_xref="GOA:Q6AB64"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB64"
FT                   /protein_id="AAT82002.1"
FT                   /translation="MSPTKSLVIVESPHKATMIAGYLGPKYTVRASQGHVRDLPTSASE
FT                   VPAKYKGEPWARTGVNVDNEFTPVYVVSPEKRSTIRELKSLLKDSDELLLATDGDREGE
FT                   AIAWHLLDELKPKVPVRRMVFNEITEKAINEAVAHTRKLDTDLVDAQETRRILDRLYGY
FT                   EVSPVLWKKVLPRLSAGRVQSVATRLVVDRERERMAFTSANYWDMEATLTADLDEFQAR
FT                   LVSLDDTKIATGRDFDSHGNLISSVRRLDEVAATAIAKALEKAPFTVTKVESKPYTRRP
FT                   YAPFRTTTLQQEAGRKLGFTSQRTMSVAQNLYEGGYITYMRTDSVALSQEAIHAARNQA
FT                   AELYGSDHIPDKPRIYASKVKNAQEAHEAIRPAGEHFRTPAETGLTGDEFRLYELVWMR
FT                   TLASQMADAKGETLSVTIDATPVSPVNLPDGDVTTATFTASGRTITFHGFLRAYVESVD
FT                   EGASDDAQKRLPQLSKGQDLDPREVTAKGHDTRPPARYTEPSLVAKLEELEIGRPSTYA
FT                   SIIRTITSRDYVFKKGSALVPTWLAFAVTRLLEEHFSNLVDYQFTADMEETLDQIARGN
FT                   ADRVAVLSAFYFGQTKTGDGDVPTPTEGHEGLHQLVTELGDIDARTICTFPLDDSDVVV
FT                   RVGRYGTYVEDPEGNRANVDDALPPDELTVEAAKELLVSPNGQDRELGLDPHSHRPIVA
FT                   RNGRFGPYVTEVLDDDEATEIVETTTKDGKKRRTKRKVKPRTASLFRSMSLETVTLDEA
FT                   LKLLSLPRVVGTAADGTEITAQNGRYGPYLKKGTDSRSLGSEDEIFSITLEQAEAIYAQ
FT                   PKQRGRAAAKPPLRELGEDPASGRPIVVKDGRFGPYVTDGQTNATLRKDDSVEDITPER
FT                   AQELLAEKRAKGPAKKSPTKKKTTRKTTTRTTTTKKTTKATSKSVKVTKANAKTSSGS"
FT   gene            295033..296520
FT                   /locus_tag="PPA0242"
FT   CDS_pept        295033..296520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82003"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB63"
FT                   /protein_id="AAT82003.1"
FT                   /translation="MTTGCRSGSTEPLYFELAWTAARPVPADLRTTVAAGGARRTIECK
FT                   VTLLDSPDHRLLRSGIVVAHRVVDGLGEWYMDAPEWSPWLPVARSVALDAAGELPQDFT
FT                   CLVRPFLRGATLCPVAALSWERNETILEALDCTKLALIRDDRIAVVQSGVTTSRVRELT
FT                   ITPQRGLAEGQREWLTNRILALDGVPVSRHPSVLRRLGPGAGALTDYPRPHLHHGAGLQ
FT                   TWVSAQLAGQLRDVIEADLAVRCQGMDLGPTETTRTEPRVLPESPDRTDLVGMGYDPVT
FT                   MSTPSIHDGNHGSIRPLQKAIRALSETLDAMSGLLDQAWVERAQNLCLRVMGLDPGHIS
FT                   IHNLSREYYQLLEEITAAARSPRLTVDPDQPARPTMKRVLRKSVADAVAKCDDVEDVQG
FT                   WSTAEVAVRHAAAVAGILDTGRAGKVAKRLRPVVKEIAQTKRSVTEAVDVSKMSPQEAF
FT                   EAGREVERASASLFAARQSFRDDWQQHRRKILKAIHD"
FT   gene            296471..297157
FT                   /locus_tag="PPA0243"
FT   CDS_pept        296471..297157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0243"
FT                   /product="putative thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82004"
FT                   /db_xref="GOA:Q6AB62"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AB62"
FT                   /protein_id="AAT82004.1"
FT                   /translation="MTGNSIAARSLRLSMTDQTVTGRDLGGVFVVFEGGDGAGKTTQAR
FT                   LLDQWLTTEGIPHLMTREPGDSWLGQRIRELVLSPGSGPISSRAEALLYNADKAQHVDE
FT                   VVIPALREGKVVVCDRYVDSTIAYQGAGRALDPGEVGQLACWATTGLVPDVTVLLDVDP
FT                   CEGAGKIAAKDRLEAAGDEFHLRVRQHFLDLAAAHPQRYLVLNARKSRKEISEAIRQRV
FT                   TGLLNR"
FT   gene            297213..298412
FT                   /locus_tag="PPA0244"
FT   CDS_pept        297213..298412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0244"
FT                   /product="ATPase"
FT                   /note="possibly involved in DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82005"
FT                   /db_xref="GOA:Q6AB61"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB61"
FT                   /protein_id="AAT82005.1"
FT                   /translation="MLTGVWADLVGQEKAVGVLRRAAESQPGRSSHAMSHAWLITGPPG
FT                   SGRSNAAKAFAAALQCVDHGCGQCNACRTTLSGAHPDVTLVRTEALSIGVDEVRELVRR
FT                   AAMNPVHGCHQVVVVEDADRITERGADALLKAIEEPAPKTVWLLCAPTPEDVIVTIRSR
FT                   CRRLHLATPRDEAVADLLTRRDGIAPEVAAEAARAGQGHIGRARRLAWDEEARARRNAI
FT                   GELPTRLRSLGDCLQAAEDLVNQASEEAAAATAEVNAAERAELKKALGFGSSGARPRNA
FT                   QAALRDLEKQQSARLKRLQRDALDRVLTELTAYHRDVLAIQTGAVRPEEENALRGARLV
FT                   NAGWSASLHRIADSQSPEHTVATIDAILAARKSLEHGVTPLLVMETLLIAMTGVDRARW
FT                   "
FT   gene            298544..299350
FT                   /locus_tag="PPA0245"
FT   CDS_pept        298544..299350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82006"
FT                   /db_xref="GOA:Q6AB60"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB60"
FT                   /protein_id="AAT82006.1"
FT                   /translation="MSKAIKRTAADSTDAETTRVIRTGASRVDADVNPTEVIKPSDSAD
FT                   SERTSVIDDNVFRPDSETTRVVDDREFEEERRRRELAEQRARERADRQAIEVERQRRAA
FT                   HAEPEPEQVAEPAPKRTTDKVMASLGLFLFRLIVGGILGVHGFQHLAQRDLTLRAVQAL
FT                   PLPSGYAQSGVWVLGICECIAAVCIILGLFTRVAGAGIIAIMVLSLTFIFWGSFAIFKT
FT                   MGFKGELELLLAACGVLLLFLGAGGWSIDAAYRRSRAAAKAEEVGD"
FT   gene            299425..300087
FT                   /locus_tag="PPA0246"
FT   CDS_pept        299425..300087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0246"
FT                   /product="conserved protein"
FT                   /note="similar to signal peptidase II"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82007"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB59"
FT                   /protein_id="AAT82007.1"
FT                   /translation="MGSWLLYPTPEGPLVCRCVWGPEEVDLDGKLPTCPGKAGDAAVAA
FT                   AARDRRTRAEILQTVRRTIEDVGVDMEVLAIDLVESGDDRAIAVYFRAPHRVEFATIVG
FT                   PLARRLRARIDLRQLRGRDTARVVGGVGVCGRSLCCSTFLPEPSSVPNRLVSEQGMASN
FT                   PLAVTGACGKLMCCLRYESPYYADFEAALGEVRVPDAPRCPLMSTCSRRRDQERKDA"
FT   gene            300104..301786
FT                   /locus_tag="PPA0247"
FT   CDS_pept        300104..301786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0247"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82008"
FT                   /db_xref="GOA:Q6AB58"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB58"
FT                   /protein_id="AAT82008.1"
FT                   /translation="MTPRVSRRRMFVSALMASSLFAVTACTSAGSRPPQSASVSRQSAS
FT                   HKPSASPSVTASVVPAQDKVDTNPPVASFDPKAHALMEGPQSPDRQAMHPARDNKPFSK
FT                   APAGKGTNRYLSRKISWHDCGTFQCADIPVPLDWDNPDGPAITLALKRKPAEGAAKATL
FT                   FINPGGPGGSGQDMVSSFQSSAFPDHDVIGWDLRGTGASTHVNCGPAKTMDGLFSLDAS
FT                   PDNEAEWNGLIRGTRDFARSCRAYSGQLLDHVSTIDTARDLDYLRYLVGNKKLDYLGVS
FT                   YGTFLGATYAELYPGRVGHMVLDSTVNITNHDTVSQAVGFDRAFGDFAQWCANRGNRCA
FT                   LGTSAAEIRKATLNFLDRLDAHPMKVAGRELTQSLAATGIALFLYSGKQAYSYLTAALV
FT                   GAMKDGNGGYLLTASDYLNGRGKDGQWETIASAFPAISCLDQADFGLKHARQEWPHEIA
FT                   KAPTLGKALGVAPICEVWTARPAPQLYLTARGAAPILVLGATGDPATPYEQATWMAGQL
FT                   KSGVLLTWRGSGHSAWELGNQCVKKAVEGYVNDGKTPKDNTVC"
FT   gene            301875..302207
FT                   /locus_tag="PPA0248"
FT   CDS_pept        301875..302207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82009"
FT                   /db_xref="GOA:Q6AB57"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB57"
FT                   /protein_id="AAT82009.1"
FT                   /translation="MTLDQRHVAGIVVRAVGLALLAGILLALEWAWRTHAWNDLKAVDG
FT                   RCVLVGARVDDGRVPTVGCHENGARYVKDVVKPSSQCPKGLTRVSVRHELSHDTGYVGA
FT                   LCVRNP"
FT   gene            complement(302241..303917)
FT                   /locus_tag="PPA0249"
FT   CDS_pept        complement(302241..303917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0249"
FT                   /product="conserved protein, DUF885"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82010"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB56"
FT                   /protein_id="AAT82010.1"
FT                   /translation="MDNAHTTHQMGSEVDEVADHYWAALVQSSPTLATALGLDLNQDEY
FT                   DDLSPAGLDAQYRLAMDTLDRLDQAMPADDTDRITVAAMRSSLGLEAESHDKGYDLLSL
FT                   NGIASGVHEIREVYDAMPTETPDQVSTIARRLHATGPALDGWLATQRASIDAGIPAAIR
FT                   QVDLLVEQITAWTSDGGFFDDYLKRTASRDLPDAVTTALAEGIDAAKGNFRRTAEALST
FT                   EIAPLATETDAVGIDRYRLASRQFVGTTVDLAETYEWGKQELARIEQLQRETAERIRPG
FT                   ASIKEAMAVLDADPAYQITGTAALKVWMQERADEAISSLDGTHFEVPEQARHIEGMIAP
FT                   THDGGVYYTPPSDDFSRPGRMWWSVPDDTNTFTTWRELTAVYHEDAPGHHLQTSSAIAA
FT                   REELNSWRRNYWTSGYGEGWALYAEWLMADLGYMDDPGHFMGLLDGQSMRAARVVLDIG
FT                   LHCQFEAPEEMGGGEWNWDKAWAFFNNHVSMDEGSARYEVNRYFGWPGQAPSYKLGERT
FT                   WLELREAAKAKDPNFDLKEFHTTALRMGALPLDVLRRAMLS"
FT   gene            304048..304126
FT                   /locus_tag="PPA2411"
FT   tRNA            304048..304126
FT                   /locus_tag="PPA2411"
FT                   /product="tRNA-Thr"
FT   gene            304329..305678
FT                   /locus_tag="PPA0250"
FT   CDS_pept        304329..305678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0250"
FT                   /product="putative flavin-containing amine oxidase"
FT                   /EC_number="1.4.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82011"
FT                   /db_xref="GOA:Q6AB55"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB55"
FT                   /protein_id="AAT82011.1"
FT                   /translation="MYDSIIIGAGLAGLTAAEELASAGHSVVVLEARARVGGRLENAEL
FT                   SNGQVVELGGQWVGEGHEELRSLLSSQGLELVDSTDGDVVVKARGRVSHVTSLSEPSAH
FT                   SLSPFELADLGQGLLRFRRLADRVANNKGWAAANATWLNQSLSQWTVSNVRTEAGRGYI
FT                   TNLFRQAFGVSANDTPLFNGLAKANAGVDLESLVAVNGGLKQQRVKGGVAQVTRNLAEP
FT                   LGDDLKLSSPVRSVHSDDDGVTVTTTDGTQYQGRSVIVTVPPRLLKDMTFEPALPAERL
FT                   EMADKVPAGNVIKAYLVYDSPWWRTSGASGQMGADEGAVRVIFDTSDDETGKGILMGFF
FT                   EGTEASGYGKLSVGLRQRAFEEVVESAFGKAPSSPIEYLDRDWLSEPYTGGCHGAHFAP
FT                   SLWTTTGPILAEPLGRVFFAGAEYASSFNGYMEGALRAAARAAQEVLDLL"
FT   gene            305982..307010
FT                   /locus_tag="PPA0251"
FT   CDS_pept        305982..307010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82012"
FT                   /db_xref="GOA:Q6AB54"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB54"
FT                   /protein_id="AAT82012.1"
FT                   /translation="MFCARCGTQVGAHDAVCPQCGLNLRLPGAVRMTDPGSYDETRVQS
FT                   PVGEGATPTREIPRVQTPSEPGEWQDSMPTQQWPVQDSTPTQQWTTNSQSGPQQPSQGQ
FT                   YRDLGASQMPDDWFRDPEAERTRVMAAVPENPVFTPPPPPSTPAMAYPPPPSGDSPRHR
FT                   NVLIGLAVGLLVLVVLGAVLLFAGGLKGRSGSEPAVVTTPSASSQPTQSASEDPQATSI
FT                   DTTPSFLMSSPASPSPVPSSPALSTPTPLSPQSPTLSARQVADKLPDGDTLCSSSVGAV
FT                   GTTSCPFALEVANAIPAGAQGDYEVQAYSPVTGKMYTMKCETQESYTTCTGGIAAKVHI
FT                   LR"
FT   gene            complement(307028..307495)
FT                   /locus_tag="PPA0252"
FT   CDS_pept        complement(307028..307495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0252"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82013"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB53"
FT                   /protein_id="AAT82013.1"
FT                   /translation="MRHAQPASHAPGGDRERPLTDVGRRQAREVGTRLGLRNVGHALVS
FT                   DALRTRQTWDCLQLDCPVEFMRALYYCGTDTVRRRIGEIDDDVDNLLIIAHAPTIPGLA
FT                   AQLAAMSGAEDEVGCWYPPATLTEVEVDGTWADLKDEYFDKVRLVGVQRPM"
FT   gene            307567..308454
FT                   /pseudo
FT                   /locus_tag="PPA0253"
FT                   /note="acetyl xylan esterase; frameshift"
FT   gene            complement(308567..309613)
FT                   /locus_tag="PPA0255"
FT   CDS_pept        complement(308567..309613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82014"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB52"
FT                   /protein_id="AAT82014.1"
FT                   /translation="MPNAVHDTMSPMSESLVLLAPAANHVYAGQAGRLCAAELSLTCPN
FT                   ATSVAPVTVAGVEYLSIHSEDPLPPADLAAVARSSAALACFEYRGDLLAPLELPQVDVV
FT                   DEDLVTIPKYRGKTNEQFTRLLLNLTLASLEGRCATRRDEGQRLAILDPLAGRGTTLEC
FT                   AWRAGHNGFGVEQDAKAVEALAAHVTTWLRRKHLKHSCATHPVRRDGRSLGKRFDAEVR
FT                   LPKTEPLAMGVFTGDAADSAVLWGRKTFDAVVTDAPYGVVHGSHSGASRRRSPTDLLRE
FT                   AIPVWAGQLRHGGALGMSWNTLGLSREHLVTILSAAGLTPLDDDLWHQFSHRVDSSIHR
FT                   DLIVAVKP"
FT   gene            complement(309691..310323)
FT                   /locus_tag="PPA0256"
FT   CDS_pept        complement(309691..310323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0256"
FT                   /product="inorganic pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82015"
FT                   /db_xref="GOA:Q6AB51"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB51"
FT                   /protein_id="AAT82015.1"
FT                   /translation="MWHENPSCKRIQCRSSPCPIQEEGPLVTDDFTNPFQGEQPESLHF
FT                   DVTIEIPRGNKNKYEMDHETGRIRLDRTLFTSTQYPYDYGYIEGTLGEDGDPLDALVLL
FT                   TEPTFPGCLIECRALAMFQMQDEMGGDDKVLCVPADDPRRAGLIDLDDVGSMTLMEIEH
FT                   FFTVYKDLEPGKSVEGATWTDRDEAEAEIKASFERAKGTSYENLHTA"
FT   gene            310315..311745
FT                   /locus_tag="PPA0257"
FT   CDS_pept        310315..311745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0257"
FT                   /product="putative carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82016"
FT                   /db_xref="GOA:Q6AB50"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB50"
FT                   /protein_id="AAT82016.1"
FT                   /translation="MPHSDQPTSKRVMSAPRRRMPGWVPVTVGIAVVVIVVVAVIVSSL
FT                   RSGSPARWTGGGILPHRHDNTAQAVQPGRGVVAAVAPTTPSAKPVAATIANRVKSAGAA
FT                   PGVLGADIMDAATGETLYQSGQNSLLTPASNLKVLTAIALLDCTDAGHRYTTKVVANGS
FT                   ALTLVGGGDPYLRSKSSAQHPEYPSMEELAKRTAAALKKAGTTKVTVNLDDTLFTGPDW
FT                   NGAWPVDNYSDEVTPITSLWVDEGMINNSPWNRSKTPAVLATNAFIGSLRSAGITVNGS
FT                   VSRHKADRSAREIAAVQSVPVEDLVTRTLEESDNSAAEVLSRQMALASGKPGSFAGGTQ
FT                   ALEEHLKNIGAWQDGVVIQDGSGLSQGNRITASMLSRAWRKVLTTPKLQPVANAVPVGR
FT                   VSGTLHKRFSDPSTAAGRGVVHAKTGSLQGVISMSGWLRDADGRILVASFIINQTDGSA
FT                   RSWLDVVYGNLAGCGCTR"
FT   gene            311745..312680
FT                   /locus_tag="PPA0258"
FT   CDS_pept        311745..312680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0258"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82017"
FT                   /db_xref="GOA:Q6AB49"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AB49"
FT                   /protein_id="AAT82017.1"
FT                   /translation="MARRELGPAALAVAQAVERMVRGVDRFVVGCSGGPDSLALALASK
FT                   WASRRCESGVRVVIVDHQLQQGSDEVAERTRDLLVRRGMDACVRRVDVDADDPDGPEAA
FT                   ARTARRAALLDVAGDEPVLLGHTRDDQAEQVLLSLARGSGATSLAGIRPRSGQFWHPLL
FT                   EVRRAQTVQACREWEVEPWQDPHNGDPRFLRSRVRTELMPVMEEVLGPEVAASLARSAT
FT                   LLAGEDEVVARVARMWADEHGVKANELPGLRGVEVGLARRVVKEWLPQARMVHVDAVLG
FT                   LLDGPGGAGVDVPGGRVEMRQGTLYLARRL"
FT   gene            312708..313262
FT                   /locus_tag="PPA0259"
FT   CDS_pept        312708..313262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0259"
FT                   /product="putative hypoxanthine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82018"
FT                   /db_xref="GOA:Q6AB48"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB48"
FT                   /protein_id="AAT82018.1"
FT                   /translation="MRASDIPGDFDHVLYTEEQVASRIREVAAQIDADYAGREILMVGV
FT                   LNGAVMTMADLCRAMTSHMSMDWMAVSSYGAGTKSSGVVRILKDLTKDIDGRDILIVED
FT                   IIDTGLTLSYLVQNLRSRNPNSIEIMAMFRKPEVVTCPLDVKYVGFDIPNEFVVGYGLD
FT                   YADKYRNLTDVATLAPHVYKS"
FT   gene            313404..315557
FT                   /locus_tag="PPA0260"
FT   CDS_pept        313404..315557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0260"
FT                   /product="putative cell division protein FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82019"
FT                   /db_xref="GOA:Q6AB47"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB47"
FT                   /protein_id="AAT82019.1"
FT                   /translation="MKNASRIFKGPLIWILLCIGLIIVFLQFAGSGNGYKDIPTSEAVS
FT                   IINSSKKLDSVTLTDGDQVIKITENENKKYRSYWVGNQSDQLVDRLNDRVKAKTLKSWQ
FT                   GENPGQSIWKALLINFLPFVIILLFFLWAMNAAQGMGGRGGVMGFGKSKAKVGSKDTPK
FT                   STFADVAGCQEAIDELQEIREFLAEPAKFQRVGAKIPKGVLLYGPPGTGKTLLARAVAG
FT                   EAGVPFFSISGSDFVEMFVGVGASRVRDLFEQAKEAAPAIIFIDEIDAVGRHRGAGMGG
FT                   GHDEREQTLNQLLVEMDGFDVHGGVILIAATNRPDVLDPALLRPGRFDRQIAVEAPDLD
FT                   GRLKILKVHAHGKPMADDVDLASIARRTPGMTGADLANVLNEAALLTARANLPVIGNSE
FT                   LDEAIDRVIAGPQKKTRLMNEHERLVTAYHEGGHALVAAAMPGTDPVQKITILPRGRAL
FT                   GYTMVMPDSDKYSQTRSELLDSMAYMMGGRAAEELIFHDPSTGASNDIEKATKVARALV
FT                   TQYGLSARVGTVQLGSGDTEPFLGMTAGQQRDYSDETAKIIDDEVRELLENAHQEAFDC
FT                   LDANREVLDELVRQLFARETLSKAEVADIFKPLKRWPERGAFTGSDKRVPSSIPPVKPP
FT                   QIAGVDEDAPEVGAPRRGVIAPPTPEPGGDLPGDNPGEWEPPSDWQPPSVGGGKSPEPP
FT                   SPTHPGEGPQPPSNGNPWGPPRS"
FT   gene            315622..316197
FT                   /locus_tag="PPA0261"
FT   CDS_pept        315622..316197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0261"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82020"
FT                   /db_xref="GOA:Q6AB46"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB46"
FT                   /protein_id="AAT82020.1"
FT                   /translation="MKLSVDRERAAAAIREFLLAVGEDPDREGLRDTPMRVAQAAEELF
FT                   GGLSQDPGELLATTFDISHDEMVLVRDIELQSMCEHHLLPFIGVAHVGYIPARDGRVTG
FT                   LSKIARLVEVYARRPQVQERLTTQVADALVEHLDARGVIVVVEAEHMCMTTRGVRKPGA
FT                   RTVTSAVRGILRNPATRAEAMGLITAGR"
FT   gene            316270..316563
FT                   /locus_tag="PPA0262"
FT   CDS_pept        316270..316563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82021"
FT                   /db_xref="GOA:Q6AB45"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB45"
FT                   /protein_id="AAT82021.1"
FT                   /translation="MFSAVGGPAAATVGVMTGLAEGTLILAFVTPRRYRRGDEADLPVR
FT                   SRWWVPVWTVFGRSPGAGFLVFVVFFALALISGGGGIGMGDVKRAVFIGLMG"
FT   gene            316805..317911
FT                   /locus_tag="PPA0263"
FT   CDS_pept        316805..317911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0263"
FT                   /product="putative outer membrane protein A"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82022"
FT                   /db_xref="GOA:Q6AB44"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB44"
FT                   /protein_id="AAT82022.1"
FT                   /translation="MWNWKMRAAGFIGGLAVVFGFVALPAHSDESVTVPVPLVDAVAVS
FT                   HYESAKRQKEKPGSVILALHAVRRLPYATVVYYSVSVDASVSGPLEDYGYLVGRGGAQA
FT                   HYSGTLSADGAVIDVGNHKLYRTIGDFQGCKMCASEWWNGAPIWEMAPGHSRLGWFSTP
FT                   PLPADVSRVDVTVANRIFHDVPVGDGLLGPTIDKEAATGRWNKGMPLGVAWPALDPKDL
FT                   AGVDVSKFVNALVTTTGDASDASRERVTKESMKIDLDASVLFDLDSDVVKPAGRQIIDR
FT                   TAKQLVARKVSGKIEVTGYTDSSGSASHNLDLSRRRAASVAKVLGSQLSKGITLVTAGK
FT                   GEADPVTSNDSEAGRRLNRRVTITVKEG"
FT   gene            317911..318549
FT                   /locus_tag="PPA0264"
FT   CDS_pept        317911..318549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82023"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB43"
FT                   /protein_id="AAT82023.1"
FT                   /translation="MKGRPVFVGCVAVLVLTACGGAGVSAGSHPHTAVASSSVSVVGMS
FT                   APPSASVSVMGSEQAAAVESAAGKAIRDKVKEDGGPIPKEVANVSFHPNLDDNVDVTAH
FT                   VVSIKAGPTGTVLTFWLTSNTIDHAMGPVFPEDFPSLVDTVGGVKYGVNYFSKAGDTSK
FT                   FVVGSEEPEIDAKSVYVMQASYPPLPKSVTKVKIAIGSAKTSPDIPVTR"
FT   gene            complement(318444..318707)
FT                   /locus_tag="PPA0265"
FT   CDS_pept        complement(318444..318707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82024"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB42"
FT                   /protein_id="AAT82024.1"
FT                   /translation="MRSGALEILGQHGPHPDSLHNAALIIATKLSSAPEPVALSLGLAW
FT                   AQASTSSPQRVTGISGDVLADPIAIFTFVTDFGKGGYDACIT"
FT   gene            318756..319277
FT                   /locus_tag="PPA0266"
FT   CDS_pept        318756..319277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82025"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB41"
FT                   /protein_id="AAT82025.1"
FT                   /translation="MANNYGVSRRTLLGVGGLMLGVGLVGCSDSEEGWESVTVDRITVS
FT                   HPTEWVEKPPENENFTKNFTDGPHGMQIAGHYSDDTEPTLAWSVLEFMIRGTFQGYDPK
FT                   GYQEITVKGAARAIKCPFDFTYKGKSARGYWLVASGVLPTEGSAIVLLRLPRDDTNLVD
FT                   KIIASMSFKA"
FT   gene            319307..319759
FT                   /locus_tag="PPA0267"
FT   CDS_pept        319307..319759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82026"
FT                   /db_xref="GOA:Q6AB40"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB40"
FT                   /protein_id="AAT82026.1"
FT                   /translation="MRQDTRSAWADSTLTSPAPKRRSRTFNVVLGVLLTIVAAGIADVV
FT                   VVWSCALVYDTRLGAALLGCLGALVLSHVWASRRALATVWWSCGLVLLCVVGMAVYAWV
FT                   RAGLSPVDPVVVETLAPILPVAACTAVGTGYVWRLCVRLVADHRSL"
FT   gene            319949..320923
FT                   /locus_tag="PPA0268"
FT   CDS_pept        319949..320923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82027"
FT                   /db_xref="GOA:Q6AB39"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB39"
FT                   /protein_id="AAT82027.1"
FT                   /translation="MRTRDDRGAAAPEYIAILLIAAMFTSAVAVGVKPEWVQQKVCQAL
FT                   AVIFGKGSCAPASQAKPPAQQLPKRCLIHSDENATSIYAEGKITWVTIGGEGGYGYHLV
FT                   EYSDGKADVELFYNVGASAGAAAPGWSKGPASLDASITGSAKYTKGETVHYDSVAAARA
FT                   DRDSLNKYARERALAVMHLGSAPDVPNSRLSSTSRTVEVDVKGKATLKVKAKVGGHGSA
FT                   DAGASGSVNGIVQYITKRDSKTGAVTHTVEALGSANGDAHANAGATMGNHGVKTPTVGG
FT                   HAGLDDDTSVSVTKDNSGKITELVITKSGAEGADFGVDGDFKI"
FT   gene            320859..321536
FT                   /locus_tag="PPA0270"
FT   CDS_pept        320859..321536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0270"
FT                   /product="hypothetical protein"
FT                   /note="weak similarity to predicted gland protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82028"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB38"
FT                   /protein_id="AAT82028.1"
FT                   /translation="MSSPRAVPKAPISAWMVTSKFELGKPRLVPGPGKPRLVSGPGKPR
FT                   LVSGPGKPRPVPGPVRWKPEPNKTRDAGNNEGRHGKQGKGSTLSKKPGREEESDGDHKS
FT                   RETTTIRVAVNDQNRSQVEKWLGDNDVGPSNAVPLLVKARFMNPLDADATNDFAKFLYQ
FT                   SEDTQIDTQTSSETSDLKDDSYDILVAKVGEKDARESSSSTGQMGYLLENGKRVPKISE
FT                   GCK"
FT   gene            321592..322437
FT                   /locus_tag="PPA0271"
FT   CDS_pept        321592..322437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0271"
FT                   /product="dihydropteroate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82029"
FT                   /db_xref="GOA:Q6AB37"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB37"
FT                   /protein_id="AAT82029.1"
FT                   /translation="MINVGSATNSHPARTLVMGVVNVTPNSFSDGGMWADPEVAIRHAR
FT                   DLVVEGADIIDVGGESTRPGTERTPEHEELRRVLPVVKALVADGVAVSVDTMRASVAKA
FT                   VVEAGATIVNDVSGGKAEPEILDVVADAGVDYVLMHWRGQSATMQNLVDYDDVVADVIS
FT                   ETSQQVDAAIAAGIDRRRIIVDPGIGFSKTSEHNWQLMNAVDAFQEGFADLRVLWGVSR
FT                   KRFLGELLAQNGEDRPALERDASTMALSTYFALHHAWCVRTHEVRANRDAVETVARLLA
FT                   "
FT   gene            322498..322860
FT                   /locus_tag="PPA0272"
FT   CDS_pept        322498..322860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0272"
FT                   /product="dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82030"
FT                   /db_xref="GOA:Q6AB36"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB36"
FT                   /protein_id="AAT82030.1"
FT                   /translation="MTYGQITLTGIRAHANHGVLASERELGQPFSVDVSLDVDMDTVSD
FT                   DLTQAVNYATVAQRVLNILTREPVSLIETLAGKIADTVLAISPRVHSVQVTVHKPHAPV
FT                   GVALDDVAVTYRKDAE"
FT   gene            322857..323414
FT                   /locus_tag="PPA0273"
FT   CDS_pept        322857..323414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0273"
FT                   /product="putative hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82031"
FT                   /db_xref="GOA:Q6AB35"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB35"
FT                   /protein_id="AAT82031.1"
FT                   /translation="MKTVFSLGSNMGDPFAHLRDAVRLIAETPGIHDVVVSPVYVTAPI
FT                   GGVEQDDFLNLIVVATSDLPPSVLLERAHVIEAAHGRDHTIPNGPRTLDVDLIRVGDET
FT                   VTTDELTLPHPRAHKRAFVLVPWRDADPEAELPGYGRIADLVASFDADELADAVKPYSR
FT                   QIDVAGVTVAGEWDERHDEEDV"
FT   gene            323411..323947
FT                   /locus_tag="PPA0274"
FT   CDS_pept        323411..323947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0274"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82032"
FT                   /db_xref="GOA:Q6AB34"
FT                   /db_xref="InterPro:IPR021517"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB34"
FT                   /protein_id="AAT82032.1"
FT                   /translation="MTRSLPPEWDDDRRPGGGNPQGNIAPTDWKVIIVAALCGAALGWF
FT                   ALSIYKINDVTVPILPWSLPVVILVAAIATWGYARAFRTKVVDPQREVEANQGLVSLAL
FT                   GKAIALSGAALVGACIVYVLTFVWHLNIPYPRQRAIVGGVTAITCAAMAWAGWFLENAC
FT                   KVPKGPDDSEKHPKG"
FT   gene            324030..324707
FT                   /locus_tag="PPA0275"
FT   CDS_pept        324030..324707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82033"
FT                   /db_xref="GOA:Q6AB33"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB33"
FT                   /protein_id="AAT82033.1"
FT                   /translation="MMMPVSGEHDPKRVEKDTGERRGVLALLIVATIVAAVCGVVPSIW
FT                   AVRAGVLVALVGAWISVFMAWRQVDAIRRMHFDTLKELRHAASEQEKRHHAESMEMIDT
FT                   FSRRVGSISKTLADTRAKLDRAESELSTLRGDKAALQYKVTAGNKKVASLEMRITELET
FT                   ELDALLADGRSGRLTTLRTVTDAGVPTAEEIWERGNDATIADLSRVAFPRLSEGTRETR
FT                   RQA"
FT   gene            complement(324784..325974)
FT                   /locus_tag="PPA0276"
FT   CDS_pept        complement(324784..325974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0276"
FT                   /product="putative NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82034"
FT                   /db_xref="GOA:Q6AB32"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB32"
FT                   /protein_id="AAT82034.1"
FT                   /translation="MRHPQRVFSSMRKIMFVIGSMPLTHPSQSADGDPGKKYEVTRLDL
FT                   GHLHPTRSGLVTIATTVDDDVIISSQVNVGTLHRGDEKLFEVRDYRQIPMLASRHDWTA
FT                   PFIGETGAAHAIEDAMGITIPTRVAWIRTLLAEFSRITSHFTFLSWVGHHCDDAGLENA
FT                   IATAIENARRIWQRCSGNRIHPMITRIGGLRIHPESEWQPALGEWLDDANALVTRLRTA
FT                   LDATVGVRGVAVIPTNMIDRYGLSGPVSRASGVDLDTRRRTAVYDELKWPEVVIEPRGD
FT                   AYSRLATLCNDAAVSSSLCRQILDRLPSLDGPLETRLPTAIKAPRGRTWTTIEALWGRA
FT                   GYLLESRGSTTPWRMALRTPTFANVQVLEAVLPGTRVDDVEATIASLGWTLGDLDK"
FT   gene            326113..326430
FT                   /locus_tag="PPA0277"
FT   CDS_pept        326113..326430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0277"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82035"
FT                   /db_xref="InterPro:IPR024412"
FT                   /db_xref="InterPro:IPR042254"
FT                   /db_xref="InterPro:IPR042261"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB31"
FT                   /protein_id="AAT82035.1"
FT                   /translation="MAQRVRVDLVDDVDGSPAEESVNFALDGVNYVIDLSAENASKLRD
FT                   ALSLWVDHARRTGGRRTRGRRPTGGPTANEVRQWAKSQGYEVSERGRVSNEIREAYQRT
FT                   H"
FT   gene            326692..329226
FT                   /locus_tag="PPA0278"
FT   CDS_pept        326692..329226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0278"
FT                   /product="putative Clp-family ATP-binding protease"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82036"
FT                   /db_xref="GOA:Q6AB30"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB30"
FT                   /protein_id="AAT82036.1"
FT                   /translation="MFERFTDRARRVVVLAQDEAKALNHNYIGTEHLLLGLISEGEGVA
FT                   AKALESLDISLEAVRAQVEEIIGHGTSTPTGHIPFTPRAKKVLELSLREALQMNHSYIG
FT                   TEHILLGLIREGEGVAAQVLIRLGADLNTVRNSVLQLLQGYQGDERQAATSGAPEAGPQ
FT                   QSSATILDQFGRNLTEAARDGELDPVIGREREIERVMVVLSRRTKNNPVLIGEPGVGKS
FT                   ACVEGLAQAIVRGDVPETLRDKKIYSLDLGSMVAGSRYRGDFEERMKKVLKEIKNRGDI
FT                   ILFIDEIHTLVGAGAAEGAIDAASMLKPMLARGELQTIGATTLDEYRKYIEKDAALERR
FT                   FQPIQVDEPSIPLAIEILKGLRDRYEAHHKITITDEAITSAANLASRYIQDRFLPDKAI
FT                   DLIDEAGARMNIRRMTAPPDLREFDERIARVRVEKEAAIDAQDFERAAGLRDDEKKLLA
FT                   EREAKEEEWKQGDESVPAVVGPDEIAEVLSGATGIPVFKLTEEESQRLLHMEDEIGKRY
FT                   VGQEDAVKALCRSIRRTRAGLKDPKRPAGSFIFAGPSGVGKTELTKALTEFLFGDEDAL
FT                   ITLDMSEYSEKHTASRMFGSPPGFVGYEEGGQLTEKVRRKPFSVILFDEIEKAHPDIFN
FT                   SLLQILDEGRLTDAQGRVVDFKNTVIVLTTNLGTRDISKSVNLGFSKADDVESSYEKMK
FT                   AKVTEELKGHFRPEFLNRLDEIIVFHQLTQPDILRIVDLMVGQLEDRLADKDMGIEVTP
FT                   AAKELLSTRGFDPLLGARPLRRTIQRDIEDVLAEKILFGEVKPGQIVVVDAAPEGSEEP
FT                   FVFTGTERSELPDEVPPELTSSAGENNRGQQG"
FT   gene            complement(329279..330286)
FT                   /locus_tag="PPA0279"
FT   CDS_pept        complement(329279..330286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0279"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82037"
FT                   /db_xref="InterPro:IPR021365"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB29"
FT                   /protein_id="AAT82037.1"
FT                   /translation="MTLDDDAPIWAKTIIDGLNRPFPWGSAHQSSGPDDVDVTPWRLHP
FT                   AFHGCLDWHSSVHMQWSAVTLLRCANQVIDHTTIDALNGVLNDRLTDENARVEAEYLRI
FT                   HRGYERPYGWGWATLLAAQCAPLTGTTWASATRIISLQVFENLLAWLPTLTFPVRTGTH
FT                   DNTAFGIGLCLDAARSLQRPEVIEAIVEHSHRLFDADVHYPSSWEPSGNDFLSAALSEA
FT                   HLMARVYDVEGRTNEFGTWLHTFLPRLGQSDDNLLNVPRVTDGTDGKLAHLYGLSLSRA
FT                   WQLRALATWLAEGSRHRIEKATARQINEVSHQITHGDFMATHWLVSFALQAVLV"
FT   gene            complement(330283..331269)
FT                   /locus_tag="PPA0280"
FT   CDS_pept        complement(330283..331269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0280"
FT                   /product="conserved membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82038"
FT                   /db_xref="GOA:Q6AB28"
FT                   /db_xref="InterPro:IPR009323"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB28"
FT                   /protein_id="AAT82038.1"
FT                   /translation="MIKVEWFYWLCGFLFLVTALVRLRDREDNKRFGSAAFWAILAFSF
FT                   GYGSFVINKTAPALVEGIAVLLLVVLAACRFPGRGSTETTTEAEREKSAKKFGNKLFML
FT                   ALIIPFVAAIFAVAGMRNVSFDGSPLLETGMATIIGLGAASVIALVTAMIMFKVRSPVV
FT                   AFKEGDRLLGHIGWAAILPQFLATLGTLFNNAGVGDAVGRITSWILPSESLFAAVCVYC
FT                   LGMALFTLIMGNAFAAFPVMTAAVGWPLLIQHFHGNMAAVFAMGMLAGFCGTLCTPMAA
FT                   NFNLVPAALLELDDSYGPIKAQIPTAVPLLVCTILIMYLCCFPGGLL"
FT   gene            complement(331266..332030)
FT                   /locus_tag="PPA0281"
FT   CDS_pept        complement(331266..332030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0281"
FT                   /product="conserved membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82039"
FT                   /db_xref="GOA:Q6AB27"
FT                   /db_xref="InterPro:IPR010374"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB27"
FT                   /protein_id="AAT82039.1"
FT                   /translation="MWVLLAVAIVVIGFALRLNAMLVVAVAGIAAGLIAGMSPVKLIET
FT                   FGTGFASSRSVTVFIVVLPVIGLLERHGLMQQAGRLMSKMKSMTAGKLLAVYLAVRQIT
FT                   AAVGLSSIGGPAQAVRPLVVPMAEAAARRTHPRYTRKMREKLRSYASSADTIGLFFGED
FT                   VFIAIGSILLITGFVDATYNLKLEALQIALWAIPTAICAFLIHAPRLWLLDRKLAKMAA
FT                   EGGDNVDIDEVPEPGHTVSLPSGGNPEQGVHE"
FT   gene            332153..332923
FT                   /locus_tag="PPA0282"
FT   CDS_pept        332153..332923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0282"
FT                   /product="lactam utilization protein"
FT                   /note="LamB/YcsF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82040"
FT                   /db_xref="GOA:Q6AB26"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AB26"
FT                   /protein_id="AAT82040.1"
FT                   /translation="MATVDLNADMGESFGSWKAGDDESLLGIVTSANVACGFHAGDAVV
FT                   MGQTCKAAAEHGVCIGAHVSYRDLAGFGRNFIDVDPGRLRDEVIYQLSALRGIAAVHGA
FT                   SVRYVKPHGALYNTIVHHQAQAKAVVEAIDAVNSATGADMAILGLPGALVLDLAEQQGV
FT                   RTLSEVFADRAYNPDGTLVSRRQEGSVLHDPGEVAERVVTLVTQGSVTAIDGTKVPIKA
FT                   DSVCVHGDTPGAVAMATAVRDRLASTGIELRAAA"
FT   gene            332920..333540
FT                   /locus_tag="PPA0283"
FT   CDS_pept        332920..333540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0283"
FT                   /product="allophanate hydrolase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82041"
FT                   /db_xref="GOA:Q6AB25"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB25"
FT                   /protein_id="AAT82041.1"
FT                   /translation="MRLLPAGRTAVLVELDDAGQRRRLHRTLSEHPAVGTVDLVPAQTT
FT                   VLIDVESPDQLPAAVAHVQEFIAAGLDCVEQGAREIVEVPVRYDGLDLSDVAELLSMTT
FT                   DELVKRHSDQQWTVEFAGFMPGFGYMSGADWPYRIPRRDSPRTRIPPGSIALADGFTGV
FT                   YPQASPGGWQIIGTTDAILWDEKADPPALLLPGAVIRFEVVDS"
FT   gene            333537..334406
FT                   /locus_tag="PPA0284"
FT   CDS_pept        333537..334406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0284"
FT                   /product="allophanate hydrolase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82042"
FT                   /db_xref="GOA:Q6AB24"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB24"
FT                   /protein_id="AAT82042.1"
FT                   /translation="MTHFVVETAGPRTLIEDAGRRGWADLGISGCGAWDRRAYLDGARL
FT                   VGNGAGLGCLEILLGPVRLRCVGGPVLVAVTGADAQIDLDGAPRPSGWGFLVTDGQTVS
FT                   IAMPATGLRSYFSVTGGINASPTFASVSADPTRGMGPAPLKAGDRVSVGDGPAGLISTT
FT                   PVDIQQAPTELVLHGVWGPRDDWFTDAGRRSLEQTPWRVAQASDRVGTRLEGPSLERAV
FT                   TGELTSEPVMRGAIQVPTSGVPLVFGPDHPTTGGYPVIGVVDPEDADRLAQARAGVVVR
FT                   FAMTAHDW"
FT   gene            334570..336057
FT                   /locus_tag="PPA0285"
FT   CDS_pept        334570..336057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0285"
FT                   /product="putative sugar transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82043"
FT                   /db_xref="GOA:Q6AB23"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB23"
FT                   /protein_id="AAT82043.1"
FT                   /translation="MSPEQSSVAHVEHLARDRDGHVVTEEQAWSALWALLIGFFMILVD
FT                   TSIVTTALPATIRALNANLNQGVWITSAYLLTYAVPLLITGRMGDRWGPHRMYIIGMLV
FT                   FGVSSLACGLSPTIGVLIAARAVQGIGAALMTPQSLSMITRLFPPEKRGAAMGLWGATA
FT                   GVASFVGPVLGGILVDTLGWEWIFFVNVPVTVIGLWLAIRNVPALETHGHAFDWCGVVL
FT                   SGIGMTLLVFGIQEGEQYNWGTITGIISVPLLIVLGVVFMVLFVVSQTQWAQSRLHARS
FT                   TNFEPLVPLRLFTKRNFTLANIAIFLVGMLVTSYFLPTAIYLQNVRGKSPTVAALLLIP
FT                   TAVVSGVLSPVVGRVLQHRRSGRMAAIGVSLYVISSIGWWLFTVPSTGLWVFPLLSVIT
FT                   GVGAALTWSPISLVGTDDLGQADAGAGSGVYNATRQVGSALGSAFIAMMMDARIMARHD
FT                   LGRGLGESMFITITAGTICVIVCAFFANFQRSRQRNS"
FT   gene            336125..337024
FT                   /locus_tag="PPA0286"
FT   CDS_pept        336125..337024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0286"
FT                   /product="conserved protein, putative cell division
FT                   inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82044"
FT                   /db_xref="GOA:Q6AB22"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB22"
FT                   /protein_id="AAT82044.1"
FT                   /translation="MRIAIGGFAGLIGTALVQRLRKEGHDVVTLTRHEPIQPSDRRWDL
FT                   DTLSIAPPFLDDVDAVVNLAGAPIADGRWTDERKTRILASRIDSTRVVVRALASSPRCR
FT                   IFLNGSAVGYYGPHGDEWLDENDPAGAGFLAEVCQRWETAANSAPDGVRVATLRTGHVV
FT                   SSFGGMLGKERPFFQFGLGGKIRDGSRYMSWISLHDHVSAMMKILTDDTMSGPVNLVSP
FT                   NPCTNAEFTTALAQAMHRPSVIPFPVPAAKMIFGSQLVDEALCSGQRVKPAKLLEHEFE
FT                   FRDTSITESITSALAGRR"
FT   gene            337021..337929
FT                   /locus_tag="PPA0287"
FT   CDS_pept        337021..337929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0287"
FT                   /product="membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82045"
FT                   /db_xref="GOA:Q6AB21"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB21"
FT                   /protein_id="AAT82045.1"
FT                   /translation="MSQNNQRPDGFSRPDEWGSWQDEPQQNHGDASGAASHARPAQRDE
FT                   STASQPEPYRSVDVDPSWAPPSASYQQATPRPVARVKRHSDVPVVTWTLIGICFLVWVG
FT                   EWLSPQVGEAVVLAPRVGFTEPWRFVTSMFGHALSIFHIGFNMYALWALGRSLEPFLGR
FT                   ARFLAAYLMSGLGGGALFCLMATADGGRAILPNVDDGVVGASGAIFGLFGVLLIVQRRL
FT                   GASTRELWVVLAINAALLLFISGIAWQAHLGGFLVGMMCGVIFFEDPKRIQAGKSARTW
FT                   PRMALLLFTMVAALVVKYLVI"
FT   gene            complement(337947..338501)
FT                   /locus_tag="PPA0288"
FT   CDS_pept        complement(337947..338501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0288"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82046"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB20"
FT                   /protein_id="AAT82046.1"
FT                   /translation="MLSLAQGDETGEVLIDANRFDLLEELILAEPLRHGQPVVLIDGRS
FT                   GAGKTTLANTLICHHADWQLVHADDLYPGWSGLSAVWDLRDLVARRRYRRWDWYQNRFD
FT                   DEVILNANRPLVIEGCGVLTPTNAPLASLRVWCEVSAPLRRHRALARDPEFRDQWAMWA
FT                   VQEGLHIARHRPADLADLTIS"
FT   gene            complement(338575..339231)
FT                   /locus_tag="PPA0289"
FT   CDS_pept        complement(338575..339231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0289"
FT                   /product="putative two component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82047"
FT                   /db_xref="GOA:Q6AB19"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB19"
FT                   /protein_id="AAT82047.1"
FT                   /translation="MLPVRVLLVDDDTLVRRAVRQILEAADDLEVVGEASDGDGAVRQA
FT                   PQADVVLMDLRMPGMSGVEATSRITHSPSSPKVVVLTTVTADAAITDAVHAGASGFLLK
FT                   ASSPDDIVNAVRAVHAGDAFMSPTSTRQLLEQLRGDAGRRVRGAARKTLSALTDREREV
FT                   AIAVAEGLTNDAIAARLNVSASTVKAHLSTIQTKLDVDSRVRIAVLVERAGYLAA"
FT   gene            complement(339311..340543)
FT                   /locus_tag="PPA0290"
FT   CDS_pept        complement(339311..340543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0290"
FT                   /product="putative two-component sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82048"
FT                   /db_xref="GOA:Q6AB18"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB18"
FT                   /protein_id="AAT82048.1"
FT                   /translation="MIEYEVVGDDRRPAVWLSIVLIAIGILGCFTSTAFCPLALRMTAQ
FT                   NPSGLTVLHGVAALVADMVLPVWLLWRHRQPFTITLVTAAISLVLPIGNTVPLIALACL
FT                   LGRRRGAASWWATAAVTITTTIVGIVDAARSPKAASTIKTLLSPANTPDAADLTVSWFT
FT                   VAAFIAAGLIISIGSGLWRRTQRATTSLTRERDVAQATNAKLGDELSRREERERIAQEI
FT                   HDQLGHRLSLLSLQSGALETQLRDNPDVVKAAHEVQAGAAAAVNDLHSLLSVLTESRVT
FT                   PDLPLSKLAEVIDESFGAGQPLNSSVFIEDADRVDPAVSRAVYRIVQELLTNAAKHAPG
FT                   QTTTLRIRGNPRDGISIDATNGYIGGWAGGPSAHSRGLRGITERVELLGGSLHYGLDDN
FT                   LFHVHVDIPWQ"
FT   gene            340694..341314
FT                   /locus_tag="PPA0291"
FT   CDS_pept        340694..341314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82049"
FT                   /db_xref="GOA:Q6AB17"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB17"
FT                   /protein_id="AAT82049.1"
FT                   /translation="MSNDQQPPHYPQPQYPGEGPQSQSNPQYALNSGGMPPSKPKKPIY
FT                   KRVWFWIVIAVVILGIFAALGGGSKGGDEQKSGSDKAASAPATSQAKEADKSAGKPAEK
FT                   PAAKTTDEDQVKGDLALLKGWKLKKDEFSAHVTGYVRNNSDESINNYIQIEFNAYDASG
FT                   SNTDTCLANTNTIDAHGKWKFDAICSQNPSEIKTVKLKDLTGA"
FT   gene            complement(341497..342408)
FT                   /locus_tag="PPA0292"
FT   CDS_pept        complement(341497..342408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0292"
FT                   /product="conserved protein"
FT                   /note="PRD domain"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82050"
FT                   /db_xref="GOA:Q6AB16"
FT                   /db_xref="InterPro:IPR004341"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="InterPro:IPR036650"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB16"
FT                   /protein_id="AAT82050.1"
FT                   /translation="MQRPDRSRYATTKQGSLRPGHVIVKKIYNNNVLLGVNGSGTEMVV
FT                   NARGIAYGRHRGEIVDASSAQRYVAEGAYRTTAIASLLTNATHTEVRVAQAIVELAREE
FT                   LGTPHARRMMLPILDHLVAAVHRAKQGAVIDFPLEWEVRQLYPDEAELGRRAVEIVDGA
FT                   LGIHLQPEEWVAFSLHFINQRWDSKDVSRTMSMTQTICDVFTELEDLWHVEIDRSSMSA
FT                   SRFVTHLRYLFARASDNKQLSHVDLDIVGLMSDRYPEATLAASQVAEHMSKVIGNDLTK
FT                   AEINYIALHTTRLYNEVMRMDG"
FT   gene            complement(342413..342886)
FT                   /locus_tag="PPA0293"
FT   CDS_pept        complement(342413..342886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0293"
FT                   /product="PTS system, glucose/sucrose specific IIA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82051"
FT                   /db_xref="GOA:Q6AB15"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB15"
FT                   /protein_id="AAT82051.1"
FT                   /translation="MSIFRKRRKATPLTIAAPVSGEIIDIADVPDPVFAGKHMGPGFAV
FT                   APVSGDFTSPIDGIVILVAPTLHAVGLRADNGAEVLVHVGVDTVELKGEGFTAHVNEGD
FT                   RVRTGDPLLSVDLDSIRPRVPSLISPVVVTNAAGFTISERSNDPASVLSVTAG"
FT   gene            complement(342898..344577)
FT                   /locus_tag="PPA0294"
FT   CDS_pept        complement(342898..344577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0294"
FT                   /product="PTS system sugar-specific EII component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82052"
FT                   /db_xref="GOA:Q6AB14"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB14"
FT                   /protein_id="AAT82052.1"
FT                   /translation="MPTRSATLRQSCPPEPTSLPLVAQSPVPPTSAPTSSTRFAPASPT
FT                   RRWRTDMFKTLQKIGKAFMLPIAILPAAGLLLGIGGALSNPTTVKSYPVLDNPILQDIF
FT                   QVMSAAGNVIFENLALLLSIGLCIGLAKRDKGTAALAGITGFLVMTATTKALVVLSRHP
FT                   DRTIDTGVVGSLVIGAIAVWLHNRYHNIELPAFLGFFGGSRFVPIVTAFAGIIIGAFFF
FT                   VVWPPIQAGMVSAGTAIADWGVIGTFFYGFLMRLAGAVGLHHMIYPMFWYTPLGGTEAV
FT                   AGKTVVGAQKIFFAQLADPNHVGLFTHSTKYFAGRFATMMFGLPGACLAMWRCVPKGRR
FT                   AKYTGLFASVAFTSFLTGITEPIEYMFLFVAPLLYVFHSVLDGVSFLVADLINIRIGNT
FT                   FSGGAIDYLLFGVLQGEAKTHWLYVLPVGALWFVIYYFSFTFFIKKFRIATPGHLEDTM
FT                   TAATPTDRRSQEKSERRNDGIDETAAEIITALGGAENIEDVDACITRLRVSVKAPDQVS
FT                   KASLKNLGATEVFEVGGGVQAVYGAKAILYKNAINAQLGIDD"
FT   gene            complement(345249..346568)
FT                   /locus_tag="PPA0295"
FT   CDS_pept        complement(345249..346568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0295"
FT                   /product="putative sugar transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82053"
FT                   /db_xref="GOA:Q6AB13"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB13"
FT                   /protein_id="AAT82053.1"
FT                   /translation="MAINSVNNLETTDKADASKPPAKRWVYVIPVAVIMYMLAYLDRTN
FT                   TAMILPYINSDTSSQIHLTKADEGIVSGIFFFGYMFLQIPAAILAERWSAKKTVAILMF
FT                   LWGFAAMAVSFVQSNGQFYTARFVLGFFEGGVWPSVLILIANWFPLKERARANSLWMCC
FT                   LPLSSVLISPITGALLDHFSWRTVLFVEGIPPLIWAIVWLLVVSDHPHNAKWASDAERE
FT                   YIEAELTADEANKPIIDGDGGYLAAARSAHVWQLITIYLCFMGGFYGYTLWLPTVVKGL
FT                   MSGSSASSVGLVTAIPYIFAVVGMLAVSSWSDHTGNRRVAIAVPLAIGAVALTIGQVVH
FT                   HPIVNIVLLVIVAIGVYSPYGPYWAVPGAYLRIEVLAGGLGLINALGNLGGFVGPYLVG
FT                   WLTDVTGSAATGYYALAGLLVVGAVLTWVVVKPKITPTTP"
FT   gene            complement(346613..347653)
FT                   /locus_tag="PPA0296"
FT   CDS_pept        complement(346613..347653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0296"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase 2"
FT                   /EC_number="1.1.1.262"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82054"
FT                   /db_xref="GOA:Q6AB12"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AB12"
FT                   /protein_id="AAT82054.1"
FT                   /translation="MPKTPLLGITEGDPAGIGPEITVQAIHNMADDRSFIPIVYGDPAI
FT                   ISRACSVTGLSETVRRVTSEEHIEPESNVINVVDTGTVPHADSIEWGSVQELAGRAAIA
FT                   SIEAATDAALSGKTDGVVTSPINKEAIWKTGSEFLGHTEMLGSLCGTPDTDTMFVVSGL
FT                   KIFFATRHMSLREAVDSIRRDLIDHEIHKALRALKVFGCNSPKLAVAALNPHAGEGGHF
FT                   GTEEIEVLRPAVKSACAEGHNVVGPVPADSVFHKGVIREYDGVLSLYHDQGHIASKTLD
FT                   FDGTVSVTAGLPILRTSVDHGTAFDIAGQGAASPMTMQSALHVASDFARFVPVIREEYL
FT                   PSTGRN"
FT   gene            complement(347729..349000)
FT                   /locus_tag="PPA0298"
FT   CDS_pept        complement(347729..349000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0298"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82055"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB11"
FT                   /protein_id="AAT82055.1"
FT                   /translation="MSEILVIGDDLTGTNATASAYARDGLRAVTMLDPTAPVDLDDSIQ
FT                   VIACSTGSRHMTPARAAQTVDAIVRNFGYDVRAIVKRFDTTLRGNIGAEIEATLTATRA
FT                   MHPERRICGLVVPGFPAAHRTTVGGYQLLDGEPILMGPASRDPFTPVRHSGVAGIIHEQ
FT                   TQLTTTNIGLDVVMGDTSTLADRLTRAAQDAELVIVDSVTDDDQQRIATAASALESDER
FT                   SWVVFESGPFGATYAHALGIRPHVDRANPILALIGSPTELTKLQSDRLESQSGVDLITV
FT                   DDPASDVSQLLSRLRASAEIGKTVIGIRTTSRDGSAPDPLHASQMLALIIDLAVECADS
FT                   MQFDGIYASGGDVAFAVLDALGARGYEVENEVVPLAVSGKLVGGPHDGLGFATKGGLVG
FT                   DADAAVECINQLRSRIRQSEPRIV"
FT   gene            complement(349234..350163)
FT                   /locus_tag="PPA0299"
FT   CDS_pept        complement(349234..350163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0299"
FT                   /product="putative regulatory protein, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82056"
FT                   /db_xref="GOA:Q6AB10"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB10"
FT                   /protein_id="AAT82056.1"
FT                   /translation="MDRPPKQTESSSDAAGLSLEAVLKLDQPNHVTDQDTMSTTPKQPR
FT                   TATAARRRHIVDHLRSLGHSESIGDLSQLFGVSTSTIRRDVDALSDESKIWKISGGDVM
FT                   IRRHEPTWHEKEQCEHVSKAAMATYAAKHLVNESDLVLLDSGTSTAALGRLLSTRNDIT
FT                   ILVGGLSVLQAVAEGTANVMVLGGALRQHSGSLLGPWASSNLRSITPDVAFIGCDAVSA
FT                   TDGLNCPLLESVEFKHEAMTRARTSWILADPTKILTTGSEPYWASIPPRTGIVTVQSSN
FT                   SELSEKLGAFRRSGHHVIQAPLQPADTD"
FT   gene            complement(350176..351051)
FT                   /locus_tag="PPA0300"
FT   CDS_pept        complement(350176..351051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0300"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82057"
FT                   /db_xref="GOA:Q6AB09"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB09"
FT                   /protein_id="AAT82057.1"
FT                   /translation="MPDTGLTSHVIEAICAWFDANGRDLPWRRPGTSAWGVLVSEVMSQ
FT                   QTPMSRVIGPWHEWMNRWPTPDDLAEEDSGEAVAAWGRLGYPRRALRLHSCAVTIATEH
FT                   DGVVPNSYDELVALPGIGDYTASAVVSFAFGGRATVLDTNVRRLIARAESGIANCPTSV
FT                   TRAERIVADALVPDEDARAAKWAVASMELGALVCTARSPQCEVCPIRDGCRWVIDGRPD
FT                   NAPARRGQPWKGTDRQCRGVIMDVVRNSPHGVKVQMALSAWPELDQASRCLESLLDDGL
FT                   VHRRGNLISL"
FT   gene            complement(351044..352354)
FT                   /locus_tag="PPA0301"
FT   CDS_pept        complement(351044..352354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0301"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase, HemL"
FT                   /EC_number="5.4.3.8"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82058"
FT                   /db_xref="GOA:Q6AB08"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AB08"
FT                   /protein_id="AAT82058.1"
FT                   /translation="MTSNAELFSAAQAVIPGGVDSPVRAYGSVGGVPRFIEKAQGPWIW
FT                   DAEGTRYVDLVCTWGPALLGHARPEVVSAVQVAASKGLSFGAPTRTETELADAIIERMA
FT                   PVEKVRFVSTGTEATMTAVRLARGATGRDVIVKFAGNYHGHSDVLLAAAGSGVATAGLP
FT                   GSAGVPAASTADTIVVDYNDVAALDAVFSERGDQIAAVIVESCPANMGVVPPEPGFNAA
FT                   IRRLTTEHGALMITDEVLTGFRCSPSGFWGLQQQAGEDFAPDIFTFGKVVGGGMPLAAL
FT                   GGHADVMDLLAPTGPVYQAGTLSGNPLATVAGVKTLQLADAEVYQRLDVRSEKWRNELE
FT                   SALDAAGVTYRLQNAGNLFSVFLGVDSPVRNYDNAKSQNAEAYTAFFHAMLDAGVNLPP
FT                   SCFEAWFLSDAHDDEAFEVFRAALPRAAQAAAQVISA"
FT   gene            complement(352402..353448)
FT                   /locus_tag="PPA0302"
FT   CDS_pept        complement(352402..353448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0302"
FT                   /product="delta-aminolevulinic acid dehydratase, HemB"
FT                   /EC_number="4.2.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82059"
FT                   /db_xref="GOA:Q6AB07"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB07"
FT                   /protein_id="AAT82059.1"
FT                   /translation="MNPYLPDASDPRMAGVKPLPEGLRPVSRPRRLRTTPAMRRMVAET
FT                   RVAPAQLMLPAFVKEGIDSPVEITSLPGQFQHSTESIKELATQAAEAGIGGIDLFGIPE
FT                   HKDEIGSQAWDLKGILNAGISAVREAVGDDLVICADTCLDEFTDHGHCGALTPDGRVDN
FT                   DSTVPLYAAMAVSQARAGAHMVSPSGMMDGQIAVIRDTLDREGFTDVSIMAYSAKYASA
FT                   FFGPFRDAVNCSLKGDRKTYQQDPPNRREGLRETLLDLAEGADLVMVKPASHYLDVLSD
FT                   VAEVSQVPVAAYQVSGEYAMLEAAAANGWIDRRRCIGESLTSIVRAGADLVLTYWAIEA
FT                   AQMFREDL"
FT   gene            complement(353478..354203)
FT                   /locus_tag="PPA0303"
FT   CDS_pept        complement(353478..354203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0303"
FT                   /product="uroporphyrinogen-III synthase, HemD"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82060"
FT                   /db_xref="GOA:Q6AB06"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB06"
FT                   /protein_id="AAT82060.1"
FT                   /translation="MTTNPADLVKPPVVVPRDDSHDKFVTTLKQAGYGVIHTALTRTVT
FT                   LPDAERLTAPDLWQADWLVVTSKTTVGLLPTPLPNPNIKVAAVGAATSAALRTRGIDVD
FT                   FVPENHSGAGLVAEWPGGVANILLPASQLTADTVPLGLTKVGCTVNRLEIYTTAAVEKL
FT                   PEVIAQSWPSVGVVVVTASSVGRALVELVEPLGWRRQKLVALGKPTARTLEVLGHPAHA
FT                   VASSPTPEAVLEAVESLVA"
FT   gene            complement(354200..355300)
FT                   /locus_tag="PPA0304"
FT   CDS_pept        complement(354200..355300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0304"
FT                   /product="porphobilinogen deaminase, HemC"
FT                   /EC_number="2.5.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82061"
FT                   /db_xref="GOA:Q6AB05"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AB05"
FT                   /protein_id="AAT82061.1"
FT                   /translation="MPLWCRRPAELSVNLSDCRLESASVLSATIGNMSAIRLGTRASTL
FT                   ATTQSEMVAGLLRSEGLDVNLTTITTHGDTSTASLAAMGGIGVFASAIRAALLEGEADI
FT                   AVHSFKDLPTGRPLGLAIGAVPARADPRDALVARDGLTLHDLPQEASVGTGSPRRAAQL
FT                   LAVRPDLTIVDIRGNVDTRLGRVKGLGRYAKNGGKEDLDAVVLAASGLARLGHSGAVTE
FT                   FLDPSVVLPAPAQGALAVECRTADSRHGKLAKALARIDDRRTRLAATAERAVLSHLEAG
FT                   CAAPIGALAQLKPVSGKSLQVLTLDVVVAAVDGSRTVREQVSVELPAEVEPALAAAHTL
FT                   GVTAAEELLDDGAADVADLKASGSTR"
FT   gene            complement(355251..356699)
FT                   /locus_tag="PPA0305"
FT   CDS_pept        complement(355251..356699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0305"
FT                   /product="putative protoporphyrinogen oxidase, HemY"
FT                   /EC_number="1.3.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82062"
FT                   /db_xref="GOA:Q6AB04"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB04"
FT                   /protein_id="AAT82062.1"
FT                   /translation="MSRVATMNISDPQHVDAVVIGGGMAGLVAAWQFTQEGLHPVLVES
FT                   RGYTGGLIARSTLAGISYDIGAEGWAVRLPDTAELATELGLTVEKPTIAPSWVYFDDAC
FT                   FAMPDNAILGIPANLSDPAVIIALGAEEAARAAELDRAPMPEDLPRDLGTLVASRMGSE
FT                   VLRRLVTPIAGGIHAADPHLLSVDVVSPGLRAAAQATGSLAAGVALCRSRMPAGPAVAS
FT                   VAGGMFIMPAELRRQAEQAGATTMTRVGARGLTRHGDQWLVETAGTSRNPDPSLPPVTD
FT                   GEIRSFLTPRVVVACSAGPATKLLSNVIDTVGPELAPGAPIGHVNLALQAPALDSSPRG
FT                   NGMLVAPGTTTVTAKALTHMSAKWPSLRESCPEGLHLLRVSYGRSGEANVALSVDQALT
FT                   DASVLLGVDLSAEQVVDSQIIHWTGSLAPTTPQARAWRDGLHRQLEVLNQSGQGRIGLV
FT                   GSWASGSGIAALVPQARRTVRQLV"
FT   gene            complement(356696..357976)
FT                   /locus_tag="PPA0306"
FT   CDS_pept        complement(356696..357976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0306"
FT                   /product="uroporphyrinogen decarboxylase, HemE"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82063"
FT                   /db_xref="GOA:Q6AB03"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB03"
FT                   /protein_id="AAT82063.1"
FT                   /translation="MIGQCQAKSVNLRGRLGNDAKPLLGMIHGQDTQSHEALFNHAVTT
FT                   NPSTYEAHNSPNNRPVGGICTWWGTIGVMTETTTFMADSPLLQAMTGHRPTVTPVWFMR
FT                   QAGRSLPEYREAREGTTMLESCLNPELAAEITCQPVRRHHVDGAVLYSDIMVPLALAGA
FT                   EVRIEPGVGPVLDEPVRTASDVDRITRRHVEDPSVIEEAARLAITELGDATPLIGFAGA
FT                   PFTIAAYLVEGGPSRDHLSARAMMHSDPQTWARLMEWVADLDAAFLAAQLRGGARAFQL
FT                   FDSWAGSLSASDYRASVAPFSQRALATVDPNIPVVHFGINATHLLSEFAQVAATASRYP
FT                   VLGVDHRISLDEACATLMVSGMEMPVQGNIDPALLFAGWEPLESATRDIVAAGRQAPGH
FT                   VVNLGHGVPSNTDPNVLTRLVELVHSL"
FT   gene            357887..359221
FT                   /locus_tag="PPA0307"
FT   CDS_pept        357887..359221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0307"
FT                   /product="glutamyl-tRNA reductase, HemA"
FT                   /EC_number="1.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82064"
FT                   /db_xref="GOA:Q6AB02"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AB02"
FT                   /protein_id="AAT82064.1"
FT                   /translation="MTVDHAEQGLGVVSEAAAQVDGLGLALTDHPQIRGALVLSTCNRV
FT                   CLIVETSPEAVAQGFDEAALRRCIADHGANVLAESAQLVCENDAVWRLFRVAAGMESMV
FT                   FGEREVAGQMKRALSEARREQTVSYTIGHVVEEALKTSRHVATETALAAEGRTVVAVGL
FT                   DLVAQRMDLDGARVLVMGTGSYAGASCAQLSSRGVAEIQVHSASGRAAGFARRHRVSEA
FT                   LDIDAALAQADLVVTCRGSGVPALSAEAARRAVDARRGRDLMVLDLAISGDVEEPVPAG
FT                   VEVIDLETIRQAVPASAEAERAAAEHIIATGVRHFAVDLERRRMAPAVVALRDVISDLV
FT                   TAELERLPEEGSVPVDEVAASLRRLAASMAHIPSARARMASEQGLGDRWLNSLSDVLGI
FT                   DVDIAAPVIDMSSFANADCMTCPVTGLRVEDLATDAAPRGEERTS"
FT   gene            359218..361269
FT                   /locus_tag="PPA0308"
FT   CDS_pept        359218..361269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0308"
FT                   /product="ferrochelatase, HemH"
FT                   /EC_number="4.99.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82065"
FT                   /db_xref="GOA:Q6AB01"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR010644"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB01"
FT                   /protein_id="AAT82065.1"
FT                   /translation="MTANPYAAPTDPLAPYSAVLVVSFGGPRSPEEVMPFLRRVSHGRI
FT                   PEERLADVARHYDRFGGVSPINDATDVFVNAIGNELRRHGVRVPVLLGNRNGTPFLEEA
FT                   LTDMHAHGVRRVLAVVTSAYASYSGCRQYREEIATALAHAGITDMQVDKVPPFNEAPGF
FT                   IRANAEALMQAFMRIPPTPLEATRVVFVTHSIPDSMQDASGAGQPGTDYISQHKAVCER
FT                   VAGQVRQVFGNMPQWDLAYCSRSGRPSDPWLEPDIIDHLRSLPEQGVQSVVVAPIGFVA
FT                   DHMEVVNDLDYEAAEAAKESGLAFTRAATAGTHSAFIADLAGLILSQAAAARGEGGNLT
FT                   SWPAPCVAGCCRRYPDAQDIPAVSGGDVESVAAGADVVDAEPGGVDFVPSGSASAVDRP
FT                   GPEAVELETPPSPYNPLTKETPMSDHSSADSVIEGPRDDEVPAGSYTAPTDPRDTPVIP
FT                   EEVNASSKWAMYSVFRVATALPAEDDERRRLVEGSDEWAGQSGVDTRGWYDLSGLRANA
FT                   DLLVWWVSDDPAVLQDAYHRFRASGLGRHLEPVWSNVGVHRPAEFNKSHLPSCFAGIAP
FT                   RRWAAFYPFIRSKEWYLLPAADRSRMLREHGIVGAASSDVKASTLAAFALGDYEWILAL
FT                   EGDDLARIVDVMKDLRYVEARRYVDVDTPFFTGERVSPVVWADRQMRA"
FT   gene            361341..361973
FT                   /locus_tag="PPA0310"
FT   CDS_pept        361341..361973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82066"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB00"
FT                   /protein_id="AAT82066.1"
FT                   /translation="MLLVVVVVVVALVIAGIAKLAGGSKESAAPAASSFTPDPSWTDTA
FT                   WASATPSASSSAVSPSRSAPRTESPSPSALASTPSASSTMCEGSQLSVKVTGDTKKPHV
FT                   GDTETFTVEVSSSTSCHWDTQKVKQTLTVTSGSDRIWSTDDCGSWGPKGVHEIKSKNPW
FT                   TYKISWPTKRSTGKCKLSQESLGAGYYVATVNLGGGPSGRFVMRMGT"
FT   gene            complement(362009..363043)
FT                   /locus_tag="PPA0311"
FT   CDS_pept        complement(362009..363043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0311"
FT                   /product="conserved protein"
FT                   /note="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82067"
FT                   /db_xref="GOA:Q6AAZ9"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AAZ9"
FT                   /protein_id="AAT82067.1"
FT                   /translation="MALLAPGTPIREGLDRIVNGRTGGLIVLGDGPEINGVCSGGFPLD
FT                   VRLTPQALRELSKMDGGLVVSSDHERIKAAAVHFVPDGSLPTLETGTRHRTADRLSQQT
FT                   GVPVVVVSASMSVMSLFLNGRRYLIERPEQLLARANQALATLASYRGRLVDEAENLTTL
FT                   EIRDQVQVRDVAAVAQRVEMWRRIDAEVRGYVSALGVEGRLVQLQRNELSLGVEDLGRL
FT                   LTDDYRPNSVAPGGFSLSGLQKLSWEDLLNVTMVAETINLGPAEHPLDSPIRARGHRQL
FT                   TLMTDLSSRTIQRIIDHFSDLQSLVSASTSELGDIKGVGLRRAREIRQGLESIFEGDQR
FT                   THHH"
FT   gene            complement(363162..364559)
FT                   /locus_tag="PPA0312"
FT   CDS_pept        complement(363162..364559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0312"
FT                   /product="putative DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82068"
FT                   /db_xref="GOA:Q6AAZ8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAZ8"
FT                   /protein_id="AAT82068.1"
FT                   /translation="MARKTQTPTWVCTECGWTTTKWVGRCGECQTWGSVVEKGAPKLTE
FT                   VTSSTPTSKAVPIGQVSEQAANRHLTGISELDRVLGGGLVPGVVVLLAGEPGVGKSTLL
FT                   LDVAAKWAKAGRRTLYVTGEESAAQVRLRAGRTKSLADELYLASETDLGTVLGHIEQTE
FT                   PSLMVLDSVQTVGTSQADGSPGGVSQVREVTGALVRVAKRRGMAVIIVGHVTKEGSIAG
FT                   PRTMEHLVDVVLNFEGDRHSGFRMVRATKNRYGPADEVGCFEMTDAGIMEVPDPSGLFT
FT                   SDNADPQPGTCVTVTIEGRRPLLSEVQALVAPSASEKYPRRITHGVEGGRVAMILAVLE
FT                   RKAGLPLSNRDVYVSTVGGARVSDPSADLAIAVSVASAVLDTNFPTRVVALGEVGLAGD
FT                   LRRVPGLERRVGEAARLGFDLAVVPRNSREAHTKIPTMHGLHVIEVGSVAEALSVLNLR
FT                   RQRKVNQ"
FT   gene            complement(364625..366271)
FT                   /locus_tag="PPA0313"
FT   CDS_pept        complement(364625..366271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0313"
FT                   /product="putative malate oxidoreductase"
FT                   /EC_number="1.1.1.38"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82069"
FT                   /db_xref="GOA:Q6AAZ7"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAZ7"
FT                   /protein_id="AAT82069.1"
FT                   /translation="MSRKPEPMTNPITNRGTAFTRAERLEHGMIGRLPAAVETLEQQAQ
FT                   RCYRQLQGLGCNIDRYVFLEELQNRNETLYYKLLVDHLVELLPVIYDPTVGEAIKKWSH
FT                   AYRRSRAVYLSVDHIEDVRPSFETLELGPDDVDLLVVSDSEQILGIGDWGVNGTDISIG
FT                   KLAVYTAAAGIRPERTIAVNLDVGTDNAYLLNDPSYLGNRHARVRGERYDELIHEYLEV
FT                   ASELYPHALLHFEDFGASNARRILVQNAANHRIFNDDMQGTAAIVLAAVISGLKVTRQS
FT                   FADQRLIVYGAGTAGTGIADQIRAAMISDGLSQQEAVDRIWLVDRNGLVTDDMKGLPDY
FT                   QEPYAKPVEKTRHWAHTNRHIGLTETIRRIHPTILIGTSTDHDAFTQQVVEEMCREVER
FT                   PIIMPLSNPTEKIEAMPADVIAWSKGKALVSVGIPVAPFHYEGTRYEIGQGNNALLYPG
FT                   LGLGVIVSGAERVSARMIRAAAEAVASQVDPRPAGSSLLPAVENLRASSATVAVAVVQA
FT                   AIEEGLATKKPSNVVQAVQDAMWWPHYPPVG"
FT   gene            complement(366335..366973)
FT                   /locus_tag="PPA0314"
FT   CDS_pept        complement(366335..366973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0314"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82070"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAZ6"
FT                   /protein_id="AAT82070.1"
FT                   /translation="MHVDHLMFAAGPAGLDEDAARLGEILGTSFINGGVHPSFGTRNRI
FT                   LPLSGPRYIEIVEVLDHPAAEKAVFGQAVRARQEQGGGWMGWAVSVDDLAPYEKRLERQ
FT                   SVPGKRTFPDGRHLEWRQIGIKGLMADPQLPFFIKWTSPTELLPSSLSGNVTLTSVEMS
FT                   GSRQRVEDWLGETIPDEVEGITFNFASPNGHPGIDAVTFDTPSRGCVRI"
FT   gene            367125..368012
FT                   /locus_tag="PPA0315"
FT   CDS_pept        367125..368012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0315"
FT                   /product="putative AP endonuclease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82071"
FT                   /db_xref="GOA:Q6AAZ5"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAZ5"
FT                   /protein_id="AAT82071.1"
FT                   /translation="MPDCFGLSETTTTSASVAPRVTLSTTSVYPESTADAFARAKAIGY
FT                   DGVELMVGIDPVAADVDRIVDLSAEYGVTVSSIHAPCLLVTPNVWGSDPWGKLDNAAEA
FT                   AGRLGSKLIVVHPPFRWQRDYAGRFEEGIAKFNEKYFPLVFAVENMYPWRTPAGRFAAY
FT                   SPGFDPTNLSYDHLVLDLSHAATAQMNSRTLVDLWGSRLRHIHLTDGSGTFKDEHLLPG
FT                   QGNQHAWEVIERAVTGGFDGDIVLEVNTRKFSGEGAGQGARFEALSETLTQTRLAIDRG
FT                   IFARRSGQAWEGAR"
FT   gene            368075..368971
FT                   /locus_tag="PPA0316"
FT   CDS_pept        368075..368971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0316"
FT                   /product="putative proline dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82072"
FT                   /db_xref="GOA:Q6AAZ4"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR008219"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAZ4"
FT                   /protein_id="AAT82072.1"
FT                   /translation="MRLAMDPTIAHKVSRSRIAREIAVTYVAGEDVASAVDKAADQVSK
FT                   GLDVSLHPLDPDPADLAQARRAMVRLCGVIERLGADPSFNGHAEVSISLAALGLKVSDD
FT                   LARDHARQVCQVARDNHVAVTVDDEGPDIHDRSHRIVMDLLSEYENTGIVIQAARHDSL
FT                   MQVRELAAPGRRIRLCKGSYTGPRSVTLIRPHDVDLRMAACLRALMTGPSTVMLASHDP
FT                   VFVALGEQLMASLDRQLEFQMLQGIRPLEQRRLVDIGHRMRVYLPYGHDWYRYCTRRIV
FT                   ERPGNIWLFGRSLVERR"
FT   gene            368971..369807
FT                   /locus_tag="PPA0317"
FT   CDS_pept        368971..369807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0317"
FT                   /product="conserved protein, putative protease"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82073"
FT                   /db_xref="GOA:Q6AAZ3"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAZ3"
FT                   /protein_id="AAT82073.1"
FT                   /translation="MMRNNTSTLGPRRCLDERPRRGMMRDRAADRRLLWETMFVLAVSL
FT                   GQSAWYSILRMIERLTRGVPMNQQTSTLNSSVTPGRPWLDLLYQLSDIAFGVVPALLAV
FT                   LLLAQVKPPRQGVRRALGLEAPGWGRDVGAGAMLAAIIGIPGLGFYWAAHALGFNTTVR
FT                   AADLQHVWWTAPVLIGLAGMNAVLEETVMIGYLFTRWGQIGWSTTMVIVTSAIIRGTYH
FT                   LYQGWGDFIGNIVMGLFLGWVFSRRCRLLPLIVAHAFLDIVSFLGYAYLAGRVSWL"
FT   gene            369582..370895
FT                   /locus_tag="PPA0318"
FT   CDS_pept        369582..370895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0318"
FT                   /product="semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82074"
FT                   /db_xref="GOA:Q6AAZ2"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAZ2"
FT                   /protein_id="AAT82074.1"
FT                   /translation="MVDDDGYRHLGHHPRHLPPLPGLGRLHRQHRHGPIPGLGFLSSLS
FT                   ALTPHRGARLPRHCLLPGIRLSGWSRQLVIRQFGHSPNLSSPARTMGIMKLGVFGATGQ
FT                   VGRVMRTLLAERHFPADEVRFFASARSAGQKLSWNNGSGDSEVVVEDTATADFAGLDIA
FT                   IFSAGGGTSREFAPRVAAAGAVVIDNSSAWRRDPDVPLVVSEVNPEDVAKRPKGIIANP
FT                   NCTTMAAMPVLKPLHDAAGLTRLVVATYQAVSGSGVAGVRALTDQTTAIDDPAGLALDG
FT                   RGVPVADLGPYVAPIAFNALPVAGNFVDDGSGETDEEQKLRNESRKILHIPDLLVAGTC
FT                   VRIPVYSGHGLVVHAEFRESLSPEKATELLTQAPGVRVVDVPDPRSAAGIDPSLVGRIR
FT                   ADQSAPAGKGLVFFCAADNLRKGAALNAVQLAELVAAE"
FT   gene            370892..371683
FT                   /locus_tag="PPA0319"
FT   CDS_pept        370892..371683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0319"
FT                   /product="putative delta-1-pyrroline-5-carboxylate
FT                   reductase"
FT                   /EC_number="1.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82075"
FT                   /db_xref="GOA:Q6AAZ1"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAZ1"
FT                   /protein_id="AAT82075.1"
FT                   /translation="MSGKIAVLGCGTMAGALVGGLIDAGQMKAEDVVATARSASHRDEI
FT                   ANTLGVTTSGDNTTAVRDADLVILGVKPYAAVDVLEEVSGALKADAVVVSIAAGVTTEK
FT                   LLMAWQGKIVRVMPNTPVRVGKGAFIVSSAPGSEDAAKKVGDLLESVGVVVTVPEELHN
FT                   AATAVSGSGPAYVFLVAEAMIDAAVALGVPRDQASQLTVATLAGSAELLAGGEHPAVLR
FT                   SKVTSPGGTTAAAVAALEAGGVRSVFADAMTACRDRAAGLS"
FT   gene            371819..371920
FT                   /locus_tag="PPA0320"
FT   CDS_pept        371819..371920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82076"
FT                   /db_xref="InterPro:IPR013177"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAZ0"
FT                   /protein_id="AAT82076.1"
FT                   /translation="MGSVIKKRRKRMAKKKHRKLLKKTRIQRRRAGK"
FT   gene            371940..372281
FT                   /locus_tag="PPA0321"
FT   CDS_pept        371940..372281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0321"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82077"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAY9"
FT                   /protein_id="AAT82077.1"
FT                   /translation="MWRHQHGMAALRSGELRPLDPLVEGRVIIVTRQGCHLCDEVIGLV
FT                   ARLRQEHRDLVPEPMIVDVDANEDFRSRWGDHVPVIFVDGTLISYWTLDADTFLSALRD
FT                   GPSLPAVLP"
FT   gene            372405..374120
FT                   /locus_tag="PPA0323"
FT   CDS_pept        372405..374120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0323"
FT                   /product="uroporphyrinogen-III synthase, HemD"
FT                   /EC_number="2.1.1.107"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82078"
FT                   /db_xref="GOA:Q6AAY8"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAY8"
FT                   /protein_id="AAT82078.1"
FT                   /translation="MTDEAHQPTPQPAGDLGTASSQARVQFVGTGPGDPNLLTLGAVDA
FT                   INRAQVIVISCAEHRMLLGSDFLGLRPDVRIVLAGGVDEEAAVLPSQPGTGAPTPVDVD
FT                   EHCADVTATVIDAASQGLEVVRLVSGDPFLDGDIGAEAAAVARADYDVDVVPGVTGMTA
FT                   VPEYAGLTLHGHDVQLIGDAACQRDIAGHGSNWSDQGLVVVNTEAGKLKEVVKHAIESG
FT                   RGEDEPAALICHGATTQQTTHTVTLGELPQTAKTARLGDAEPVHVAIGKVVEAPEREQL
FT                   DWYESKPLFGWNILIPRTRDHSATLPSRLQSYGAHSLDVPTISMEPPRTPQQMDKAIRG
FT                   LVEGRYEWVVFTSANAVRAVSEKLEQIGLDARAYSGLRIAAIFDSTINALAEWGVRPDF
FT                   VPSGEQSTRALAAVFPAFDEALDPINRVFVPRADIATESLSADLSELGWEVEDVVGYRT
FT                   VRAAPPPAETREAIKTGKFDAVVFTSSTTVRNLVGIAGKPHKHTVVAAVGMRTAETCRE
FT                   HGLTVDVIAPEPTALSLADALADFAAKRRDDMVAKGLPVVRPSQRKRRGRHPSR"
FT   gene            374191..374859
FT                   /locus_tag="PPA0324"
FT   CDS_pept        374191..374859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0324"
FT                   /product="putative phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82079"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAY7"
FT                   /protein_id="AAT82079.1"
FT                   /translation="MGATTTVHLLRHGEVDNPTGVLYGCMAGYHLSPLGRRMAARAAEH
FT                   FAGAELSALVSSPLERARETMAPIAALHPGLEVRIDSDVIEAANVFEGQVFGKGNKALR
FT                   SPRNWRYLSNPLTPSWGEPYVEIAERMTRAIMRAAEEVPAGGQALIVSHQLPIWIARCA
FT                   AEGRRLPHDPRFRKCTLASVTSFGVLHGRIVRVDYCEPARDLIPAKDRRANISAGGAQG
FT                   "
FT   gene            374856..375425
FT                   /locus_tag="PPA0325"
FT   CDS_pept        374856..375425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0325"
FT                   /product="conserved protein"
FT                   /note="putative thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82080"
FT                   /db_xref="GOA:Q6AAY6"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAY6"
FT                   /protein_id="AAT82080.1"
FT                   /translation="MKTRLIATLAAATLVVTGVSACSSTSASDDKGFAAGDGSWSKLPA
FT                   DKREPAAVLTGTDLNGKKISTADAKGKVIVVNVWGSWCAPCRHEAPALVKAADSTKNVA
FT                   AFYGINTRDLDPGPPQAFSRTFHISYPSFYDPDGALLLKFTELPPKAIPSTLVIDRKGR
FT                   SAARFVGEVSTATLVQAINDVAKESQ"
FT   gene            375422..376183
FT                   /locus_tag="PPA0326"
FT   CDS_pept        375422..376183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0326"
FT                   /product="cytochrome c biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82081"
FT                   /db_xref="GOA:Q6AAY5"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAY5"
FT                   /protein_id="AAT82081.1"
FT                   /translation="MTPLDLGSWAAGALTGSMAGAIPVAVFAGLLSFFSPCVLPLIPGY
FT                   LSYVTGLGAADVIEGQRRARTVVGTVLFVVGFTVVFVATGTIIGTLGKVLVGHRRAIEI
FT                   IVGALTVVLGAMFAGLVPLGRRELRIHRLPRAGLAAAPILGIVFGLGWTPCIGPALSVV
FT                   YGLSLTQGSAVRGAVLAICYSLGLGIPFIAAAAAVVWMGRTIDAMRTHQHGVQRFGGIL
FT                   LMTVGVLLVTGWWESIMAMLRAWAAKFGAVI"
FT   gene            376261..377772
FT                   /locus_tag="PPA0327"
FT   CDS_pept        376261..377772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0327"
FT                   /product="conserved protein, putative c-type cytochrome
FT                   biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82082"
FT                   /db_xref="GOA:Q6AAY4"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAY4"
FT                   /protein_id="AAT82082.1"
FT                   /translation="MRWVWGQLTSMRTALILLFLLALAAIPGSVVPQSAQSAMKVSDFA
FT                   ANHPTLDRICRPLGMYHVYTSVWFSAIYLLLLISLIGCIVPRIVSHAKALRRQPPRVPA
FT                   RLDRLAAHASMITSASAVEVSQRAQQWLTSHRYRFVVDDDGSLRAEAGRHRETGNLVFH
FT                   IFLVFVLVGVGWNTLWGFKGTSVVVEGQGFSNSITQYDEFKAGAMVDTDNLTPFSMKLR
FT                   KFVVSFETGTVQRGAARSFDATVDLTMGGKTQTRDLQVNHPLRIGSTKVHLLGHGYAAD
FT                   VVVRDGDGKVAYSGPVVFLPQDANFKSVGVIKVPDARPDRLAFQGFFLPTGAITAGGPT
FT                   SLFPDALNPQLYLTAWYGKPTVETGVPSNIYTLDTTGLTQVTNGKDKARFVLSPGQRYK
FT                   LPDGKGSIQFNGWQRWAKIQVSQNPGLPLTFLSVVLSVAGLCVSLFSRSRRVWVRTIPG
FT                   DDGLRVEIGGLDRSDSRSGAVDDVNSLLAALHGDSMSGDVGEEHS"
FT   gene            377769..378650
FT                   /locus_tag="PPA0328"
FT   CDS_pept        377769..378650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0328"
FT                   /product="putative cytochrome c biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82083"
FT                   /db_xref="GOA:Q6AAY3"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR017562"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAY3"
FT                   /protein_id="AAT82083.1"
FT                   /translation="MSVENLSAVGIVTAAVLYMLAFLAHAVEWASVRGTEHPSHEERLR
FT                   SETWGRMGLNLTVLGAACAAIGVVCRGIAAHRLPWGNMYEFVTSALFFVVIAYLVLVAI
FT                   HHVRWMGIAVTLLLAVGNGLAATVFYVAVAPLVPALHSVWFVIHIVAACIAAAALNVGA
FT                   IASIMYLIATNAQAKAQRTGVLVAKLPPLESMDALAYRAHAIGFPIWTFTIAAGSVWAD
FT                   YAWGRFWGWDPKETWSLVTWVVYAAYLHARSTAGWRGRRAALIAIVGAACFWFNFVGVN
FT                   LIFNGLHSYAGI"
FT   gene            378637..380100
FT                   /locus_tag="PPA0329"
FT   CDS_pept        378637..380100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0329"
FT                   /product="hypothetical protein, putative sigma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82084"
FT                   /db_xref="GOA:Q6AAY2"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR019606"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAY2"
FT                   /protein_id="AAT82084.1"
FT                   /translation="MPESDMTGSFSESRDDWLPQLYQERWDAFVRLATLLLADQQVAED
FT                   AVIAAFATSYLRDPKLHSYEHAVSYVRTAVVNKARSRQPAERDATPPETPEDLAYWCLR
FT                   GLLARQREVLVLKLATPDLSDDDIAETLGMSVSAVRNNETKGLIAIGERLRPGSQTNPG
FT                   HADPRVEAVVRSALETFAESIHPMSRYDAIISQIACRPHRGRPTTWVIVLACGLAFLVG
FT                   VLLPLLGSGNGSTMGDPEALPSIRTPESSSQSLSTLQTGLDVFYLGRDDGLIHRELRDL
FT                   PTSGDRLGTAVGAVLNVAPLDPNYTSGWAAGQVNRATVKGNRITLDLSASAFSQFKNGE
FT                   QVQRAIQQLVATATAAVGDRTGDKSVRILVDGSPNLPIIGKPATDFVDEGFARCARVWV
FT                   DSPQAGADMSAGTITISGVAQPTVSVMSYEVRPPQSSRIITSGQINLSANDGDKWRPWH
FT                   ATFTMPKGEYDLIIREGTHIADEKVITAK"
FT   gene            complement(380112..380906)
FT                   /locus_tag="PPA0330"
FT   CDS_pept        complement(380112..380906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0330"
FT                   /product="putative short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82085"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAY1"
FT                   /protein_id="AAT82085.1"
FT                   /translation="MNDMEATRDERPWALVSGASGGLGQAFSRHLASCGVNLVVTGRRH
FT                   DVLDDLADQLTTRYGIQTIVHPCDISSASERLALVNEIAGRGIIIDTLVNNAGFGAAGR
FT                   IAETDPERQTSQVEVNCEAVVHLCGLLLPGMITAKRGSIINVASTAAFQPIPQFATYAA
FT                   SKSFVLSFTRALWAETNGTGVRATAICPGPTETGFFDVAGVPRMAAGARRDPDDVVRTA
FT                   FDALARHRPYAVDGFVNRTVARLAPHLPARLVMTQAEKYLQV"
FT   gene            complement(381123..382196)
FT                   /locus_tag="PPA0331"
FT   CDS_pept        complement(381123..382196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82086"
FT                   /db_xref="GOA:Q6AAY0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAY0"
FT                   /protein_id="AAT82086.1"
FT                   /translation="MSTSNQSTTESKDAQAIKTEIFDLYSDITKPKSPHRTGRPGKNVA
FT                   EQAVALGGVAVKYNKSIFDVCEMLHEKKIEQRTIERQNYNLFNRFRLQIGDLCDRFNSY
FT                   YYNRAKTVDQKIFYDICSTYKQNARPTTSVTELRSCLCDTAARCNATPHAVWAAAEQYM
FT                   SHSLRAVRNSLDYTKPNYWIRLLLSVIFITLMCLVCDLPRVIKSLSIIESIGFIIATAL
FT                   FTADFVFIFLPVTTQWLRVNKLSTKFLEVLFSVFSFLIVYQFQASKMTSASTPYLMVDI
FT                   WLIVAIFIMWLITHNKANEVVSQQDHIRDLQDQLQTLRMSEPQQIVEPDTVGHAPKESS
FT                   RLRLLGMVINPFQRPRF"
FT   gene            complement(382407..383111)
FT                   /locus_tag="PPA0332"
FT   CDS_pept        complement(382407..383111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82087"
FT                   /db_xref="GOA:Q6AAX9"
FT                   /db_xref="InterPro:IPR033458"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAX9"
FT                   /protein_id="AAT82087.1"
FT                   /translation="MFTLTSTPVTFIGLLILFAWSLVWSVRDAIKAPTVVTRISTWVHV
FT                   VMAVTMILMVPKSWWKPIVPAIGGPITPVIIFAICTAWMVFMAAWRSSWSSWGHAAMFA
FT                   AMVWHLAAMRKMSSLMTAPRDSGMGQMNHTHSGMHGPGMQTAMNAAMHDYAVVGVPLMV
FT                   ALLAMAVAGLWRAISGRAENPGKAPTCHVVATEPLAIRLSGLADFAMAFGMAWMSTGLL
FT                   SPVMPFTAHLHP"
FT   gene            383235..384635
FT                   /locus_tag="PPA0333"
FT   CDS_pept        383235..384635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0333"
FT                   /product="pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82088"
FT                   /db_xref="GOA:Q6AAX8"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAX8"
FT                   /protein_id="AAT82088.1"
FT                   /translation="MEHYDIVVIGSGSGNTILDEDFADRRAAIIDSGAFGGTCLNVGCI
FT                   PTKMFVLPADFASSPSEAVRVGVDLQFRGASFASIRDRIFGRIDSISKAGLSYRQGLDN
FT                   IDVYTGEAAFIDAHTLEVGGRCITADQIVLAAGSRPRVPDVPGLDDPSMAGLIHTSDTI
FT                   MRLAELPQRLVILGGGLIAAEFAHIFSGLGSQVTVINRSGRMLRHEDREISQRFTEQMG
FT                   RRVRLRMAEGLVGVDRDPGGHLVVLTVDGDGVDYDYPADVVLNATGRVSNGDRLNLPAA
FT                   GVDVDDDGFVVVDKHQRTNVEHIWALGDVCSPWELKHVANHEARVVRHNLLHPDDLASS
FT                   NHCFVPHAVFSNPQVASVGATEQGLLQSDTPYAAYLQEYADVAYGWAMEDEGHCVKLLG
FT                   DPQTRTLLGAHIIGPQASTLIQTCIQGMSVGQTVDEMARGQYWIHPALSEVVESALLGL
FT                   GKEMDTTR"
FT   gene            complement(384718..385734)
FT                   /locus_tag="PPA0334"
FT   CDS_pept        complement(384718..385734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0334"
FT                   /product="putative ABC-type transporter, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82089"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAX7"
FT                   /protein_id="AAT82089.1"
FT                   /translation="MSTPHTRRRATRVTAAVLTGLCAISMSACAGSSTEKSSSSSSGPA
FT                   RTVMSCNEKLTFTSVPKRVIMLGDTDASTMNALGVLDHVVARAGRIKEGAYDAKTLAKL
FT                   KAIPTIASQELNTGGVKVSTETILDQHADLVIGYDTGVDRDALRKSGVKMYSTDAMCTD
FT                   KKPPAPATFSQVKDEVTKVGQIFDVPDKAKQVNKELDAKISTIQKQTASGAKANAVALY
FT                   ITPGSTEFYTYGSSSMIEPMFAANGLRNMYHSNTTRVFDADMEDLLHKNPEWIVLLAGD
FT                   GAMSKVEPTFLSFKGAKELKAVKKGHVVTMSFALTDPPTPLTITGTEKLHDLIKDKK"
FT   gene            complement(385746..386504)
FT                   /locus_tag="PPA0335"
FT   CDS_pept        complement(385746..386504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0335"
FT                   /product="ABC-type transporter, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82090"
FT                   /db_xref="GOA:Q6AAX6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAX6"
FT                   /protein_id="AAT82090.1"
FT                   /translation="MINASQLVVRRGQRIVLENIDFSAGQGVTVGVVGPNGAGKSTLLS
FT                   ALYRNVSIASGQVTVSDHDLASMSRREIAREVAVVSQTPDPSLPLTVRDTVALGRLPHR
FT                   SLMGYGDAADRNIVEEALTRTDLTDLADRLVTQLSGGERQRVLVARAIAQQAGHLLLDE
FT                   PTNHLDIGHQFALLDLVRTIKATTVIVLHDLNLAARVCDQLVLLAEKHLVATGSCEDVL
FT                   QPDLLSKVYEVNVERITHNGHIHLLFNPPR"
FT   gene            complement(386501..387526)
FT                   /locus_tag="PPA0336"
FT   CDS_pept        complement(386501..387526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0336"
FT                   /product="putative permease, FecCD transport family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82091"
FT                   /db_xref="GOA:Q6AAX5"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAX5"
FT                   /protein_id="AAT82091.1"
FT                   /translation="MVRSLHRRTPVRFILLVALLVLTPVLSIAFGAAPVPIGQVLGVLA
FT                   DHCGLPVHLSWDSITDAIVWQNRMPRIVTGLGVGAILGAAGVTLQAVVRNPLAEPYVLG
FT                   VSAGASSGAATAIILVGISSTFGVAGMAFLGALASTAIVLFMGGGRNSSTLRLILAGLA
FT                   VGFVFQALTNFIIFSSDSPETARAVMFWTLGDLSRASWAQGWTSIVVAVVLSILLWICA
FT                   PWLDALASGDSTATAVGIDPAMIRVLLLVPVSAGVAIAVAISGGIGFVGLVIPHLMRSF
FT                   IGHGHRRLVVSSAIAAAIFLVWADTFSRTVFSPAELPIGVITGLLGAPFLLVLVKRETL
FT                   A"
FT   gene            complement(387764..388651)
FT                   /locus_tag="PPA0337"
FT   CDS_pept        complement(387764..388651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0337"
FT                   /product="siderophore-interacting protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82092"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAX4"
FT                   /protein_id="AAT82092.1"
FT                   /translation="MAEYRPYLMRLSSRSLVEPNFIRLILTGDEVRFPQPCLDRRIKLL
FT                   FIGEHPNPALTDPKVGDGWYQLWLDDPARPEMRTYTVRRVIENGIVIDVACHDGDGPGH
FT                   RFATSAPLGSQVLVIGLDATAPGAEQTGIDFHPGDAKRLLILGDDAAAPAVCSILEQLP
FT                   THAAEVEAVVEVPQLARKIEAGPDGHWTDSRGNRINIRWQERLSERGDRLAEAIEDHLH
FT                   RFPLPRCQQDSPEEGPDDLLWDTPASPPQEFYSWIAGESTMVRRLRRILVNDHGVDRRH
FT                   IAFMGYWRHGSAGM"
FT   gene            complement(388878..389654)
FT                   /locus_tag="PPA0338"
FT   CDS_pept        complement(388878..389654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0338"
FT                   /product="phosphate transport ATP-binding protein PstB"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82093"
FT                   /db_xref="GOA:Q6AAX3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AAX3"
FT                   /protein_id="AAT82093.1"
FT                   /translation="MAKRIETKDLDIYYGSFHAVESVNLIVEPRTVTAFIGPSGCGKST
FT                   VLRTLNRMHEVIPGAYCTGKVELDGVDLYGKGVDPVAVRRNVGMVFQRANPFPAMSIRD
FT                   NVVAGLKLNGVRDNKLLDEACEKSLRGANLWDEVKDRLERSGASLSGGQQQRLCIARAI
FT                   AVEPEVLLMDEPCSALDPISTLAIEDLVSELKERFTVVIVTHNMQQAARVSDQTAFFNL
FT                   KAQGEPGRLVEIDTTERIFSNPKEKATEDYISGRFG"
FT   gene            complement(389673..390599)
FT                   /locus_tag="PPA0339"
FT   CDS_pept        complement(389673..390599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0339"
FT                   /product="phosphate transport system permease protein PstA"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82094"
FT                   /db_xref="GOA:Q6AAX2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAX2"
FT                   /protein_id="AAT82094.1"
FT                   /translation="MSATTPDHITHHGDNTPGQLDLSRPSGKRTIKSGCASAFMIVATV
FT                   LAVIPLAWLLFAAVRRGIGSLFHASWWTHSMDPSFDLAEQGAIHAIVGTLEIGLITSII
FT                   SVPIALMTAIFLVEYARGTKIAKVISFAVDVLTGVPSIVAALFVFAVVVTTFGGTQSAW
FT                   ASSLALMILMVPTVLRSTEEMLKLVPDSLREASFALGVSQWKTIMKVVLPTSMTGILTG
FT                   IVLGLARVMGETAPLIVLLQFNTELTFNPSTPNFATLPTVITNAYTQGGVDTPVVWGAA
FT                   ITLIILVMGLNLIARRISRRYMRRMGK"
FT   gene            complement(390596..391600)
FT                   /locus_tag="PPA0340"
FT   CDS_pept        complement(390596..391600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0340"
FT                   /product="putative phosphate transport system permease
FT                   protein PstC"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82095"
FT                   /db_xref="GOA:Q6AAX1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAX1"
FT                   /protein_id="AAT82095.1"
FT                   /translation="MAETTSPAQRKLTAASRMKPVSRVGDTIFAGASSVIAIALAIIVI
FT                   LMFVFLMKTAAPTLLANTDNFFTSRAWTTDQNPPAFGIQALLWTTVISSLLALLIAVPL
FT                   SVGIALFITQLAPRKLASPVAFVVDLLAAVPSIVFGLWGGIVFGSSGIINGLRGAIIKA
FT                   LGWIPIFSEDPSWSSATGTVYLASLVLAIMILPIITAVSRDVMAQTPHDQVEAALALGS
FT                   TRWEVIKLAVLPHSRSGIISGSMLGLGRALGETLAVTLILQTMSPMALKQNLNLSIFVG
FT                   GETFASKIAGNFSEAISDPTSLGALVASALALFVITFVVNATARLIAAKGVKR"
FT   gene            complement(391709..392860)
FT                   /locus_tag="PPA0341"
FT   CDS_pept        complement(391709..392860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0341"
FT                   /product="phosphate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82096"
FT                   /db_xref="GOA:Q6AAX0"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAX0"
FT                   /protein_id="AAT82096.1"
FT                   /translation="MNRFAKITALAAISAISLTACGANGDKGSSSASSSKTTSTASSAA
FT                   QPSDSSADAVSFKPACPGGSISGAGSSAQLNAINQVISDYKAACSSATVNYSPTGSGAG
FT                   VKSFIGRQTDWAGSDSVLNADKGEPDKAKQRCNADPWHLPMAAGPIAVVYNVDGVKDLT
FT                   LSTATLAKIFSGAITNWNDDAIKKENPKAALPSAQIEVFYRKDESGTTDNFTKFLNKAA
FT                   GDIWTEKHSKTWKGAGKGADKSAGIAQAVKSTKNSISYDEWSYATKNSLDMAAIDNGNG
FT                   PVKLTGESAGKAVSAAKVVGQGHDLQLELQYKNTPAGVYPAVLVTYEIACSKGQDSGKA
FT                   ALLKDFLSFYASEREQKKIQDLGYAPLPSDVASKVLGSAQALS"
FT   gene            complement(393033..393974)
FT                   /locus_tag="PPA0342"
FT   CDS_pept        complement(393033..393974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0342"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82097"
FT                   /db_xref="GOA:Q6AAW9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAW9"
FT                   /protein_id="AAT82097.1"
FT                   /translation="MGGHKGPIQAAGAVVLRDIDDGAREVLVVHRPSYDDLSLPKGKLE
FT                   PGEDLPTTAVREVAEETGINIRLTMPLQPIEYTVKYSTRDGKPKSRAKVVSWWLGVAIG
FT                   GSIENATASPEEIDGAFWMPTDQALERLTYPTDVQVLEEALDLPSTSTIILVRHGKAVS
FT                   RKEWNSRKRHGKDATRPLERRGRRQAKALADLLSAFGVARLASSSSTRCMQTLQPYADT
FT                   IGAQITGLDALSEETHEADPHKATSAMRKIIGRALADPNQPIAICGHRPVLPTMRDALG
FT                   GANRPMSTAECLIVHLDETGRTIRQEWHSSRY"
FT   gene            complement(393982..396087)
FT                   /locus_tag="PPA0343"
FT   CDS_pept        complement(393982..396087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0343"
FT                   /product="polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82098"
FT                   /db_xref="GOA:Q6AAW8"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAW8"
FT                   /protein_id="AAT82098.1"
FT                   /translation="MAKKPTPGTSPSSPDELPEGRYSDRELSWLAFNERVLDLARDTER
FT                   IPLLERAKFLAIFSSNLDEFFMVRVAGLKRRIDAGVAVPSVAGMLPRELHDAILARTHD
FT                   LVSEQSRVFAEEVRPGLVDEGIEILRWAELSDDEKGRMRTLFSERIFPILTPLAVDPSH
FT                   PFPYIRGLSINLAVMLANPITGAEQFARVKVPSVLPRLVNLGEGRFLPLEEIISRHLDQ
FT                   LFTGMHVLQHTTFRVTRNEDLEVEEDDAENLLFALEKELLRRKVGRPPVRLEVQDDISA
FT                   EMLELLTRELDIRDKEVFRLPAPLDLTGLFSLADVDRDDLSYPNFLPITHPHLAEVETA
FT                   RPADMFAAIRRRDVLVHHPYDSFATSVQRFIEQAAQDPQVLAIKQTLYRTSGDSPIIDA
FT                   LVDAAEAGKQVLAVVEIKARFDEQANITWARLLERAGVHVVYGMVGLKTHCKLAMVIRD
FT                   EGEGLRRYAHIGTGNYNPKTARQYEDLGLLTSNPIITEDVARLFNHLSGMTAEKRYRRL
FT                   LVAPESIRSGIIDAIEREIDNKKAGLPAGVRIKVNSIVDERVIDALYRASRAGVPVDLW
FT                   VRGICSIRPGVPGLSENIRVISILGRFLEHSRIFWFANGGRPMVAIGSADLMHRNLDRR
FT                   VEALVGLSNKQHVAEVEEMFDMAFDPGTVSWHLQDRTWTEVSRGPDDIPLTDLQEELIR
FT                   RTRDRRR"
FT   gene            complement(396209..396922)
FT                   /locus_tag="PPA0344"
FT   CDS_pept        complement(396209..396922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0344"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82099"
FT                   /db_xref="GOA:Q6AAW7"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAW7"
FT                   /protein_id="AAT82099.1"
FT                   /translation="MMGCDIVDDMISNNAISAWEGIRMARLSLLGPLDAPLPQALELLP
FT                   HSISRYDDLKECMSHLEGVDVVLVDCHDEPAKAREACLRLSCHERRVPVLLLVGSDTLS
FT                   VISPDWGMDDFLCDSATPSEAETRLRCLFTIQVTNQLVAGPFTVDEDGYTASVGDKDLD
FT                   LTYTEFELLKYLVGHPGRVLTRDLLLSDVWGYDYYGGTRTVDVHIRRLRAKVGPEYEGH
FT                   IQTVRSVGYRFQAER"
FT   gene            396981..397865
FT                   /locus_tag="PPA0345"
FT   CDS_pept        396981..397865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82100"
FT                   /db_xref="GOA:Q6AAW6"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAW6"
FT                   /protein_id="AAT82100.1"
FT                   /translation="MPDEWFRPDEEESGPGEPCPAESVEGPQENENPPSRHADSEETPI
FT                   SSTTSGTIRVLTDDTGPSVVVGHARATGASASSHHRHFPIWILGVAAALVVGLVLGTFI
FT                   TQSRDSTGAAQIAPRALVPASTSTADMPYQGKVKAIGGVKATASCVSDPAVGSRHELVR
FT                   YDAKYVVDDKPETAWRCNGSGEGQQITLTLPHPSRIVGVGMINGYAKVFGNVDLYPQYR
FT                   RVRTVRWTMPDGTWFNQDFTDDDQDLQKVMIAPRTVKGDITLTIIASTQPGSLGEPTRD
FT                   SVLISSVQLYEES"
FT   gene            complement(397880..398317)
FT                   /locus_tag="PPA0346"
FT   CDS_pept        complement(397880..398317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0346"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82101"
FT                   /db_xref="GOA:Q6AAW5"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AAW5"
FT                   /protein_id="AAT82101.1"
FT                   /translation="MRVVIQRATSAEVVVEGRTVGSLTTPGLVVLVGVTGTDTATTAEK
FT                   LAEKVWGLRILSEEKSASDLNAPLLVVSQFTLYASTRKGRRPSWSAAAPGPVSEPLVDH
FT                   FVTHLRSLGAHVETGIFGADMKVGLVNDGPMTILIDTDDWH"
FT   gene            398513..399013
FT                   /locus_tag="PPA0347"
FT   CDS_pept        398513..399013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0347"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82102"
FT                   /db_xref="GOA:Q6AAW4"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR014878"
FT                   /db_xref="InterPro:IPR022939"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AAW4"
FT                   /protein_id="AAT82102.1"
FT                   /translation="MPFQIPDDLNRDLMPLAWMIGHWEGEGHGNTPDDGEFSFGCQVDF
FT                   TDNGGDYLHYICQTFTMNPDGTPAAPLRMETGFWRPNVDTRKVDVLMAAPEGWAEVWTG
FT                   NIDGAKIELVTDAVARTEEALVPYTGGQRLYGQVEGDLLWTFDRATVDAPLQPYMWARL
FT                   KRS"
FT   gene            399015..399956
FT                   /locus_tag="PPA0348"
FT   CDS_pept        399015..399956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0348"
FT                   /product="conserved protein, putative glycine cleavage
FT                   T-protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82103"
FT                   /db_xref="GOA:Q6AAW3"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAW3"
FT                   /protein_id="AAT82103.1"
FT                   /translation="MSDPVLLTDGPDTGLVSHMRNPIAEQRLMVDGGGSVELSNREVLA
FT                   ISGVDRLGWLHSLTSQFLDGMEPGRTTTSLVLSPTGHVEHVLHGVDDGQTFWAWTEPGR
FT                   GADLAAWLDSMRFMMRVEVALRPDMTVRWFGHDVAVSDGVVLDSEVAGGHEVILPVDAE
FT                   IPGDADPVGVLAWEALRIAAGIPRIGLDTDDRTIPNEIGLYGTHMDKGCYRGQETVARV
FT                   YNLGRPPRRLTLLQLDGSRAELPEVGADIHAGGRRVGAMGSSANHGVDGPIGLALVRRG
FT                   VDVGLELEVDGIAAGQQPLVDPEVGLHVCPVV"
FT   gene            399997..401382
FT                   /locus_tag="PPA0349"
FT   CDS_pept        399997..401382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0349"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82104"
FT                   /db_xref="GOA:Q6AAW2"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAW2"
FT                   /protein_id="AAT82104.1"
FT                   /translation="MKKDYFNRTQKLVTVLIDAIVFVVGIFLSFWMRFGMVIPQRNLDD
FT                   GKAALMASVIAFLIINVLSGVYVLYNKTLLDIGIITVVDQVMVTIVIMALTFFGRWFAF
FT                   PRSVLLINLVVGIVLLLVWRSVEVVAYRHLRGAKRVMLLGPPEMLNRAVMNYMANKATR
FT                   HRLTHVVRGHYLEQIRSHINEFDTAHVSDDIPSSERVAIYDLLLSEDKEIFMSTSFEHM
FT                   MLINPTIMSIEDETIIAASPFKIPAEMDIVKRFFDILLSLIALVVASPIMFVTAILVKA
FT                   SSPGPVFYRQTRITKDGREFKILKFRSMGVMAEKESGPMLATTNDPRVTTVGKYLRSLR
FT                   IDEIPQLINVLIGDMSIVGPRPERPFFVDQFQEQNAHYTLRHNVRAGITGYAQVYGKYA
FT                   SDFAAKLNFDLIYIKQYSLVLDVKIMIQTIKILFDKVSSRGVDETAEPDENIHLPAEVQ
FT                   QLN"
FT   gene            complement(401405..402142)
FT                   /locus_tag="PPA0350"
FT   CDS_pept        complement(401405..402142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0350"
FT                   /product="short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82105"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAW1"
FT                   /protein_id="AAT82105.1"
FT                   /translation="MTKTAVVTGASSGIGAATARALAGDSWHVICAARRVERIEPLSAE
FT                   IGGQAVVCDVTSDESVTNLVKTVGGKVDLLVNNAGGAVGQEPVTEADLNAWTTMYQTNV
FT                   LGMGQVTKALLPALEIAEGTIITITSTAAEWGYEGGAGYCAAKSGERAVVEALRLELCG
FT                   HPVRVCEVSPGMVHTEEFSLVRFHGDQAKADKVYQGVDSPLVAADIAECVRWISGLPSH
FT                   VNIDRMIVRPRAQAAQYKVARES"
FT   gene            complement(402218..403936)
FT                   /locus_tag="PPA0351"
FT   CDS_pept        complement(402218..403936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0351"
FT                   /product="putative phosphoenolpyruvate-protein kinase"
FT                   /EC_number="2.7.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82106"
FT                   /db_xref="GOA:Q6AAW0"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAW0"
FT                   /protein_id="AAT82106.1"
FT                   /translation="MPSLRTCKPTRRPDPMRTLSGLGVSAGVGQAHALVVSPAPGLPAS
FT                   DPSRGAEADLAKVEAALGKVADRLDERSLHADPSALAVLQATAMMARDPGLLTSIKSHL
FT                   SDGHGPAHALWAAFEDFCAQLSAAGGYLAERVTDLRNVRDRAVAVMQGLPEPGVPSFDS
FT                   PVILVAEDLAPADTATLNPELVRGLITAAGGPTSHTAILASQIGIPAVVRCSEARDIED
FT                   GTPLALDGVTGTVLVEPDEASVSELTERANRRAEVLASAPDGDATLSDGERILVLANIG
FT                   NPSDAPTAKKKGAEGVGLFRTEFLFLDRQDAPTIDEQTEAYATVLKTFDEGAKVVFRTL
FT                   DVGADKPLAFADLGAEENPALGRRGLRLSQVRTDLIDAQLEALAKAAEQTGRDPYVMAP
FT                   MVATKAEAEWFSSRARAAGIKTVGIMVEVPSTALRSSQVLESVDFASIGTNDLTQYAMA
FT                   ADRLQGELAELLTPWQPAVIQLVKATCDGAGERLIGVCGEAAGDPLLALVLVGVGVRSL
FT                   SMAAGKITAVKAALSRHNLEQCRRIADAALAACSPEEARTAALKLADPSVEVLVS"
FT   gene            complement(403896..404162)
FT                   /locus_tag="PPA0352"
FT   CDS_pept        complement(403896..404162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0352"
FT                   /product="phosphocarrier protein HPr"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82107"
FT                   /db_xref="GOA:Q6AAV9"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAV9"
FT                   /protein_id="AAT82107.1"
FT                   /translation="MPSRTTTIAAESGLHARPAAMFVQAASKSGLAVKIGRPGEEPVDA
FT                   RSILSVMGLGAKHGETVELTAEGDNADEVLDALVANLQTDPEA"
FT   gene            404249..405061
FT                   /locus_tag="PPA0353"
FT   CDS_pept        404249..405061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0353"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.60"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82108"
FT                   /db_xref="GOA:Q6AAV8"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AAV8"
FT                   /protein_id="AAT82108.1"
FT                   /translation="MPTMVDEHTPPVVAVVVAAGLGTRFGGPVPKQVTSLTGKAVVAVA
FT                   VESLAAGGCDEAVVVVKEGMHNHLQLALAASPIPVHFVTGGNTRQESVRNGLRFIAQHH
FT                   RLSDATTVLIHDAVRPLVPAYVVENVIAAVENGAVAVTPVVDVVDTIRQVDGDTSSVVD
FT                   RSTLRAVQTPQGFKRDIITECHEQLSIEGGSVTDDISCCERYGHHATFVEGSRMSLKIT
FT                   EPVDLDVAEVFAKAAAGAGRHSGRRIGRMLHAVKPSTVARKLGRGSRR"
FT   gene            405058..405564
FT                   /locus_tag="PPA0354"
FT   CDS_pept        405058..405564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0354"
FT                   /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82109"
FT                   /db_xref="GOA:Q6AAV7"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AAV7"
FT                   /protein_id="AAT82109.1"
FT                   /translation="MIEIRTGIGTDVHQLSAGVPMHVAGLSFPDETVGLVGHSDGDVAC
FT                   HAICDALLSATGLGDIGSIFGTADPQWAGAAGVALLGHVVALVTGEGWTIQNVAVQVVG
FT                   QRPRMAARRAEAEAALAQTVGAPVSVSATTTDHLGFTGRGEGVAAIASALVTRGLKGED
FT                   SSLIR"
FT   gene            complement(405511..405915)
FT                   /locus_tag="PPA0355"
FT   CDS_pept        complement(405511..405915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0355"
FT                   /product="putative PTS family protein"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82110"
FT                   /db_xref="GOA:Q6AAV6"
FT                   /db_xref="InterPro:IPR004716"
FT                   /db_xref="InterPro:IPR036665"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAV6"
FT                   /protein_id="AAT82110.1"
FT                   /translation="MTTTSSTLWNAVVLRIGKGAQDMLDTGVIVLFGEPVPDALSDICV
FT                   IHNRGGRSPLAPQRELLPGDVLNFADTRYTIDEVGETATSNLGDLGHVVLYFNSPDQSL
FT                   LAGAIKMSGPPPQLPDQGAILTFEPSSDKG"
FT   gene            406113..406406
FT                   /locus_tag="PPA0356"
FT   CDS_pept        406113..406406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0356"
FT                   /product="putative phosphotransferase enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82111"
FT                   /db_xref="GOA:Q6AAV5"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAV5"
FT                   /protein_id="AAT82111.1"
FT                   /translation="MIEKKILVCCGTGIATSVQVANKLQRLLRERGINARMEHCRVAEV
FT                   PRVAERFSPDAIVSTTAVKQPTENVKMLRGVAFLTGVDEGQLADEIANALKS"
FT   gene            complement(406490..406975)
FT                   /locus_tag="PPA0357"
FT   CDS_pept        complement(406490..406975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0357"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82112"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAV4"
FT                   /protein_id="AAT82112.1"
FT                   /translation="MTFNVGETVVYPNHGAAVIEDIETRTIKGEEKLYLVLRILGQNDL
FT                   VVRVPASNLDLVGVRDVVDDEGLENVFEVLRKTNVEEPSNWSRRYKANLEKLHSGNVLK
FT                   VAEVVRDLWRRERDRGLSAGEKRMLSKARQILVSELALAKKVADDRAEEMLDEVLAS"
FT   gene            407115..407720
FT                   /locus_tag="PPA0358"
FT   CDS_pept        407115..407720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82113"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAV3"
FT                   /protein_id="AAT82113.1"
FT                   /translation="MALPMGRLALADEALMDADSAKLNDDMHLGRGDSTMIDRRRTTAV
FT                   LAAVGVLGVAACGADPKVLTSYTPAAGVNGKSATVKVQNLVLINGGGQARVSAAVVSRK
FT                   DDNIVGITGEPLTSNNSLSGRSFTMRTLNVKLPAQTSVNLTQSKLQAPVEGLSNGLLAK
FT                   VTIKFASSAPITLDAPVVSSTHPDFAEYASSGIPSARS"
FT   gene            complement(407773..408453)
FT                   /locus_tag="PPA0359"
FT   CDS_pept        complement(407773..408453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0359"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82114"
FT                   /db_xref="GOA:Q6AAV2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAV2"
FT                   /protein_id="AAT82114.1"
FT                   /translation="MTRVLIIEDEESYREATAFMLRKEGFEVNTAANGADGLEIYSRNG
FT                   ADIVLLDLMMPGLPGTEVCRQLRQRGNVGIIMVTARDSEIDKVVGLELGADDYVTKPFS
FT                   HRELVARIRAVTRRGSPEVEVSPDVLEESGVRMDVERHEVSVEGTVVRLALKEFDLLEV
FT                   LLRNAGRVMTRASLIDRVWGADYVGDTKTLDVHIKRLRAKIEDDPSRPVRITTVRGLGY
FT                   KFQA"
FT   gene            complement(408450..409631)
FT                   /locus_tag="PPA0360"
FT   CDS_pept        complement(408450..409631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0360"
FT                   /product="putative sensor kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82115"
FT                   /db_xref="GOA:Q6AAV1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAV1"
FT                   /protein_id="AAT82115.1"
FT                   /translation="MRTVGMILSAIIGAVVGAGLMVLMSRVVESSRHPVDTLATDIEAI
FT                   EVNSALARALDLTTEAAVIVGPHDEVLHTTLGARSMELVRGSRIANETLLKLVRTARRE
FT                   GRDIVDTMEMKRASTGADLILTVRAGPLDDHGNAIIAASDSSRHVRLAETRRDFVANVS
FT                   HELKTPIGAVSILAEAIEGAADDPEAIRHFSQRLTAESSRLSALVTQIIDLSRLQADEP
FT                   LLRAEPVAVADVIDEAVSRHREQAANREVSLVVRCDDDLWVLGDQSQLTEAVANLVHNA
FT                   IVYSEPKVRVAVSARRVRDVDTDVIAIAVADNGIGISEADQKRIFERFYRVDYSRSREN
FT                   GGTGLGLSLVKHTCQAHGGSVDVWSKLGQGSTFTLRLPTLDVDHHNESDQEES"
FT   gene            409714..410460
FT                   /locus_tag="PPA0361"
FT   CDS_pept        409714..410460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0361"
FT                   /product="putative phosphate transport system protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82116"
FT                   /db_xref="GOA:Q6AAV0"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAV0"
FT                   /protein_id="AAT82116.1"
FT                   /translation="MALHGRNVLVDKVDRLGCTPLWKDTGMRESYHDELNATSGRILTM
FT                   AELVRVAVKDATAALIGADLTTAERVISDDSKVDSLNEEIERRCFDLLARQAPVAGELR
FT                   TIVAMLRMCYELARMGDLAAHVAKIARLRFPEVAVPPQVADQFVEMSKIADSMIGKAEK
FT                   TLADRDAEAAESLASEDSKMDDLRRDQFRLLLGDDWTYGVESAVDTALLGRYYERIADH
FT                   AVAVGSRVIYIVTGEGPAGEDWPSAY"
FT   gene            410606..411676
FT                   /locus_tag="PPA0363"
FT   CDS_pept        410606..411676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0363"
FT                   /product="polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82117"
FT                   /db_xref="GOA:Q6AAU9"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAU9"
FT                   /protein_id="AAT82117.1"
FT                   /translation="MAFAFRSKTIAGAVVVVTTVSMAIAGCASSDPESASSSSKSGVSS
FT                   AQSSSQPSPSKSPIAKPSISSGASAPAGLPSGPVPAGVFGVGAAVTKPACAEPPSNYSP
FT                   LKVPGTVVKDIDGLEAGTNHGRAADKYVYSASVVNQWLEKPSTQPKNKKIVFVTFDDGP
FT                   TTKFTGEQLDNLEKAGARATFFMIPPQMRDVGKNMLSRSLKMGNALAIHSYSHDYKYLY
FT                   HGSAANKAKHISCDWDWAMAQSRAILGSNYFSSAFRYPGGHMSWTNLSQADATLAKRGV
FT                   GWIDWNAMSGDADAQRPTTVPGYLQMVKKSIKESNNPNVVVILNHDTYGKQMTAKAMPS
FT                   ILAWLKSQGYEFGVIA"
FT   gene            complement(411768..412517)
FT                   /locus_tag="PPA0364"
FT   CDS_pept        complement(411768..412517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0364"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82118"
FT                   /db_xref="GOA:Q6AAU8"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AAU8"
FT                   /protein_id="AAT82118.1"
FT                   /translation="MTAKLILLRHGESEWNSKNLFTGWVDVDLNEKGEGEARHAADLLK
FT                   QENLLPDIVHTSLLRRAIHTAYLALDGCDRHWIPVHRSWRLNERHYGALQGLNKAETKE
FT                   KYGNDQFMAWRRSYDVRPPDLDRDSEFSQFHDPRYADIPASERPVAECLKDVVARMVPY
FT                   FTSDIAADLKDGKTVLVAAHGNSLRALVKHLDEISDEDIAGLNIPTGIPLFYELDDNLK
FT                   PVTRGGRYLDPEAAAAGAKAVANQGNK"
FT   gene            complement(412642..413100)
FT                   /locus_tag="PPA0365"
FT   CDS_pept        complement(412642..413100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0365"
FT                   /product="putative PTS system"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82119"
FT                   /db_xref="GOA:Q6AAU7"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAU7"
FT                   /protein_id="AAT82119.1"
FT                   /translation="MPTPRLIVADVTATSQNDLYAQVNDRLTADNMVKSTFLNAVSARE
FT                   KKFPTGLDFGYVSIAIPHIDPEHVISPGLLVCRNSASTTFHAMDDPERNLDVQLSIWPL
FT                   VTDPGNQIDMLEAVITLIQDESSYRILLHGSHAEVANTLPDVLATVED"
FT   gene            complement(413345..413638)
FT                   /locus_tag="PPA0366"
FT   CDS_pept        complement(413345..413638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0366"
FT                   /product="putative phosphotransferase enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82120"
FT                   /db_xref="GOA:Q6AAU6"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAU6"
FT                   /protein_id="AAT82120.1"
FT                   /translation="MVNKKVLVCCGTGIATSVQVANKLQRMLRDRGITATMKECKTANV
FT                   PAQMTTFQPDAIVVTTAITPPDEEIKVYRGTPLLTGVDAEELADQIASDLKA"
FT   gene            complement(413845..414840)
FT                   /locus_tag="PPA0367"
FT   CDS_pept        complement(413845..414840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0367"
FT                   /product="L-asparaginase I"
FT                   /EC_number="3.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82121"
FT                   /db_xref="GOA:Q6AAU5"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="InterPro:IPR041725"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAU5"
FT                   /protein_id="AAT82121.1"
FT                   /translation="MMQTHVLYTGGTLGMVSTPNGLAPGADLTGWLNQLLSGTELAGTF
FT                   ETLSFEHLIDSANATPDDWRRIVDDLWEHRDDADSFVVLHGTDTLAYTSAALSYALTEF
FT                   GKPVVVTGAQYSLGVVGTDAAPNVTGALRAATSGRLNGVAVFFGHKLLRGNRVTKLSSW
FT                   AYNGFDSPAVPQLARTGAPWQWVENESTGCGWLNPGPYQRHDVLVVDLSPGISARRLRA
FT                   VLDPLPEAVILRAFGVGNIPSDEPGVVDAILDVISAGTPVVVASQCMQADVQLGQYQSS
FT                   HALTEGGAVSAHDMTLEALYAKLIFLLSQGLHGKELKRWIETDIAGEISV"
FT   gene            complement(414841..416289)
FT                   /locus_tag="PPA0368"
FT   CDS_pept        complement(414841..416289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0368"
FT                   /product="amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82122"
FT                   /db_xref="GOA:Q6AAU4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAU4"
FT                   /protein_id="AAT82122.1"
FT                   /translation="MQEGDSVTPHTSTTVDKGDAGYDKALKNRHLQMIAIGGSIGTGLF
FT                   LGTGGRLAQGGPGLAISYAVCGIFAFLMVRALGEMAIRRPSSGAFVSYAREFMGEKGAY
FT                   ATGWFFFLDWSVTVMADITAVALYLHYWTPLRAIPQWVLALIALGVVFTLNMLSVKMFG
FT                   EAEFWFAAIKVAAIILFMIAAIWAIVTGARVGNYTAGLHNIAQHGGFFPAGLAPVFALT
FT                   LGVIFAFGGTEMVGVAAGETKDASKILPKAINSMILRIFVFYVGSIILMALVLPYTAYS
FT                   SNESPFVTFFTGIGIPYAGDIIQVIVLTAALSSLNAGLYSTGRTLRSLAVAGEAPKAAA
FT                   KLNRHHVPSGGIAMTAALGLLGVALNAFLPDSAFEIVMNLAGIGIAGTWAMVLLAHTRF
FT                   VSAVRRGKDNRPEYRMPGAPVTNYISLAFLLIVVLSNVTSESGRWTLALFALVAIAMVA
FT                   GWYAVRNSIKPDLLDNVVPSDEGM"
FT   gene            complement(416665..418140)
FT                   /locus_tag="PPA0369"
FT   CDS_pept        complement(416665..418140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0369"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82123"
FT                   /db_xref="GOA:Q6AAU3"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AAU3"
FT                   /protein_id="AAT82123.1"
FT                   /translation="MSDPRAVDPTARDIAEKLAPAYRTMLDAIAQVEPRIAEATRAELT
FT                   DQRHSLKLIASENYASLPVLATMGTWFSDKYAEGTAGHRFYAGCQNVDTVETIAAEHAC
FT                   ALFGAEHAYVQPHSGIDANLTAYWTILAHHIETPALSEFGARTVNDLTQVDWDTLRHRF
FT                   NDQRAIGMSLDAGGHLTHGFRPNISGKMFDQRSYGTDPQTGLLDYDKVAELAREFKPLV
FT                   IVAGYSAYPRRVNFAKMREIADEVGAVLMVDMAHFAGLVAGKVFTGDENPIPHAQVVTT
FT                   TTHKSLRGPRGGMVLTTKDYADDVDRGCPMVLGGPLSHVMAAKAVALAEARTQTFRDYA
FT                   QRVANNAKALAEGLMKRGVKLVTDGTDNHINLLDVTTSFGLTGRQAEAALLDAGVVTNR
FT                   NSIPTDPNGAWYTSGIRIGTPALTSRGFGPDEFDQVAELIVTTLEATTPMTASTGKPGK
FT                   AKYQIADGVAQKVHDAADELLGNFPLYPGLDLA"
FT   gene            complement(418254..419354)
FT                   /locus_tag="PPA0370"
FT   CDS_pept        complement(418254..419354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0370"
FT                   /product="carbohydrate kinase, PfkB family"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82124"
FT                   /db_xref="GOA:Q6AAU2"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAU2"
FT                   /protein_id="AAT82124.1"
FT                   /translation="MSITLRPADRCRYDIVSLGEVMLRLDPRERRIRTAKSFDVWEGGG
FT                   EYNVGRGLSRVFGKRAAVITGLVDDPVGHLVGDLITAGGVDDQFITWVPSDGVGRTVRT
FT                   GLNFTERGFGVRGAVGVSDRGHTAASQLRAEDIDLDCLFGELGVRWLHTGGIYTALSET
FT                   SAQTAKAVMEAAHANGTIISYDLNYRPSLWKSIGGQEEARRVNRELASLVDVMIGNEED
FT                   FTACLGFEVEGNDENLSHLDVDSYAAMIDKVVEELPNISVVSTTLRQVRTASRNDWSAI
FT                   AWSKGTGLVRSVERPDLEILDRVGGGDSFAAGLVAGLMETGGLQKAVEWGAAHGALAMT
FT                   TPGDTSMATRCEVESLAAGGSARVKR"
FT   gene            complement(419351..419998)
FT                   /locus_tag="PPA0371"
FT   CDS_pept        complement(419351..419998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0371"
FT                   /product="KHG/KDPG aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82125"
FT                   /db_xref="GOA:Q6AAU1"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAU1"
FT                   /protein_id="AAT82125.1"
FT                   /translation="MSNEALGKVLANLVIPVVVIHDAATAPAVTDGLVDGGLPVAEVTF
FT                   RTDAAPAAIESMAKDGRVMVGAGTVINARQVDEAVSAGATFVVSPGLSREVVDRCRHHD
FT                   IPVLPGVITPTEIMAGIDMGLDTFKFFPAGNFGGATTIASLDGPFPNLRFVPTGGVKPH
FT                   NLADFLSRPNIPAVGGTWLTPADAVAARDSRTIANLAREAARSAHSIVEEQS"
FT   gene            420201..420977
FT                   /locus_tag="PPA0372"
FT   CDS_pept        420201..420977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0372"
FT                   /product="putative 3-oxoacyl-(acyl-carrier protein)
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82126"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAU0"
FT                   /protein_id="AAT82126.1"
FT                   /translation="MTKVALITGGNRGIGLAISKAMLQQGYAVQILSRSELAPEVLTEL
FT                   QGLSEVGHTSGDVSDLTAHQRFIGDALDRWGRIDVLVNNAGVAPTSRDDILDATVESFD
FT                   RVLGINLSGPYFLTQAVARQLIAQRGDGTTDTTDGIVGAIVNVASCSSTMVSFNRGEYC
FT                   ISKAGVSMATQLWAARLAPEGILVNEVRPGVIATEMTAGVKEKYDRQFAEGLAPMPRWG
FT                   RPEDVAAAVVNLVIGSMRYSVGEVINVDGGMHIARL"
FT   gene            420943..421338
FT                   /locus_tag="PPA0373"
FT   CDS_pept        420943..421338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0373"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82127"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAT9"
FT                   /protein_id="AAT82127.1"
FT                   /translation="MSTAACTSRGCEMDLPTMHLAGLDVPVASVNTVVVGTGSAGYCAA
FT                   DRLAQFGQHDVLVIADTINAGASRNAGSDKQTYYKLTLAGDGPDSVGEMARILFDGGAM
FT                   DGDIALTEAALSARCFYNLVEAGVELP"
FT   gene            421322..423000
FT                   /pseudo
FT                   /locus_tag="PPA0374"
FT                   /note="oxidoreductase; frameshift"
FT   gene            423025..423681
FT                   /locus_tag="PPA0376"
FT   CDS_pept        423025..423681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0376"
FT                   /product="putative glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82128"
FT                   /db_xref="GOA:Q6AAT8"
FT                   /db_xref="InterPro:IPR029010"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAT8"
FT                   /protein_id="AAT82128.1"
FT                   /translation="MASIRVLSGHGRYTDPWHPFAEGSAAIREILEAVGHRVEVRDDDV
FT                   SCLQELDALDLVVVNLGGNVEVELEHDDEWAAAQHEFGQWIRGGGRVLAVHTAANSFPD
FT                   WPEWPALLGGQWVRGTSWHPKRCIATFGKAPGAEDYPVWTGLDVVTVYDERYSDLVVHE
FT                   GSTPLIRHELSEEWQVMGWAHGDNVIYDGMGHDARSYSSPSHRKFLINEVDWLLS"
FT   gene            complement(423884..424591)
FT                   /locus_tag="PPA0377"
FT   CDS_pept        complement(423884..424591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0377"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82129"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAT7"
FT                   /protein_id="AAT82129.1"
FT                   /translation="MSDLSRLSLNTATAKHATLAECTSACAEAGLGWIGPWRDRIQGVS
FT                   NDEAARIISEAGLKASTVCRGGFLTGTDADSLPGAIAENTRALEEAAAVGASELVMVVG
FT                   GLPTGDKDIVAARQRVADRLGDLVSIARDHGVRLALEPMHPLFTADRGVLTTLGQSLDM
FT                   AAPFSPDVVGVVVDTYHVWWDPQARESIARAGREGRISSYQICDWILPLAAETLNSRGF
FT                   PGDGYIDFPTITQ"
FT   gene            complement(424584..425408)
FT                   /locus_tag="PPA0378"
FT   CDS_pept        complement(424584..425408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0378"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82130"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAT6"
FT                   /protein_id="AAT82130.1"
FT                   /translation="MAELAHRHNIIDGVVHDKLYLPGLVKLRRLVDMGFFGRILSMRGE
FT                   FGYWVWEGTDVPSQRPSWNYRKTDGGSMTTDMYPHWNYVIEGIIGQTRDVYSQTATHIT
FT                   KRVDEQGNIYNADTDDAAYAIFNVVTPSGDPVIVQMNSSWATRVFRDELLEFQIDGTHG
FT                   SAVAGLFGCVCQPRGVTPPPARPGIPTSLTLMTTCRCGRRFPTTPPLPPAASTTVSRHS
FT                   GRNTSPTSRWIVGTASTCCREHAKSNLPNSDCGRPPRDDAFTSPRSWWTSDE"
FT   gene            425575..425880
FT                   /locus_tag="PPA0379"
FT   CDS_pept        425575..425880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0379"
FT                   /product="putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82131"
FT                   /db_xref="GOA:Q6AAT5"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAT5"
FT                   /protein_id="AAT82131.1"
FT                   /translation="MKDGATFINTARGAICDQDALIAELQRDRISAIIDVTDPEVNAPD
FT                   SPLWTLPNVILTPHAAGSMGRELHRLGDGAVDDLANYISGAPVAGEFPVGQYAGRA"
FT   gene            complement(425934..428375)
FT                   /locus_tag="PPA0380"
FT   CDS_pept        complement(425934..428375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0380"
FT                   /product="hyalorunate lyase"
FT                   /EC_number="4.2.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82132"
FT                   /db_xref="GOA:P0CZ01"
FT                   /db_xref="InterPro:IPR003159"
FT                   /db_xref="InterPro:IPR004103"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011071"
FT                   /db_xref="InterPro:IPR012970"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR038970"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CZ01"
FT                   /protein_id="AAT82132.1"
FT                   /translation="MFGTPSRRTFLTASALSAMALAASPTVTDAIAAPGPDSWSALCER
FT                   WIDIITGRRAARTSDPRARAIIAKTDRKVAEILTDLVSGSSRQTVLISADLRKEQSPFI
FT                   TKTARAIESMACAWATPGSSYHKDPEILSACIEGLRDFCRLRYNPSQDEYGNWWDWEDG
FT                   ASRAVADVMCILHDVLPPEVMSAAAAGIDHFIPDPWFQQPASVKPTANPVQPVVSTGAN
FT                   RMDLTRAVMCRSIATGDEKRLRHAVDGLPDAWRVTTEGDGFRADGGFIQHSHIPYTGGY
FT                   GDVLFSGLAMLFPLVSGMRFDIVESARKAFHDQVERGFIPVMYNGQILDDVRGRSISRI
FT                   NESAAMHGISIARAMLMMADALPTHRAEQWRGIVHGWMARNTFDHLSEPSTLVDISLFD
FT                   AAAKARPVPESSTPSYFASMDRLVHRTADWLITVSNCSDRIAWYEYGNGENEWASRTSQ
FT                   GMRYLLLPGDMGQYEDGYWATVDYSAPTGTTVDSTPLKRAVGASWAAKTPTNEWSGGLA
FT                   SGSWSAAASHITSQDSALKARRLWVGLKDAMVELTTDVTTDASRAITVVEHRKVASSST
FT                   KLLVDGNRVSSATSFQNPRWAHLDGVGGYVFATDTDLSADVATRKGTWIDVNPSRKVKG
FT                   ADEVIERAYASLHVTHHDRPVAWALLPTASRSHTMALATRPGVEPFTVLRNDATVQAVR
FT                   SAGALLTKDPTVVTTLAFWKPATCGGVAVNRPALVQTRESANQMEVVIVEPTQKRGSLT
FT                   VTIEGSWKVKTADSHVDVSCENAAGTLHVDTAGLGGQSVRVTLARQVTQTPSGGGRHDR
FT                   A"
FT   gene            428537..429409
FT                   /locus_tag="PPA0381"
FT   CDS_pept        428537..429409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0381"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82133"
FT                   /db_xref="InterPro:IPR016624"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAT3"
FT                   /protein_id="AAT82133.1"
FT                   /translation="MTQRSPLTHWGREDWCNLADRLVTTAMSHATPGHGRIVMPGEPGG
FT                   LGPDIDGLEELASWWAGGVAAGVDQRAEDRWLRPSEHWQAVVEACSLALTLHFTKPWIW
FT                   DQLSQRTQEQAVEWFQDVRNPEIPDNNWIWFQVIVETFLRGLGADWDEALVREHLERHE
FT                   DWYRTDGWISDGPRRCYDHYVGWAMETLPALWTLMDPTWDLSRDFATVHGPRLRRYLED
FT                   VPFLVGADLDGHGGTAPLIQGRSLIYRWCTCAPLWAGTFMGVSPVSPRTDEAYLLGNRK
FT                   AFPRSRSGR"
FT   gene            429195..430067
FT                   /locus_tag="PPA0382"
FT   CDS_pept        429195..430067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0382"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82134"
FT                   /db_xref="InterPro:IPR016624"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAT2"
FT                   /protein_id="AAT82134.1"
FT                   /translation="MRTSPSSSELIWTATEVPLLSSRDVASSTGGAPARRCGPEPSWVF
FT                   LQCPPGLTRRICSGTVRHFLDRGAGADGILTMGWFGEFRPMAQFYFGVGSPYWASKGML
FT                   GLALPADHLVWAAEEEALPVEKEDTHRLISTPGWMVSGTSADGVVRVLNIGTDGENEAD
FT                   LVSEAPLYTSLGFSTVTAPAQAGEWTLQPVANVVALRDAKGRVSCRSGQHVDRLEQLGD
FT                   VLVGQSSWQVHWIKVEPDSQVGYGARGESDLGPRIVCAQVCHQGIEVRCAWFDEDVPVA
FT                   SVVVAGLAD"
FT   gene            complement(430312..431268)
FT                   /locus_tag="PPA0383"
FT   CDS_pept        complement(430312..431268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0383"
FT                   /product="putative tRNA/rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82135"
FT                   /db_xref="GOA:Q6AAT1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAT1"
FT                   /protein_id="AAT82135.1"
FT                   /translation="MARNSQRRGAGHKGKSSAVGSGGRGRKALKGRGPTPKAEDRVYHK
FT                   AYKAKQERLARAAARKPAKSKGAGPEWVIGRNPVLEALHVGLPVRTAYVAEGAEHDSRL
FT                   REILTFAADHGIALMQATRGELDRMTGGSNHQGVALRLPEYEYATVDDLIAAGNQTYHG
FT                   GLIVALDKVTDPRNLGAIIRSAAAFGAQGVLIPSRRSASMTAAAWKTSAGAAARVPVAM
FT                   ASNLNQALGKFAATGWMIVGLAGEADSDIAAAPGLDGPLVLVVGSEGEGLARLTRQSCD
FT                   VLTSIPISSDVESLNASVAASIALYEASRVRVSASED"
FT   gene            complement(431282..432754)
FT                   /locus_tag="PPA0384"
FT   CDS_pept        complement(431282..432754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0384"
FT                   /product="tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82136"
FT                   /db_xref="GOA:Q6AAT0"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AAT0"
FT                   /protein_id="AAT82136.1"
FT                   /translation="MVSDVSGYTGSLSHVTFKLYNTATHGIETFKPLREGQVSIYHCGM
FT                   TVQSSPHLGHIRKEVVFDVLRRWLECSGYRVTVVANVTDIDDKILAKSAAAGTPWWAHA
FT                   YHYENELHAAYKALGCRPPTYEPRATGHIPEMIELVKTLIEKGHAYPAPDGSGDVYFDV
FT                   RSWPRYGELSGIRVDEMSPAEDSDPRGKRDPRDFALWKGHKEDEPETASWVSPWGRGRP
FT                   GWHLECSAMSGKYLGEAFDIHGGGIDLRFPHHENELAQSAAAGRPFAHYWMHNAWVTMS
FT                   GEKMSKSLGNTAQVSEVTKTYSPRAVRYFLLAPHYRSMIEFSPSDEGTMGSLDEATKAI
FT                   ERIDSFLDRASNLVGEQVTASHELSEAFVTAMDDDLGTPQAVAALFSQITEGNKSVSIG
FT                   DAEATRHHLSQVKAMLAVFGLDPQAPEWADVAGSDDRLEPVVDGLVHAMLEQRAEARAR
FT                   KDWATADAIRDTLTNLGLTIEDTPAGAHWSLS"
FT   gene            432761..432979
FT                   /locus_tag="PPA0385"
FT   CDS_pept        432761..432979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82137"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAS9"
FT                   /protein_id="AAT82137.1"
FT                   /translation="MAEIRKHKPSSSPIARALEAAMGESIKPVVPGSRPDKGVEEPETK
FT                   LESTPSVAAGSAQWGSFTVAMLPKSSD"
FT   gene            complement(432990..434408)
FT                   /locus_tag="PPA0386"
FT   CDS_pept        complement(432990..434408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0386"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82138"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR025111"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAS8"
FT                   /protein_id="AAT82138.1"
FT                   /translation="MGGKLFLVTRFLSAKPDSRLLPLPWSTPLAQWPQERLVALPRGIS
FT                   RHVVRFITVDDDVYAAKEVVEHLAIHEYRLLHDLMRLDTPSVEPIGVITDRVASNGEPL
FT                   EPIILTRHLRFSLPYRSLFHSGVRQGTVMRLLDALVVLLVRLHLVGFLWGDISLSNVLF
FT                   RRDAEAFAAYLVDAETGELHDHLTTGQREHDLQIARTNLYGEFLDLEEGDMLDDALDPL
FT                   GLVTTIEDRYHDLWNELTAAEEFDGGDYSQVESRVRRLNALGFDVAELDIQTSPDGQRL
FT                   RIQPKVVDAGHHQRRLLRLTGLDTEEFQARRLLNDLDTFRARNGLQGVDEAVAAHRWLT
FT                   ECFEPVVQQIPPELSRKRELAQFYHEVLDYRWYESQRQQREVPHVEAAQGYVRDILAKL
FT                   PDEAISTESVVPVDGSPAHSGHELVNVYDPSLGYVEDEEENAPYDPWEAHAEAIDVESA
FT                   SRLDIDALRARMKR"
FT   gene            434660..435178
FT                   /locus_tag="PPA0387"
FT   CDS_pept        434660..435178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0387"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82139"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAS7"
FT                   /protein_id="AAT82139.1"
FT                   /translation="MTDNKTASAKSDATKTENLPETTTKETLPPSPLHTDHGSTLIAEQ
FT                   VVQKIAGIACREVPGVHAMGSTGRRMLSSITDRIPGSTTNVSNGVQVEKGERQCAIDLS
FT                   VVIEYGYSVVEVANKLRETIIDAVEYGTGLEVVEVNVQVTDVYIQGEDDHDDDQSDQVA
FT                   GQRKNTELS"
FT   gene            435190..435375
FT                   /locus_tag="PPA0388"
FT   CDS_pept        435190..435375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82140"
FT                   /db_xref="GOA:Q6AAS6"
FT                   /db_xref="InterPro:IPR018730"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAS6"
FT                   /protein_id="AAT82140.1"
FT                   /translation="MNASRIGALVGLLLGVIAVCVGVWQAIVVLVLGLLGLIIGRIIDG
FT                   QLDVHDIFGKPSQRNR"
FT   gene            435375..435788
FT                   /locus_tag="PPA0389"
FT   CDS_pept        435375..435788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82141"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAS5"
FT                   /protein_id="AAT82141.1"
FT                   /translation="MSAGTTRVRSVPSLAVHNREKASRGTLTVTTAVVEKVAARVAAQS
FT                   EGFGAPTSSFFGSGSRADFDRGPKVSAVLTGRTADLEVEVAIGYPAPVQAQCDDLRARL
FT                   TEQVPKMSGVDIRTIDILVSRVVSKAPTMKELT"
FT   gene            435790..436344
FT                   /locus_tag="PPA0390"
FT   CDS_pept        435790..436344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82142"
FT                   /db_xref="GOA:Q6AAS4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAS4"
FT                   /protein_id="AAT82142.1"
FT                   /translation="MSKQYVSPPLIRRPSRTLPVTILAVVLLAAGVVAIIAAIQRLQHG
FT                   SLPQWVAWGRGHMTTASWLNDTALTVAIVIGVVALLFLIWAFKPGRTSGVFLQPSEGAP
FT                   DNREIVMDNSDLTGWLSRWLDEEDGVASSVVKRRGKTLKVHAETDVKDPEVMREQLTTR
FT                   IAARVDSLGLEQPLKVEVRLR"
FT   gene            436341..437057
FT                   /locus_tag="PPA0391"
FT   CDS_pept        436341..437057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82143"
FT                   /db_xref="GOA:Q6AAS3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAS3"
FT                   /protein_id="AAT82143.1"
FT                   /translation="MKGRANRTRLAVVGIIGLVVVAWFMLVRFNVVSSWGWRQPKPDAP
FT                   IVDVPKAWRTDYASWALLIVGILVAVIGLVWLLRQFSSSNRAHTYGMSHEADHGSTVLS
FT                   TDALGRAVEEQIEEFPGVSSASVRFFGARVAPEMMVQIDIDDRADVRKLVDRLESEVAR
FT                   DVEATLDAKLVRFGTKLRTGPHVTGMGVSHVGVTEVPNIDDSGDSLPANPMPKSTFLQE
FT                   KSDRAKPRTREGKVLA"
FT   gene            437114..437689
FT                   /locus_tag="PPA0392"
FT   CDS_pept        437114..437689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0392"
FT                   /product="putative RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82144"
FT                   /db_xref="GOA:Q6AAS2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAS2"
FT                   /protein_id="AAT82144.1"
FT                   /translation="MVSRVDGHGGDEVILADIRAAQDGDAGAYARIVKSWGGRLLRFCR
FT                   NNLPATIDAEDVVQDVLLTAWQKLPGLDDRSRFRAWMYTIARNRCREVIRTAGRRATDP
FT                   VSPEEVAVKIDSRQDPARAHARDAAMMALRKSVAGLPDTQRSIWVMAQIDGLGYAEIAD
FT                   IEGLPLSTVRGRLARARATIAKEMESWR"
FT   gene            437680..438204
FT                   /locus_tag="PPA0393"
FT   CDS_pept        437680..438204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82145"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAS1"
FT                   /protein_id="AAT82145.1"
FT                   /translation="MEVKLACGADMNRVWEGATQPLTEHEAECPACQAVRTEALRADQL
FT                   RDDTVAEDAQTKVVVDPLKLSSVWRSYAADLSPRHCVFDDDGGQVEVRETVLAAIVRNS
FT                   LADCEDGRLNRIRFSVPHTPLRLRIDLSVARGVRIPDCAERVRHRISTAMTRELGGRPE
FT                   AIDIIVEDIHV"
FT   gene            438197..438550
FT                   /locus_tag="PPA0394"
FT   CDS_pept        438197..438550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82146"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAS0"
FT                   /protein_id="AAT82146.1"
FT                   /translation="MSELKNDDVVSGTLLTGEHIIDDLAGIIVTTVRNTPGVTRLVKPW
FT                   WRRIGNDDRSAIRISEEDGLSEVKVEVTVDLTVPIVQLTQDLRHRVSTAITQSGRTPGK
FT                   VDIVVSKVEPNNE"
FT   gene            complement(438616..439935)
FT                   /locus_tag="PPA0395"
FT   CDS_pept        complement(438616..439935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0395"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82147"
FT                   /db_xref="GOA:Q6AAR9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAR9"
FT                   /protein_id="AAT82147.1"
FT                   /translation="MRQDLIHSSPHAENSPLDKENRCIFTPRPTFVGCVHYDQFWLLET
FT                   SEGPGDIRHRFSTTDRRARTCPWKGTTVMATVQYKEATRVYPGTDRAAVSKLDLDIGDG
FT                   EFMVLVGPSGCGKSTSLRMLAGLEEVNAGSIWIGDRDVTDLPPKDRDIAMVFQNYALYP
FT                   HMTVADNMGFALKMQNVPKAERQQRVLEAAKLLGLEDFLNRKPKALSGGQRQRVAMGRA
FT                   IVRNPQVFLMDEPLSNLDAKLRVQTRTQIAALQQRLGVTTVYVTHDQVEAMTMGDRVAV
FT                   MRDGVLQQVDSPLALYDTPKNLFVAGFIGSPAMNLMEGDVVDGGVELGDYVVPVSRDVL
FT                   AKVPNETKLTLGIRPEAFTLASEGIGLDVAVVEELGADAYLYGSLVGSGKQASIEDGEA
FT                   HQVVARISSRRPPQRGEQVRLGVDPASVHVFSQETTERIS"
FT   gene            complement(440439..441875)
FT                   /locus_tag="PPA0396"
FT   CDS_pept        complement(440439..441875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0396"
FT                   /product="L-serine dehydratase"
FT                   /EC_number="4.3.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82148"
FT                   /db_xref="GOA:Q6AAR8"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAR8"
FT                   /protein_id="AAT82148.1"
FT                   /translation="MSVAVSVFDIFKVGIGPSSSHTVGPMRAARIFVTDLAQSPVWPEV
FT                   TRVRAELFGSLGATGHGHGSEAAVLLGLEGEDPATVDTDQTPARAASIANDGRITLDAV
FT                   HGGREISFDVTTDLVLHRNRSLPFHPNGMTFTAWSGQEVVVERTFYSIGGGFVVEHGED
FT                   EHPAIVRDSAPVPYPFKTGKELLEQCSDYRMSIPEVAMANEMTLRAEEEIRGQLLDIWA
FT                   VMHACVERGCSRAGVLPGGLHVRRRAMKMHHDLVTRERITPGKPEPFGSVDWLTVWALA
FT                   VNEENAAGGRIVTAPTNGAAGIIPSCLHFAVKFLSPGSDIDSGTPGVDTGDDDLIVNYL
FT                   LAAGAVGEIYQQSASISGAEVGCQGEVGVACSMAAAGLAQVMGGTPTQVCNAAEIGLEH
FT                   HLGLTCDPVGGLVQIPCIERNALGAIKAVTAARLAMAGDGSQIVSLDQVMKTMMETGRD
FT                   MKVKYKETARGGLAVNIVEC"
FT   gene            442217..444526
FT                   /locus_tag="PPA0397"
FT   CDS_pept        442217..444526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0397"
FT                   /product="oxidoreductase with transcriptional repressor
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82149"
FT                   /db_xref="GOA:Q6AAR7"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAR7"
FT                   /protein_id="AAT82149.1"
FT                   /translation="MTSQERPAGRGQRKDDVLRELRADGALTAAELVERTSLSRPTIIS
FT                   LLRELEEDGWVSSEVGGHGAPGRPATAWAPASRAGIVIGADVLVDSMLTVVSTFHGRVL
FT                   EVRTDQLVDRCREARLDVVAGVIGEARDRWSEGFGLLRQVAVSTTGVVDGHGTVLRSDL
FT                   VPQWEGLDLAAALVQRLGVSVSVENDINMAAWGEFCCRRGQSLSSDGDMLLVQMTKGLH
FT                   TGLVLSGRIHRGRQWNAGEISDVLDLRLEDGQHPDDEWIDRAALTIGSVAGVVDPDLIV
FT                   VAGPTSRSLDVIRQVIARLHQRRVPGSVPVPAEVAALGRAASVVGAVDVALGHASAAFL
FT                   GVERPHPVALQGVERIHQEVEKGHHSVMATTRDKRTIEVLRVGVVGVGARSRLALNAEL
FT                   EGNGGAIVAVCEPHHLARRRVADRLGKDPDSIVITSDVAGLIRAGIDVAFVTSPDDTHV
FT                   EVTCALLEAGVPVYLEKPLAITLESATKVLVTAHRTGTKLYVGHNMRHMNVVRSMRDLI
FT                   RTGRIGEVKAIWCRHFVGAGGDFYFKDWHATREHGTGLLLQKAAHDIDVMHWFAGSHTT
FT                   DVVGMGGLTLYDQITDRCDHSDELMGDWYSLDNWPPLSQKGLNPVIDVEDLSMVLMRME
FT                   SGVYASYQQCHYTPDYWRNYTVIGTEGRIENFGDGEGGVIRLWNTRTHYNAEGDETFPI
FT                   IGDANGHGDADVLTVTEFLNFVRNGTRTDTSPLGAWYAVAAGIEATESLRSGSTPRMVP
FT                   SLDAELVEYFNNNQVK"
FT   gene            444549..445841
FT                   /locus_tag="PPA0398"
FT   CDS_pept        444549..445841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0398"
FT                   /product="conserved protein, putative sugar-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82150"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAR6"
FT                   /protein_id="AAT82150.1"
FT                   /translation="MDRRGFIAGAALATLAVAGCSSSKKEAGSGTASIAPDTSAELVLA
FT                   YWDKNQTRTIKENIKSFNKKYPNVKVTTNLAGYEDYWKKLRTQAQGNELPDVFWMNGPN
FT                   IQLYAGNGMLAPIDKVTDAGVKWSDYPEALVKLYTYDGKHYGVPKDFDTIGVFYNKKIF
FT                   KDAGVELPTADWTWDDFHDKAKKISDWGKSKGIYGCATTINGDGQGTYYNTIFQAGGFV
FT                   IKDDKSGFDDPKSIEGLQCWADWVKDGSVASPKVITDTKPSQMFKSGKSAMYWSGDWTA
FT                   SELAEEFKGHENDYDVIVLPKKDRKATVIHGLGWVVSARSANQAAALALVAHMGSKQAQ
FT                   ETEARNGTAIPAFHGTQDPWVKAFPQWNCKMFVDAATTYAVTYPVSRNTSVWADKEADY
FT                   VNPAFSGEMPVPETARKLATFMNDALAKEKG"
FT   gene            445838..446794
FT                   /locus_tag="PPA0399"
FT   CDS_pept        445838..446794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0399"
FT                   /product="sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82151"
FT                   /db_xref="GOA:Q6AAR5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAR5"
FT                   /protein_id="AAT82151.1"
FT                   /translation="MIHPGTRGDTAVAPLSSRSGHRKKKDPTSVGAWPALFIGPLMLGI
FT                   AVFYYWPIFENVVASLKQTNAFGGNPQFVGFENYRELFASPDLRSAIGNTLLYTVIVLL
FT                   GIPLSVAVAAMIELPGLRFKGLYRILYFMPYLAMPMAVAQVWKIVYNGQFGLLNQILRS
FT                   VGVSDPPYWLVSPGWALFAVALFGLWASIGFNVIILSAGLKSIPRELYEAASIDGASAW
FT                   RQFRMVTVPLLSPSIFFLTIMTTIGGFQLFDALYAMIGTGNPAEPRTRSLVSLFYRQAF
FT                   VNHDQGLGAAVAIVIFALVAIVTLAQFLGQKRWVNYV"
FT   gene            446796..447677
FT                   /locus_tag="PPA0400"
FT   CDS_pept        446796..447677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0400"
FT                   /product="putative transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82152"
FT                   /db_xref="GOA:Q6AAR4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAR4"
FT                   /protein_id="AAT82152.1"
FT                   /translation="MSTGSELSAVEVAALAKRGDTVSQRRFVGVHILLLLGGVLMVFPF
FT                   VYQILMSLSTNMEIQSVPPKLIPDRWQFHNYTEVFTRLPFLKQFGVSVTITVLRTVVQL
FT                   ILCSMGGYAFARMKFGGKSVLFGFVLAILMVPGQSYLIGQYEIIRELGLLETPWGIVLP
FT                   GFFSAFGVFLMRQSFMSLPAELEEAARLDGCNPWQTFWRVMVPVVKPGLFAVMITTVLW
FT                   SWNDLLWPLIVTAREESMPLSVGIATLAGQHSSEFALMMAASVMAMAPIFLLFFSMQRK
FT                   VIEGLASSGLKG"
FT   gene            448031..449068
FT                   /locus_tag="PPA0402"
FT   CDS_pept        448031..449068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0402"
FT                   /product="threonine 3-dehydrogenase"
FT                   /EC_number="1.1.1.103"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82153"
FT                   /db_xref="GOA:Q6AAR3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR004627"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AAR3"
FT                   /protein_id="AAT82153.1"
FT                   /translation="MKALVKTRPEPGLELVEVPDPVAGPNDVIVKVMRTGICGTDVHID
FT                   KWDGWAAKTVHTPLVLGHEFCGEIVELGSEVNDLEVGQFVSGEGHYVCGRCRACLAGKR
FT                   HLCRNTQGIGYAVNGAYCQYFVMPAGNVWVHHIPDLDPDVAAIFDPFGNAVHTALQFPC
FT                   LAEDVLVSGAGPIGIMAALVAQFQGARNVVVTDLSDERLELAQQLGLKNAVNVSREGLE
FT                   TVWDRFDMKEGFDIGLEMSGSGTALTSMIDNMTHGGRIALLGTPSTDITLDFSKIIFNM
FT                   ITIQGVTGRQIFETWYTMASLIRSGLDISGIITDRYPITEFREAFDVAGSGHGGKVVMN
FT                   WECLD"
FT   gene            449094..450290
FT                   /locus_tag="PPA0403"
FT   CDS_pept        449094..450290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0403"
FT                   /product="aminotransferase, putative 2-amino-3-ketobutyrate
FT                   coenzyme A ligase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82154"
FT                   /db_xref="GOA:Q6AAR2"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011282"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAR2"
FT                   /protein_id="AAT82154.1"
FT                   /translation="MYGPMKDELSAKIAALKEEGLYKAEAPLTSPQSGKITVDDGREVI
FT                   NLCANNYLGLADSPVLIEAAKKALDEWGFGMASVRFICGTQTLHQKLERAITEFLHPDD
FT                   PDNWDTILYSSCFDANGGLFEVLLGPDDAIISDELNHASIIDGVRLCKAQRFRYRNQDM
FT                   ADLEAQLQAAKDCRHIMIATDGVFSMDGFVAPLPQICDLAEKYGAMVMVDDSHAVGFVG
FT                   EHGAGTPEQWGVRDRVDVLTGTLGKALGGASGGYTCSHREVVEMLRQNSRPYLFSNSLA
FT                   PSIAGASLATLDLLKSSGDLLTKLRENTEYFRSEMTRRGFEIPESDHPIVPVMVGDAVK
FT                   AAKMADAMLAKGIYVRAFSYPVVPKGKARIRTQMSAGLTREQLDKAIKAFEEARAEIG"
FT   gene            complement(450307..451230)
FT                   /locus_tag="PPA0404"
FT   CDS_pept        complement(450307..451230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0404"
FT                   /product="putative substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82155"
FT                   /db_xref="GOA:Q6AAR1"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAR1"
FT                   /protein_id="AAT82155.1"
FT                   /translation="MITTPMTRRTLLGTALLTGLAACSSNDPLNSDGSGSGSADLIVGS
FT                   ANFTESEIIAEVYAQSLETVGITIKRRMQIGARDVYVKALQDGSVNLVPEYSGNLLQFF
FT                   QGASSASDEKSVMASLRKAVPAGMSVGEPSAAQDADSWCVTTEFSHTHKVTSLTDLATL
FT                   DSLKVGGNPELKERPYGPKGLTKAYGVPSSIVKFTALSDSSGPLTVKALTSGTVDLVDL
FT                   YTTTPAIKEQHLVVLSDPRHLIVPQNVVPLLSKKVDDKARAQLARVSKALTTDDLIGMN
FT                   QRFQGDEKASAATIAKDWLAQRGLAS"
FT   gene            complement(451252..451947)
FT                   /locus_tag="PPA0405"
FT   CDS_pept        complement(451252..451947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0405"
FT                   /product="ABC transporter-associated permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82156"
FT                   /db_xref="GOA:Q6AAR0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAR0"
FT                   /protein_id="AAT82156.1"
FT                   /translation="MNHIAAALTWLTTSSHWAGSGSIGVRIGEHLWYTLLALTIAAITA
FT                   IPAGLAIGHTGRGKTIAVACSGALRALPSLGLLTLLAISTTIGIENPVVPSTIVLAILA
FT                   IPPLLAGSYSGVDAIDDEVADGARACGMTEMQVLGRVELPLATPLLLGGLRSAALQVIA
FT                   TTTICSYLGMGGLGRFILDGLAVSDYPQMLAGSIVIIVLALVVDGLLCLVTRLLTGPGV
FT                   RHALALTPQ"
FT   gene            complement(451944..452591)
FT                   /locus_tag="PPA0406"
FT   CDS_pept        complement(451944..452591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0406"
FT                   /product="ABC transporter-associated permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82157"
FT                   /db_xref="GOA:Q6AAQ9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAQ9"
FT                   /protein_id="AAT82157.1"
FT                   /translation="MNTRWISENWDQIWQLTSHHAVLGVTPVLLSLLLSVPLGWWAHRA
FT                   RTARRILVPGASVLYALPSLPLFVLLPLILGTKILDPINVVVALTLYGIAVLVRTATDA
FT                   FDSVGRSVRRDAVAIGHSDSQVFWRVALPLAVPALVAGMRVVSASTLSLVSVGALVGVP
FT                   SLGYFFTDGYQRSFPTEIWVGIIGTLVLAIIFDLVIVCVGRLLTPWRRAATI"
FT   gene            complement(452588..453424)
FT                   /locus_tag="PPA0407"
FT   CDS_pept        complement(452588..453424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0407"
FT                   /product="putative ABC transporter ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82158"
FT                   /db_xref="GOA:Q6AAQ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAQ8"
FT                   /protein_id="AAT82158.1"
FT                   /translation="MIRFDHVSKRFDDGTVAVDNFELTVESHHLVVLLGSSGCGKTTLL
FT                   RMVNRMVDPSEGRILIDDTDVATVNPVKLRRQIGYVMQSGGLLPHRTVVDNIAAVPLLS
FT                   GVSRTAARTRAMDLLERVGLDSSLARRYPTQLSGGQRQRVGVARALAANPDILLMDEPF
FT                   GAVDPVVRTELQQGLLQIQADLAKTIVFVTHDVDEAFLLGDEVLVLRREAQVAQRGRPD
FT                   DVLLHPIDDFVSSFIGGDRRNLHMERHDDHPTIVDAGGRLVGRFANQPSTTVRENS"
FT   gene            453574..454374
FT                   /locus_tag="PPA0408"
FT   CDS_pept        453574..454374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0408"
FT                   /product="hypothetical membrane protein (DedA family)"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82159"
FT                   /db_xref="GOA:Q6AAQ7"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAQ7"
FT                   /protein_id="AAT82159.1"
FT                   /translation="MQNEMSTAAAGEKDSFAVAATSLAVAEDELARSSTGTESSAEEEW
FT                   WKAEGMPWNHKPGRSDYWCMGWIGFLGIFSLAMLPLRGWLLGLDPPILMGLTGSRTGAA
FT                   ATGALASVGQAPYWLWWLLLGSIMSIKLDWVYWWAGKLWGRGMIEVWAGRSERAHRRYD
FT                   QAEKWARKLGWLGVLVAYVPIPLPIMPVVFVLTGASGMKVRWFIALDFVAATIWNLGYL
FT                   GLGWGVGDPIVDALKYYAKIANWVAIALIIVILAPIFVKKKQKA"
FT   gene            454390..454761
FT                   /locus_tag="PPA0409"
FT   CDS_pept        454390..454761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0409"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82160"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAQ6"
FT                   /protein_id="AAT82160.1"
FT                   /translation="MEDMTIFRAVNIRDDLKKGPAEGYRVLVDRMWPRGVKKDDARLDE
FT                   RRTDLAPSSQLRTWWNHDPERFDEFAGRYEVELDESGAAKTFLEECAGRDEVILLYGAG
FT                   DREVNHAVVLERILTELAN"
FT   gene            complement(454792..455463)
FT                   /locus_tag="PPA0410"
FT   CDS_pept        complement(454792..455463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0410"
FT                   /product="conserved protein"
FT                   /note="domain of macro histone 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82161"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAQ5"
FT                   /protein_id="AAT82161.1"
FT                   /translation="MDGTGGRGTCGAHGGTPLLDTATALLANSRASIAVTPDDSAEGDR
FT                   GSCTIGAMADITILRADITTLDVDAVVNAANRQLAGGGGVDGAIHRAAGPELSQACRKL
FT                   RETTLTDGLPTGQSVATTAGKMPAKWVIHTVGPVWAKTIDKSDQLASCYRTSLHVADEI
FT                   GARTIAFPTISAGVYGYPMDEATRIAVETCRQTVTKVDTIYLVAFNAEAEAGYRAALGE
FT                   E"
FT   gene            455425..456441
FT                   /locus_tag="PPA0411"
FT   CDS_pept        455425..456441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0411"
FT                   /product="zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82162"
FT                   /db_xref="GOA:Q6AAQ4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041694"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAQ4"
FT                   /protein_id="AAT82162.1"
FT                   /translation="MSTTRPTTTRAVHLASRPHGAPTEDNFRIEEISLPELSDGQILVA
FT                   NDVMSVDPYMRGRMNDVKSYVPPFHIDRPLDGGAVGTVIESRSEDIPEGSHVSHQLGWR
FT                   EHAVLNAGDAHIIDTDIAPASAYLSVLGMTGLTAYAGLTRAAEMKAGDAVFVSGAAGAV
FT                   GSMVGQLARLLGASRVIGSAGTDAKVARLRELGFDAAFNYHDGPSTELLGQAAPDGIDV
FT                   YYDNVGGDHLEAAIDHLNIDGRVAMCGAISQYNSVEPPCAPRNLALAIGKRLTLRGFVI
FT                   AKYAEEVRPEFQQRMAEWLPADEIHWDETFRDGLDAAPQAFIDMLDGANTGKMLVRL"
FT   gene            456507..457520
FT                   /locus_tag="PPA0412"
FT   CDS_pept        456507..457520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0412"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82163"
FT                   /db_xref="GOA:Q6AAQ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAQ3"
FT                   /protein_id="AAT82163.1"
FT                   /translation="MSWPSCDIEGWWLQSCRFETGAMDKPAIEIRDLVKSFPQTGSRER
FT                   LIAVDHLSMTINRGEVVAFLGPNGAGKSTTVDMLLGMTRPDSGKVSVLGSDPRTAARTG
FT                   CISAVFQTGGLLPDFTVAETMKAIAAAHGQRSRVKPLIERWELAPFAGTKVGKCSGGQR
FT                   QRLRFALAMLPKPDVLILDEPTTGLDVEARRHFWQVMGEEADAGRTVIFATHYIEEADS
FT                   FARRVVLVSGGQLVADGPINEVRASVSGSIVRATLTDPSGLAEGLHTFPGINDVTVRGQ
FT                   QLIVHTSQPDDLARYLLAHTDAHGLLISTTTLEDAFVRLTGSNDSRDDADDWEAAA"
FT   gene            457517..458101
FT                   /locus_tag="PPA0413"
FT   CDS_pept        457517..458101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0413"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82164"
FT                   /db_xref="GOA:Q6AAQ2"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAQ2"
FT                   /protein_id="AAT82164.1"
FT                   /translation="MITYALLDIRRLLRNTGGTIFTVLMPAGFYLIFGATQSYTDAAVA
FT                   HGNVKATIMVSMAVYGAVLAVTTWGSHAALEQQRGWGRQLALTPMTPLKYVFSKVLAIE
FT                   TVALVPLAVVFATGAITNARVDGLRWLWSFLLCWVCSMPFTLFGLAVALLVRGEAATGI
FT                   TSFCTVAVAFLGNMFIPLNGFMLKLSRFTPM"
FT   gene            complement(458088..458387)
FT                   /locus_tag="PPA0414"
FT   CDS_pept        complement(458088..458387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0414"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82165"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAQ1"
FT                   /protein_id="AAT82165.1"
FT                   /translation="MRCPYDYYHGGVLPASLVHSRGVVLIDFVPDVDFSSAPILSAVLT
FT                   TSTRQHCHDPHDYRPSDDTDDRTPHRLVDHATHRHHLLPDERHPRQLAGPTTLG"
FT   gene            458331..459497
FT                   /locus_tag="PPA0415"
FT   CDS_pept        458331..459497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0415"
FT                   /product="putative sensor histidine kinase, two-component
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82166"
FT                   /db_xref="GOA:Q6AAQ0"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAQ0"
FT                   /protein_id="AAT82166.1"
FT                   /translation="MHEASRKDSAMVVIVGASHPIPLRRRNRNALAAGIWLVFLAYTVV
FT                   SLQSSHLPPWRIALGWVGLTIFALFYLTLFWWHVDGLELWYTKRQVRRSAIVGQVVLVV
FT                   LCALLALVSPKMVASALVYPIAFAVFQMPEVALEITLAIEVVGIAVLVWTVPDLMPWAI
FT                   SWAISVALVTVVGVLERTACREQLACQAEQDVLARLEEREQVASDVHDLLGQTLTVMAM
FT                   KAQLAERLIGTDPDAARAQAVELHGLTRRALAQVRELVSDMAHMGVDAQLAAARTALEA
FT                   AGVECVVSDTRTDVQGGCHGEGSEFDTVRGWVLREAVTNVVRHAQAHTCCVEIDDEILV
FT                   ISDNGRGRGGAPEGNGLTGMRRRVEAAGGELWIGPGERGHGTRIVVTG"
FT   gene            459502..460122
FT                   /locus_tag="PPA0416"
FT   CDS_pept        459502..460122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0416"
FT                   /product="two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82167"
FT                   /db_xref="GOA:Q6AAP9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAP9"
FT                   /protein_id="AAT82167.1"
FT                   /translation="MIDKTPIRLVLADDQTLVRGALAALLGMEDDLEIVGTCGRGDEVV
FT                   GLVQDTYADVCLLDIEMPGLDGITVAAELRDQAPWCRILIVTTFGRPGYLRRAMDAGVA
FT                   GFLVKDTPAEVLAQVVRKVHAGGRAIDPALAAESLIEGHNPLSGREREILRLAESGASI
FT                   SLIASELCLSVGTVRNHVSSAIGKTGAANRTEAAVTARRRGWL"
FT   gene            complement(460395..461102)
FT                   /locus_tag="PPA0417"
FT   CDS_pept        complement(460395..461102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0417"
FT                   /product="conserved protein, phosphoglycerate mutase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82168"
FT                   /db_xref="GOA:Q6AAP8"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAP8"
FT                   /protein_id="AAT82168.1"
FT                   /translation="MVGDNAQPQTSSPAEQTDGNVAAWRDRHASHLIEIELSSGPGSLP
FT                   KVSRIVIVRHGQSTWNRQGRIQGQTMGVRLTMRGRSQARQAARTVADLVPHGTPTIASD
FT                   QKRAVQTARPIARVLGVQVMTDPRLREQGLGAMEGHTADELEPLPQPTGVHPADVRWAG
FT                   GESLADVAERCHSLLDDLAARHLSAIVLVTHGDTMRILLGILDGRSHRDLDWDLSLTNG
FT                   SVMVRNVDLGELH"
FT   gene            461019..462047
FT                   /locus_tag="PPA0418"
FT   CDS_pept        461019..462047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0418"
FT                   /product="cobalamin biosynthesis CobD/CbiB protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82169"
FT                   /db_xref="GOA:Q6AAP7"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAP7"
FT                   /protein_id="AAT82169.1"
FT                   /translation="MSITPRRHVAVGLLCRAAGLGLGIIADHIVPDPQTHHPVAVFGAA
FT                   VARLEKTMYADSTRRGTLFTVTCLTPLAVIGGAVDRLTRNRPALRIATTALATWAVVGS
FT                   ASLAREGRAMAGHLANGDLVAARKRLPHLCGRAPDALDAAEIARGAVESMAENASDAAV
FT                   ASLWWGAVAGLPGLLVHRGANTLDAMIGHHNDRYEHFGKVAAYLDDVVNWVPARFTGAL
FT                   AAGCASTVGGDRKTTWRVVRAEHGHHPSPNGGWCESAWAAALGVQLGGRNVYYGNRVEF
FT                   RPLLGSGTRPDADKTADAARLVTTVTTAATWCAVAGLASVAHVLFYGGLIPRGLLPHST
FT                   RR"
FT   gene            462065..463519
FT                   /locus_tag="PPA0419"
FT   CDS_pept        462065..463519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0419"
FT                   /product="cobyrinic acid a,c-diamide synthase CbiP"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82170"
FT                   /db_xref="GOA:Q6AAP6"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AAP6"
FT                   /protein_id="AAT82170.1"
FT                   /translation="MTGILVAGTSSDAGKSLVVTALCRVARRRGVDVVPFKAQNMSNNS
FT                   MVCADGSEIGRAQYLQATAAGVTPTSAMNPVLLKPGTDRRSFVVLRGKPGGVLEAGEYT
FT                   TGRRYLAEAAWAAYDELAASHDMVICEGAGSPAEINLRRGDYTNMGLARAKNLPVVLVG
FT                   DIDRGGVLASLFGTWALLDDDDRALLAGYIVNKFRGDDAILAPGLEEITDRTGMPSFGV
FT                   LPWVPGVWLDGEDALEVGRWRHEGDAVDPSSLRVAVVRFPRISNATDVDAMAGETGVDV
FT                   QVTTNPDTCQAADVLVLPGSRSTVSDLEWLRRSGIADVVARRAEQGRTVVGICGGYQML
FT                   CRTILDPDGQETTPGSVVEGLGLLPVEVDFAATKTLALSHGTWRGIEVGGYEIHHGVCR
FT                   SLEDAEAFLDGVHVGPVWGTMWHGAFEHDEFRRTWLADAARHAGSSWRPHSDELGYQAR
FT                   REAMIETLADALEAHVDVDRILHLVR"
FT   gene            463550..463849
FT                   /locus_tag="PPA2397"
FT   CDS_pept        463550..463849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA2397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA2397"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82171"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAP5"
FT                   /protein_id="AAT82171.1"
FT                   /translation="MNSATLFSDDLVQAVSVQEHHGGDREPVMRCGDVFLATAALGVCG
FT                   VSSRLCSICDRAMSNPVRFRSGPATVRHPMRCSQTLCPVPAEQTVRRGYLRRTT"
FT   gene            463846..464601
FT                   /locus_tag="PPA0420"
FT   CDS_pept        463846..464601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0420"
FT                   /product="tetrapyrrole methylase, putative precorrin-2
FT                   C20-methyltransferase, CbiL"
FT                   /EC_number="2.1.1.130"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82172"
FT                   /db_xref="GOA:Q6AAP4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAP4"
FT                   /protein_id="AAT82172.1"
FT                   /translation="MNDATSRTLFGVGVGPGDPELVTVKTVRILREADVILVPYTEATT
FT                   DGPGRAESIVTAVAPEIAGRIRRIPFSMRERSGVGEKRKASWQVSSDAVVTAFDEGART
FT                   VALATVGDPTVFSTFTYLRANVEERLPDVTVELSPGITAMQALSAASGRPLVEGKEILA
FT                   LVPATVGISKLGQVLDLVDSVAIYKGGRKLPDVVEQLRSRDRQAVIGTDVTLESEQIIT
FT                   LDEVADAQTLPYFSTVLTTPERTTTGGKL"
FT   gene            464598..465569
FT                   /locus_tag="PPA0421"
FT   CDS_pept        464598..465569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0421"
FT                   /product="tetrapyrrole methylase, putative precorrin-3
FT                   methylase, CbiF"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82173"
FT                   /db_xref="GOA:Q6AAP3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAP3"
FT                   /protein_id="AAT82173.1"
FT                   /translation="MSEPQAARPTQHVSEKALEDLDHNVIEPPPVPRRDIPEGAGKVVF
FT                   VGAGPGAPDLVSVRGARVIETADIIIWASSLVHPDMVARHKEGAELIDSASIPLEDLEP
FT                   LYTRARDEGLMVARVHTGDPSIYGATAEQRDLCRRIGIDFETIPGISAFSAAAARMDVE
FT                   ITVPEVSQSLILTRLEGGRTPMPDGETVASFARHGATMAIYLSAARNKALQEALLEGGY
FT                   LPETPCIIGYAVTWPEEMMFRCDLAHLSETMRNHKLWKHAVVLVGPALAEGPISTRSHL
FT                   YHPGFRHEYRAADAQAHADLKAHGTCGVYHRNSTNPDTKGNS"
FT   gene            465566..468136
FT                   /locus_tag="PPA0422"
FT   CDS_pept        465566..468136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0422"
FT                   /product="tetrapyrrole methylase, putative CbiE/G/H fusion
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82174"
FT                   /db_xref="GOA:Q6AAP2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAP2"
FT                   /protein_id="AAT82174.1"
FT                   /translation="MIRVHGYLGTISDALREEVTQADLVVGGQRHLDALAVPDDKRQKL
FT                   GLIGPAIERIQSLPDDANVVVIASGDPLFFGVVRRIRQAGLRVEVVTAPTSLQAAFAAV
FT                   ALPWDDAQFVSSHSKDIETAVRLAKIHPKVGVLTAPNRGLAELVDGLAGRGKTFVLAEK
FT                   IGEEGQRVRVLDEDAAKAVIADEDILSPNVVLVLEHHPDSPEALGINPELAGDVNVNGP
FT                   DDPQPGSDTNPDGSDRDPIIGQIINSDAAVAHAEAIDRALKRETKKYVGPSRTGLAAAW
FT                   GECDLIVSHLALGATTRIIAPLLESKKTDPGVVVVDEAGRFAIPLVGGHVGGANELSRT
FT                   VAEALSGTAVVSTATDSLGVPALDQLGWAYEGDVAGVTGSIIAGRPVLVVREQPWPLPP
FT                   LPQNVTEDVETPAARVIVSERVAERVFVDHGDDLPTVVLHPSCLVVGMGCNKGTEVESL
FT                   RQLLVKTLEDNGLALGSVTRLVSHEVKAGELGLVKLANQLGVEYRTESAEALAAHDVPT
FT                   PSDVVAREVGTPSVSEAAVLCQGAELLVHKTKTSEATCAIGRIPARGHLSVVGLGPGSR
FT                   DLLTPRAVEAIRNATFVAGYAPYVRQIRDLVRPGATILATKMGTEEERTQAAIEATRDG
FT                   RNVAFVCGGDPAIYAMASPTLEMGTDGIDVEIVPGVTAELAISAILGAPLGHDHATISL
FT                   SDLHTDWDLILKRVKAAAEGDLVTTFYNPRSRTRTHQLPDALAIMAEHRPPSTPVALVS
FT                   HAERRQQQVIMSTLEEFKPEWCGMTTLVVVGSTTTKYVSSGDGRRLMVTPRDYHWMDGH
FT                   VCSEARKNYTHKDLPKADEETYLSKPPVHSTRMSEPINDTKDSK"
FT   gene            468133..469401
FT                   /locus_tag="PPA0423"
FT   CDS_pept        468133..469401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0423"
FT                   /product="cobalamin synthesis protein, fusion CysG+CbiX"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82175"
FT                   /db_xref="GOA:Q6AAP1"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAP1"
FT                   /protein_id="AAT82175.1"
FT                   /translation="MTDPLTSGTPLVIAAHGTRDEAGVAECRALAERVARKLPGIPVEL
FT                   GFVELAEPGIPEAVGAAVAQAPDNPEGAGGDEEAAAVVVPLMFNTGGHVREDIPEAIDE
FT                   GRGDARVMYSAPLLPDVRMRKALNHRLTETLAAGEGCEEWRPRDTSAVLVGRGALVPDA
FT                   NASHYTLTRMFWEENDLSRVEPAFIQVTRPSVPEALSALAAQGANQIVVQGNFLFPGLL
FT                   HVWMTEQVEAWQASHPGVEIRIAPVIGDCDEVADVVVDRYREPLDEVGLGEGAPVYMSG
FT                   LRLQGRKVLVVGAGHVAERRVVRLLEAGADVHVVAPNSGIQLTRMFRKGLVNLERRAFQ
FT                   TEDLDGVWFVQALTNDPEVNALVAEEADRRGIFCVRGDNSRKGSAFTPATQQAGGMTVS
FT                   VVGDRTPRRSARLRDEVLRALQG"
FT   gene            469443..470309
FT                   /locus_tag="PPA0424"
FT   CDS_pept        469443..470309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82176"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAP0"
FT                   /protein_id="AAT82176.1"
FT                   /translation="MTGASGGAYHRRVISHDLHALGFDAPDLDALVNSAAEAGAVGVED
FT                   VGGFDLLAAYTDPSGARLALMKQKGHDEMETMASLVAPTTHPADLVRFSPAVALVDIYS
FT                   HAGLASMLTGESVLTLPTMNRRHVARFLANVDDPVEVPLCAEPGDDTPRFVKHLRVGAV
FT                   ANQMLRVFESEEEYGRSHEGSLGGELQFAAGTLISPWLMEINAGRATRGEASAVAEMTM
FT                   VCKKVEKRTNVLTGVDWYRIVGDTSIPMTLAVSANLPRVPHVGSVVTGQVVPVVSTGTW
FT                   EGDVLWG"
FT   gene            complement(470521..470928)
FT                   /locus_tag="PPA2398"
FT   CDS_pept        complement(470521..470928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA2398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA2398"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82177"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAN9"
FT                   /protein_id="AAT82177.1"
FT                   /translation="MRDPNDTAPCMGVFGLRITLGRPFPGSLPVVSPTSSPSPLRNSPG
FT                   FTPGSCDLIRAAPYRLMEDIRDLHSMPHSPVNVPSHTTESAQTTTSWGEKLHGNREVLQ
FT                   CCLDLDRDRIRPESHTSGVNAGGSYNCGHPT"
FT   gene            470958..472022
FT                   /locus_tag="PPA0425"
FT   CDS_pept        470958..472022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0425"
FT                   /product="FecCD-family membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82178"
FT                   /db_xref="GOA:Q6AAN8"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAN8"
FT                   /protein_id="AAT82178.1"
FT                   /translation="MPSSRRSVERDRRLPVAPLLLVLVVLIVVSAVISLAIGSEPLPLR
FT                   GVLDTVGARVTGQPGPDPTIDVIVWDLRAPRALLAVIVGAGLALAGSGMQTLVRNPLAD
FT                   PYLLGVSAGASVGATAVIALGMFTSWGTHRLTLGALVGALAAAALVYLISMAQGGMTPL
FT                   RLVLSGVVLSSAFSALASFLVFRSPDPRAAQSVLFWMLGSVAGATWDSLWVAALVTVVI
FT                   AVLMIAFSGWLDALAAGTDVARSLGIPDTRVRKALFVGNSVLVGVLVAVSGGIGFVGLV
FT                   IPHMARLLVGASHRSMLPIAAGVGSLFLLWVDVGARVIAAPQEVPLGVVTGFIGAPIFL
FT                   YLMGRSEYRFSSES"
FT   gene            472019..472810
FT                   /locus_tag="PPA0426"
FT   CDS_pept        472019..472810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0426"
FT                   /product="Fe uptake system permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82179"
FT                   /db_xref="GOA:Q6AAN7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAN7"
FT                   /protein_id="AAT82179.1"
FT                   /translation="MTCLDVRNVQCRIGDRVIVDDVSFTAEAGQLTAIVGVNGVGKSTL
FT                   LRSIAGVRKVNAGDVLLDGKSVNQYTPMQRARLMAFVGQEESPSPDLLLGEMVALGRTP
FT                   HRKPWQVGQRSERAIIRDALALVGLDHLIDRRCDHLSGGERRRAVIARGLAQGADLILL
FT                   DEPTNHLDVRHQLQLLETLRASGRTVVATIHDLSMAASHFDRVVVLADGGVLATGPAEE
FT                   ALSPSNVATAFHVIAHHVTTPEGSRELVCTAALPEPSRKEI"
FT   gene            472812..473882
FT                   /locus_tag="PPA0427"
FT   CDS_pept        472812..473882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0427"
FT                   /product="putative iron transport lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82180"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAN6"
FT                   /protein_id="AAT82180.1"
FT                   /translation="MSIPRLPIAVVACLAMALAGCSSGSTSKGDDAKSSSEVTLTNCGN
FT                   KVTYPKVAQRLYVNDGNIIAMALSAGAAKQIAAVSSLGDDKTILAAKYGSHVIDNLHEA
FT                   VKGYPTLESIIANKPDVVVAGWNYGFSEEGNLTPDKLHERGIGSYLLSESCRQKGSEKA
FT                   RGVMQPWDAVRTDLSNLAKLTGNEPTGKKAVKDLDDRLDALNKAPKAAKTPVVLLFDSA
FT                   KDTVLTSGNKGGPQAIINAAGGQNAAHDVNDTWVRISWEKVATLKPDAIAFVDYDAQPY
FT                   SEKVKILQSNPATKNLAAVQKKRFLNLPYAMWTSGPLNIDAAEHLRVSLEKWGLEPKSS
FT                   IKPQLTIPASVPGHEG"
FT   gene            complement(473959..475185)
FT                   /locus_tag="PPA0428"
FT   CDS_pept        complement(473959..475185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0428"
FT                   /product="ATPase of the AAA superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82181"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAN5"
FT                   /protein_id="AAT82181.1"
FT                   /translation="MQLLQRNITAWVQELLDISPIVVIEGARQVGKSTLTGMIDNANTT
FT                   FTTMDDDLTRTFAHDDPAGFLSSAKEGRLVIDEIQRCPELILSLKAVVDNDRRPGRFVL
FT                   TGSANLLRLPGAQDSLAGRAMTARLHPFSQGELEGHKEDWVSWLLSPDRRKAQEADRSN
FT                   VITRLTVGGYPLVQSMSPRVRTAWLKDYANRLVQRDASDMAQTRIPILGQLLQLLAAAP
FT                   GAELVQDRLAQKLKVTRGTVVRYSDLLESLFLIHRLPAWSRNLTKRQIQRPKVFLTDTG
FT                   LNAALSNMDAAHLSSMQGADHLGPLLEQFVVCELLRQQGWSATPFKLFHYRDRQGAEVD
FT                   IIVETPTGIIAVEVKSAVAATARHFQHLKALRDRLGDEFLAGIVLTTSTGQKAGDRLES
FT                   LPVSSLWSR"
FT   gene            complement(475278..475931)
FT                   /locus_tag="PPA0429"
FT   CDS_pept        complement(475278..475931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0429"
FT                   /product="precorrin 8X methylmutase CbiC"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82182"
FT                   /db_xref="GOA:Q6AAN4"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAN4"
FT                   /protein_id="AAT82182.1"
FT                   /translation="MAHEYINNGSDIYRESFRIIRSEANLDRFPTDVEGVVVRMIHAAA
FT                   DPAIADDIAFTPAVVTAARRALGDGAPILCDSSMTATGIIRSRLPRDNETICYIKDPRL
FT                   ADIAQAKDMTKTCAAVDLWTEEGKLDGAIVAIGNAPTALFRVLEVCEETGARPAAVVGI
FT                   PVGFVGAAESKQALVDSKLGLEYLTLLGRRGGSAIAVAAVNAIASTDELTNSHR"
FT   gene            476237..476920
FT                   /locus_tag="PPA0430"
FT   CDS_pept        476237..476920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0430"
FT                   /product="cobalt transport protein CbiM"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82183"
FT                   /db_xref="GOA:Q6AAN3"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="InterPro:IPR018024"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAN3"
FT                   /protein_id="AAT82183.1"
FT                   /translation="MHIAEGVLSPAQCAVWYAAAAPFVVHGGYRVVKEVKEHPENKLLL
FT                   ATAGAFTFVLSAIKLPSVTGSSSHPTGTGVGAALFKPPVMAFLGMIVLIFQALLLAHGG
FT                   ISTLGANTFSMAIAGPWAGYAFYKLTKKLRGPDALAIFLCMVFSDFITYVVTSFQLAFA
FT                   FPDATGGFWGAVGKFLGIFAITQVPLALIEGLVGILLFRFLAKVAAPQLKQLGVLDDNP
FT                   EVAHA"
FT   gene            476913..477347
FT                   /locus_tag="PPA0432"
FT   CDS_pept        476913..477347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0432"
FT                   /product="putative cobalt transport protein CbiN"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82184"
FT                   /db_xref="GOA:Q6AAN2"
FT                   /db_xref="InterPro:IPR003705"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAN2"
FT                   /protein_id="AAT82184.1"
FT                   /translation="MPENTVAKAHRDSSLTSKSKWVTPVIIVLVVGLFIISMVLGAKKT
FT                   SGGEEGFGGTDDAAAEAAEKAGAKKWIKPIFEPNSSEVESGLFALQAALGAGIVGYALG
FT                   RMSGRTKGREEAERASDLNSVDDVPQAAVTSSEDTSTSKS"
FT   gene            477344..478189
FT                   /locus_tag="PPA0433"
FT   CDS_pept        477344..478189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0433"
FT                   /product="cobalt transport protein CbiQ"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82185"
FT                   /db_xref="GOA:Q6AAN1"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAN1"
FT                   /protein_id="AAT82185.1"
FT                   /translation="MTITSLDDAAWDSPWRRRPVGEKVALSTALLLTALCTPSMEASRW
FT                   VRSVVGSGIWPGALLAGIVSVIVVLGPARIAGRVLWQAVVAPLVFLVIGGISVLVSLGS
FT                   TPVGTVWWHAGAFSIGPVSSAQAMSLIEHGVCGTLALMVLAVTTPMVDLLTWLRKFHIP
FT                   DPLLEIASLTYRLIFVLLDTVVTASEAQHARLGDTPAGRFGGFNRRMNNTAALLGSVGI
FT                   RAWARANRLNDGLVNRGFEAALATLPIKRTGSVRYKIIVVIVIAVLWVISWTTTGRIFR
FT                   "
FT   gene            478186..479022
FT                   /locus_tag="PPA0434"
FT   CDS_pept        478186..479022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0434"
FT                   /product="membrane associated cobalt transport protein
FT                   CbiO"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82186"
FT                   /db_xref="GOA:Q6AAN0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005876"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAN0"
FT                   /protein_id="AAT82186.1"
FT                   /translation="MSAKVLLSTEHLYATHPGRPMVLTDVNVSFRAGVRVAILGANGSG
FT                   KTTLMRCLSGSLKPAKGHVKRGDIVVSYGRAQLREHRRAVQLVLQDPDDQLFSADVSQD
FT                   VSFGPMNMGLKVDEVRDRVSESLELLGASHLAERATYQLSYGERKRVAVAGAVAMRPDL
FT                   LLLDEPTAGLDPVGVTQMLEALDRLRDHGTTVAMATHDVDLALAWAQEALVVVDGQVHQ
FT                   GPIGELLADADTVGRAHLHLPWPLELARRLGVRDLPRTMDDVVAMLSDNPSPVPSN"
FT   gene            479075..479764
FT                   /locus_tag="PPA0435"
FT   CDS_pept        479075..479764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82187"
FT                   /db_xref="GOA:Q6AAM9"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAM9"
FT                   /protein_id="AAT82187.1"
FT                   /translation="MDPMNRSSSSAALLVGAVAVPIAVCAVLSALIDVFVAPAAALVLV
FT                   LVIVIVCLRGSWLVDALVIVVSAIGFDFFLTYPYRSMKIASRPDIEVTIVLFVVGAAIA
FT                   GISRWALTASDLAERRQGYVTYALDARSGDMSRDEVAQRLAGLVGAEAGAWVDGAPPSG
FT                   EAVIQDATAMRTDVGLEDPSRVGFPTDRFICFPAAGGYIRISAASRHVRPTAEQMRAAC
FT                   LLASQIS"
FT   gene            complement(479791..480387)
FT                   /locus_tag="PPA0436"
FT   CDS_pept        complement(479791..480387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0436"
FT                   /product="precorrin 8 decarboxylase CbiT"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82188"
FT                   /db_xref="GOA:Q6AAM8"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAM8"
FT                   /protein_id="AAT82188.1"
FT                   /translation="MTHDPDTSLLGRTPGLAEEHFAHDGLITKHAVRAVALAALRPMPG
FT                   QLLWDLGTGAGSIAVEWCRTDPTCRAIGLERKAERAANARTNASELTLPGQFDVIDADL
FT                   AKGLPEGLPDPDAVFIGGGATKALVNQCRPRLPIGGRLVVHGVTMEAEMLVETLHCDLG
FT                   GDLIRFGVETADVIGRLHGWKPARTVVAWTWQRTE"
FT   gene            480617..481231
FT                   /locus_tag="PPA0437"
FT   CDS_pept        480617..481231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0437"
FT                   /product="cob(I)alamin adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82189"
FT                   /db_xref="GOA:Q6AAM7"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAM7"
FT                   /protein_id="AAT82189.1"
FT                   /translation="MPHARTSAEPDDGLSTRQRRLRPVLVVNTGEGKGKTTAAMGTALR
FT                   AWHQGWRVGVFQFVKSGRWHVGEEDALRALGQLHEEIGVGGPVTWEVMGTGWSWTRSFD
FT                   AAENPEAAAREGWRHVSDLLAHEALDFYLLDEFTYPMDWGWLDVDEVVETLVNRPGTQH
FT                   VVITGRRAPDALVEVADIVTEMTKIKHPFDVGQRGQAGIEW"
FT   gene            481231..483654
FT                   /locus_tag="PPA0438"
FT   CDS_pept        481231..483654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0438"
FT                   /product="cobyrinic acid A,C-diamide synthase, CbiA"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82190"
FT                   /db_xref="GOA:Q6AAM6"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAM6"
FT                   /protein_id="AAT82190.1"
FT                   /translation="MRLPRILIAAPASGGGKTTVATGLMAALRASGRTVAPFKVGPDYI
FT                   DPGYHSMASGRPGRNLDSVMCGDELMAPLLAHGFVTPDPADIAVIEGVMGLFDGQLGTG
FT                   RGSSAEIATTTRTPVVVVVDTAHASLTHAAVVAGLATFDPDVTVAGTILNRVASPRHGA
FT                   EVARGLARLGIPVLGQIPRTESIFVPSRHLGLVPAGEWQDSATKVAGLGDLIAEYVDLD
FT                   AVMDLAATAPDLDVEPWDPAATLESAGWQGHPFGESPVVGMFAGRAFTFRYPETTEMLI
FT                   AAGFRVVDVDPLTDRRLPDGIQGLYLGGGFPQMHATDLETNSELADDVRSHAEAGMPIV
FT                   AECAGLLYLCRHLDGHEMAGVLPMDAAMAKRLTMGYRVATRDSISVVGHEFHRTTTTPL
FT                   ADLDPAWHITMPDGTDRAEGALGDPAGLGRPTIQASYLHLHWAGQPTQAAWFASEVTKF
FT                   HEGRGDQVVEPDLNHHGDRDIADGLVDLAVNVRVSEPPQWLRDAIISTEHDWARYPDAT
FT                   PGREALAAMHGVPTDMVLPTAGAAEAFPLVATLEPRHAIVVHPQFTEPEAALRAAGISV
FT                   GRHILNVSDGFALDPDLVPDDADLVVVGNPTNPTGRLHPATDLLALRRPGRILVVDEAF
FT                   MDATDESQSLIGSDMDDLLVLRSMTKTYGLAGIRAGYVVGDSQLVAQLAAHQTPWSVST
FT                   PAIAAMIACTCEEARRFRTQLRDDIPAARANLVDKLKGLGLSVVDSEAPFVLVNTSSLS
FT                   GDSIRQPLAERGFAVRRGETFPGLGPTWIRLAVRDSNIHAELARAISDLTAHRN"
FT   gene            483664..484440
FT                   /locus_tag="PPA0439"
FT   CDS_pept        483664..484440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0439"
FT                   /product="uroporphyrinogen III methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82191"
FT                   /db_xref="GOA:Q6AAM5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAM5"
FT                   /protein_id="AAT82191.1"
FT                   /translation="MIYSADLVPGTVTLVGGGPGDPGLLTVAGFEAVRQADVILYDRLA
FT                   PTAVMDENPQAERIPVGKVPRGPYVPQERTNELLIEHAKAGRKVVRLKGGDSFVFGRGG
FT                   EEWQACAAAGVPVRIIPGVTSCVAGPELMAVPLTHRHMVQGFTVVSGHVAPGDTRSELD
FT                   WAQIAKTGTTLVILMGVAHIGDIATRLMDGGLAGDTPVAIIADASLPTQRSLTTTLEKA
FT                   AEDMAEAEINPPAITVVGDVAGLDLDGTQAHVPSDH"
FT   gene            complement(484460..485500)
FT                   /locus_tag="PPA0440"
FT   CDS_pept        complement(484460..485500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0440"
FT                   /product="precorrin-6x reductase CbiJ/CobK"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82192"
FT                   /db_xref="GOA:Q6AAM4"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAM4"
FT                   /protein_id="AAT82192.1"
FT                   /translation="MPRTVRASKLSADRDSGRRAIMLHRRERRRIPRACVLAGLGAARV
FT                   RRSGPTPVGVSERGSGLTSPKRRHSGGTVPDSHRCSTAIEAHCSTGWFDGLMDVLILGG
FT                   TTKARQLATRLIDEGVDLCSSLAGRTKSPRPVPGPTRVGGFGGIDGLKEFLTDNEVKVM
FT                   VDASHPFAAAMHGHAAQACRDLNLPLARLAPPSWRTQPEAATWHWVDDHDGAAQVLADL
FT                   PDVILLTVGRQPVSHYLRLGPRRVIVRCVDAPEEELPAGWKVLRERGPFTLDREREIFS
FT                   QGVATLVSKDSGGTGLDPKLRLAAETDVQVVMVSRGPAPGWGDELSTVDDAVQWTGNHI
FT                   ATVIEQ"
FT   gene            485439..487106
FT                   /locus_tag="PPA0441"
FT   CDS_pept        485439..487106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0441"
FT                   /product="phosphoribosyltransferase, cobalamin biosynthesis
FT                   enzyme, fusion CobTU"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82193"
FT                   /db_xref="GOA:Q6AAM3"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR017846"
FT                   /db_xref="InterPro:IPR023195"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAM3"
FT                   /protein_id="AAT82193.1"
FT                   /translation="MARLPESLSAESLLARTVRGIRGADAKALEAARARQQLLTKPEGS
FT                   LGLLEDLSIRLAGMYGQVPVTVPSHPVVGLFAGDHGVWAQGVSPDPQEITTQQMINMAA
FT                   GGAAISVLSRQMGAQLWITDVGARHEVDAPIRQRCVRRGTDDISQGPAMSLDEAVEALE
FT                   VGIETGVAAVEQGADILITGEMGIANTTPASALISVFTGLPPAEVTGRGAGSDDRRHQH
FT                   KIGVVARALQVNRPEAKHPIEALAKVGGFEHAAMAGFILAAASSRIPVLIDGVIACSAA
FT                   LTATAICPEARDFIITSHAGAEPGITASTSALGLPALLDLGMRLGEGSGAILTLPIVQA
FT                   SAHILNEMATFEDAEVIDIKVSGETEIPDTVQTSVPPCRMLVIGGARSGKSTFAESRLP
FT                   RDSRVTYVATSQRNPGDAEWEERIRLHQARRPATWQTVETTDIASVLLADDDSPVLVDC
FT                   LGVWITRILDEVGAWAAAPGDEAWQNDLRRHVNDLASAIRGTRRDVIFVSNEVGMGVVP
FT                   DTPAGRLFRDELGRLNAAVGEACDEVWMCVAGIPKRWA"
FT   gene            487055..487942
FT                   /locus_tag="PPA0442"
FT   CDS_pept        487055..487942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0442"
FT                   /product="putative cobalamin-5-phosphate synthase, CobS"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82194"
FT                   /db_xref="GOA:Q6AAM2"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAM2"
FT                   /protein_id="AAT82194.1"
FT                   /translation="MRRGVDVCGRNPQEVGMTDEQHPDLGRLGPLRGVAEALSLFTILP
FT                   GPYLNDIDRPLARRAITAFPWLGLCLGVVAGGIVALVLGLGAGPWLAGVLALGWLAGAT
FT                   GGFHLDGVADTADGLGSRAAPEKALMIMKKSDIGPMGVMSIVLVLLVDAAAVVSLAGTA
FT                   GSGAWWRVAILVGLGPALARAAILLATMTEVPCARPGGFGSLVAGVTTPRSAAINLTVL
FT                   GCVCALAGLVAGGWMWCLVTVSCAALTLLIARGWIHHLVRRLSGMTGDTFGSINEVTQM
FT                   TFWVLTALTVAVVS"
FT   gene            487939..488703
FT                   /locus_tag="PPA0443"
FT   CDS_pept        487939..488703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0443"
FT                   /product="metal binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82195"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAM1"
FT                   /protein_id="AAT82195.1"
FT                   /translation="MIDDLGVKASVARPVQRVVSLVPSITEAIAMTCPHVLVGCTDYCI
FT                   RPTHLEEIVGHEVVRVRGTKNPDRKAIIDLRPDLVVANQEENREHDVTLLREAGVAVWV
FT                   TRIDTVEEAISSLTRLFEEGFGVRCPQWLEEAGREWREPCRGEVLSAVTAVWRDPWICV
FT                   GKDTYISDVLRRVGIELVDLPGESRYPHVELTDIAAAHPDRVILPDEPYHFGPDDVSAF
FT                   PGLDVRLVDGQKLAWYGPSMVGARRYLASALR"
FT   gene            488760..488838
FT                   /locus_tag="PPA2412"
FT   tRNA            488760..488838
FT                   /locus_tag="PPA2412"
FT                   /product="tRNA-Thr"
FT   gene            complement(488925..490562)
FT                   /locus_tag="PPA0444"
FT   CDS_pept        complement(488925..490562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82196"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAM0"
FT                   /protein_id="AAT82196.1"
FT                   /translation="MKSHKLLTFAVAAIMATSGLSTMIPTQSALASGPSQGAQSQHVGP
FT                   MTCVPFFGRPGSSGQLPLGVIPPNWGTDGWQRMDSTSRSDLPSKIVMRDNTEGFNQRMD
FT                   FALRDGKVYGRFQSENQWRHIDTPSCLDGHISAISVNDAMLAAVDSNGWVYSLNNLLSS
FT                   PKDWGWFRAWGSPFWFGRGLKLDNHDQGWWALSLIDNQTDRTYRGVDGHDHPISLAMCT
FT                   EIMMVSKDGAHIYQHDSWLPNDYSFEASTPYNSRFRVHSMSASGSVALITNDHGDMFTR
FT                   LWDYDIAGTDPAQFRYTWQDQSNLPSPSTWLQGKVDPRYAAIKLPPAGWKHQPKIPGEI
FT                   TDRLTVVSTAPGSQNRELRVEGRREGHTGYWSKMIDAKAWKFVPTGQNLKGKPLDNPQR
FT                   DTSKVDLGSASGLNYSGNLQGKANINIKDFAYQSTTRTIELTVGEKKYPVKLHSIDGRL
FT                   KTTLSMLSHRERGLTSTPRYYDAAIEVPDSYLKDPDFSPFMKGYLKGEKVHELYLEVTK
FT                   DSFKVINDRHPEIALRNGRNVSILDRAK"
FT   gene            490993..491181
FT                   /locus_tag="PPA0445"
FT   CDS_pept        490993..491181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82197"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAL9"
FT                   /protein_id="AAT82197.1"
FT                   /translation="MVDAAIDDSWCLKMSVLITVPSLDKSFGCRWLLAETLPRKWLIYR
FT                   VPHGFTGDPRRMALSLE"
FT   gene            complement(491219..492808)
FT                   /locus_tag="PPA0446"
FT   CDS_pept        complement(491219..492808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0446"
FT                   /product="putative sugar-specific permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82198"
FT                   /db_xref="GOA:Q6AAL8"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAL8"
FT                   /protein_id="AAT82198.1"
FT                   /translation="MNIALAIVQFLVNEILSVPAFLIGIITAVGLAAMRKSIGQIAGAA
FT                   IKATLGFLLIGAGAGLVVNSLGPLGKMIEGALGAQGVVPTNEAIAGIAQQQFGSQVAWI
FT                   MLAGFLISLVLARITPLHYVFLTGHHMLFMATLITIVMASTSMPTSIVIGLGSLLLGVL
FT                   MVSLPALAHPFTRKITGGEDIAIGHFGTSAYIAAAATGRLVDPHGKSQSTENIKVPEGL
FT                   RFLRDSMVATALSMVLMYVVVAIVFLARRGEKAAFQTFSKPATGTGNYIMASVTQGLEF
FT                   GIAVAVILFGVRTILGELIPAFQGIASKVVPGAIPALDCPIVFPYAQNAVLIGFISSFI
FT                   GGLVGLTILATVLGPAWGLALILPGLVPHFFTGGAAGVYGNATGGRRGAVAGAFVNGLL
FT                   VTFLPAFLLKVLGPFSSANTTFGDADFGWFGILIGYGARTGTVSGSIILALIGATILGS
FT                   AILMQRRAGGWDPAPARGSSSDGVTAVVTAEEVSDDPDEATRTATASTISHRRIAPPVG
FT                   APTPPSRDELGL"
FT   gene            complement(492858..493787)
FT                   /locus_tag="PPA0447"
FT   CDS_pept        complement(492858..493787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0447"
FT                   /product="phosphotransferase system protein,
FT                   mannitol/fructose-specific IIA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82199"
FT                   /db_xref="GOA:Q6AAL7"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAL7"
FT                   /protein_id="AAT82199.1"
FT                   /translation="MRVGSQPFPQGRPRSRPHNAEPPRPLETGNGLKTVAFYPHEGVRY
FT                   GSHSDGKAPTVIDLTDLLPPAAIRLDAHVNDWREALQAVGHLLVATDTATPRYTQAMID
FT                   NLEKNGPYIVVAPGFALAHARPDSSVLRTGMSWIRLDEPVAFGHETNDPVTLVAGLAAT
FT                   DASAHQNVLAALASALADPNRRNALDTATTPQEVVSILSNEAGHRSAEASTSQNLLLTV
FT                   CGNGLGTSLFLKNTTEQVLDAWAWTPYLSVEATDTISARGRCSEADAILTSGAIAQTLG
FT                   ELSIPVEVIDDFTSVSQVDAALRRIYDV"
FT   gene            494686..495183
FT                   /locus_tag="PPA0448"
FT   CDS_pept        494686..495183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82200"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAL6"
FT                   /protein_id="AAT82200.1"
FT                   /translation="MRIRKSVSAVVATVIVAALFSGAAGSMTVVAHAESISNTGQTVTS
FT                   AMQALSDRNDLAHGGDGRIAVGDREVVRWHGGMPVAEVANSHQVSTYSWTSWGRRVALF
FT                   VLRHSVHKLPAKIRPWANKIADVLEQTEIWEKAPIIFTLGKAGIPYDVAKAAADWIIFF
FT                   LG"
FT   gene            495192..495638
FT                   /locus_tag="PPA0449"
FT   CDS_pept        495192..495638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0449"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82201"
FT                   /db_xref="GOA:Q6AAL5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAL5"
FT                   /protein_id="AAT82201.1"
FT                   /translation="MVVSKKFDDLLGMLGAIVFFLVIVILVMAPFIMIPVLFALVFQEC
FT                   YLDSPWTWETVVLGGLVLFALGMGVSLLMGVLARVVAPLTHPVVNRVFKEILEFLVLWW
FT                   FYSTLMHPTSYAFWASIVVMIMTTVTEPILDRAIERQKHAPNQP"
FT   gene            complement(495789..496271)
FT                   /locus_tag="PPA0450"
FT   CDS_pept        complement(495789..496271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0450"
FT                   /product="autoinducer-2 production protein LuxS"
FT                   /EC_number="3.13.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82202"
FT                   /db_xref="GOA:Q6AAL4"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AAL4"
FT                   /protein_id="AAT82202.1"
FT                   /translation="MREDGFMAHKMNVESFNLDHTKVAAPFVRVADVKHLPAGDTLTKY
FT                   DVRFCQPNKEHLDMPAVHSLEHSFAECVRNHSDAVIDFGPMGCQTGFYLIMIGEPDVSG
FT                   TCELVETTLRDILKLNTTPAANEVQCGWGANHSIKAAQEAAHTMLNHRDEWEQVMA"
FT   gene            complement(496309..497490)
FT                   /locus_tag="PPA0451"
FT   CDS_pept        complement(496309..497490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0451"
FT                   /product="phosphomannose isomerase"
FT                   /EC_number="5.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82203"
FT                   /db_xref="GOA:Q6AAL3"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016305"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAL3"
FT                   /protein_id="AAT82203.1"
FT                   /translation="MKRLTGTVRTYSWGSYDAIPDILGKEADGKPWAEYWLGAHETSPS
FT                   TLDGIPLTDYIHAHPDELGDRSRKVFGARLPFLLKILSAYHPLSLQAHPDAAMARAGFA
FT                   RENQDGIDADDPHRTFVDDWPKPEILVALSDFEGLCGFRDPHETRQLFDELEVLTPTDP
FT                   VLGSLTERSGSAALAETFLNCLAGDDVRRQIVTEVVSGAVNHVGEDTPLGEFARTAVEL
FT                   DEYFPGDPSILAALMLNRVHLKPGQALSVPPGLMHSYLSGTGIEIMADSNNVVRGGLTN
FT                   KHIDIDSLIQIVSFQTQEPRIIAAEEVDPGMRVFPGIDDQFRLWQLDLDTTCPAMMPAS
FT                   ELARILLITDGYAVCSGSHGTDEIVRGQAVWIPAGERVQIDGDCDGFIAAAGL"
FT   gene            complement(497535..497819)
FT                   /locus_tag="PPA0452"
FT   CDS_pept        complement(497535..497819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82204"
FT                   /db_xref="InterPro:IPR021678"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAL2"
FT                   /protein_id="AAT82204.1"
FT                   /translation="MSDSITPESAESAELCASDRAILDLEESWQAGSLSVDKETAIRDS
FT                   LGLSSPRYHLRLNELIDDEKAAQYAPSLVGRLQRVRSQQRRSRSAQLLR"
FT   gene            498152..499786
FT                   /locus_tag="PPA0453"
FT   CDS_pept        498152..499786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0453"
FT                   /product="60 kDa chaperonin TCP-1/Cpn60"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82205"
FT                   /db_xref="GOA:P0CY97"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CY97"
FT                   /protein_id="AAT82205.1"
FT                   /translation="MAKLIEFNIEARRGLEAGMNTLADAVKVTLGPKGRNVVLEKSWGA
FT                   PTITNDGVSIAKEIELDDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQAMVREGLR
FT                   NVTAGANPMGLKKGIEAAVQAVSARLSDMAIDIETKDQIASTASISAADPTVGEIIAEA
FT                   MDKVGKEGVITVEESNTFGLELELTEGMRFDKGYISPYFVTDTERMEAVLEDPYILIVN
FT                   SKISSLKDLLPVLEKVMQSGKPLFVIAEDVEGEALAGLIVNKIRGTFKSVAVKAPGFGD
FT                   RRKAMLNDIAILTGGQVISEEVGLSLDAVTLDLLGRARQVVVTKDEATIVDGAGDSEQI
FT                   AGRVSQIRKEIENSDSDYDREKLQERLAKLAGGVAVIKVGAATEVELKERKHRIEDAVR
FT                   NAKAAVEEGIIPGGGVALLQASKAAEIEGLEGDELTGAQIVLAACTAPLKQIAINAGLE
FT                   GGVVAEKVAGLPAGQGLNAANDEYVDMVEAGIIDPAKVTRSALQNAASIAALFLTTEAV
FT                   IADKPEPVKAPAGGGDMDGMGGMGGMM"
FT   gene            complement(499921..500997)
FT                   /locus_tag="PPA0454"
FT   CDS_pept        complement(499921..500997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0454"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82206"
FT                   /db_xref="GOA:Q6AAL0"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAL0"
FT                   /protein_id="AAT82206.1"
FT                   /translation="MKINYTPGPLLDASRTTPTALWNDSADLDELRQSIAFGGVGATCN
FT                   PVIGYTTIKKHPDIWEDRIRAIAENNPTWGESQIGWQAIKDMSVEAAKLLEPIFVEHKG
FT                   RNGRLSIQTDPRLHRDAKALADQAEEFSNLAPNIIVKIPCTSVGIEAIEEATYRGVSVN
FT                   VTVSFTVPQAVKSAEAIERGLQRRAAEGKPIDEMGPVVTIMAGRLDDWLKIVAERDRLF
FT                   IDPGHLEWAGIAAIKRANQIFVERGFHSRVLCAAFRNVLQWSELIGGDLVVSPPFKWQK
FT                   RINDSDYHVVPRIDEPVAAEHLDALKKIPEFMRAYDPDGMTIKEFDTFGATRRTLRQFL
FT                   QADADLDTLVRDIITPAI"
FT   gene            complement(501099..501842)
FT                   /locus_tag="PPA0455"
FT   CDS_pept        complement(501099..501842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0455"
FT                   /product="GntR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82207"
FT                   /db_xref="GOA:Q6AAK9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAK9"
FT                   /protein_id="AAT82207.1"
FT                   /translation="MENEPYIADITIDRSRPEPLHTQIAEPLAQLIESGELPPGTRIED
FT                   EMSMAARLHVSRPTARRAFETLTQRGLVIRRRGIGTQVTPTRVHRSMNLTSLYDDLQAS
FT                   GQRPRTSVLDWTVETAPPAVAAALGLPSNSEVAHFRRLRMSQDEPLAIMTNWVPVDLAP
FT                   SAEELRTTGFYDYLRSRDVVVAVGHQRFSARLALPDEARLLNEPPGAALLTMQRTACDE
FT                   SNRVIEFGQHVYRASIYAYENTVYA"
FT   gene            502057..503046
FT                   /locus_tag="PPA0456"
FT   CDS_pept        502057..503046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0456"
FT                   /product="carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82208"
FT                   /db_xref="GOA:Q6AAK8"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR023314"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030830"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAK8"
FT                   /protein_id="AAT82208.1"
FT                   /translation="MVSSRRRDLDVLTMGRIGVDIYPLQYGVGLEDVTSFGKFLGGSPT
FT                   NVAVAAARLRHSAAVVTAVGDDPFGRFCRREMARLGVYDNYVLVNSELPTPVTFCEIFP
FT                   PDDFPLYFYRRPTAPDLRITPDDVPEDAVRNAQILWLSVTGLCQQPSYDAHCRALEVRG
FT                   KAEHTVLDLDYRSMFWQSAAKAHEAVSAVLPHVTVAIGNREECEMAVGESDPDRAAHAL
FT                   LDAGVQLAVVKQGPKGTLAMTREERVEVAPTPIDVTNGLGAGDSFGGSLCHGLLEGWSL
FT                   AETIQAASAAGALVATRLECSTAMPSEPELFAMMAKHPDIAIKEEHLS"
FT   gene            502890..503930
FT                   /locus_tag="PPA0457"
FT   CDS_pept        502890..503930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0457"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82209"
FT                   /db_xref="GOA:Q6AAK7"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAK7"
FT                   /protein_id="AAT82209.1"
FT                   /translation="MEPRRDDSSSVGRRSPRRDAVGVFHRDALGTGTVRDDGETSGHCH
FT                   QRGASVMTRTPLIDKLLDRRLADPVRFADRVRQRPRATWSPTEPLMVVAADHPARGALA
FT                   AGGRADAMADREHLLERCVTALGRPGVNGFLGTADMVADLANLDALDGKVVFGSMNRGG
FT                   FAGASFELDDRMTGYDVQGILDEDLTGGKMLLRFDLSDPGTATTAQACAEAVTTLARAR
FT                   RIAMVEPFISYRADDGKVVNDLSADAVVKSVVMASGLGADTSWTWLKLPAVDDMERVVR
FT                   ATSLPILLLGGEVSTDPEETRRRWATALAARHVRGLVLGRSVLYPPDSDVATAIDNAVQ
FT                   LLGVQA"
FT   gene            503927..504799
FT                   /locus_tag="PPA0458"
FT   CDS_pept        503927..504799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0458"
FT                   /product="putative myo-inositol catabolism protein IolB"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82210"
FT                   /db_xref="GOA:Q6AAK6"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR024203"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAK6"
FT                   /protein_id="AAT82210.1"
FT                   /translation="MTELVLRSGSTASGCRDVVVDPKCAGWTYSGLTIASLTKDETLEL
FT                   TTDDHEYLVLPLEGSFIVQGDGFRADLAGRSTIWGEVTDYAFVPRHRTITVTAVSGGRV
FT                   ALPNALASEDLEPRYCPSTEVRVELRGAGNCSRQVVNYAVANPVHTSRLLACEVLTPGG
FT                   NWSSYPPHKHDEESQVEHELEEIYYFEIRGDEHGPGMAFHGTYGTPDRPIHVAEMISNG
FT                   DVALVPHGWHGPCAAAPGYDLYYLNVMAGPGAAEWKSVDDPHYGWIRQTWQDQDIDPRL
FT                   PLAVDDSKE"
FT   gene            504802..506700
FT                   /locus_tag="PPA0459"
FT   CDS_pept        504802..506700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0459"
FT                   /product="thiamine pyrophosphate-requiring enzyme, putative
FT                   acetolactate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82211"
FT                   /db_xref="GOA:Q6AAK5"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR030817"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAK5"
FT                   /protein_id="AAT82211.1"
FT                   /translation="MTEQTVRLSVGQAIVRYLTHQYTERDGVERRFIRGVFGIFGHGNA
FT                   TGLGQALLQNEAAPDDEEGRLEYWMGRNEQGMVHACSAYARATNRLQALAATASIGPGS
FT                   LNMVTGAALATTNRVPVLLFPSDIFANRAPDPVLQQLEDPTNPDVSCNDAFRPVSKFWD
FT                   RVNRPEQLMVSLPRAMRVLTDPVDTGAAVICLPEDVQTEVYDWPVSFFAKKVWYIDRRL
FT                   PDRAAVVRAAQAIRAARCPLIISGGGTIYSEASQELRDFASATGIPVADTQAGKGAINW
FT                   DHPCAVGGVGATGSDSANALAAQADLIIGIGTRYSDFTTGSQTAFKNPDVTFVNVNVGA
FT                   FDAAKQGAQMLVADAREALTALSKELDGYRVPQEWSDLASAKAKAWAEVTDRCYHLGHG
FT                   PLPAQTEVFGALNELMGDDDVVINAAGSMPGDLQCLWRASTPVQYHVEYAFSCMGYEIP
FT                   ASLGVKMALPDSEVVAIVGDGTYQMLPMELATIVQEGAKVILVLLQNYGFASIGALSES
FT                   HGSQRFGTKYRQHDDGQGHVVGDDALLPLDIAANARSWGIDVLEVRTIKEFREAYRKAE
FT                   ASDHATMIHIETDLYGPNPPASGWWDVPVTSQSRLKSTQKAYAEYTGQVAAQRRFF"
FT   gene            complement(506845..507159)
FT                   /locus_tag="PPA0460"
FT   CDS_pept        complement(506845..507159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82212"
FT                   /db_xref="GOA:Q6AAK4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAK4"
FT                   /protein_id="AAT82212.1"
FT                   /translation="MSAHTAVPSTAVRSCFGIRKGVETSHMSLSYVDSGIILRTPAGMG
FT                   SVMHSQAVTLLRFVPAALVLFALAIAGVINQAPILTIVSGLMTVALTITLSMVHFFDNA
FT                   "
FT   gene            507448..508941
FT                   /locus_tag="PPA0461"
FT   CDS_pept        507448..508941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0461"
FT                   /product="methylmalonic acid semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82213"
FT                   /db_xref="GOA:Q6AAK3"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAK3"
FT                   /protein_id="AAT82213.1"
FT                   /translation="MKTIRQWVGGEYYEGSPLGVIPVENPATGEVTAELLQASKEDLDH
FT                   TVEVTRDAQKEWANYSLSKRVAIMFKMRQLVLDHQDEMARLIVEEHGKNYSDAIGEIQR
FT                   GRETFDFATAINVALKGEYSHDVSTGVDIHTTRQPVGVVAGICPFNFPAMVPMWMHPLA
FT                   VATGNAFILKPASPTPSASLLTAELYKEAGLPDGVFNVLSGDRRSVQDILVHPGIDAIS
FT                   FVGSTPVAHIVQDTGVSHGKRVQALGGANNHAIVMPDSDLDFAAQHISASAFGAAGERC
FT                   MALPVVVAVGGCGPQVAEKVKKHAEAIKVGEGMGEGVEMGPVISAKAKDRIVGLIDDAE
FT                   KRGSKVVLDGRGLTVPGYENGHFLGPTVLDDVPLDAPVYTEEVFGPVLAIVHADTYEEA
FT                   LKIVNAQPFGNGSAIFTNDGGVARRFTLDVEAGMVGVNVPIPTPVAFYSFGGWKESLLG
FT                   DTHIHGPEGVTFYTRAKAITERWPTEKTYAATMSFQREE"
FT   gene            509037..510017
FT                   /locus_tag="PPA0462"
FT   CDS_pept        509037..510017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0462"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82214"
FT                   /db_xref="GOA:Q6AAK2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAK2"
FT                   /protein_id="AAT82214.1"
FT                   /translation="MRNPTQTDVARMAGVSRGLVSLALAGRPGVSSATRRRIQDAADRL
FT                   GYSRDLSAASLATGSSPVLGIILPNLRNPFFETVVSYLSVAAERVGWLPLVGTASDDTR
FT                   HEEAVLRRFREFRAVGVIVVSPVGDLESLAALSGPTSPLVLLGAENQSGVVPCVHVDED
FT                   TAAQLIVEHLGSQGVRRVVSLAEECGSGMVWVLRRRAALIAACQSAGIECVPAIVERGE
FT                   AVAPILARFIDDAQTDVGVVAHNDVVALDALSVLRSVGLESRRWIPVVGFDDTHLASRP
FT                   EFDLTSVNQQPGALVDVALDMVAGAVRGLDHTVEPRLVVRSSSKR"
FT   gene            510154..511368
FT                   /locus_tag="PPA0463"
FT   CDS_pept        510154..511368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0463"
FT                   /product="dehydrogenase, putative myo-inositol
FT                   2-dehydrogenase"
FT                   /EC_number="1.1.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82215"
FT                   /db_xref="GOA:Q6AAK1"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAK1"
FT                   /protein_id="AAT82215.1"
FT                   /translation="MSALSQPATSQRHPLSVAVIGAGMAGRTHANAWRQVGTVFGSEGI
FT                   PPIRLAAICDSYEPFARSARDSYGYERAVTDWHDIVDADDIDVVSVVVSNALHRQVAED
FT                   LVRAGKHVLCEKPLSDSLKNARAMAELEANSQVVTGVGFSYRRHPSVAAIAELVRQGRL
FT                   GDVTTFSGRYWCGYGVDPTVPMAWRYRGPQGSGALGDLGSHIIDVAEFVCGPIRSVRGG
FT                   AFATIIDKRPPALEGVAGGRGMTVSAQAIETVENDDIAVFNMTFESGAIGTIVVSRVAF
FT                   GLPNSMEFDVFGTQGRASFDLARSGEIIVDDTSTPEGFSGPRQVLSNPTFPYYKGGSSM
FT                   DFAGVGSTQIEQFTYQARAFLDQVLGLDEGFPLVPSFAHGYRTMCIADAVARSAAAGGK
FT                   TIDLT"
FT   gene            511413..512411
FT                   /locus_tag="PPA0464"
FT   CDS_pept        511413..512411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0464"
FT                   /product="sugar phosphate isomerase/epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82216"
FT                   /db_xref="GOA:Q6AAK0"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAK0"
FT                   /protein_id="AAT82216.1"
FT                   /translation="MSMNIGAYTACLHNYDLAEALDILKTNGLTGAEVNVGGFIPSPHC
FT                   PVDTLMTSQTAREDYMGIFEDKEMRLAGLNTSGNPLSPLPDVGPRHAYDLRRAIELAGK
FT                   LGITDLVCMSGTPGSDRHAKYPSWVVNPWNGVELEVLEYQKSVVDPFWREMDLRAQDAG
FT                   VKLALELHPHNLVFTPVNFLEFAERIDARNIGVNMDPSHLMWQGMDIIAAIELLGDHIF
FT                   HVHAKDTVILPGIATRGVLDSSFGPVPDDPDVRVQTGMEHYCSSWPSDPAWRFVAIGNG
FT                   HDVTWWTNFLRAIRDVNPGMNINIEHEDQSLAQLDGIAVSARNLLAAEQAV"
FT   gene            512483..513349
FT                   /locus_tag="PPA0465"
FT   CDS_pept        512483..513349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0465"
FT                   /product="myo-inositol catabolism IolH protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82217"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAJ9"
FT                   /protein_id="AAT82217.1"
FT                   /translation="MVDIALDPNMYYCSMSTADTLRKAADLGFRYVELSPNEEFHFWHR
FT                   YPKADDAFVTEMRKAVRETGVTIRTLNPVFNWSSPDEAERRNQMRNWRRLLELADQLDV
FT                   HEITSEFSGDPNSPRECEAAWYRSIEELAPSFERYGIRLNMEAHPYDFIELHDDACRTV
FT                   RGTNLDWIGYEYCCPHTFHLSNGAGDVRRMIHGCADRLREVHVADAFNHAAHDGNRYII
FT                   NPPGADVRVHQHNEIGLGDVPFDDVFEALRDVGFDGVMSVCVFGWHERADEINKSMLAR
FT                   LNREFVA"
FT   gene            513559..514770
FT                   /locus_tag="PPA0466"
FT   CDS_pept        513559..514770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0466"
FT                   /product="putative myo-inositol 2-dehydrogenase"
FT                   /EC_number="1.1.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82218"
FT                   /db_xref="GOA:Q6AAJ8"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAJ8"
FT                   /protein_id="AAT82218.1"
FT                   /translation="MGVVMEKRRTIGVGVVSLGWMGRLHTRAYKALAEKFPEIDVNIRL
FT                   VSCCDVVAENRRQAVDRLGFCTAVEDYHDLIGNPEVDVVSICAPNFLHRDIALAAAEVG
FT                   KPFWIEKPMGTNAKQSRQIAEAAEAKGLVTSVGFNYRHTPSIEFARQLIADGRLGTVTN
FT                   ARAWLIADYASDPHGPLTWRYDRERAGAGVILDLMGHGEDLVQYLLKGRFTEVSAVSET
FT                   FIRQRPKPLKEGIGHTGWVVSDELGPVGNEDYCAVIARMENGVMCTLESSRVSVGPRAE
FT                   YIVEIYGTDGSIRWNFEDLNHLQVCLGRNNRALQGYVNCMAGPDFPEFMRFQPGAGTSM
FT                   GFDDMKVVEAAKFVRGVLDGQQYGPSVADGWASAEVNDAIVASCGDHAWHDVKPVSGRT
FT                   TFDK"
FT   gene            514880..516526
FT                   /locus_tag="PPA0467"
FT   CDS_pept        514880..516526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0467"
FT                   /product="putative sugar transporter YfiG"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82219"
FT                   /db_xref="GOA:Q6AAJ7"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAJ7"
FT                   /protein_id="AAT82219.1"
FT                   /translation="MSTPPRIREDISRMVDETPPSGKHRGIGALAAVATLGSLLFGYDT
FT                   GVISGALPYLYMPHLAGGLALTPMQEGAIGGTLLIGAAIGAVTGGIMSDRWGRRHNITI
FT                   LAVIFLLGALGTTFSPNVFVMYVFRFVLGFAVGAASATVPVYLAENAPKRIRGSIVAID
FT                   QLMIVTGQLLAFSMNAIINAAHGGPQLIIKANNNPDSLGITKGTYSWDQILALQASKGG
FT                   PLEGDQYRAFVENLVIQSGNGAAWRWMLVLCSIPAIALWIGIRLMPESARWYLAKGRVA
FT                   DAVGALKRVRDPQKDGPLDAEVEEMLVTQQRELENKYQGNAFAHVWRTPWLRKLMLVGI
FT                   FLAIVNQTTGVNTVMYYAPKVLEYAGMTTSASITAQVANGVMSVIGSVGGLWLILKFSR
FT                   RSLLIFDVSAVGITLLVIAGTFQFTIAPHIADKTTPPTWAPYLILGLMAVFMLIVQSTN
FT                   GTVVWTMLGEMFPANVRGIMNGTAIFFMWVINAVITFTFPSMMASLGGGLTYTIYGMMN
FT                   LVIAVVLFKIMPETRNKSLEQIETYMEERYS"
FT   gene            complement(517136..517999)
FT                   /locus_tag="PPA0468"
FT   CDS_pept        complement(517136..517999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0468"
FT                   /product="putative myo-inositol catabolism protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82220"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAJ6"
FT                   /protein_id="AAT82220.1"
FT                   /translation="MKIAGAPISWGVCEVPNWGYQMTPERVLTEMKQIGLTATEFGPQG
FT                   WLPIEAEARATEVKKYGLKPVGAFFLSVMHDPDFDPIPMVNKELDAFEAAGGDYLILAT
FT                   DSGRDGYDDRPVLDEAGWKTLFTNLDQIREVCASRNVTACLHPHWGTMVQNRDEVIRVL
FT                   ENSSIGLCLDTGHLACGGTDVVELVRKYANRVDIVHAKDVHKEMADKLLPGEITWSEGI
FT                   RAGMFAPIGDGDIDFAAIVRLLDEAGFDGYYVLEQDIMIDEEPPADDGPIINAKKSYEA
FT                   LASLGR"
FT   gene            518116..519183
FT                   /locus_tag="PPA0469"
FT   CDS_pept        518116..519183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0469"
FT                   /product="putative myo-inositol 2-dehydrogenase"
FT                   /EC_number="1.1.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82221"
FT                   /db_xref="GOA:Q6AAJ5"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR030827"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAJ5"
FT                   /protein_id="AAT82221.1"
FT                   /translation="MTGFVLTLGSLAVTGENPALSNTGVHSMIRIAIIGAGRIGHVHAR
FT                   AIQGRNDVTLALVCDPFEQNARALAGEYDVRYCLDPDEVFDDSTIDAVVIGSPTQFHVD
FT                   HILKAVNGGKRVMCEKPIALDVESAKRCINELGDRADQVMMGFNRRFDPTFSALKSRLD
FT                   DGEIGSLQQLTVISRDPAAPSASYIAGSGGIFKDMTIHDFDMVRHFLGDIAEVNAVGTN
FT                   VSPEIAEQGDFDQVIVTLKSRDGKLATIINSRTCAFGYDQRLEAFGADGMLSADNLTDA
FT                   AVRMATSTQTDAKTAIMDFFLERYEDAYRIELETFLDSIAIGGAVSPSVRDGYEALVLA
FT                   DAATRSAQEHRVVAL"
FT   gene            519116..520198
FT                   /locus_tag="PPA0470"
FT   CDS_pept        519116..520198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0470"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82222"
FT                   /db_xref="GOA:Q6AAJ4"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAJ4"
FT                   /protein_id="AAT82222.1"
FT                   /translation="MRPLSWPMQLRVAPRSIASSPCDATRYDHGVSTDNQCSTGSLSGD
FT                   AEPVEVPPQHGVTGLPPGPSRTCKRPVVQFLAGAGTFHPLLSLLAAMVILGVGQAGFDL
FT                   VLTALVGGHPDAQTSTILLLASFAGVWLVLWAWMRFVEQRPMSCLGFRGPGSDVWIGVA
FT                   IAIAILAIDVVVMTVSGQVTMSWARPSIMAAVFIVAAILLFLVQGCAEEAVLRGYLMQS
FT                   VAAKWGIPAGLAIQAVVFAALHGANPGTTWVALVNVTGFGLMQGLLVVWRGNLLAAMGF
FT                   HTVWNWLQGMVLGFDVSGLELHHSVMTTARTTGSHSWLTGGTFGAEGSVINTIVLAILI
FT                   TCLLVTMRHDWRDNEAYGIA"
FT   gene            520176..520871
FT                   /locus_tag="PPA0471"
FT   CDS_pept        520176..520871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0471"
FT                   /product="putative copper homeostasis protein CutC"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82223"
FT                   /db_xref="GOA:Q6AAJ3"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAJ3"
FT                   /protein_id="AAT82223.1"
FT                   /translation="MKPMALLEVICLHEHDAKRAAAGGADRIELVGTMDDGGLAPSPEL
FT                   LARTLSAVHIPVRPMLRLDGGFRADPRRRDEILRLASAYRDLGADGPVLGFLDEATGVD
FT                   VETVIELTEGCQRWTFHRAIDNCLEPDKAWAQLLGLHGLDQVLTAGSPRGVEHGLDDLI
FT                   ARASADLRVADLIMAGGGLCAEHVPWLYRAGVRAFHIGSPARPQGSWKAWVDADLVRSW
FT                   RDLLDRLAG"
FT   gene            complement(520885..521889)
FT                   /locus_tag="PPA0472"
FT   CDS_pept        complement(520885..521889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0472"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82224"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAJ2"
FT                   /protein_id="AAT82224.1"
FT                   /translation="MSGKALIARRTALGGLLVATGAAIGVPVVRATNRPQKKAPRKPVP
FT                   TTVTSPAAPGPYVPFPYQDELSTYLNTRDGEQSVAMRVHGQREIQVFNHGATTYITASI
FT                   IKLAIMETVMIQAVGEKRQLTEGEKNLLVPMIENSSNDAATALWKKVGKADGVRTAMRR
FT                   MGATHTTFDPEGRWGLTSTTAADQVALADHIFCPNTIIPESMRAYARELMSNVEDDQNW
FT                   GMTAGMKSPFVKNGWLSLDDGWHVNSVASTGTAGYTVVGLTHSATASMDDLVETIEGMA
FT                   RIIARHQPRSVTTPSSSTAPTQTTAPKPQGVEDDHGHVSFRAPGTRDIWIQAF"
FT   gene            complement(521933..524017)
FT                   /locus_tag="PPA0473"
FT   CDS_pept        complement(521933..524017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0473"
FT                   /product="DNA or RNA helicase of superfamily II"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82225"
FT                   /db_xref="GOA:Q6AAJ1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032438"
FT                   /db_xref="InterPro:IPR032830"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAJ1"
FT                   /protein_id="AAT82225.1"
FT                   /translation="MLPHPPFAGRRPRIHDSAHAHGHTHKLRQYALNNQSPDRLLSTQP
FT                   VHAHCGDLPAAREGFLRCHHGPSAARPSHLGTRLTWSCWFPRLAVAMRLASVPSAICGG
FT                   NRILAAHHCHNRPRAATPTHSTRTSPGTNARCGAILGVMTSVPGPLIVQSDHTLLLEVD
FT                   HPQADECRHAIAPFAELERAPEHIHTYRLTPLGLWNAMAAGHDAEQVVDILMRYSRYPV
FT                   ASGLLIDVTETMSRYGRLRIEKHPTHGLVLVSTERAILTEVLRSKSVRGLVGNQIDDET
FT                   AVVHPSQRGTLKQALLKLGWPAEDLAGYVDGEHHDIDLDEDGWSLRPYQKVAAQSFWDG
FT                   GSGVVVLPCGAGKTVVGATAMSLARCTTLILVTNTVSARQWKEELVRRTSLAPDDIGEY
FT                   SGSRKPVRPVTIATYQVITTKRHGVHPHLELFEARDWGLVIYDEVHLLPAPVFRMTADL
FT                   QARRRLGLTATLVREDGHEDDVFTLIGPKRYDAPWKEIEAQGWIAPADCVEVRVSLSES
FT                   DRMACAMAEPDVRYRMAATLPIKNKVVRDLVERHRGQPTLVIGQYVDQLEELAAELKCP
FT                   IITGSTTPTRRQEIYQDFREGQIDLLVVSKVANFSIDLPSAEVAIQVSGAFGSRQEEAQ
FT                   RLGRLLRPKEGLVARFYAVVSRDTVDTDFASHRQRFLAEQGYSYRIIDADDLDALDRTA
FT                   "
FT   gene            complement(524223..526352)
FT                   /locus_tag="PPA0474"
FT   CDS_pept        complement(524223..526352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0474"
FT                   /product="conserved protein, putative helicase of DeaD/DeaH
FT                   box family"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82226"
FT                   /db_xref="GOA:Q6AAJ0"
FT                   /db_xref="InterPro:IPR032830"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAJ0"
FT                   /protein_id="AAT82226.1"
FT                   /translation="MSPSEEPTTLASTIRNLDAQSLSRLLTLRPDLANPTPRDLTEVSS
FT                   RASTHASIIAAISSLDRWRLSLLTALAALGDLRFTELAGALCQGWPIKPEAIQADVADG
FT                   ISDLLNMALVLEDSGQLHVIQIVTAHLSGYPAGLAPASVLPMNPNEVAEKLAAAGSKAR
FT                   SVLERLVWSPTGHVPNARRAVTPATATTPVETALAHRLLRPLSDDTVILPREVSLMLRG
FT                   NRLFAEQPSPTPPPWSEPHQTNLVNRAGLGTALEAVSAMSALLEAMERHNCALLASGGI
FT                   AKRDARIVLSRVAPGDDGWVYLALAAAGGLIGADGRSWLPTPLADRWRTDSLWGQWVSL
FT                   REAWRHIPQLPGNLGNALDASAPATAQAWRRLIHRELHSAEPGTPIETKVIANRIRWRQ
FT                   PGTTVDDSLVEAVLDECRVLGMVALDARTDLVDARTCADMPERTDEVILQSDLTAVAPG
FT                   PLTPDTAADLALLADRESTGIAGVRRFNRSSLRRALDAGWTGERVRQWWAEHSLGDVPQ
FT                   SLLVLLNDVVRDHGRVSVAAAGALLEVDDPATVEAILRSSLTTDVGLRRVGPQVLVAQA
FT                   EPDQVLAGLRQLGMSPVARDAHGDVFSAPPPPRAKVDVPASSAPQADPEELAASLLDKR
FT                   GRGFSDRRQLIAQLHQAQQDGTWMYIERVVDDGTSVRQTVRIMAATAGAVRCVIRGGGG
FT                   VTIVPVSRITSCQPV"
FT   gene            complement(526349..527104)
FT                   /locus_tag="PPA0475"
FT   CDS_pept        complement(526349..527104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82227"
FT                   /db_xref="GOA:Q6AAI9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAI9"
FT                   /protein_id="AAT82227.1"
FT                   /translation="MAPSITAPVDVVDSRPAPRAFQAPRADPLETPTQPVNPAAGKPCS
FT                   APHHYQGGDHRPLTELIPRRRSSRQPLEPFSTQAGLTGPRIEHHDPHEPIRTSRLTSGY
FT                   STWSAPTEAPVSTTPPPRIKSVRMPSRLDPRTPSKAGSRSFLDLCQGLGWPWIVVLVLG
FT                   CAWSPLSIPALFITWWLAWRHPFAAGRLTKALTAVTVAVIIGGAIESPVRTVLAQFAWM
FT                   SRLGCVIMLGLGFILIDRQLTPDDPGSSR"
FT   gene            527278..528063
FT                   /locus_tag="PPA0476"
FT   CDS_pept        527278..528063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0476"
FT                   /product="glucosamine-6-phosphate isomerase"
FT                   /EC_number="3.5.99.6"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82228"
FT                   /db_xref="GOA:Q6AAI8"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AAI8"
FT                   /protein_id="AAT82228.1"
FT                   /translation="MEVIICSDEQAVGRIAADRIAKVLGRAKAPVLGVATGSTPLTTYS
FT                   SLAALAAEGKADFTDLRAFALDEYIGLPADDERSYAATIRHTVTEQLGLDPANVHTPDG
FT                   MADDLDAACAAYETAIQEADGVDVQILGIGANGHIGFNEPTSSLSSRTRVKTLAERTKA
FT                   DNARFFEEGEKVPSHCVTQGLGTIMDARNVVLLAIGANKADALAGAVEGPVSAMCPASV
FT                   LQFHPHVLVIADDAAASKLTMAEYFRWTDSQRGDLSGAM"
FT   gene            528210..528593
FT                   /locus_tag="PPA0477"
FT   CDS_pept        528210..528593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0477"
FT                   /product="cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82229"
FT                   /db_xref="GOA:Q6AAI7"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAI7"
FT                   /protein_id="AAT82229.1"
FT                   /translation="MPTGKVRFYDATKGFGFLTKDGGGDVYVNASALPAGVNTLKPGQK
FT                   VDFGIVEGRRGEQALSLQIIETPASLSKASRKKPQDMAVICEDLIKMLDKMGNGYRHGR
FT                   HSDSRTAGAVAKMLRAVADELEL"
FT   gene            528593..529393
FT                   /locus_tag="PPA0478"
FT   CDS_pept        528593..529393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0478"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82230"
FT                   /db_xref="InterPro:IPR021391"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAI6"
FT                   /protein_id="AAT82230.1"
FT                   /translation="MTQVTSKPRTATRTIKADATIAKAVDQAREAAEYRAGDFGVGEHV
FT                   GTIAEGERVLTHLFECPHPGYRGWRWAVTMSRALRGRNVTVNEVVLVPGEDSLLAPPWV
FT                   PWRDRVRAGDIAAGTLMPTADNDPRLEPGYTGGELAADEDPAEWAATRAVASELGLGRE
FT                   RLLSREGRDSTAERWLAGEGGPDNATSHHAPASCVTCGYFVRLQHSLGRVFGVCSNEYS
FT                   PSDGSVVHVDHGCGGHSDVVEKRRGIELPEPVFDTISVDESLFD"
FT   gene            complement(529431..529703)
FT                   /locus_tag="PPA0479"
FT   CDS_pept        complement(529431..529703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82231"
FT                   /db_xref="GOA:Q6AAI5"
FT                   /db_xref="InterPro:IPR019681"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAI5"
FT                   /protein_id="AAT82231.1"
FT                   /translation="MTCHNNVAGHYDGAVSNHHLLTQANVAPVDENGVTVGIVGTIAFA
FT                   VASLICWIMLDRLTETGYRDWLWICLTGTGLGVVGTAYCWQRSRH"
FT   gene            529719..531230
FT                   /locus_tag="PPA0480"
FT   CDS_pept        529719..531230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0480"
FT                   /product="putative xanthine/uracil permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82232"
FT                   /db_xref="GOA:Q6AAI4"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAI4"
FT                   /protein_id="AAT82232.1"
FT                   /translation="MPSNTASARFDQWFHLTERGSTTSREVRGGIVTFFTMAYILALNP
FT                   LIIGTAADKNGKLLNGAPKFLDAAGTSLNTAGIDDNKIMVMAVTAFVAAIMTIAMGVWG
FT                   RFPMGIATGLGINSLLAYVVAPTMTWSQAMGLVVWEGIFILVFVLTGVREMIFRAVPNS
FT                   LRSAISVGIGLFIAFVGFVDSGVIRPGSGTPVTLGVGGSLEGWPILLCLFGFLLLVVLH
FT                   QRHIKGSMLIAIIGTSLVGVAIEAVGNIGAQSDKNPTGWALNVPRLPGASDFRWPDLGL
FT                   LGHVDLFGGFLANGHFRIGVFLGTLLVVFSLMLADFFDTMGTVVAIGDHAGLLDETGNP
FT                   EHLKGILVVDALAAVAGGLGSASSATGYVESAAGVGEGARTGIASIVTGLGFLLAMFLS
FT                   PIVSIIPSEAAAPVLVFVGFLMMAQVTRIDWKHVEEGLPAFLGMVLMPFAYSITTGIGA
FT                   GLIMFCITKVIAGKARSVHPLLWVVALLFVVYFSQTLLMKLFGQL"
FT   gene            complement(531205..531840)
FT                   /locus_tag="PPA0481"
FT   CDS_pept        complement(531205..531840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82233"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAI3"
FT                   /protein_id="AAT82233.1"
FT                   /translation="MKLRRWAEARFSVPVHHHRRPRWRSPFHPLYKPNVECSMLPTGWP
FT                   TPHDVEDLVCGRYIESDRSARCWRLVNEWLTHLSWGWTEIPMSVARFEELDRDLAAAGL
FT                   PSTYSLKRLMDEDPQIPLRPAPGMKIGYAGTRQILATWVELSEVIGTVPIARRGEVNAV
FT                   LKFLSSYPGWNHLAVDLGRPAPGLLVVWQPDTVEDAHPTGLRAGRTAS"
FT   gene            532040..533062
FT                   /locus_tag="PPA0482"
FT   CDS_pept        532040..533062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82234"
FT                   /db_xref="GOA:Q6AAI2"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAI2"
FT                   /protein_id="AAT82234.1"
FT                   /translation="MIGRSGMAGCNIVTQRSRTRRRASRAASALLALGCAWGLSVSPAA
FT                   AADFTVRTDKKLGKPVGMAADLHHDWYWITDGSSSTVHSLLAVDKTGKEVHRVVWEPAF
FT                   HDVEAMSWARGVLYVADIGDKKAQRRGIRVMSPTSTAAKQSTYYEWMFTYPDGAHDAKA
FT                   LTVSPKGSFYIITDGPHPAIYRGGPQVSRTESNPLEKVADAPAGVKDATFLPDGSRMAL
FT                   LTDHEVRIVDAYSWKTVANAAFSGGQAITTDTTQKTLEIATSGNKVRGIKFPTTLTSIT
FT                   PTPSHSPKAKVVTPANGKPTSKARSGTFIAVMGAVVVALCAGVVTFFYGRSRDTTWRHR
FT                   "
FT   gene            complement(533059..534177)
FT                   /locus_tag="PPA0483"
FT   CDS_pept        complement(533059..534177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0483"
FT                   /product="phosphoserine aminotransferase"
FT                   /EC_number="2.6.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82235"
FT                   /db_xref="GOA:Q6AAI1"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR006272"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAI1"
FT                   /protein_id="AAT82235.1"
FT                   /translation="MAQPMIPRDLLPSDPRFGCGPSRIRREVVASLSEPGSVMGTSHRQ
FT                   PPVRHVVAAIREELTELYNLPTDYEVALGNGGATLFWDMATVSLVEKRAATGVYGEFTR
FT                   KFSSALQRAPFLADPAVFQAEPGKLALPKAVSDVDTYAWAHNETSTGVVAPVRRPNDID
FT                   DNSLVLVDATSAAGGVAADMSTIDAYYFSPQKNLSSDGGLWLAILSPAAIERSNRVTSS
FT                   ARWVPQMLDLSLAVTNSRADQTLNTPALATLVMLEAQCRWLLDQGGMAWAASRTASTSG
FT                   ILYRWAEDNPLTTPFVADPALRSPVVVTIDIDESVDAARLCARARDNGILDIEPYRKLG
FT                   RNQIRIATFSSIEPSDVEALTACLDWLLENRD"
FT   gene            534270..535400
FT                   /locus_tag="PPA0484"
FT   CDS_pept        534270..535400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0484"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82236"
FT                   /db_xref="GOA:Q6AAI0"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAI0"
FT                   /protein_id="AAT82236.1"
FT                   /translation="MITRIASHHVVDRDGSDSPATITVEAGRISDVSEGIDPKAELVDE
FT                   WILPGYVDTHCHGGAGADFTDPDREAALRAVHYHRSQGSTTLFASTVTAAIDDVVAQIG
FT                   RLRQLVDLDEIAGIHLEGPFLAESRKGAHAVELLCDPDPVSVGRLIEAGGSALKMVTIA
FT                   PERAHGLEAVTTFTTAGVHAAIGHTECDTTTASAAVDAGADVITHLFNAMPSIHHRKPG
FT                   PVPPMLTDSRVVCELICDGVHLAPDVIRMAMSSAGPKRIALVTDAMSATGQPDGDYILG
FT                   SLPVKVVDGRARLLAADGSLGAIAGSTLTMGRAVEFVTSVVGIPLGQVAVMAATTPAKL
FT                   HGLNEVGVIEEGHWADLCLTDAKGHLVRVIHRGEAV"
FT   gene            535554..536252
FT                   /locus_tag="PPA0485"
FT   CDS_pept        535554..536252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0485"
FT                   /product="repressor"
FT                   /note="similar to diphtheria toxin repressor"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82237"
FT                   /db_xref="GOA:Q6AAH9"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAH9"
FT                   /protein_id="AAT82237.1"
FT                   /translation="MSSELVDTTEMYLRTFYELLEEGVELRRARIVERLHQSGPTVSQT
FT                   VARMERDGLVVVESDRSISLTQEGHDVAQTVMRKHRLAECLLTQIIGLRPDLVHDEACR
FT                   WEHVISGEVEKRLTGLLENPDVSPYGCPLPPEQAGCRPDGSARFRDDSKPLDEVIAETG
FT                   CPVSVTVTRLSEFFQATEGNLADVYAAGLLPGKSVEVDDDADGIRLTGPSGSIVVDPEI
FT                   LSGLFVAQNS"
FT   gene            536291..537352
FT                   /locus_tag="PPA0486"
FT   CDS_pept        536291..537352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82238"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAH8"
FT                   /protein_id="AAT82238.1"
FT                   /translation="MCPSQLPDLDQIAALCESGWYDTADSMLRMAHASESANPHVVQAA
FT                   GVMAVARRVLALDAEDFEDIGEALPADLRSRLVDSGFPHHPRAAERGALGDLIPLYELM
FT                   LEVLDIRMRREEPQQVVVTCHILGEYLAQLAWQPVLGDGGDPLTLPGKVGQKWGGDAQG
FT                   CAHTSAMNATARRSMHAAQGDEEGYTSYLDKFHSRLGEALGVCAMNHATIDAGERPDVG
FT                   ITCPDPCRWVLAGTWEERRALDARVRLARIFQESGLVALRHHAPVGHFFGVPSGSEIGN
FT                   AWVMTWNKLNEQWADGSNPMLDPSAPGYDVDASDGALPGLARMVSVIAARPIRAGHLLR
FT                   DLGVTAIAELKAV"
FT   gene            537474..537839
FT                   /locus_tag="PPA0487"
FT   CDS_pept        537474..537839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0487"
FT                   /product="thiol-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82239"
FT                   /db_xref="GOA:Q6AAH7"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAH7"
FT                   /protein_id="AAT82239.1"
FT                   /translation="MATVALTKDNFSSTIDSNDVVLIDFWASWCGPCQRFSPIYEDASG
FT                   RHSDVTFAKVDTEDQQELSAGLEITSIPTIMAFRAGYLVFRQSGLLQGRQLDELIEKVK
FT                   EIDVEDLKKQAAAQNQG"
FT   gene            538011..539627
FT                   /locus_tag="PPA0488"
FT   CDS_pept        538011..539627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0488"
FT                   /product="sugar transporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82240"
FT                   /db_xref="GOA:Q6AAH6"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAH6"
FT                   /protein_id="AAT82240.1"
FT                   /translation="MTSRIEVAELVETTQPAGPKRRMGVVAAVATLGSLLFGYDTGVIS
FT                   GALPFMYLPHGAGGLALTVGHEGAIGGTLTLGAAFGGLIGGMMSDRWGRRHNLLILAVL
FT                   FVVGALGTAGAPSVWVMYPFRVVLGFAVGAASATVPVYLSETSPKRMRGRIVALDQFMI
FT                   VFGQLLAFSVNAAISAAHGGPSLMVTADPTGRLSPGTYSWDTLQAMTTSHGGAMTDQAF
FT                   HAFLTQLSVSAGSGGAWRWMLVVCTLPAIALWIGMRKMPESARWHLSHGQLRETVACLK
FT                   QVRVEGVDEPIVDEVTEMVELNGEGGRLSHRQQWAVVMESRWTRRLLLVGIFLAVVNQT
FT                   TGVNTVMYYAPKVLEFAGMSTQASIISQVANGVMSVIGAAAGLWLIERFDRRHLLIFDV
FT                   TAVGVCLLGIAATFGLAIAPHVGQGVPKWAPILVLVLMSIFMLIVQSTNGTVVWTMLGE
FT                   MFPTRMRGAMNGAAVFCGWLANATITWTFPVMLAGLGGAGTYLTYGLVNLMIALVLVKV
FT                   MPETKGRSLEEIEVEMKQRYA"
FT   gene            complement(539704..539779)
FT                   /locus_tag="PPA2413"
FT   tRNA            complement(539704..539779)
FT                   /locus_tag="PPA2413"
FT                   /product="tRNA-Arg"
FT   gene            540108..541505
FT                   /locus_tag="PPA0489"
FT   CDS_pept        540108..541505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0489"
FT                   /product="UTP--glucose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.9"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82241"
FT                   /db_xref="GOA:Q6AAH5"
FT                   /db_xref="InterPro:IPR002618"
FT                   /db_xref="InterPro:IPR016267"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAH5"
FT                   /protein_id="AAT82241.1"
FT                   /translation="MSEEGLAAARQKMTEAGVDPVAIEVFTSYYHQLETGDTGLIREDT
FT                   ISPLTNPPMLDDVEVSEEQAAEALDKTVIIKLNGGLGTSMGLDRAKSLLEVRDGKSFLD
FT                   IIATQVLSARKTFGARLPLMFMNSFNTREDTLKALEKYPELAVDGLELDFLQDQEPKLD
FT                   AETLAPVEWPKDSSLEWCPPGHGDLYTALLGSGVLDHLLEAGYQYASVSNGDNLGAVPD
FT                   GRLAGWFAASGAPYAAELCRRTINDKKGGHLAIRKSDDQLILRDTAQTAEEEMDYFTDE
FT                   HRHPFFHTNNLWFDLEALKKVLDERHGVMGLQIIRNEKTVDPKDSSSTPVIQIESAMGG
FT                   AIEVFEGATCICVDRSRFLPVKTTNELLLLRSDVYDLDDSDHLVKTTDMTCAVDLDKDF
FT                   YKKISDFDDRIPEPPSLRRATSLKVKGDWTFGSEVVVAGDVSLDTEKPQTIPDGTVLTG
FT                   EVLGAKK"
FT   gene            541532..541873
FT                   /locus_tag="PPA0490"
FT   CDS_pept        541532..541873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82242"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAH4"
FT                   /protein_id="AAT82242.1"
FT                   /translation="MAAVLTGQRLTAPDNPGWQAVDVVEWLAEEGWPANRLANRRAEFQ
FT                   QAGRSWPGPIPDDLSPGLEFARYGAVLAQARRIAGLDGLTATVHRGAVVIGPDEARLLA
FT                   ERPPHSLLH"
FT   gene            complement(541896..542264)
FT                   /locus_tag="PPA0491"
FT   CDS_pept        complement(541896..542264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0491"
FT                   /product="large conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82243"
FT                   /db_xref="GOA:Q6AAH3"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAH3"
FT                   /protein_id="AAT82243.1"
FT                   /translation="MKGFKDFLMRGNLIELAVAFILGGAFSTVVKSFTTIIMDLIGKLG
FT                   GTPNFSGWVPGGVHVGAFITDVISFFVMSFVIYFGLIKPIELATEKLKRTKDEPVAAPT
FT                   TADLLIEIRDELRSRPVK"
FT   gene            complement(542376..543035)
FT                   /locus_tag="PPA0492"
FT   CDS_pept        complement(542376..543035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82244"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAH2"
FT                   /protein_id="AAT82244.1"
FT                   /translation="MRLTAKNSQDPRRLSRTHKPTARRRVHVMVARHRRGLAALLAALA
FT                   VLLVASPGMATSSSGREVIVAAHAIEGGRVIQRSDLHTVRIDPGVLPHETATLAQVEGR
FT                   QASIRITEGTILTSSAVLSGSAVGSGKALVGIHLADSSMVGMLQVGQRVSVVSPSEDGT
FT                   PHVLTRGAIIRSLPTSGGGLIQGSPSTELVVVSTGSTDAAAIAVAGQGQPLGLVVE"
FT   gene            complement(543115..543417)
FT                   /locus_tag="PPA2407"
FT   CDS_pept        complement(543115..543417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA2407"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA2407"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82245"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAH1"
FT                   /protein_id="AAT82245.1"
FT                   /translation="MPTYQYQCNDCGRDLEVVQRFSDPSLTICPSCEGDLRKVFSAVGV
FT                   VFKGSGFYSTDNHTKGASKAATGDSSSPTALESSTKSEPASSSSSSTAKASESAS"
FT   gene            complement(543495..544082)
FT                   /locus_tag="PPA0493"
FT   CDS_pept        complement(543495..544082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0493"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82246"
FT                   /db_xref="GOA:Q6AAH0"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAH0"
FT                   /protein_id="AAT82246.1"
FT                   /translation="MDPPSGKEELRRRCLAHRAALDHRTRMSRDDRRTEHAMSRLLWAH
FT                   KVALYLSRGDEPDTVDLADTLIMMGKKVLAPVLTDGHGRSLHEPAWAWYDSKNIRTGLW
FT                   QIPEPIAPILPASAIDQVEVVLCSALFVDRSGYRVGVGGGWYDRVLVHRADDVPVWAVV
FT                   NDDEILDEVPHDPWDEPVTAALTPSGLHMLGQ"
FT   gene            544192..545499
FT                   /locus_tag="PPA0494"
FT   CDS_pept        544192..545499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0494"
FT                   /product="putative molybdopterin biosynthesis enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82247"
FT                   /db_xref="GOA:Q6AAG9"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAG9"
FT                   /protein_id="AAT82247.1"
FT                   /translation="MALFHRKKQVEAPEPEAEPLGLPGAPETDMSDRRSVDDHRDYLCS
FT                   LVQAVPPVAVEVPRAVGLAVCEDVHAPHDVPVVTTAVIDGYALDSASTRMAGRPDAVEI
FT                   QVDRRPPSPVIPGTAVRVVAGSPLPEGTDCVLPPDLLNADGDIVLFSPVKRWAGARLAG
FT                   SDYGRGEVLVRNGTILHPGIISVLASAGIDEVFVRPRPKVVIVAVRADEDQRAEIERKA
FT                   RANGAEDIASLDATAAAIESATRALDVNVTVVSTNTSSDSELTRLLANAGRGADLVIAT
FT                   SDRIVVGQQDPVPSVLPPMGGTDFARVAMEPGANQVFALIDPGLVPLIVLPVGPGPALV
FT                   SFMAFVQPLLRKLSGLPPVEKLKAETDRPIARHPESTTFVPVRLARVGGRPVLSRAGMG
FT                   DVTHVVDLSMADAIAVVGAGDEPVPTGMPLTCWRLG"
FT   gene            545537..546211
FT                   /locus_tag="PPA0495"
FT   CDS_pept        545537..546211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0495"
FT                   /product="putative ribosomal-protein-alanine
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82248"
FT                   /db_xref="GOA:Q6AAG8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAG8"
FT                   /protein_id="AAT82248.1"
FT                   /translation="MPRHRHWPVTMQAGGVVLRPMRRADEARWTTTRELDWDWLGPWEA
FT                   TKPPGSHERVGGYRMMIARNRRRAKEGTFLPWAIGWDDGWPDRPALNRDTTPLIGQLTV
FT                   SSISLGSAMSCSMGYWVASAYAGRGVAPTAVALACDYVFQVMGLHRVEICVRPENTKSL
FT                   RVVEKLGLAEEGMRPAYLHIDGQWRDHRVFRLLTDDYPDGVLRNYLVNHLLPGFALGED
FT                   EG"
FT   gene            546284..547087
FT                   /locus_tag="PPA0496"
FT   CDS_pept        546284..547087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82249"
FT                   /db_xref="GOA:Q6AAG7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAG7"
FT                   /protein_id="AAT82249.1"
FT                   /translation="MSFVQALQAVLIAIVLVGWIAYLVPMVVNRRRSQEVTDDKHEDFP
FT                   DTMSVVSRGSCTVTPNDTDENPRVELSTPYTRSYARWDLRRSWAVAARRRMTTMLVLLG
FT                   LTALAMVLAITDVTPWWLVAIFVLLLVGFFALARWSVVAMAKRFDRRYALIDKGWDEDT
FT                   VELEVGTEPFRAEDEPTSWTIDLDRPVTAPEGSLWDDVVVTAPTYVSTPLGARTVRTID
FT                   LSAPGPVPGQVDTPVVAEKPVERSDGEHVAEAHEGPSGIVGVASA"
FT   gene            547303..547378
FT                   /locus_tag="PPA2414"
FT   tRNA            547303..547378
FT                   /locus_tag="PPA2414"
FT                   /product="tRNA-Ala"
FT   gene            complement(547811..548488)
FT                   /locus_tag="PPA0497"
FT   CDS_pept        complement(547811..548488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0497"
FT                   /product="putative component of anaerobic dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82250"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAG6"
FT                   /protein_id="AAT82250.1"
FT                   /translation="MSPEQVTEPVTGSLDDELDQFAAVFTILGSLHYQVPDADHLHELL
FT                   QMIDEWPLSRPRSPSRMEEGLQMWRLSREEAESRQVVVADHDRLYGDSAVALVPPYESV
FT                   HRNREGLVFDEHTLQVRAAYARLGLAAPHLHREPDDHIGLELEFLAQGCLRVLDAREDG
FT                   HADESHQTLAIVANFLRTHVLAWAPSFLSRVSEQAQTSFMKGVALVTIATLDEFDRCLD
FT                   SVT"
FT   gene            complement(548485..548970)
FT                   /locus_tag="PPA0498"
FT   CDS_pept        complement(548485..548970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0498"
FT                   /product="molybdenum cofactor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82251"
FT                   /db_xref="GOA:Q6AAG5"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAG5"
FT                   /protein_id="AAT82251.1"
FT                   /translation="MTSHPFTHLRGNGSAHMVDVTTKTPTVRVATAECCVVCSEPIMTA
FT                   LRDESVPKGDVLAVARIAGIQATKHTPDLIPLAHRIGVHGAEVDLWLEPDRVRIRATTR
FT                   TTDRTGVEMEALTAVTVAALTVADMVKGVDRGFAIEHAVITHKAGGRSGEWTRSDDQ"
FT   gene            complement(548936..550270)
FT                   /locus_tag="PPA0499"
FT   CDS_pept        complement(548936..550270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0499"
FT                   /product="molybdenum cofactor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82252"
FT                   /db_xref="GOA:Q6AAG4"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAG4"
FT                   /protein_id="AAT82252.1"
FT                   /translation="MSSSRSSVPATTPKPVSIARHLQLVSSLATAPKTVELPLAECLGL
FT                   VSAEPVTARLTVPPFTNSAMDGFAVRHADVSEATVHTPVTLPVTNDVPAGSPAHRPLDP
FT                   GTAQRIMTGARMPENADTVIKVEDTDHAPGTVDAPATVTIFRTPSTGANVRRRGEALAT
FT                   GATVLPAGRRLTPEALAAAAAVGHGSLRVHPAPRVGVLATGSELGGSGEPLHRGKIPDS
FT                   NGIMLGGLVRTHGGVVEQTRVPDDPERLRELVRSWRVDLIVTAGGISMGAYEVVRQGLP
FT                   ELTFHHVAQQPGGPQGAGMVAEMPVLALPGNPVGAYVSFHVYVAPLLARLRGLSPDLID
FT                   ATPAGVTAPIDPLLGRRLVRARAGAPWRSPAAKTQFMPVCWNGENVEPVHALGSKSHLV
FT                   TSLPLVEGLAVAGPGIDHVDSGDELSILLTGGVTHDLTPIHPPAW"
FT   gene            complement(550267..550689)
FT                   /locus_tag="PPA0500"
FT   CDS_pept        complement(550267..550689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0500"
FT                   /product="molybdopterin synthase MoaE"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82253"
FT                   /db_xref="GOA:Q6AAG3"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAG3"
FT                   /protein_id="AAT82253.1"
FT                   /translation="MHAKISDEPLNVAKVVSLVSDDRSGAVVTFTGVVRNHDGGQSITA
FT                   IDYSAHPHATQILADLVEQCATRDGVHGVAAEHRIGHVEVGGTAMVVAVSADHRGQAFE
FT                   AACEFVDAVKESLPVWKCQWLTDGSHEWAGLPGEEP"
FT   gene            complement(550690..550929)
FT                   /locus_tag="PPA0501"
FT   CDS_pept        complement(550690..550929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0501"
FT                   /product="putative molybdopterin converting factor"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82254"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAG2"
FT                   /protein_id="AAT82254.1"
FT                   /translation="MQVHYYGGTAEAAGTSEETVETPTGLSVNQLLDHLRNLHPGLGRL
FT                   LGVCTLFVDGSAVRGEQIVPARAQVEVLPPFAGG"
FT   gene            complement(550932..551972)
FT                   /locus_tag="PPA0502"
FT   CDS_pept        complement(550932..551972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0502"
FT                   /product="molybdenum cofactor biosynthesis enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82255"
FT                   /db_xref="GOA:Q6AAG1"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAG1"
FT                   /protein_id="AAT82255.1"
FT                   /translation="MSAATGQSAAHHGLPDRFGRLATDLRVSVTDHCNLRCTYCMPAEG
FT                   MDWLANRDLLTDDEIIRVIGIGIERLGITKVRFTGGEPLLRPSLENLVAATSTLRRTNG
FT                   TPPITALTTNGIGLDRRVDGLVEAGLDRVNISLDTVDRERFATISRRDRLADVVTGIDA
FT                   ALAARLLVKINAVPQIDSYRRDIPELLVFCLDRGLELRFIEFMPIGANGWKREATVSAD
FT                   DILTVVRDAGFSITADQAARGSSPAQRWSVSSRHTRPGWLGIIASVTRPFCANCSRTRL
FT                   TADGQIRNCLFADQEADLRSLLRSGASDDEIIAVWQGEMWCKSAHHGVDNGSFANSRRR
FT                   MSAIGG"
FT   gene            552215..552643
FT                   /locus_tag="PPA0503"
FT   CDS_pept        552215..552643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0503"
FT                   /product="putative molybdopterin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82256"
FT                   /db_xref="GOA:Q6AAG0"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAG0"
FT                   /protein_id="AAT82256.1"
FT                   /translation="MSIMSPHPPSHRVSDVAALLGVSDDTVRRWIDQRHVRAAKDTTGR
FT                   LRVDGASLAAFLVTQQQERQDLADGAQTQSMRNHIRGIVAKVISDKVMSQVELVTGNLS
FT                   IVSLVSTEAVRELGLQVGSIAVAQVKATNVSLQLPVTR"
FT   gene            552649..553419
FT                   /locus_tag="PPA0504"
FT   CDS_pept        552649..553419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0504"
FT                   /product="putative molybdate-binding protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82257"
FT                   /db_xref="GOA:Q6AAF9"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAF9"
FT                   /protein_id="AAT82257.1"
FT                   /translation="MSRVSLRTCAIAAVAAVLLAACGSGPSSTQPSAAPTRLTVFAAAS
FT                   LTRSYEQIGEQFERKYPRVDVQFSFEGSQNLVAQMAQGAPADVLATADQRSMNKAVEQN
FT                   LVNVPRQFASNVLTLVTPAHNPARVTGLNSSLRGAKLVICAPEVPCGNATRKLANKLGV
FT                   TLKPVSEEQKVTDVRGKVESGEADVGIVYRTDALAAGNKVDVIPIGRANEVVNHYPIAT
FT                   AVGATHQGLAKRFVEYVMSADAQKILSDDGFSGP"
FT   gene            553543..555357
FT                   /locus_tag="PPA0505"
FT   CDS_pept        553543..555357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0505"
FT                   /product="ABC transporter, putative molybdenum transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82258"
FT                   /db_xref="GOA:Q6AAF8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006469"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAF8"
FT                   /protein_id="AAT82258.1"
FT                   /translation="MKTRRRLFDPAPMPMWIVILAVVGICVLVLPLVGMGNEVPWARIP
FT                   AIMASPEAQDALWLSVRTCVIATVIDVFLGVPIALLLARDWNGVAAVRVLVLLPLSLPP
FT                   VVAGLALLATFGRRGMIGASLHAAGISIAFSTAAVVMAQVYVSLPFLVTALESSIRTRS
FT                   WKLEQTAAALGAGPWRVLRTITMPTVASALGRGTALAAARCLGEFGATITFAGSLQSVT
FT                   RTMPLQVYLARETDSDTAMALGLVLVVVGAIVAGLTQWQPSQRSWRRNEPPLVEEGLTG
FT                   QGNYELAGTRGTPYEQHVCEQSDPGKDLPEQSSITTNLGTSAVTVWSPQAHDDSVSRVR
FT                   GASAGHEPIGSAAAAIHVDGQVSARSWDVRLDVEPGEVVAVMGPNGAGKSTLASVVTGL
FT                   LALDRGRVCIGRQLVDAGDGRIVLPGRRGVGLLTQDALIFEHMSVLDNVAYGPRCHGLS
FT                   RAQAQKVAYAQLAAVGCAHLAARRGGELSGGQAALVGLARAFAVEPAVLVLDEPTAALD
FT                   IDAQIRVRDLLKSQLDRTNMTALIITHDVADTMTVAGRLVVLEHGRIIEDGVVSQLLEN
FT                   PKKAFTAQLAALVKFGVRTNSQGAESSS"
FT   gene            complement(555291..555911)
FT                   /locus_tag="PPA0506"
FT   CDS_pept        complement(555291..555911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0506"
FT                   /product="hypothetical protein, putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82259"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAF7"
FT                   /protein_id="AAT82259.1"
FT                   /translation="MTITDLARESKLHVNTIREPLNVLVSLGLVEREKLPAAGRGRPYW
FT                   GYTSRTLSGPNSPADLLRHLSRSTIRWIRDTSDDPVAAARSLGEHLGDDALAMANVPDH
FT                   TEHSPSDKFSLADHMTKIRVFLTAFGFSAEPHPTNPTALILRACPFVDPNDTDPVAMAI
FT                   QQGMLYRVIERTGGNSVHVTLHHEEDSAPCELVLTPNFTNAAS"
FT   gene            complement(556013..556726)
FT                   /locus_tag="PPA0507"
FT   CDS_pept        complement(556013..556726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0507"
FT                   /product="nitrate reductase gamma subunit"
FT                   /EC_number="1.7.99.4"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82260"
FT                   /db_xref="GOA:Q6AAF6"
FT                   /db_xref="InterPro:IPR003816"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAF6"
FT                   /protein_id="AAT82260.1"
FT                   /translation="MNTNLLVWLVLPYLSIILLIGGMIWRYRTDQFGWTSRSSQWNEPS
FT                   ILRWSSPLFHFGILFVFLGHVLGLVIPQSWTSTIGITEDTYHVMATVLGSAAGLAALVG
FT                   LLGLLYRRFMTKSVRLTTTTMDIVTYVLLTLTVTLGCWATVHQQMIVGGYNYRDTIGPW
FT                   FRSIALFQPRPELMATVPLDYKLHVMAGMVLFSVWPFTRLVHVVSAPVSYPTRPYVIYR
FT                   SKNGHLGSSSRHYGW"
FT   gene            complement(556723..557394)
FT                   /locus_tag="PPA0508"
FT   CDS_pept        complement(556723..557394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0508"
FT                   /product="nitrate reductase delta subunit"
FT                   /EC_number="1.7.99.4"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82261"
FT                   /db_xref="GOA:Q6AAF5"
FT                   /db_xref="InterPro:IPR003765"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="InterPro:IPR042290"
FT                   /db_xref="InterPro:IPR042291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAF5"
FT                   /protein_id="AAT82261.1"
FT                   /translation="MGVFLGAPRIPVSTHVDASLAQRRVVHMATSLLLDYPDEQLTQII
FT                   TAVRHDRDLMPAVVADEITAFCGVAESWGLRALQEHYVETFDQHRRCALYLSYYSAGDT
FT                   RERGAAILGFREVMRSAGFELDHANELPDYLPVVLEFSARASEGDTLLRANREALEVIR
FT                   SALVTASSPYAHLLEGLCLILSPLDKKTLARYQKLISQGPPVEMVGLAATDPVSTLGRQ
FT                   L"
FT   gene            complement(557396..558919)
FT                   /locus_tag="PPA0509"
FT   CDS_pept        complement(557396..558919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0509"
FT                   /product="nitrate reductase beta chain"
FT                   /EC_number="1.7.99.4"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82262"
FT                   /db_xref="GOA:Q6AAF4"
FT                   /db_xref="InterPro:IPR006547"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029263"
FT                   /db_xref="InterPro:IPR038262"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAF4"
FT                   /protein_id="AAT82262.1"
FT                   /translation="MKVMAQIAMVMNLDKCIGCHTCSVTCKQAWTNREGTEYMWFNNVE
FT                   TRPGVGYPRGWEDQERWRGGWKRTRSGKLVPYQGGRLATLGKIFANPNLPAKKDYYEPW
FT                   TYEYDQLLASPSTQHIPTARAKSALTGEHKDTIDWGPNWDDDLGGSMETLDQDPVLHQM
FT                   NLTVRKSIEDSFMFYLPRICEHCLNPTCVSACPSGAIYKRAEDGIVLVDQDHCRGWRMC
FT                   VSGCPYKKVFFNHHSGKAEKCTLCYPRLEVGQPTVCSETCVGRLRYLGVLLYDADHVTW
FT                   AASQPDPRTLYAAQRDILLNPNDPEIITQAKANGVPHSWIKAAQASPVWQLISRYQIAL
FT                   PLHPEYRTLPMVWYVPPLSPVVDAVSASGNDGEDHRVLLAAISQMRIPLEYLAGLFTAG
FT                   ATAPVELSLRRLAAMRSYMRDIFLGNEADETIPEAVDMTGEDIQSMYRLLSIAKYDDRY
FT                   VIPTTCSGLPDGIADLGRCPVSGSLEAFHSISSPVSAPEGTPTLPLEVI"
FT   gene            complement(558919..562656)
FT                   /locus_tag="PPA0510"
FT   CDS_pept        complement(558919..562656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0510"
FT                   /product="nitrate reductase alpha chain"
FT                   /EC_number="1.7.99.4"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82263"
FT                   /db_xref="GOA:Q6AAF3"
FT                   /db_xref="InterPro:IPR006468"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR037943"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAF3"
FT                   /protein_id="AAT82263.1"
FT                   /translation="MTEYDETSDAESPSGSALLKMGTWLRRGTTSPDTRQLFLEGGRDA
FT                   DVFYRKCWSHDKVVRSTHGVNCTGSCSWKIYVKEGIITWESQQTDYPSTGPDMPDYEPR
FT                   GCPRGASFSWYEYSPTRIRHPYVRSVLLDAWRDKLAEFGDPVDAWASITNDPELSQAYK
FT                   CARGHGGMVRVSWEEATQIIAAAYVHTIKAYGPDRIAGFSVIPAMSMVSYGAGSRFTEL
FT                   LGGTMLSFYDWYADLPPASPQVFGDQTDVPEAGDWFNSQYLIMWGSNVPVTRTPDAHFM
FT                   TEARYHGQKVVVVSPDYADNTKFADEWLRVASGTDGALAMAMGHVILSEFHVTRREPMF
FT                   LDYMRRYTDSPFLVELDRFDGPQADGAAYVPGKFLTADKVNLQTRPDHPEFRPLVMEAD
FT                   GSLKDPGGTLADRFSESGVGHWNLDLDGVNPVMSMMDVNSWEAVEIALPRFDLPSSPDQ
FT                   TSLGAGIVHRGVPARRIGDRLVTTVYDLLLAQYAVSREGLPGQWPSGYDDPTVPGTPAW
FT                   QAELTGVPAAAAERIGREFALNSLETGGRSMIVMGAGVNHFYHADEIYRTFLALTNMCA
FT                   TQGVNGGGWAHYVGQEKVRPFTGWANYSFALDWARPARQMIATAWYYLTTDQWRYDGAR
FT                   AESIASPLGSGSFAGRTTADCMVYSARRGWTPSYPTFTRNPLDLADEAAAAGMEPAEYI
FT                   AQKLTDGSLGFACEDPDATQNYPRLLANWRTNLLGSSAKGTEFFMKHMLGCENDVNATE
FT                   LTEGKRPTDIRWRDDTPPGKLDLMWTADFRNTSTTLHSDVVLPAATWYEKHDLSSTDMH
FT                   PYVHSFNPAVDPPWEARTDFEVFRTLAYSVSQMAVKHLGTRTDIVAAPLMHDTPDEMTT
FT                   PAGSVSREQEAWIPGVTMPKLVTVERDYTQIGAKFDTLGPLTESLGMVTKGVPFHPDPE
FT                   VADLAQRHGVATSGPGAGRPLLDTAIKACDTILATSGTTNGRLATAGFEQLEARTGTKL
FT                   TDLSVGSQDRRVTFTDTVIQPQPVITSPEWSGSEHGGRRYSAFVINMERHKPWHTLTGR
FT                   MHYYLDHDWMRDMGESLPIFRPPLDVAHIYDEPPAGYTGTDADGAAVVSVRYMTPHNKW
FT                   GIHSQYYDNLHMLTLARGGQTIWMSPADAAKIGVSDNDWVEAYNRNGTVDARAIVSHRI
FT                   PEGTVFMYHGQERTVNTPLTERSGKRGGTHNSLTRILLKPSHFIGGYAQLSYAFNYYGP
FT                   TGNQRDEVTLIRRRGQEVTF"
FT   gene            complement(562714..564030)
FT                   /locus_tag="PPA0511"
FT   CDS_pept        complement(562714..564030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0511"
FT                   /product="nitrate/nitrite transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82264"
FT                   /db_xref="GOA:Q6AAF2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAF2"
FT                   /protein_id="AAT82264.1"
FT                   /translation="MSTSPSHHLIENWDPEENWDSGIAWRTLTISTFSMIIAFCVWFLV
FT                   SAIAPKLNAIGFHLTKSQLYWLTAMPGLSGGFIRLVYMFLPPVIGTRRLVGYSSLLYLI
FT                   PMLGWFFAVQNTSTGYGTLLLLAFLCGVGGGSFSGYMPSTGYFFPKSKQGTALGVQAGI
FT                   GNLGMSIVQLLGPWLMGFGLLGLTWIAPQHTAGSPLWVHNIAIVFVPWTILATILAFTM
FT                   LKDVPVKANFRRQIDIFTNPDTWIMTLMYVMTFGLFSGFSAQFGLLIENTYGNSSNLAH
FT                   GFSNLPAGASYAFLGPLIGSLVRVVWGPLCDRFGGAIWTLVSGIGMALTFGFCAFFLNP
FT                   TSPSQFGYFLWGMLTMFFFSGIGNAGTFKQMPMIMPARQAGGAIGFTAAIGCFGPFVVG
FT                   VALSSMSAVAWFWICTVFCIVCSIICWIRYARPGAPCPG"
FT   gene            564217..564891
FT                   /locus_tag="PPA0512"
FT   CDS_pept        564217..564891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0512"
FT                   /product="hypothetical protein, putative
FT                   molybdopterin-guanine dinucleotide biosynthesis protein A"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82265"
FT                   /db_xref="GOA:Q6AAF1"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAF1"
FT                   /protein_id="AAT82265.1"
FT                   /translation="MKSVAGGLLRIGMRHDHDMTNRRLDAVILAGGCAHRLGGVAKANL
FT                   RVGTRRLLDVVLDAVDGAREGLEGSNVVVARESVEVPWSVIRTMEDPPGSGPLAGIRAG
FT                   LQALPPAQPDDLVLVCAVDSPGIGRSIRQLREALEDDPLNHFAGAVTFGGVPKPHRQLL
FT                   QGLYRRVPLEASIAAADTVVNRSVHSVLGGLCLLDLPVEPEACRDLDTPGDVEWWLRHI
FT                   GD"
FT   gene            565188..565688
FT                   /locus_tag="PPA0513"
FT   CDS_pept        565188..565688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0513"
FT                   /product="molybdenum cofactor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82266"
FT                   /db_xref="GOA:Q6AAF0"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAF0"
FT                   /protein_id="AAT82266.1"
FT                   /translation="MDEIRARVITVSDRCAAGAALDRSGPLAASLLAELGCSWLKVDPV
FT                   TVVPDGIDSVGGALRDALENGCRLVVTTGGTGISPRDLTPEATEPLLVARLDGLAEQVR
FT                   ALGAHGSALAGLSRGLVGVTSRGDQAALIINAPGSTGGVRDTLTVIGPMLEHIFRQLAG
FT                   GGH"
FT   gene            565858..566133
FT                   /locus_tag="PPA0514"
FT   CDS_pept        565858..566133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0514"
FT                   /product="hypothetical protein, putative
FT                   molybdopterin-guanine dinucleotide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82267"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAE9"
FT                   /protein_id="AAT82267.1"
FT                   /translation="MSHHDDNPEKMARMRDWLEIAAREVDVDPSVLTDVEQPLLDMVSV
FT                   ISHGPSRPGAPLTAFLVGIATAQGGDTLQLVKKLMQAAEQRGQTRD"
FT   gene            complement(566197..567207)
FT                   /locus_tag="PPA0515"
FT   CDS_pept        complement(566197..567207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0515"
FT                   /product="anaerobic dimethyl sulfoxide reductase chain C"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82268"
FT                   /db_xref="GOA:Q6AAE8"
FT                   /db_xref="InterPro:IPR007059"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAE8"
FT                   /protein_id="AAT82268.1"
FT                   /translation="MNTHDVPMILFTVVTQMCVGAFLVLGTAHVGAAIRGRENSVVERT
FT                   SRPVLYAIGPAMVFGLFVSMFHMGYPAHTLNVLRHPQTSWLSREIMFGSGFALLGFVFA
FT                   MLSWFKRPAFAIQRVLAVVTAIVGIGLLVCESMIYYSLVTVPAWHSWWVPFSFAATTII
FT                   LGTLSVACALMITAMVRHRHETAVPSAREKHPKTTGWWSRHVTEEIRAINAPTDDQEWD
FT                   LSLTVTKWCSIGAAVVSVALMVGYPLYTSQLASGGPVAHQASNTFSGGIYATRLILLGA
FT                   IALMLGSFVYRGALHTPREHPHSLGWLLITMLIITFAGEIVGRALHYWSLVRIGI"
FT   gene            complement(567207..567848)
FT                   /locus_tag="PPA0516"
FT   CDS_pept        complement(567207..567848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0516"
FT                   /product="anaerobic dimethyl sulfoxide reductase, chain B"
FT                   /EC_number="1.8.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82269"
FT                   /db_xref="GOA:Q6AAE7"
FT                   /db_xref="InterPro:IPR014297"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAE7"
FT                   /protein_id="AAT82269.1"
FT                   /translation="MGEKNYTAKGAKYGFFFDQTLCTGCKACQIACIDKHDLPTGVRWR
FT                   RVVEYSGGTWQISGDTFNPSVFTYYTSVSCNHCEDPICMKVCPTTAMSRRDDGTVYVDQ
FT                   DKCVGCRYCEWACPYSAPQYRKDTGRMSKCDLCYDYRSKGKEPACVAACPSRALDWGPI
FT                   DELRSTYGNEDAIAPLPDPSVTKPHLVITAHRDAQRWDEGTGEIANTKEI"
FT   gene            complement(568015..570576)
FT                   /locus_tag="PPA0517"
FT   CDS_pept        complement(568015..570576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0517"
FT                   /product="anaerobic dimethyl sulfoxide reductase chain A"
FT                   /EC_number="1.8.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82270"
FT                   /db_xref="GOA:Q6AAE6"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR011888"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAE6"
FT                   /protein_id="AAT82270.1"
FT                   /translation="MESYSTNIPGLKTKASRREFMKWSAVVGGTAALAPVLHETKDALA
FT                   NKPTNDASTFVWSACTVNCGSRCPLRLEVKDGTIVRVLPDDTANNKVGSQQVRACVRGR
FT                   SIRHRIYNPDRLKKPMKRKPGTKRGDEQWVTISWDQALDEIAEKMKKIKARYGNEAFYI
FT                   NYGTGTLGSVMAKSWPPDQSAFARLMNTWGGYLDHYSDYSTTEITQAYPYFYGSWVGSN
FT                   SFDDVKNSKLQVMFGNNPAETRMSGGGQVFVSQQTRKASGVRTIVIDPRYSETAITMAD
FT                   EWIPIRPGTDAALVAGLIHTMITEDLHNQAFLDRYCVGFDDKHLPEGTSAGSSYRAYLE
FT                   GKGPDHTIKNAQWASHITGVPAERIRRLAREIAAANPCAITQGWGPQRHANGENSARAI
FT                   FLLAAVTGNIGIPGGGTGAREGAQAFQFTLPFNTEITNTKSNKIIPVFSWLDAIDHGEQ
FT                   MDTFNSGVCEKPAPGVRANKVPIDEHGKPTNVKLSAPIKMVWQYAGNSLVGQTGNNNRS
FT                   VEILRDDSKCELIVVCDIQYTTSARYADYVLPGTSTAEEEDIHPGENGGPMAYGIVSSQ
FT                   AIKPLYECRNIFDICAGPAKRLGTEKEFTGGLTRSQWLERTIEETRKKDPGLPTYREWK
FT                   KIGIFRKDMGPYVELDEFRKDPVANPLETPSGKIEIYSERLAAMSEAWTFGTFRKKLAG
FT                   DKLTALPEYVVTWEGPEEAKASKKYPFQVIGHHFKGRTHSSYGNVDWLLDAHPQTVWIN
FT                   TRDARAKGITNGDQVFVYNDRGTIRLPARVTDRIAPGVLSVPQGAWYRPLSNTKVAPPS
FT                   KANPKQPVDINGAMNTLTSLHPSPLAKGNAVHTTIANVEKA"
FT   gene            complement(571030..571875)
FT                   /locus_tag="PPA0518"
FT   CDS_pept        complement(571030..571875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0518"
FT                   /product="putative molybdopterin biosynthesis protein MoeB"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82271"
FT                   /db_xref="GOA:Q6AAE5"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAE5"
FT                   /protein_id="AAT82271.1"
FT                   /translation="MSALNPMDDAVSRATNGHDAVEDMGSTTSLINRDLIRYARHIVLP
FT                   GFGQEAQRRLRDSRVLVVGAGGLGSPVLLYLSAAGVGYLTILDDDVVDESNLQRQVIHR
FT                   QADVGRPKALSAKDAVQRLNTHLVAEAVVARLGTDNALDLVKDHGLILDCTDNFTTRYL
FT                   ASDAAEITGTPLVWGTILQYQGQLSVFWPDRGPMLRDLFPEVPAADSVPSAVVGGTFGP
FT                   VVGQVGSMMATEAVKVLTGIGTPAVGKLVVVDALGVGARTLSFAADPDRASVTQLPEAE
FT                   "
FT   gene            complement(571872..572705)
FT                   /locus_tag="PPA0519"
FT   CDS_pept        complement(571872..572705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0519"
FT                   /product="thiazole biosynthesis protein ThiG"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82272"
FT                   /db_xref="GOA:Q6AAE4"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AAE4"
FT                   /protein_id="AAT82272.1"
FT                   /translation="MSCDEKAATSSDEPLRIGGLRLTSRLIMGTGGSTSMDTLERALVA
FT                   SGTQLTTVAMRRFAAGPRQSVFEILQRHRITALPNTAGCYTARDAILTANLAREALDTN
FT                   LVKLEVIADEDTLLPDPVELVNAAEQLVANDFVVLAYTNDDPAIAKRLEDLGCAAVMPA
FT                   GAPIGTGLGILNPHNIELIVDRANVPVILDAGIGTASEATLAMELGCDAVLLASAVTRA
FT                   HNPVGMAQAMKMAVVAGRMARTSGRIPRRRLARASSPFDGIITGRVRGPRENDSL"
FT   gene            complement(573023..574270)
FT                   /locus_tag="PPA0520"
FT   CDS_pept        complement(573023..574270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0520"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82273"
FT                   /db_xref="GOA:Q6AAE3"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAE3"
FT                   /protein_id="AAT82273.1"
FT                   /translation="MGTAATRREFAGSTVVGHVDTKSHNHAAETSTIPPSERGRPSSVV
FT                   IAGAGIIGLTTAWRLRRRGIEVTVLDDAPVSGASFAAAGMLAPVSEVIWDQPTLYPLMV
FT                   ESGRIYRDFAAAIAHDVGHDIGYLESSTFVCAGDSADRQTLNELLELQHRMGMTVNRIS
FT                   VSQARAAEPALGPGCVGVVDIPGDHQVDPRRLCGAILEFLGDRVVPTRASEVLFNEDHR
FT                   AIGLRGANGKSYRADHVVLAAGVDTGAITGIPQALTDLLRPVRGEVLRLRVPEALRPLV
FT                   TRTIRGVVQGNAVYIVPRADGTIVLGATTREDDMVGVRAEGVHQLLRDAHRLVPGILDC
FT                   EIYEMTAKARPGSPDDVPMVGRVGDGLTVSMGYFRHGILLAAIGSRIGADIVCGTEKDN
FT                   NPALLAAVNPFRFGNR"
FT   gene            complement(574652..574966)
FT                   /locus_tag="PPA0521"
FT   CDS_pept        complement(574652..574966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0521"
FT                   /product="conserved protein, putative metal-transport (Mg2+
FT                   and Co2+) protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82274"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAE2"
FT                   /protein_id="AAT82274.1"
FT                   /translation="MDGHPERLGIIVEQSPNRTQIKRLVDPMNLDPLLAEDLAEGHQRP
FT                   KLERHGEALFLVLHPPFYIDSIEDVAFVEAEVIKQRNCVVPTLIGSIYSMNFDNMPELH
FT                   "
FT   gene            complement(575226..576671)
FT                   /locus_tag="PPA0522"
FT   CDS_pept        complement(575226..576671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0522"
FT                   /product="putative uracyl permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82275"
FT                   /db_xref="GOA:Q6AAE1"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAE1"
FT                   /protein_id="AAT82275.1"
FT                   /translation="MIWKLHNRGVLESGEVVAPDERLGWGRTIGLGAQHVVAMFGATFV
FT                   FPVLMGLNPQLAVMMSGVATLVFIFVTQHEVPSYLGSSAAFPGVATAIYASGGKPNDVS
FT                   GALLCVGLTLLICGIIIQAAGSRVVHKVLPPTVTGAVVMLIGFNLAPVVAKTYWPTDQW
FT                   TALIVMLLVIALSVGPRGFVSRIAIFLALVIGYLLSWTEDLVFGPLHHSDGSTAPRVDW
FT                   SAVHNSAWIGLPPATNLNNWQYLPQVHNGSHYASTNVVGFHLPAFHLAFILLALPVVIA
FT                   LIAENTGHVKAVAEMTGKNLDHQVGRAVAADGATSMLATFLGAGPTTTYSENIGVMAAT
FT                   RVYSTAAYVVAAVVAILFGFSPKFGAVISATPGGVLGGITVVLYGMIGLLGAKIWKENE
FT                   VDFGNPVNLVPVAAGIIIGVGDVSLKFSKSFTLGGIALGTIVTVGVYHLARWLAPHELS
FT                   DAAGGTNIILDAPGMYVDDDTPQ"
FT   gene            complement(576754..578337)
FT                   /locus_tag="PPA0523"
FT   CDS_pept        complement(576754..578337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0523"
FT                   /product="putative dolichyl-phosphate-mannose-protein
FT                   mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82276"
FT                   /db_xref="GOA:Q6AAE0"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="InterPro:IPR032421"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAE0"
FT                   /protein_id="AAT82276.1"
FT                   /translation="MPATRRSLSTIERLDDGRMTDEYTSWIITALITTVAFLLRVWNVG
FT                   FPNSLVFDETYYPKDAWTMLHQGYEATWPDAAKANADIVRGITNTWTPDAEFVVHPPVG
FT                   KWLIATGEQLFGFNSFGWRFSSVVFGSLLVLMTIRLARRLSRSTMVGAIAGILLTLDGL
FT                   AFVMSRIGLLDIFQAFFLVAGVSAVAADRDWFRHRLADHLRTIGNPHLNGDFGPALGWR
FT                   PWRLVAGIMFGLACGTKWNSMFVLATMGIVSVIWDWSARRLAGAGTKAWWSFLRDGVPA
FT                   FVYLVVVALLTYLATWAKWLVTYPHMVFGKSWAGPAPSPGLSKVVGKPLAALWEYHRQI
FT                   YDFHTGSYMMTQTHVYASNPSGWLVIQRPLGVDAVNGIKPGQQGCKAVGDTCLRVISAT
FT                   GTPVLWWFAAIALVAAVIWWIFARDWRFTLPIVAMMSTWIPWFRYDDRPLFFFYAICII
FT                   PFTVTILAIWLGQILGPAKASSRRRIGAIVVGTVMALVAADFAFIYPILTDGLMTRKAW
FT                   LARMWFHSWI"
FT   gene            578398..579258
FT                   /locus_tag="PPA0524"
FT   CDS_pept        578398..579258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0524"
FT                   /product="putative tetrapyrrole (corrin/porphyrin)
FT                   methylase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82277"
FT                   /db_xref="GOA:Q6AAD9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAD9"
FT                   /protein_id="AAT82277.1"
FT                   /translation="MSKTQPGRVILAGTPIGDRRSASPALIETLRDARVIAAEDTRRLR
FT                   DLLRRLGVESSARVVSYFEGNESARTPELINCLRDGDDVVVVTDAGMPSVSDPGYRLVT
FT                   AAIEHGIVVTSVPGPTAVTTALAISGLPTDRFCFEGFLPRKPGERRRRLAELAQEPRTT
FT                   VLYEAPHRLADLLDDAADALGTDRRAAVCRELTKTYEEVRRGGLGELAEWAREHARGEI
FT                   TIVIEGAPGTVVGIDEAAEMVAELTADGIKRSKAVAQVARATGVDRHDLYDAAQNALTT
FT                   DKEES"
FT   gene            579255..580163
FT                   /locus_tag="PPA0525"
FT   CDS_pept        579255..580163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0525"
FT                   /product="DNase"
FT                   /note="related to TatD"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82278"
FT                   /db_xref="GOA:Q6AAD8"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAD8"
FT                   /protein_id="AAT82278.1"
FT                   /translation="MNEAIREVLGEAGAPPLPEPLAGSIVDSHTHLDTVQDVVGIEPAI
FT                   SLAAAREVGVTRIAQIGCDVAGSEFAEELARTHKNVIAAVAIHPNDAARLGREKIGDAL
FT                   KRIDELASVGNHVRAIGETGIDHFGTTDADGQALQREVFAAHIAMAHAHDLTLAIHMRD
FT                   ARNGGEGDEPPSGRQAHDDVVDVLNSEGWPDRIIMHCYSGDADLARICLDHGAYLSFSG
FT                   TITFNSAGPQRDALAIAPDNRILVETDAPFLTPAPRRGKRNGPYLLPHTARFIAKQRGW
FT                   DELRVCQQLTENAFAAYGGAW"
FT   gene            580160..581056
FT                   /locus_tag="PPA0526"
FT   CDS_pept        580160..581056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0526"
FT                   /product="dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82279"
FT                   /db_xref="GOA:Q6AAD7"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AAD7"
FT                   /protein_id="AAT82279.1"
FT                   /translation="MSETGLLNPASIRRIADQIGLRPTKTRGQNFVHDANTVRRIVSLA
FT                   QVGAADRVIEVGPGLGSLTLGLLETGAEVVAIEIDEVLANQLPGTVAERMPGAAERLEV
FT                   VLSDALDVKVIPGAEPTALVANLPYNVAVPVLLHMLAICPQWSTGVVMVQSEVADRLVA
FT                   APGSKIYGVPSAKLAWYAEAIRVGNVPPTVFWPVPNVDSGLVRITRRRPPHVDGRDPRV
FT                   TRSQVFRVVDAAFASRRKMLRSALAGLCGGSMAASELITAAGIDPTARGEALDIGDLAR
FT                   VVEALAQAGALSDSGQV"
FT   gene            581080..582051
FT                   /locus_tag="PPA0527"
FT   CDS_pept        581080..582051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0527"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82280"
FT                   /db_xref="GOA:Q6AAD6"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AAD6"
FT                   /protein_id="AAT82280.1"
FT                   /translation="MVMMDDPFDLLRPMTVTVRVSAKVNLALGVGGLAPDGFHPLATVF
FT                   EAICIYDEVAVTRRDDSRITLTVSGEDADQVPTDETNLAWRAVELVREEFASEWGKRGH
FT                   GADIHIDKSIPVAGGMAGGSADAAGALMAAAALCRLPYSPEELQPLAAQLGSDVPFCLT
FT                   GGVALGRGRGDRLAPVICRGRHRWVFATSNQGLSTPAVYRRFDELGGTPGGETVPNDLI
FT                   SALTRGDLDAVAASLSNDLQAAAIDLRPELEEVLTVGREVGALTALVSGSGPTCAFLVR
FT                   DTAGAKKVSAAVSNLPQVHRTRTARGPAAGAQLLPGPVGSFA"
FT   gene            582048..582587
FT                   /locus_tag="PPA0528"
FT   CDS_pept        582048..582587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0528"
FT                   /product="putative MarR-family regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82281"
FT                   /db_xref="GOA:Q6AAD5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAD5"
FT                   /protein_id="AAT82281.1"
FT                   /translation="MTRPLHQNAVHQNSPRKDAVDGIIAAWARERPDLPVEVMEVWSRV
FT                   TRLARRLDRDRAKAFSQWDLEGWEFDVLAALRRSGEPYQLSPGQLLNELEVASGTMTNR
FT                   ITRLSNRGLVRRLPHPKDGRGVIVELTDEGRDRVDGALAALLESEGRLFDSMDAQVVEQ
FT                   VGQGLRAVLARQEELD"
FT   gene            complement(582569..583252)
FT                   /locus_tag="PPA0529"
FT   CDS_pept        complement(582569..583252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0529"
FT                   /product="putative TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82282"
FT                   /db_xref="GOA:Q6AAD4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAD4"
FT                   /protein_id="AAT82282.1"
FT                   /translation="MMSDFSSQPSPPQRRARMTSGQRREQLISVARRLFADNGMAGTSV
FT                   EEIAATAGVSKPVIYEHFGSKDGLYAVVVDREVRHLQDSLNAAMTRPKQGPKRTLESAV
FT                   LALLDYIDDRPDGFRIISRDSSVGSATGSYASILSDVASWAEGILAANFDRHGFDVSYS
FT                   YLYAQALTGMVGMTGQAWLDTREPAKEVVAAHLVDLTFNGLAHLSGSPHLSRHAERESL
FT                   QSSSS"
FT   gene            583335..583416
FT                   /locus_tag="PPA2415"
FT   tRNA            583335..583416
FT                   /locus_tag="PPA2415"
FT                   /product="tRNA-Gln"
FT   gene            583502..584800
FT                   /locus_tag="PPA0530"
FT   CDS_pept        583502..584800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0530"
FT                   /product="N-acetylglucosamine-1-phosphate
FT                   uridyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82283"
FT                   /db_xref="GOA:Q6AAD3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AAD3"
FT                   /protein_id="AAT82283.1"
FT                   /translation="MTPSPSTDRAEIDGVAAVIVLAAGGGTRMKSTKSKLLHEVAGRPM
FT                   LSWAIGAARGLNPEHLVVVVGHRREQVEAHLAEDAPDVTTAVQAEQKGTGHAVACGLEG
FT                   LDELHGEVVVTYGDVPMLTGETLQRMVEVHRERRNLVTVLTAEVEDPTGYGRILRGGEA
FT                   VVGIVEHKDADEAQRAVREINSGIYVFDAEALREGVSKLSNDNVQGEYYLTDVVTMAAD
FT                   GTVEVPGRGRVGAFRIDDVWQTEGVNDRVQLARMNAEVNRRIVTGWMRAGVTIIDPTST
FT                   WIQPDVDLANDVTLYPGVFLNGATTIGAGATVGPDVTVTDSEIREEATVTRSEVTLAVV
FT                   GEGVRVGPFSNIRPGSVLDRDAKVGAFVETKNTHIGTEAAIPHMAYVGDSEVTAGSSIV
FT                   AGSVLSRECAAPATVSDITSDSQDDTLNPEADQ"
FT   gene            584797..585765
FT                   /locus_tag="PPA0531"
FT   CDS_pept        584797..585765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0531"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82284"
FT                   /db_xref="GOA:Q6AAD2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAD2"
FT                   /protein_id="AAT82284.1"
FT                   /translation="MSGTTRPNNKHLMICSGRAYPELAEQIAAELGVELVPSRQVTYAN
FT                   SEIYVQFQESVRGCDAFVIQSHSAPVNEAMMEQLIMIDALKRASAKRITVVSPFYPYAR
FT                   QDKKHLGREPISARLMADLYQAAGADRIMSVDLHAAQIQGFFDGPVDHLWALPVLADYV
FT                   TSKYDNSDMVVVSPDAGRVRLADMWTDKIGCQLAIIHKRRDPNKANETTTHEVVGEVEG
FT                   KTCLLVDDMVDTAGTMCQAALALKKHGAKRVIAAATHPILSDPAAERINNSPIEELIVT
FT                   NTLKIRDDIDIPAMTLLSIAPLIAKAIQEVFEDGSVTSLFR"
FT   gene            585914..587191
FT                   /locus_tag="PPA0532"
FT   CDS_pept        585914..587191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82285"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAD1"
FT                   /protein_id="AAT82285.1"
FT                   /translation="MWPIRTVRAYCAGTVATAVALAAFVTSGAHAAGARETSKPQAYPV
FT                   PGLFHPCGGSVTPDWHYGETSRHYQSDGTLQFTNQTDHAVDYTASVKTSTNHKIDSNSA
FT                   SKLPPNWNTTLKTELGIVASNGWQDKETFGPVKLGPGESFRVEYGVTVKNFVGMFLGCR
FT                   DGYLEPSGGANVIQGTAPAERYAYALVIHKDGSISDRALAIPSRGSGKNSRIVDDHDIV
FT                   MAGPNLEKLADPSKDVPVEPTSPLQRDPSWPKQGERCPARGWYPLDISGIDPLIRQPGY
FT                   SQDFLNWSKGQYHFTPVTDTVVGAQFAGYVNWNPAADGPPRGWLESVGAIYRAYLPVRT
FT                   ELKGVDLAPGEKVHVEYGTLLRRVNYREVGCKNGVASIVSHYGLASAPAGFWAEATITG
FT                   TDGTKRTVDVTPDAWKHLPVPTQTTR"
FT   gene            587227..587796
FT                   /locus_tag="PPA0533"
FT   CDS_pept        587227..587796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82286"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAD0"
FT                   /protein_id="AAT82286.1"
FT                   /translation="MIRSLVATLAVGAIVTAGAQMPAQALPVQHQNPANPTTIGAPCSN
FT                   PGDTGQTVHVVRSYFDGSAGTWTISNYNDTPLPVTRSITETKTKNWSVSAGIDFPLLDV
FT                   IHISISSSYSTSSTYEVGETVGPYNVAPGKTAVLQAGWIVSDFEGQHTVCGPDKKWQGR
FT                   GDHFTATLPREHHVRISTRDNVQYDV"
FT   gene            587816..588412
FT                   /locus_tag="PPA0534"
FT   CDS_pept        587816..588412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0534"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82287"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAC9"
FT                   /protein_id="AAT82287.1"
FT                   /translation="MLRRAVVGAVTAAVTSTTVLSVVPAGAVQESPNNGINFELPQRWN
FT                   DNYKPGTRCTPQGTRGVYVTASRRWFKQTDGASVENTTDTAMPVTHTVTVKRSETTEVK
FT                   GEIKADGTLTTYLNQSYGFDYINTVSWELSQKVGPYDLAPHTQGRLVWGFIMLDVDAQN
FT                   VSCGADLTWHAVGKPFSGTNPESRYAELRSEGSIG"
FT   gene            588519..589208
FT                   /locus_tag="PPA0535"
FT   CDS_pept        588519..589208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0535"
FT                   /product="ribosomal L25P family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82288"
FT                   /db_xref="GOA:Q6AAC8"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AAC8"
FT                   /protein_id="AAT82288.1"
FT                   /translation="MIDWPPTWASSRRAVLRQREGDAAMADIIHLKAEQRTEFGKGAAR
FT                   RIRRDDKVPAVMYGHDHDPIHVTLDGHATLLALRTENPLLSIEIEGQKPMLALPKDVQR
FT                   DVLKGFVRHVDLLTVRRGEKVDVNVALRITGESAPGTIAMTEFNEIEVQADLLNIPEVI
FT                   EIDVTGLEAGTTIYLGDLKLPEGTSLLGDAEDVAATVAFPETEPVEDEESAGEDAQGES
FT                   EEKAAKE"
FT   gene            589205..589807
FT                   /locus_tag="PPA0536"
FT   CDS_pept        589205..589807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0536"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82289"
FT                   /db_xref="GOA:Q6AAC7"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AAC7"
FT                   /protein_id="AAT82289.1"
FT                   /translation="MSPSWLVIGLGNPGPRYDGTRHNVGADVIAELCRRAGEKLSPARG
FT                   QRAELVRTRLSSAGLGVPAVDAQTVILMRSRTYMNESGIAVSKVASFAGITPDHLIVVH
FT                   DEIDLDPGRLRLKKGGGDNGHNGLKSIRAHLRTGDFIRVRLGVGRPPGHQDPADWVLAR
FT                   VPARQRAEMGVQVALAADAVESIIIQGLAAAQNRFNS"
FT   gene            complement(589847..590089)
FT                   /locus_tag="PPA0537"
FT   CDS_pept        complement(589847..590089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0537"
FT                   /product="D-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82290"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAC6"
FT                   /protein_id="AAT82290.1"
FT                   /translation="MNPETIDVIENDHRYFHQDHRLDVLNNHDLTLLRSFPNVVVTPHI
FT                   AFYSDTVTAEMVHCAMEYLRDFSQTGEPLMEVHPD"
FT   gene            complement(590153..590338)
FT                   /locus_tag="PPA0538"
FT   CDS_pept        complement(590153..590338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0538"
FT                   /product="putative D-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82291"
FT                   /db_xref="GOA:Q6AAC5"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAC5"
FT                   /protein_id="AAT82291.1"
FT                   /translation="MQPLGCNVLACDLLPNPQQNDIVEFVDLETLLHNSDAITLHVPAM
FT                   PMNHHTIDAEQFAMMR"
FT   gene            complement(590844..591899)
FT                   /locus_tag="PPA0539"
FT   CDS_pept        complement(590844..591899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0539"
FT                   /product="alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82292"
FT                   /db_xref="GOA:Q6AAC4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAC4"
FT                   /protein_id="AAT82292.1"
FT                   /translation="MKAALVEQYHEPLAIRDIPEPAHDSDGVVVEVKACGVCRSDWHGW
FT                   QGEWPGFTGGSLPHIFGHEFVGLVSDIGNNVSRYRVGDRVIVPFTLGCGHCEYCRSGHS
FT                   NVCPTVSMPGFSYDGGFAQYVTVPDADANLVKLPDAVDFTDAAGMGCRLMTAYHGIVEV
FT                   GQIHPGDWLVVYGAGGVGLSATLVATSAGANVIAVDIADDKLALARKVGAIATINSRET
FT                   DPVEAVRELTDGGADKSVDALGISETLHNAVNSLRSRGTHIQIGMTAEGPVGDVALTIN
FT                   DLIAKEIDFRGSFGMPAVEFRYLLNQVAAGKMKPGQLVTKTIALSEVNDALTAMSTYNT
FT                   VGTTVITDFTR"
FT   gene            complement(592274..593413)
FT                   /locus_tag="PPA0540"
FT   CDS_pept        complement(592274..593413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0540"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82293"
FT                   /db_xref="GOA:Q6AAC3"
FT                   /db_xref="InterPro:IPR026898"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAC3"
FT                   /protein_id="AAT82293.1"
FT                   /translation="MQYPLTPKPVRRSGALPIVITVLGAIAILLIVALISAGSPVTFIV
FT                   GAIPSTAALIVCLLCYRWLDRWEPEPTRLTVMALIWGGSAGVIFSFLVEMAIPASEFVT
FT                   MAIVAPLAEELAKASVFILVATGARKLELTSLTDHIFYAGICALGFAFVENLGYFALSS
FT                   SAGEFVVMALVRTGFGVFGHPLYTTATAVGIWAWRTKGGLWKAAVGYIAACLLHGLWNG
FT                   GPTLLAGSLGLDDTGQLAAMILVYIVLFVPVFIGTIIMTTRNRRNEYEAVRSQLPLMVE
FT                   AGLVTPAEADMIADPRKRRAILADSGKYGRVAKRNQKRTITAATEAALAQHRIAAGEGG
FT                   PELVKRRDQLSEWLRSRPDKLGQLPLMPQFPPIQPPATW"
FT   gene            593435..597103
FT                   /locus_tag="PPA0541"
FT   CDS_pept        593435..597103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0541"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82294"
FT                   /db_xref="GOA:Q6AAC2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAC2"
FT                   /protein_id="AAT82294.1"
FT                   /translation="MLWGGESSRTTSRVMVSVGTTTYPMLVTFGGLTSLLSREPVLSHV
FT                   VEDALTRRTPTLDLQVAASARPAVAAVLGRSLDGSGRLPVLLVTSTFREAEESVATLKT
FT                   WLGADAVCYYPSWETLPHERLSPRTDTVGRRMEVLRRLCGTEGEVPQVVVAPVRSLLQP
FT                   QVAGLGRVAPVRLAVGEEHDLTELATELVNAAYSRVDMVERRGEFAVRGGIVDVFPPVL
FT                   EHPVRIDFFGDEIEEMTSFAVADQRSTDETHQELICAPCRELILTDEVRSRAKALLTDH
FT                   PELADMLERIGNGQAVEGMEALMPALVDEMELLVDVLPEHAMVVLSDPEMVRSRAADLV
FT                   RTSEEFLGAGWAAAAGGGQAPIDLAASGYRSLAQVRSHCLERGMAWWSMSSFSLDSSAT
FT                   DVLVDDDITSAPQTVNPQLVAVEPWHGDVEAAVKDLTARLDDGWTVLLCAEGEGMAKRM
FT                   SELLGEHNVAARLVDDVDPDATEPCVQVIRLHQRHGFAAESVKLLVASTGDLAESQDPG
FT                   GTGERRMPRRRRNQIQPLELKPGDLIVHEQHGVGRYVEMVQRTVGGATREYLVIEYAPS
FT                   KKGQPGDRLFVPVNSLDQVTRYVGGDAPSLDRMGGGDWRKRKARARKAVREIAAELIKL
FT                   YAARQATKGHAFGPDTAWQRELEGAFAYVETPDQLTTIADVKRDMEQVVPMDRLVCGDV
FT                   GYGKTEIAVRAAFKAVQDGKQVAVLVPTTLLVQQHFQTFTERYAGFPVKVAALSRFQTD
FT                   TEARETLEGLQRGTVDVVVGTHRLLAKEVEFKDLGLVIVDEEQRFGVEHKEALKRMRVN
FT                   VDVLAMSATPIPRTLEMAVTGIREMSTIATPPEERHPVLTFAGPYDEGQVVAAIRRELA
FT                   REGQVFYIHNRVQSIEKTAAKLRELVPEARIVTAHGQMNEKQLEQIMVDFWERRADVLV
FT                   CTTIVESGIDISTANTLLIDRADLMGLSQLHQLRGRVGRSRERGYAYFLYPADKPLSQT
FT                   AHDRLATMAAHTDLGSGMAIAMKDLEIRGAGNLLGGEQSGHIADVGFDLYIRLVGDAVA
FT                   EFRGDSTTADEPEMRIELPVDANLPVEYVETERLRLEMYKRLAEVRSDEEVDAIGAELV
FT                   DRYGPMPEPVQALLGVARFRLLCRQAGIHEVVPAGRNIRFSPVNLPESRVMRLKRLYPG
FT                   SVVKQTAGLVLVPKPMTATIGGQPLGGADLLKWSADLVTNVLAVDTPIGAGRPTEP"
FT   gene            597165..597680
FT                   /locus_tag="PPA0542"
FT   CDS_pept        597165..597680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82295"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAC1"
FT                   /protein_id="AAT82295.1"
FT                   /translation="MTMRRRLGAAAVAVALVSVASGCASSPSNAATVGNTTVTMKSVDD
FT                   AVEHCSKFINPSSELTPRQIIASTVIRGAVAQEVLDKRGAKLSDAERDQIVARNGMAAL
FT                   DSDQVCHTMVRSFAGVFHLFDLEGDRKAKADLSAVDVKANPRLGSWDANNLVVQGSSSL
FT                   SQPFTKTS"
FT   gene            597689..598327
FT                   /locus_tag="PPA0543"
FT   CDS_pept        597689..598327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0543"
FT                   /product="putative MazG-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82296"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAC0"
FT                   /protein_id="AAT82296.1"
FT                   /translation="MAAEYARPRAEFSELVEVMARLRDECPWDRSQTHRSLVTYLVEET
FT                   GEVIDAIEAGTDDDLVEELGDLLLQVVFHSRIGEQGGRFDINEVVGGIVAKLVARHPYV
FT                   FSDEEVPEDLDAAWEARKAAAKGRTSSLDGIAYSLSSVARSAKVISRARTRGVGVKLAD
FT                   EPITAAETGDQLVTLIARAQASGVDADQALRDRLRDLEDEIRKAECRTD"
FT   gene            598443..598973
FT                   /locus_tag="PPA0544"
FT   CDS_pept        598443..598973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82297"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAB9"
FT                   /protein_id="AAT82297.1"
FT                   /translation="MRRALAALFAAVVALGALSGCKGSANDPAGVTEVSDAPTASVPSV
FT                   SQSSGPKPTPQDVNPNTKLTATPQRGGLKDFLPGVTGIISDRVVTGSTSQTVVVKAGTV
FT                   TDYYFLCDTTDALMSVTENDESTASTPCHEGFAHLSVGKRAQSGQIELHIDAPENVTYE
FT                   FVITENPAEDQRQ"
FT   gene            599061..600341
FT                   /locus_tag="PPA0545"
FT   CDS_pept        599061..600341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0545"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82298"
FT                   /db_xref="GOA:Q6AAB8"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AAB8"
FT                   /protein_id="AAT82298.1"
FT                   /translation="MATIEFIEAREILDSRGNPTVEVEMILDDGTQARAAVPSGASTGQ
FT                   FEAVELRDGDKKRYSGKGVLKAVENVNEKIAEEVLGCDASEQRIIDQIMIELDGSDNKG
FT                   KLGANAILGVSLAAAHAAADCAELPLYQYLGGPNSHVLPVPMMNILNGGAHADSDVDIQ
FT                   EFMIAPIGAESFKQAYEWGAAVYHSLKKVLKDKGLATGLGDEGGFAPNLPSNAAALDLI
FT                   LDAIKAAGFEPGKDVALALDVAASEFFEDGKYTFEGQAKTSAEMIAYYEGLIAKYPLVS
FT                   IEDPLDEEDWDGWAEFTKKLGEKIQIVGDDLFVTNPKRLAKGIETKAANALLVKVNQIG
FT                   SLSETIDAVELAHRNGYRCMMSHRSGETEDTTIADLAVALSTGQIKSGAPARGERIAKY
FT                   NQLLRIEEELGDSAEYAGASAFPRFQA"
FT   gene            600428..601081
FT                   /locus_tag="PPA0546"
FT   CDS_pept        600428..601081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0546"
FT                   /product="conserved protein, putative septum formation
FT                   initiator"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82299"
FT                   /db_xref="GOA:Q6AAB7"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAB7"
FT                   /protein_id="AAT82299.1"
FT                   /translation="MATTPSNRHRPSGRSQRPAGGRTHASSPNRSGPRNRGNYQRTTRT
FT                   EPPRNRATQEEGGQPRRFGLTLRAVVMGAAVLLVLVMITPSLGIYFSQRSQISRTQDDE
FT                   ARTRASISTLQDEVKRWHDPDYVRAQARSQLGWVMPGETGYQVIGENGKVIGSTTSLDE
FT                   KDPANEASADARWWRKAAGSVQDADHPAPPHPSPGAMITPTPSAKLSSPSPSRR"
FT   gene            601089..601631
FT                   /locus_tag="PPA0547"
FT   CDS_pept        601089..601631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0547"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82300"
FT                   /db_xref="InterPro:IPR007511"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAB6"
FT                   /protein_id="AAT82300.1"
FT                   /translation="MLEEFTENDRQDVRDQLGREPRGVAGVAWRCGCGKPGVIATEPRL
FT                   PNGTPFPTTYYLTCPRAASLIGTLESSGLMARMTERLGEDEELADQYRRAHESYIADRV
FT                   QIGEDAGLDPVPEIDGISAGGMPTRVKCLHALAGHALAVGPGVNPFGDEVVAELGEFWC
FT                   DPCAPEHREPESDRRIV"
FT   gene            601628..602560
FT                   /locus_tag="PPA0548"
FT   CDS_pept        601628..602560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0548"
FT                   /product="hydrolase, Ppx/GppA phosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82301"
FT                   /db_xref="GOA:Q6AAB5"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAB5"
FT                   /protein_id="AAT82301.1"
FT                   /translation="MSGSHTVAAIDCGTNSIRLLIASADSDGRLVEQARELEMVRLGQG
FT                   VDATGSFRPDALERTFSACRTFAQAIADHHCDRVRFVATSAARDVSNRDAFFAGVRQAL
FT                   GVDAEVIDGMEEASLSFAGAISGIQVIDEPVLVIDCGGGSTELVLGRGSSIDSRVSLNI
FT                   GSVRLRERFLHDDPPTVEQIDDARKYVREALDSCPVDVAAARTVIGVAGTVTSLSAIGQ
FT                   NLTDYDRAKVHRSVLTVGQISDLAGKLLSSTVDEVEQMGPLKRRRAEVLCGGAVIIDEV
FT                   CRRATAGKLVVSETDILDGMALAMLAQGS"
FT   gene            602571..602647
FT                   /locus_tag="PPA2416"
FT   tRNA            602571..602647
FT                   /locus_tag="PPA2416"
FT                   /product="tRNA-Leu"
FT   gene            602792..603625
FT                   /locus_tag="PPA0549"
FT   CDS_pept        602792..603625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0549"
FT                   /product="membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82302"
FT                   /db_xref="GOA:Q6AAB4"
FT                   /db_xref="InterPro:IPR010539"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAB4"
FT                   /protein_id="AAT82302.1"
FT                   /translation="MANPVFSRAEAFQPRGNPYGQPAYAGQGYRAQYGVSGQPGGESGS
FT                   LLDGPQGQSAERAMTFDDVLGRTGLVLLIIAAIGAVSFALIGPNVVASGPALVVGSIAA
FT                   FITAMVVSTRRTVPVGGVIFYCICEGLVLGSMSAMFETAYPGIVVQAVLGTFAAAGVTL
FT                   AAYKFFNIRVTPRFRQIVIISTFGFALAMLVNLVLILFRINIGVASFGPIGILCSALGV
FT                   VLAAMNLVVDFDYAEQGVRNQAPASESWRAAFGIAVTMVWLYTEILRILSYFRAD"
FT   gene            complement(603697..604392)
FT                   /locus_tag="PPA0550"
FT   CDS_pept        complement(603697..604392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82303"
FT                   /db_xref="GOA:Q6AAB3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAB3"
FT                   /protein_id="AAT82303.1"
FT                   /translation="MLITAVGTPGSGQTHAFRVRHGMNPHVELWRHGLVVREYLSADRV
FT                   DDEIVVTAHVAPRTSSSQPPRTRKSVPDLSEDRQADEPVRPYQRIAAYAVVRSRRGLLG
FT                   TECSPRTAVPGLWALPGGGLEPGESPAQAVTREVMEESGQRVRLNRIIDLQSDHWIGRS
FT                   PTGVLEDFHALRIIYSATSENPTDPYVIDVGGTTQSAQWIPLWRWRRLSWGAATRMCLE
FT                   THLRDVPST"
FT   gene            complement(604469..605434)
FT                   /locus_tag="PPA0551"
FT   CDS_pept        complement(604469..605434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82304"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAB2"
FT                   /protein_id="AAT82304.1"
FT                   /translation="MTYRIRFRQTASVILSAAALCVCASCTSTTPTTPSDEPSRTALVP
FT                   SSKVTASVSPLDGIHTRAIINELVAASGNGPITKVDITKGALSITVQIGNSPTIWTWQN
FT                   GKIDSSATQSTQTASRPFNPGDFAVEKLPVILSRAADISGSHMNQNLQIVEYNQGTVLM
FT                   TVSTKPETQTVFFRPNGSAINHIDFASTSGMTEALSDAVAGAKQVDQISYQPGKAIIVD
FT                   TPTTTPGIVMRRTRSADMPAWAVQRRSDASATFSPGLLNPHVIVRIMNLAAAQAHQKPS
FT                   DMEWTISQDTKLDTPVLRVDINGLTRAFNTDGTDVTDKIK"
FT   gene            605764..605967
FT                   /locus_tag="PPA0552"
FT   CDS_pept        605764..605967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82305"
FT                   /db_xref="GOA:Q6AAB1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAB1"
FT                   /protein_id="AAT82305.1"
FT                   /translation="MCWYGFPGCCFGGGVVGWFCWLVLGSWFCGFGVGVVGLVGSPCDG
FT                   FCMVCVGIVVVGVMFENSTVCL"
FT   gene            606163..607687
FT                   /locus_tag="PPA2417"
FT   rRNA            606163..607687
FT                   /locus_tag="PPA2417"
FT                   /product="16SrRNA"
FT   gene            608072..610963
FT                   /locus_tag="PPA2418"
FT   rRNA            608072..610963
FT                   /locus_tag="PPA2418"
FT                   /product="23SrRNA"
FT   gene            611077..611198
FT                   /locus_tag="PPA2419"
FT   rRNA            611077..611198
FT                   /locus_tag="PPA2419"
FT                   /product="5SrRNA"
FT   gene            complement(611557..612054)
FT                   /locus_tag="PPA2401"
FT   CDS_pept        complement(611557..612054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA2401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA2401"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82306"
FT                   /db_xref="GOA:Q6AAB0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAB0"
FT                   /protein_id="AAT82306.1"
FT                   /translation="MATTRRATPADLPFMVHVLRHAAGGTSGPLDVEECRTNPAIAHYI
FT                   DGWTPDQVGLICLVDDTPVGAAWVRNLPASDPGYGFVAPGIPELVIAISPHHREQGLGG
FT                   YLLESLLDTCSANGIKSVSLSVGVGVGWLVRVCRRVGFVVVSYRGRRVVMLRVDQTLGC
FT                   CG"
FT   gene            complement(612064..612201)
FT                   /locus_tag="PPA2402"
FT   CDS_pept        complement(612064..612201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA2402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA2402"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82307"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAA9"
FT                   /protein_id="AAT82307.1"
FT                   /translation="MNRQASSRERAGNRTPGNLSSPDAPRTCYHKPILAALSRIVVTDR
FT                   "
FT   gene            612190..612621
FT                   /locus_tag="PPA0553"
FT   CDS_pept        612190..612621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0553"
FT                   /product="membrane spanning protein, GtrA-family"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82308"
FT                   /db_xref="GOA:Q6AAA8"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAA8"
FT                   /protein_id="AAT82308.1"
FT                   /translation="MTVHSVLPFPLSGLPVTFIGYCIINGLGFLIDMSLLAVFFRGVGL
FT                   PYPVSVSLGYGLSAVYSFVVNRWLNFHSHGNLGRQSGRYVVTMVTNYVCLTLGLSSLLE
FT                   SLGVHFELARFTAACVEGLYVYLMLSIWVFPKSGRRQLA"
FT   gene            612696..614684
FT                   /locus_tag="PPA0554"
FT   CDS_pept        612696..614684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0554"
FT                   /product="oligopeptide transporter, Opt family"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82309"
FT                   /db_xref="GOA:Q6AAA7"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="InterPro:IPR004814"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAA7"
FT                   /protein_id="AAT82309.1"
FT                   /translation="MSDLSSSSAPARRPGTSVRELTFRGIVLGGLMTLIFTAANVYLGL
FT                   KVGLTFATSIPAAVISMAVLRHFKGHSVEENNIVQTIASAAGTLSAIIFVLPGLIMVGW
FT                   WSGFPYWTTLAICLVGGILGVMYSIPLRRALVTGSDLPYPEGVAGAEVLKVGDSAGAAE
FT                   ANKVGLRVIIVGSVVSAAYALLSDLKLVKSALTKPFKTGDSSGSMVGVSMSMALIGVGH
FT                   LVGIAVAAAILVGLFISYGAILPWRVSGKVGSDLTVIQDVFTSDVRFVGAGTIGVAAIW
FT                   TLVKVIGPIVKGISDSISSSKTRHEGGEVPLTERDLPVSVVLTVVLISMIPIGFMLWGF
FT                   ARDMVVSRSMTGVIIVSLAFILLVGLAVASVCGYMAGLIGASNSPISGVGILVVLVAAL
FT                   LIKLTYGAVGGGETVKLVAYTLFTASIVFGIATISNDNLQDLKTGQLVGSTPWKQQIAL
FT                   IIGVIFGSAIIPPVMQLMQSAFGFQGAPGAGPNALQAPQATLISSLATGVFGGSLDWGL
FT                   MGIGALVGIGVIVVDEILTHTTKKFSLPPLAVGMGMYLPMTLSLTIPIGAALGWLFDKW
FT                   AAHTAGDVEGKKRTGILLATGLIVGESIFGVIYAAMIAAAGSEDAIAIAPESWDSGAGI
FT                   VGVITFAAAIAFLYRWTKRQAKERVEA"
FT   gene            complement(614727..615590)
FT                   /locus_tag="PPA0555"
FT   CDS_pept        complement(614727..615590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0555"
FT                   /product="aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82310"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAA6"
FT                   /protein_id="AAT82310.1"
FT                   /translation="MKYRQIGPFRTSAIAYGSMPLSIEGRPDRETAINILHDVLDAGCT
FT                   HIDTAWAYYESGGVEQYGERLVTDALASWDGDHSTISVATKVGHFRCFNDAGQPVWDVD
FT                   GSPERLRRDAKLSAEALRTDQIDLLYLHRPDPKVEYEGMVRTLAGILDDGLARTAGISN
FT                   ANPDQIRLAHSILGDRLVAVQNQFSPGFLSSRPELELCGELGLAFVAWSPLGGYRRPLD
FT                   EDAFAAFQRIADARGISRAQVILAWELSKGPHVIPIPGSHRSQTILDSLRSVDVTLNDE
FT                   ELAQLP"
FT   gene            complement(615706..616338)
FT                   /locus_tag="PPA0556"
FT   CDS_pept        complement(615706..616338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0556"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82311"
FT                   /db_xref="GOA:Q6AAA5"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAA5"
FT                   /protein_id="AAT82311.1"
FT                   /translation="MNKTEMVSSENALPGGHTPVLAMPFFHRVTGDRLDRPFPSSETIY
FT                   LAMGCFWGAEKLFWNTDGVLQTAVGYMGGLTPNPTYREVYTGCTGHAETVRVTYDPTQV
FT                   STEAILTIFLENHDPTQGMRQGNDVGTQYRSAIWCTTTEQFMTATTVKGSYQANLLNAG
FT                   YGAITTAISMANGVEFYLAEAEHQQYLEDNPFGYCPVHATGVCLAGS"
FT   gene            616495..618114
FT                   /locus_tag="PPA0557"
FT   CDS_pept        616495..618114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0557"
FT                   /product="sodium-and chloride-dependent transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82312"
FT                   /db_xref="GOA:Q6AAA4"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAA4"
FT                   /protein_id="AAT82312.1"
FT                   /translation="MSDPAQSGATVAGGGRATRKPQRRESFAGRGAFLIAAIGSAVGLG
FT                   NIWRFPYVAYSNGGGAFIVPYLVALLTAGIPLLFLDYAVGHKFRGSPPMALRRLHRRME
FT                   AIGWWQTLICWVIVIYYAVIIAWAIRYVGFSVTKTWGHDPEGFLTGSFLHVASNVDVEF
FT                   HFVSGVFWPLLLLWLFVLAIMATGVEKGITRASWIFMPLLAVMFITLVIVALTLDGASV
FT                   GLNALFTPSWGALGNYRVWMAAYGQIFFSLSVGFGIMVTYASYLKPKSDLTGSGLVVGF
FT                   ANSSFEILAGLGVFAALGFMATASGKPVSEVAGSGIGLAFIAFPQIISQAGAVGPILGV
FT                   LFFVSLVFAGITSMISLLEVVIAAFREKTGISRKAATWIIGGVTAIASIVLFPTTTGLN
FT                   LLDVTDHFINNIGIVGVALLACLVISWALRKLPVLRDHLNEYSSFQVNKVWMALVSVVA
FT                   PLVLLSLWITEIITVASKGYGEMPRNFVGIFGWGMSILVVVLAIVLSLIPWPHRSAIHH
FT                   ELTHEEELACENFQETEEGALS"
FT   gene            complement(618243..618959)
FT                   /locus_tag="PPA0558"
FT   CDS_pept        complement(618243..618959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0558"
FT                   /product="uracil-DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82313"
FT                   /db_xref="GOA:Q6AAA3"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAA3"
FT                   /protein_id="AAT82313.1"
FT                   /translation="MSSVCILLEATVVAHPVAELVTPDWAEALTGVEPRIHEMGDFLRA
FT                   ETAAGRGFLPHGDRILRAFSRPMADVRVLIVGQDPYPTPGHPVGLSFSVERDVRPLPRS
FT                   LQNIYTELQSDLGIAPCEHGDLTGWFEQGVLLLNRCLTVQPGRPASHRGKGWEEVTQTA
FT                   IEALVARGGPLVAILWGRDAQSLEPMLGKVPIVKSSHPSPMSARYGFFGSRPFSRTNEL
FT                   LVQQGADPINWDLSSH"
FT   gene            619028..620254
FT                   /locus_tag="PPA0559"
FT   CDS_pept        619028..620254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0559"
FT                   /product="membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82314"
FT                   /db_xref="GOA:Q6AAA2"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAA2"
FT                   /protein_id="AAT82314.1"
FT                   /translation="MKLFSSGRKTPTSSPASSHAGAMDETVGVTSTSEAANVATQPVPT
FT                   PVEDVPNGVRTAAGWCWRMIVIAAFIYGLYQVLHAASEVSVPVAVALMLTAAMWPLANW
FT                   LSRHHIHRGIASGICLLLLVILVGGVFTLVGAQIALQWRQLGDQSVASFKQALQWLAKS
FT                   PLHTNEAQLTHLMQKAEAAMAGSQGRIASTAAAAGSQIGRFGAGLVMALFATFFFVYEG
FT                   DKLAEKSAVLIPREHRAAILDAAKRGWVALVAYVRAAVIVAFVDGLGAGIGAAIIGSSM
FT                   SVAIGALTFILAFVPIVGALTAGVVAVGVVLVTLGFFKAFIMLIVFVAVMQIEGHVLQP
FT                   FLLGKAVSIHPLIVLLGIAVGAIISGIVGALFAIPIVAFGVAFIKALNPETPANEVPPN
FT                   HDDLAAEHT"
FT   gene            620292..621275
FT                   /locus_tag="PPA0560"
FT   CDS_pept        620292..621275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82315"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAA1"
FT                   /protein_id="AAT82315.1"
FT                   /translation="MSADITAILEDLAAGRIDTAEASRRIAAAGQDQPTSGVTSGPDCG
FT                   PGPRHGASEDDAPGADSSSLGGFTIPSEAKEGLRSAWRIVSGMAESVGETVASTVSSGS
FT                   RRASGGNDSERSVDMTTDLDRVRINCSGRRIRLIGDRSIPGVQIGGKHTRRRIGRVVEI
FT                   GIDGHLAPDLGVLKRFRFPTGMDGVKDLSFGREVTVRVHPDLPVDIELSGGSLRASGVE
FT                   RFGRVRVTAGVTEIDGVHQIEDGLFQAGSGSITGRIDTGRSQIRVESGNLNIKLAGGSN
FT                   VSVRGKAQTGMISWPEGGEVDEYVMGNGSARLDLTCLVGRIAVRAL"
FT   gene            complement(621380..621886)
FT                   /locus_tag="PPA0561"
FT   CDS_pept        complement(621380..621886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0561"
FT                   /product="transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82316"
FT                   /db_xref="GOA:Q6AAA0"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAA0"
FT                   /protein_id="AAT82316.1"
FT                   /translation="MPESEDTVWLTQEAFDKLTQELEYLKGEGRTAIANKIADARSEGD
FT                   LSENGGYHAAREEQGQAEARIRQLEQMLRNAEVGEAPSSPDEVVPGSKVTVCYFDDESD
FT                   TDTFLLGSRQVMGLDDSVNVSVYSPQSPLGGAILGHSKGESTEYQAPNGKTIKVTILNV
FT                   EPFEE"
FT   gene            complement(621908..622333)
FT                   /locus_tag="PPA0562"
FT   CDS_pept        complement(621908..622333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82317"
FT                   /db_xref="GOA:Q6AA99"
FT                   /db_xref="InterPro:IPR025443"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA99"
FT                   /protein_id="AAT82317.1"
FT                   /translation="MGHVPTPDHSLTDEARERIANRYPSPRRAPWVVLIIVLAVILIGW
FT                   TVWTGLYHADQPIRASLHGYQAVSDSRVDVTIKLHRPDPSVAGSCTLVATGADHVRVGE
FT                   TTVTFPASSSQDETIRASVKTFSRAVTADLEKCGPIR"
FT   gene            622629..624644
FT                   /locus_tag="PPA0563"
FT   CDS_pept        622629..624644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0563"
FT                   /product="conserved protein containing thioredoxin domain"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82318"
FT                   /db_xref="GOA:Q6AA98"
FT                   /db_xref="InterPro:IPR004879"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR024705"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA98"
FT                   /protein_id="AAT82318.1"
FT                   /translation="MPNYLGESTSPYLIQHAANPVDWFPWGEEAFDEARSRDVPVMVSV
FT                   GYSSCHWCHVMALESFSDPEVAEVVNANVVPVKVDREERPEVDAALMQVTLAMTGQGGW
FT                   PNTVFLTPEGKPFFAGTYFPPVRRGRLPGFVELVEALGGAWRERRDEVVSSAEAIVEHL
FT                   RPVEKDPEVARPIAGELIDAVGADYDIVHGGFGSPTKFPMPTLLDALLVKGDPTSLDMA
FT                   QNTCEHLVRGGIFDQVGGGFHRYSTDSQWVVPHFEKMLYDNALLLATMARCWRRTADHD
FT                   SDRRDLYSHAARRTVAWLNREMRLPNGLYAAGLDADSDDAAGHTHEGIYYLWNQDLITD
FT                   ALGTDEAEWLRPLVHLEPCNDNGLGTLQLRGRVEWERINADMDTLLEARGRRSAPARDE
FT                   KAITAWNAMLIDGLVEAGMILREWSWVEQARELADSLWTAHWDHGMALRTSFHDRPGVP
FT                   AVCEDYAWVALSFAGLAGATGESVWLDHAVEVLGEAVARFSAVDGSFLDAEDSFLLTVT
FT                   AHTLTDDACPSPTAAMVMALRRVGLMAERADFIERANKASVVLLPVVSATPRFAGWAVA
FT                   DFLITDEARRGLKPAGVVIADTTDEPSDLAAAAWRMAPAGSAIMRRLNEDSGFGTWFNE
FT                   RVPRDGQPTCWVCRGAVCFEPVTDYLDLKEPLWRRA"
FT   gene            complement(624666..625487)
FT                   /locus_tag="PPA0564"
FT   CDS_pept        complement(624666..625487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0564"
FT                   /product="undecaprenyl pyrophosphate synthase"
FT                   /EC_number="2.5.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82319"
FT                   /db_xref="GOA:Q6AA97"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA97"
FT                   /protein_id="AAT82319.1"
FT                   /translation="MSSLDHRLSKVSETLDRMHPSGLLYTTYEARLLDQLDRSRLPQHV
FT                   AVLADGNRRWARLNAPGEPLVAGYEAGADRLREFCTWCDAVGIPIITLWVLSTDNLQRA
FT                   ETGELGPLLKVIESLVDSLADNSRWRVQAVGDLDLLPDDMAESLCRAGRTSIGHVGMHI
FT                   NVAVAYGGRHELRDAFRSLLAEEAEKGTSLADLARTLEIDQIEDHLYTRGQPDPDLIIR
FT                   TSGEQRLSGFLMWQSAHSEFYFCEALWPDFRKVDFLRALRSFTQRERRYGR"
FT   gene            625632..626303
FT                   /locus_tag="PPA0565"
FT   CDS_pept        625632..626303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0565"
FT                   /product="conserved protein family (Hly-III / UPF0073),
FT                   putative hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82320"
FT                   /db_xref="GOA:Q6AA96"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA96"
FT                   /protein_id="AAT82320.1"
FT                   /translation="MATGCSSKTKNRSSVLPKPRLRGWVHTVMAPLILLAGVGLMIATP
FT                   TWGNRFAVGVWMLTGLELFGNSAVYHRVPWGAKVKDVLRRIDHANIAVFIAGTYTPLAV
FT                   SLATGASRVILLAIIWACALLGVAFRFVWNGVPRWASTILYVVMGWTALWWLPQFWRTC
FT                   GPAVVILILIGGVFYTVGAISYARQKPNPSPTWFGFHEVFHSCTAVAAICHAVAIGLAV
FT                   I"
FT   gene            626450..627799
FT                   /locus_tag="PPA0566"
FT   CDS_pept        626450..627799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0566"
FT                   /product="ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82321"
FT                   /db_xref="GOA:Q6AA95"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA95"
FT                   /protein_id="AAT82321.1"
FT                   /translation="MSVRPEGSERAHSLIPEAPEGRRTYVLDTSVLLSDPRALLNFAEH
FT                   EVVVPIVVITELEGKRHHPELGHFARAALRILDRLRLENGGLVGPVPVNNEGGVLLVEL
FT                   NHSDPLCLPDGFRLGDNDTRILAVAQSYRLAGHSVVLVTKDLPLRVKASAIGLEAEEYR
FT                   HELVPSSGWTGMVNLEVPDEMISTLYEEGSVVDSIFDEIPVHAGLVLEGPNGTALARRM
FT                   SDASARLVPNDQEAFGIRGRSAEQRIALDILLDPQVGIVSMGGRAGTGKSALALCAGLE
FT                   AVMERQLHKKVMVFRPLYAVGGQDLGYLPGDEGDKMAPWGQAVLDTLTSVTNNYVIEEV
FT                   MSRGMLEILPLTHIRGRSLHDAFVIVDEAQSLERNVLLTVLSRIGQNSRVVLTHDVAQR
FT                   DNLRVGRYDGVAAVVERLRGHDLFGHVTLTRSERSPIAALVTSMMEDMVG"
FT   gene            627819..628382
FT                   /locus_tag="PPA0567"
FT   CDS_pept        627819..628382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82322"
FT                   /db_xref="GOA:Q6AA94"
FT                   /db_xref="InterPro:IPR025339"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA94"
FT                   /protein_id="AAT82322.1"
FT                   /translation="MGGICNNQQVPRNPRAGVKDMLLSLAIILVPVMLIVWFFTRTPDE
FT                   PNIQQVDWKPVVASARSRAGYPVLAPKEVPEVWRPTKARYANKGDRWVGNTISAGDRWE
FT                   LGFLTSKNVYLAVDQSDEPGRAFVASVTRSATEDGKVSVGRYIWTKMVSPDDRTHALVT
FT                   KMAPRRRWSLRTLIIEFSPTLRGC"
FT   gene            complement(628420..628656)
FT                   /locus_tag="PPA0568"
FT   CDS_pept        complement(628420..628656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0568"
FT                   /product="exodeoxyribonuclease VII small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82323"
FT                   /db_xref="GOA:Q6AA93"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AA93"
FT                   /protein_id="AAT82323.1"
FT                   /translation="MTDTTPNSAPEEPEITYEAARDELVEIVTRLESGGISLAETMTLW
FT                   ERGEKLADICQSWLNGARARIEAARSDAETAQP"
FT   gene            complement(628653..629900)
FT                   /locus_tag="PPA0569"
FT   CDS_pept        complement(628653..629900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0569"
FT                   /product="exodeoxyribonuclease VII large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82324"
FT                   /db_xref="GOA:Q6AA92"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA92"
FT                   /protein_id="AAT82324.1"
FT                   /translation="MVEPNAADNPRSLAWVVNAVKGWVERCGAIWVQAQVIEITRRSSP
FT                   TQFLTLRDPIEEISASATCHRRVLDAAGPIETGMTVTALIRPTVWSRTGRLSFEISEIT
FT                   PTGEGQLLAQLERRKRLLEAEGLFDVTLHRPIPVLPRGIGLITGAGSDAERDVQRHATL
FT                   RWPAARFVVHNTRVQGPMAAQQIIAALADLDADPTVDVIVIARGGGPLEDLLPFSDEAL
FT                   VRAVYATRTPVVSAIGHDRDNPILDLVADLRASTPTDAGKLIVPDAAEQSQAIETARAQ
FT                   LRQAVTRFIDVESGHLSQIRSRPVMVNPAATLDIAVERLDSTLQRLRLATHRVLDAESR
FT                   DVNHMLERVRAMSPKATLDRGYAILADTEGDSITSVNDTNARANLLVYLSDGTLSVTVD
FT                   SLDRRTPNRPTFQEDS"
FT   gene            complement(629981..631507)
FT                   /locus_tag="PPA0570"
FT   CDS_pept        complement(629981..631507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0570"
FT                   /product="hypothetical protein, putative phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82325"
FT                   /db_xref="GOA:Q6AA91"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA91"
FT                   /protein_id="AAT82325.1"
FT                   /translation="MEKNNTANDPARSSAVPNQIGTTSSKIKHVIYIVRENRTFDQELG
FT                   SNGRGNADPSLNLFGEESAPNTRALARQFTTFDNFYADAEVSANGWNWVSQANSNPWSE
FT                   EMWPSNYSGRGAPYPAESNDPDSRAKEHDSYFWEHLSKNNISFRNYGFYTTLDKKGKAH
FT                   GVDKKILDPNTDHDFIGWSLDCPDSARSFAPMAKNCGPKSRVDEWKSDFNKQLAKGSVP
FT                   TVQLVRFGNDHTQATKVGVPTPQAYVADNDQAIGQLVETVSHSPIWKDTAIFLTEDDAQ
FT                   NGPDHVDAHRTIGEVISPYTRTGGVDSTFYSTVSMLHTMEGILGIGPLTQFDAFSTPMS
FT                   AAFTDKPDLTPYQAASPSYDMKTLNTPKAPMAKESGEQDTTKEDDIDEQVFNKAIWKAV
FT                   KGARSTMPEPKHSVIQSGPVLTYDDDDDEGEKLKPGDVDLDELGSYSKDAKGFPVWTPD
FT                   DKRFDPAQGIDPCSPKPGPTLTPTVPTAVMPSNSTHRGEGRHPGLPRTGV"
FT   gene            complement(631516..632787)
FT                   /locus_tag="PPA0571"
FT   CDS_pept        complement(631516..632787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0571"
FT                   /product="protein with WD40 domain"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82326"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA90"
FT                   /protein_id="AAT82326.1"
FT                   /translation="MPFLFPKFWVMSAPHDTHVSRRLRRGLASACAVVTAIAAFSPAHA
FT                   APSPNKAGPMSGSTGRTTVGQLLTPAGQLTTLGDLPLNEALSPDGRYLIVSNNGQGTQS
FT                   LQVIKTATGKVVQTIPYKSPESLYMGLAFSPDGTHLFASAAGNHKIRTYHFDCGKLVET
FT                   SAIQMPVVSPKLTKVNLYPAGLAVTNDSKRLVVADQLADAVSVIDLATNKIQTTHIGHR
FT                   PVWVTLSKDSTKAFVSSQGGADVAEVDITKSQPLATHKINVGFHPNKSVLTPDGKSLYV
FT                   ANGDADTISVVDVASHRQTATIPVNRNGSKLVGANPTGLALSQDGKRLYVTNSGHNEVA
FT                   VINAATRKVIGDIPTGWYPTQVLAHDGKLSITSAKGLGAGPNNGPGHPNPTDPRDTAEN
FT                   QYSGSMIKGLLSTVNGMTQRPWPS"
FT   gene            632907..633878
FT                   /locus_tag="PPA0572"
FT   CDS_pept        632907..633878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0572"
FT                   /product="IspH, non-mevalonate pathway of isoprenoid
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82327"
FT                   /db_xref="GOA:Q6AA89"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AA89"
FT                   /protein_id="AAT82327.1"
FT                   /translation="MAVTGACTNKKLYLAAPRGYCAGVDRAVVTVEKALEVYGAPVYVR
FT                   KQIVHNRHVVETLEGRGAIFVDELDEVPDDALVVFSAHGVSPQVKKEATDRGLRTIDAT
FT                   CPLVTKVHHEAKRFANQDTQILLIGHAGHEEVEGTTGEAPENITLVQTPADVDGLALDR
FT                   DRPVAWLSQTTLSVDETVETVDRIRDLHPQLIDPPSDDICYATQNRQHAVKQMAPQCDL
FT                   VIVVGSKNSSNTGRLVEVALESGAKASYRVDNAGEIEETWLDGVSTIGVTSGASVPEAL
FT                   VQGVIDLLISKGWPPAEEETLIEESLSFALPPQLRKRRTTAK"
FT   gene            complement(633882..635102)
FT                   /locus_tag="PPA0573"
FT   CDS_pept        complement(633882..635102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0573"
FT                   /product="DNA recombination protein RmuC homolog"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82328"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA88"
FT                   /protein_id="AAT82328.1"
FT                   /translation="MTNIVVGLIGLAIGVALGWLIAQLRTSQRIAEATSAARVATERLE
FT                   AAEKIATDRDALATQFKALSAQSMADQNERATQSAQRTMSDAQRLLAPVSLALERLDRR
FT                   LAEVEQERTDMTASLREQVAGVSTAGESLRKETASLVAALRKPQIRGAWGEMQLQRTAE
FT                   VAGMLEHCDFQTQQTTTAQGAPQRPDMTVKLSGRRCIHVDAKTPLAAFLEAAQCDDAEE
FT                   YDAQMARFARHVRTHIDQLSAKGYWRTDLDSPEFVVCFLPSDALLQAALQEIPDLHEYA
FT                   NRRGIVLASPSVLIPMLRTVALAWRQEAVARSATEVAALGRDLHKRLGTLAGNLDKMGR
FT                   SLTSTVRAYNSALGSLETRVLVQARRFEHLGVTADDIASPAPIEEAVRPLTSPELTENQ
FT                   TEVGLPE"
FT   gene            635181..636467
FT                   /locus_tag="PPA0574"
FT   CDS_pept        635181..636467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0574"
FT                   /product="aspartyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82329"
FT                   /db_xref="GOA:Q6AA87"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA87"
FT                   /protein_id="AAT82329.1"
FT                   /translation="MVVMADKSVPTSDHIRDIISFVEASPTSYHAVAELTRRLEQAGFQ
FT                   RLEETESWPSVEGRRYVVRDGAVIAWITPEKVTPQLGARIVGSHTDSPSFKLKPNATVT
FT                   NQGWQQVGMEVYGGGLLNSWLDRDLGLSGRLVTCDGQAHLVRTGPILRISQLAPHLDRT
FT                   VNDDLKLDRQRHLMPILSVGKPDLDVEDLLCEAAGIKRDELAFHDVFAHLTQSPAVIGP
FT                   YGEFLASQRMDNLSSVHSSVAAFVDVKPTSDVAVMACFDHEEVGSATRSGACGPFLEDV
FT                   LVRIAEGFGMTGAAYRAMIAKSSCVSSDAGHGVHPNYVEKFDPANHPLLNEGPLLKINA
FT                   HQRYATDGVGGALWQRACAAAGVPTQNFVSNNSVPCGSTIGPLTATRLGMLTVDVGVPL
FT                   MSMHSTRELAGTADLTYLSKALGAYWAGA"
FT   gene            636616..637689
FT                   /locus_tag="PPA0575"
FT   CDS_pept        636616..637689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0575"
FT                   /product="putative ATP/GTP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82330"
FT                   /db_xref="GOA:Q6AA86"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA86"
FT                   /protein_id="AAT82330.1"
FT                   /translation="MALTIGIVGLPNAGKSTLFNALTKNDVLAANYPFATIEPNVGVVG
FT                   VPDKRLDVLTEMFHSAKTIPATVSFVDIAGIVKGASKGEGMGNEFLSNIREADAICQVT
FT                   RCFADDDVTHVNGHVDPSDDIETITTELVLADLQTMEKQLPKLQKEAAIKKESRPKVEA
FT                   WEQAKAVLEEGKTIFSAGLDPEPLHDLFLLTTKPFIYVFNCDQDQLADADFQAKMEKLV
FT                   APAEAIFLDAEFEAELAEMEPEDAAEFLADAGIEEPGLDKLARVGFDTLGLQTFLTAGE
FT                   KESRAWTIHKGDTAPEAAGVIHTDFQKGFIKAQVVSFGDLVEFGGEKEAQAAGKLRLEG
FT                   KEYVMQDGDVVEFRFNV"
FT   gene            637820..638557
FT                   /locus_tag="PPA0576"
FT   CDS_pept        637820..638557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82331"
FT                   /db_xref="GOA:Q6AA85"
FT                   /db_xref="InterPro:IPR007759"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA85"
FT                   /protein_id="AAT82331.1"
FT                   /translation="MHYSEIAQRILDSGLRQQTGATPAATVAATISTTLRKNVVRVDRG
FT                   VYSLRTPQSVPPEESETELPDSRGVIPPTALEAGEENNGFLNAFGMFWRRDEVDWDKRG
FT                   QTLLGAQLKVAKPVNFSGQVGVYILYSGERVICVGRITEPRLGPRLWDHTRDRLAGRWD
FT                   RFSWFGVLIAKDDGTLGNVPCGNFAVDMLVSTMEALLIEGLEPPQNRRRGDGFNATEFI
FT                   QATDPEVERRRAKQLLFKLTDSK"
FT   gene            complement(638635..639102)
FT                   /locus_tag="PPA0577"
FT   CDS_pept        complement(638635..639102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0577"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82332"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA84"
FT                   /protein_id="AAT82332.1"
FT                   /translation="MAVPVDFTTVSAQGLETSEHPEALAGLRANEARYFHNKFKHTFEV
FT                   SPASEEPYALAWVTQILAEERDITIASPALEISINDVEGIHWVHVFYASGLAINVLWTV
FT                   ANSGKRAVGFKLCDGMDQPAELSAFKFARQRSKLAGTIRGSYFVIKGDYPY"
FT   gene            complement(639165..640391)
FT                   /locus_tag="PPA0578"
FT   CDS_pept        complement(639165..640391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0578"
FT                   /product="transporter, putative fucose permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82333"
FT                   /db_xref="GOA:Q6AA83"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA83"
FT                   /protein_id="AAT82333.1"
FT                   /translation="MPEPQLRYDERSPFIVHMLLLAIIYLAFISLGLPDSLVGAGWPAM
FT                   HESLGVPLSCAGFITFIIATGTIISSLMSDRLTTRFGPGRVTAASVALTAAALFGFSFS
FT                   TQFWVLCLWAMPYGLGAGTVDAALNNYAALHYTARHMNWLHGCWGLGASISPFIMSQAL
FT                   SSGHGWPSAYRTVGTLQAILIAIVTVSLPLWNKTRKINGGGSAKLFDHVPTRAALATPG
FT                   VPAVLGAFFSYCAVESTSMLWAASYLVSVRGTDGATAAAFASLFVLGITAGRFLAGFVA
FT                   ERIGDRMLVRGGFITVGVGVVLVGLPGVPSWVALAGLVIAGLGSAPIYPAIIHSTPTTF
FT                   GAHNSQAIIGIQMAAAYVGTTLAPPLFGAISANTGLWTLPLYLIVLVIFGLVMSEHVTR
FT                   RERARAQDG"
FT   gene            complement(640458..641075)
FT                   /locus_tag="PPA0579"
FT   CDS_pept        complement(640458..641075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0579"
FT                   /product="transcriptional regulator MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82334"
FT                   /db_xref="GOA:Q6AA82"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA82"
FT                   /protein_id="AAT82334.1"
FT                   /translation="MTIAAGTGSNSLGGVDGLDLDHGVSLLAGRMCADVSVVQRYKKHS
FT                   AQLSCVQSCCASNILPVVHDQTLDLDDQFCFSLYRASRAVTRAYRPLLEGIGLTYPQYL
FT                   AMLVLWHAEGPVGVNDIGTRLHLDSGTLTPLLRRLEDAGFITRAWSNDDERRRIISLTE
FT                   GGRSLRHQAAGLPERMLALYPTPPQELAQVKAFLDDLATQLE"
FT   gene            641010..641438
FT                   /locus_tag="PPA0580"
FT   CDS_pept        641010..641438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0580"
FT                   /product="stress-induced protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82335"
FT                   /db_xref="GOA:Q6AA81"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA81"
FT                   /protein_id="AAT82335.1"
FT                   /translation="MIEIEPVYTTEAIATGAGRNGHVQSPDGRVSEDLAVPVEMGGSGK
FT                   GTNPEQLFAAGYAACFHSALQMVARQAKKDLGDSSVGARVSIGQAGEGFGLAVALEVVI
FT                   PALPHDEAQRLADKAHQVCPYSNATRGNIRVDVTVVDD"
FT   gene            641558..642247
FT                   /locus_tag="PPA0581"
FT   CDS_pept        641558..642247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0581"
FT                   /product="NonF-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82336"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA80"
FT                   /protein_id="AAT82336.1"
FT                   /translation="MSRILMILTSHNQLGDTGRKTGFWLEEFAAPYYVFCDAGHDVTLA
FT                   SPRGGQPPIDPTSSLPQMQTDATRRFDVDEQAKRALATTTPLSEVDIATFDAVFYPGGH
FT                   GPLWDLADDPTSQQIILDSDAVGRPLGLVCHAPGVLHTVKKHDGTLFVTDRSVTGFTDG
FT                   EEEAAGLTGVVPFLVEDSLKQAGARYSKGPDGDSYVVTDKTLVTGQNPASSAATAQRLL
FT                   DLLCVRV"
FT   gene            643038..644519
FT                   /locus_tag="PPA0582"
FT   CDS_pept        643038..644519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0582"
FT                   /product="arginine/ornithine antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82337"
FT                   /db_xref="GOA:Q6AA79"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA79"
FT                   /protein_id="AAT82337.1"
FT                   /translation="MAEQVVGQASTEVSMGEDVNVGKLSFPAMLSLVVGSMIGGGIFSL
FT                   PQNIAAAASPGPMVIGWTITGIGMICLAMVYQKLAIRRPDLDNGIYAYAKAGFGDFIGF
FT                   NSAWGYWLSALIGNVGYLVLLFSTVGKFVPAFAGGNTVWAVLAASVLLWLTHALVLAGV
FT                   RTAAFVNTIATIAKIVPLITFIAICAVAFDVGVFTEDFWGSHAGLGSVFAQTKSMMLVT
FT                   VWVFIGIEGASIYSKRARKRSDVGKATVGGFLFVLVLLIGVNLLSMGIMHRAKLAGLPD
FT                   ASMGDVLSSVVGPWGSVLVSAGVIISLLGALLAWILLCGETMQVPGEDGTMPKLFGRIN
FT                   KHEAPAPALWITNIVSQICLVMTVLWDGAYLAMATLAAALILVPYLLSAAFALKMVIKG
FT                   ETYENGPRSQRVRDAVVATVATLYGIWLVVAAGADALMLAALLYLPGAAVFVWAKREQR
FT                   AKRIFKPYEIGVLVLLALISVVSIISIVTGRLSLT"
FT   gene            644650..645894
FT                   /locus_tag="PPA0583"
FT   CDS_pept        644650..645894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0583"
FT                   /product="arginine deiminase"
FT                   /EC_number="3.5.3.6"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82338"
FT                   /db_xref="GOA:Q6AA78"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AA78"
FT                   /protein_id="AAT82338.1"
FT                   /translation="MTTPIGAWSEVGKLREVMVCEPRLAHRRLTPSNCRELLFDDVLWV
FT                   EKAQEDHRDFVAKMRERGIVVHEMHQLLSEVLDISEGRSWVLDRKLSPNAVGLGVDEDV
FT                   RDWLNDMPSDTLAEYLIGGVAYGEVPADRRKHVLGALIKAHSENEFLIPPLPNTQFTRD
FT                   TTAWIFGGVTFNPMRWPARQQETVLASAIYTHHPIFAERDFKIWYGCAEADHGMSTLEG
FT                   GDIMPVGNGTVLIGMGERSSWQAITQVARSLFAQNAARRMVVAAMAPDRASMHLDTVFS
FT                   FCDVDLVTLYKPVVDTITPLVLEPSSEAAGFSVRVDDRHFTDVVASSLGLDGLRTVETG
FT                   GDCWEAQREQWDDGNNVVALEPGVVVGYDRNTATNALLAKAGVEVVEIKAAELGRGRGG
FT                   GHCMTCPITRDPVDY"
FT   gene            645968..646972
FT                   /locus_tag="PPA0584"
FT   CDS_pept        645968..646972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0584"
FT                   /product="ornithine carbamoyltransferase, catabolic"
FT                   /EC_number="2.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82339"
FT                   /db_xref="GOA:Q6AA77"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AA77"
FT                   /protein_id="AAT82339.1"
FT                   /translation="MAFNLKNRHLLSLAHHSTEEIKFLVGLAADLKEAKYCGTEQPLLK
FT                   GKNIALIFEKASTRTRCAFEVAAHDQGAHVTYLGPSGSHIGHKESMKDTARVLGRMYDG
FT                   IEYRGFHQSVVEELAEYAGVPVFNGLTDEFHPTQMLADALTMREHAEKPFHEIKFAYVG
FT                   DGRNNMGRSLLLLGAKLGMDVRIGAPEGLQPEAELVERCREWAEQSGGKVLVTASAEEA
FT                   VRDVDFIHTDVWVSMGEPVESWSERVGTLLPFQINDALVKAAGNPRVKVMHCLPAFHNS
FT                   ETAVGAEVAKTYPELANGIEVTESVFESPACIAFDQAENRMHTIKAVLVSSLA"
FT   gene            646993..647898
FT                   /locus_tag="PPA0585"
FT   CDS_pept        646993..647898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0585"
FT                   /product="carbamate kinase"
FT                   /EC_number="2.7.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82340"
FT                   /db_xref="GOA:Q6AA76"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA76"
FT                   /protein_id="AAT82340.1"
FT                   /translation="MRILVALGGNALLRRGETMTAENQRANVRIAANHIKEVAVDHEVV
FT                   VAHGNGPQVGLLALQSTAYEEIGIYPLDVLGAESQAMIGYMIEQELGNVMPQDQQIVTM
FT                   ITMTVVDADDPAFKHPTKPIGPVYDEATARRLAAEKGWTIAPDGEYYRRVVASPQPRNI
FT                   IEQKAIRQLVDSGVMVVCAGGGGVPCVYDEDGILHGAEAVIDKDLASAELAVRVDADLL
FT                   VIATDVAGVFRNWGEPDQERIEQMHASDALNTEFAAGSMGPKVKAACNFALATGKRAVI
FT                   GSLEDIQGLVAGTHGTAIIP"
FT   gene            648015..648578
FT                   /locus_tag="PPA0586"
FT   CDS_pept        648015..648578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0586"
FT                   /product="arginine repressor"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0586"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82341"
FT                   /db_xref="GOA:Q6AA75"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA75"
FT                   /protein_id="AAT82341.1"
FT                   /translation="MCAKGAMSLSNDDHRPVLISRAARLSRISALIRSEQISSQAELAR
FT                   RLAAEGIVVSQGTLSRDLKDVGAARGRDQLGNFQYSIPEGEHPSQMTTGLPARNHLARM
FT                   CHSLCIAVNYNNGAVVIKTPPGAAQYLGSAIDTSGVHTVLGTIAGDDTVLVVCKVGVDG
FT                   EDLARLFREMAETGLPAKGLVAVN"
FT   gene            648760..649422
FT                   /locus_tag="PPA0587"
FT   CDS_pept        648760..649422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0587"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82342"
FT                   /db_xref="GOA:Q6AA74"
FT                   /db_xref="InterPro:IPR002833"
FT                   /db_xref="InterPro:IPR023476"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA74"
FT                   /protein_id="AAT82342.1"
FT                   /translation="MQLVLLRDKHHPARQVDACEAAARAVVFLLDDPRTQPGGPWHDAV
FT                   RQWSNKRIRKIVRRASGKRWDDVQVLDGVTISQDPPPYASPETGPARVRAFVPAPVHPQ
FT                   PKQIDKLQVAGTNLPADGDSATTEPVVTIEINPRIEMTTGKACAQCGHAAQLAHEAMSF
FT                   GNDDDRHALETWRHDGFRVRVVTPTVEHWDSDVARVRVVDAGFTEFNGPTATTRARW"
FT   gene            649446..649964
FT                   /locus_tag="PPA0588"
FT   CDS_pept        649446..649964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0588"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0588"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82343"
FT                   /db_xref="GOA:Q6AA73"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR016867"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA73"
FT                   /protein_id="AAT82343.1"
FT                   /translation="MTQLLLTAVGADRSGLVSDLSEIVAHYDGNWLDSRMARLAGAFAG
FT                   IVLVDIKSSKIEPLKADLAGLEVKGLRVTVTDTTPQQDEGEAVLVVHLVGHDHPGIIHK
FT                   VTATMARLGVTIDDLSTGLREAPMGDGILFEAQVQCRITNATTLDDLRSELEAIATEIM
FT                   VDIDLVDRS"
FT   gene            649990..650958
FT                   /locus_tag="PPA0589"
FT   CDS_pept        649990..650958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0589"
FT                   /product="oxidoreductase, putative aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82344"
FT                   /db_xref="GOA:Q6AA72"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA72"
FT                   /protein_id="AAT82344.1"
FT                   /translation="MTRIPGTDLDIRPLVLGANTFGWTADEHDSHTILDAFLGAGGSLV
FT                   DTADGYSHWADGNNGGESERIIGSWVEKGGRRDDIVIATKVATHPEFKGLAPENISAAV
FT                   DASLARLHTDHIDLYYAHFDDDTQQIEDMAAAFDKLVKAGKVRWVGLSNFSVAREQKWL
FT                   EVAEHEGLASPVALQPQYNLLHRADVEDPQGYGQLASEYSLALFPYFSLASGFLTGKYA
FT                   TRDDLHGVARESMMAAYLPDAEHEKAAFAVLDQLRQIAGDHRVEVSSVSLAWLLAKGVT
FT                   APIASARTIDQLDALLAAPDLVLSSDEVCALDEVSAVFAHE"
FT   gene            651011..651514
FT                   /locus_tag="PPA0590"
FT   CDS_pept        651011..651514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0590"
FT                   /product="thiol peroxidase"
FT                   /EC_number="1.11.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0590"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82345"
FT                   /db_xref="GOA:Q6AA71"
FT                   /db_xref="InterPro:IPR002065"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR018219"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA71"
FT                   /protein_id="AAT82345.1"
FT                   /translation="MATTAFMGKPLNTVGDLPQVGSLLPSFTLVKSDLSELRSDELKGK
FT                   KLVLNIFPSVDTGVCATSVRTFNEKAAGLDDTTVLCVSRDLPFAQARFCGAEGIKNVVV
FT                   ASAFRSHFGKDLGVTLADGPMQHLLARAIVVVDAEGKVTYTQLVDEITTEPDYDAALEA
FT                   ASKA"
FT   gene            651675..653099
FT                   /locus_tag="PPA0591"
FT   CDS_pept        651675..653099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0591"
FT                   /product="lysine-specific permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0591"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82346"
FT                   /db_xref="GOA:Q6AA70"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA70"
FT                   /protein_id="AAT82346.1"
FT                   /translation="MDGELKRGLSSRHMNMIAIGGAIGTGLFVASGATISQAGPGGALV
FT                   AYFAMGLMVFLLMQSLGEMSSYLPVPGAFETYATRFVSPSFGFALGWNYWFNWAITVAA
FT                   ELAAASIVMAYWWPGVPAWMWSVGFLALLFLLNVLSARAYGESEFWFAIIKVTAVIVFL
FT                   VLGILMIAGVMGTSPGLSHWRRGDAPFVHGFGGILTVFLIAGFSFQGTELIGIAAGESK
FT                   DPRMTIPKATRQIFWRIMIFYIGAIAVIGLLLPYTDPHLLAGEVTDVAVSPFTLVLKRA
FT                   GVAAAAAVMNAVILTSVLSAGNSGLYASTRMLYALAREGKAPRILGRTSRRGVPVPALI
FT                   VTTLVGAACFATSLVGSGQAYTWLVNISGLCGFIAWIGIAICHIQFRRAFQAQGHDLSE
FT                   LPYRARWYPAGPIVAGVLCVIVTLGQGRDAVLSGDVTDMIVAYISIPVFLALWVGHKIV
FT                   TKAPHADLSTADLHHD"
FT   gene            653144..654379
FT                   /locus_tag="PPA0592"
FT   CDS_pept        653144..654379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0592"
FT                   /product="alpha-amylase 3"
FT                   /EC_number="3.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82347"
FT                   /db_xref="GOA:Q6AA69"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA69"
FT                   /protein_id="AAT82347.1"
FT                   /translation="MAYRPGWVDHLIGWHVYPLGFVGAPARLESQEVSHRLAHLGAWLD
FT                   HAVALGCSSLALGPVFSSASHGYDTLDYFTIDPRLGDDDDFDHLLQAAHARGLSVLLDG
FT                   VFNHVSRRNRIVQDAQSAGPDSDAGRMVRWCAGRLDVFEGHSDLVALNHDNPAVREHVT
FT                   RIMNYWCGRGVDGWRLDAAYSVNPEFWAAVLPSVREKYPDVWIFGEVIHGDYASIVRAS
FT                   GMDSVTQYELWKGIWSSIESRNFFELDHALGRHNEFSDAFTPMTFVGNHDVTRIASRVG
FT                   QDGAVLATAILATIGGIPLIYYGDELAYRGVKEERFGGDDDIRPVFPASPADLSNLGAD
FT                   TLRAHQSLLGLRRRHPWLVDARTESLDLTNERYVYRTGVPGVEPLIVELDVRDGCSVLI
FT                   REVGQVVWSSGA"
FT   gene            complement(654404..655570)
FT                   /locus_tag="PPA0593"
FT   CDS_pept        complement(654404..655570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0593"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82348"
FT                   /db_xref="GOA:Q6AA68"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA68"
FT                   /protein_id="AAT82348.1"
FT                   /translation="MKIAVAGLGYVGMANAVLLAQHNSVVAIDIDAERVDMVNNRHTTI
FT                   VDPLIAEYLAHHNLDLRATTDPQEAYRGADFVVIATPTNYDPGQNYFDTSSVDEVLDLV
FT                   QELAPHTTTVIKSTIPVGFVEGVRKERSGLDVIFSPEFLREGKALFDNLHPSRIVVGAD
FT                   SPKAHLFADLMAAGAVDTNVPVLFVGATEAEAIKLFANTYLAMRVSFFNELDTYASQRG
FT                   LSTRQVIDGVCLDPRIGNHYNNPSFGYGGYCLPKDTRQLLANYQDVPQTLIQAIVDSNT
FT                   VRKDFIASDIIARDPKRVGIFRLVMKAGSDNFRSSSIQGVMKRIKAKGIEVVVYEPTFD
FT                   GDEFFHSEVTKNLAFFKANCDVIIANRMSPDLSDVADKVYTRDLFGGD"
FT   gene            complement(655713..656651)
FT                   /locus_tag="PPA0594"
FT   CDS_pept        complement(655713..656651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0594"
FT                   /product="putative lysophospholipase"
FT                   /EC_number="3.1.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82349"
FT                   /db_xref="GOA:Q6AA67"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA67"
FT                   /protein_id="AAT82349.1"
FT                   /translation="MALQEIEFTSRNRRDAIQAWAYEPVGTPAAVVQIIHGLGEHSRRY
FT                   LHMISALLDASFIVVADDHAGHGRTAMQSGQWADAGDNSAEVVISDELTLQQQLTGQFN
FT                   DLPWVVFGHSWGSLIARAMATRPNARLDGLALGGVVAQLRGLETTLDHEALAKAMATNP
FT                   AGPAPESLVAQMFDGCTDRLSEGDGPTGWVARNRDVVADYGKDKFNNFGAQMSTRFLQG
FT                   FADIYDMANGEGFYAAMPKIPIALFAGSEDPAGNFGTGVQAVAQRLRRDGHDVELHLYD
FT                   GLRHEVHNEPESRADVESSLVTFVDRVAKRN"
FT   gene            657197..659107
FT                   /locus_tag="PPA0595"
FT   CDS_pept        657197..659107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0595"
FT                   /product="methylmalonyl-CoA mutase small subunit"
FT                   /EC_number="5.4.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0595"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82350"
FT                   /db_xref="GOA:Q6AA66"
FT                   /db_xref="InterPro:IPR004608"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR024067"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA66"
FT                   /protein_id="AAT82350.1"
FT                   /translation="MTDPDNLASKSVEDRMPEELSLAGDFPKVTHEQWEEAVLKVLNRG
FT                   RPEGKELNIEQGMKRLEPTTVDGIQIEPMYRRQDAPEKLGVPGVPPFTRGTTIREGGMD
FT                   AWDVRALHEDPDVAFTKKAVIADLERGVTSLWLRVGADAIKPEDIAGDLKDVLLDLAKV
FT                   EVSSRDDQEAAAQALLDVYIESKIDADKLSFNLGLDPIGFAALNGGNPDLSGMAEWVKK
FT                   TENYKNSRPFVVDATIYHNAGAGDVHELAWAVATGVEYVRAFIEQGLTAEQAFDSINFR
FT                   VTATHDEFLTISRLRALRTLWNRVGEVFEVPAAKRGARQEAVTSWRELTRDDPYVNILR
FT                   GTIATFGAAVGGAEAVTTLPFDAAIGLPKSDFSRRIARNTGIILAEESNIGRANDPAGG
FT                   SFYVEALTKKLEDAGWAEFQAVEAAGGMAAALTGDHVRTELDKLNTERAKRLATRKQPI
FT                   TAVSEFPLLDAKSVETKPYPAAPAREGLEWHRDAEVFEALVDRSATCPERPKVFLACLG
FT                   TRRDFGPREGFSAPVWHIAGMETPECEGGTTEEVVKAFKESGADIADLCSNAKTYAAQG
FT                   LEVAKALKEAGAKLVYLSGAFKEFGDDAAEAEKVIDGRIYLGMDVVDVLTATLDTLGVA
FT                   K"
FT   gene            659104..661293
FT                   /locus_tag="PPA0596"
FT   CDS_pept        659104..661293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0596"
FT                   /product="methylmalonyl-CoA mutase large subunit"
FT                   /EC_number="5.4.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82351"
FT                   /db_xref="GOA:Q6AA65"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA65"
FT                   /protein_id="AAT82351.1"
FT                   /translation="MTTLPRFDSINLGDSPVPADAQEQFARLAAAAGEQEPWTTPEQIP
FT                   VGHLYSEDVYGDMDWLDTYAGLPPFTHGPYATMYAFRPWTIRQYAGFSTAKESNAFYRR
FT                   NLAAGQKGLSVAFDLPTHRGYDSDNPRVPGDVGMAGVAVDSILDMRELFAGIPLDRMSV
FT                   SMTMNGAVLPILALYVVTAEEQGAKPEQLAGTIQNDILKEFMVRNTYIYPPLPSMRIIS
FT                   DIFAYTSANMPKWNSISISGYHMQEAGATADIEMAYTLADGVDYIRAGESVGLQVDQFA
FT                   PRLSFFWAIGTNFFMEVAKMRAARMLWAKLVHQFNPKNPKSMSLRTHSQTSGWSLTAQD
FT                   VYNNVIRTCVEAMGATQGHTQSLHTNSLDEAIALPTDFSARIARNTQLFIQQESGTCRV
FT                   IDPWSGSAYVEKLTLELARKAWAHIQEVEKAGGMAKAIEKGIPKMRIEEAAARTQARID
FT                   SGRQPLIGVNKYRLDEEEPLEVLKVDNTQVLKEQKAKLEQLRANRDEEACQAALEKITW
FT                   AAANPDPSDPDRNLLKLCIDAGRADASVGEMSDAMEKVFGRYTAQIRTIEGVYSKAAGN
FT                   SESTKKVHELIKQFEEKEGRRPRIMIAKMGQDGHDRGQKVVATAYADLGMDVDVGPLFQ
FT                   TPEETARQAVEGDVHVVGVSSLAAGHLTLVPALRKELDKLGRSDIMIVVGGVIPTQDFD
FT                   ELRKDGAAAIYPPGTVIPDAAVELMEKLLAAHNDD"
FT   gene            661447..662493
FT                   /locus_tag="PPA0597"
FT   CDS_pept        661447..662493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0597"
FT                   /product="kinase ArgK, involved in lysine, arginine,
FT                   ornithine transport"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0597"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82352"
FT                   /db_xref="GOA:Q6AA64"
FT                   /db_xref="InterPro:IPR005129"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA64"
FT                   /protein_id="AAT82352.1"
FT                   /translation="MKEMVIMPIDVPELVEQVLAGSRQHIARALTLVESSKPAHREMAR
FT                   EMLRQLAPRTGDAIRVGISGVPGAGKSTFINAVGGRLIDEFGYKVAVLAVDPSSTRTGG
FT                   SILGDRTRMGDLANRDEAFVRPSPSGGHLGGVARATRESMIVMEAAGYNVVLVETVGVG
FT                   QSEVAVAGMVDTFLMLSVAGTGDQLQGIKKGILELADVVAVNKADGDNAGNARVSARDL
FT                   SIAMKLVSSDADKRRVPVLTCSSYTKEGLDDVWQAIVDHRAYLEKDGSLQIRRTEQQRE
FT                   WLWNMVRNEILESLDTDPSVQQTAERIEAGLGIEATSALEGAEEILRAFARAVPSLPWA
FT                   QGELTSGS"
FT   gene            662715..664187
FT                   /locus_tag="PPA0598"
FT   CDS_pept        662715..664187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0598"
FT                   /product="serine protease, subtilase family"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82353"
FT                   /db_xref="GOA:Q6AA63"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034176"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA63"
FT                   /protein_id="AAT82353.1"
FT                   /translation="MALRRTLTLMLCAITGASLVATAVPSSAAPGFTISPLRTSDSIQS
FT                   TSGFVVHLKDRSASAQRVRTAHAASAMQATSTSLRGLVDRAAKVRGAHVTESLARANNS
FT                   MSVQVSQGLNATAAKAFASEIERNPEVESVEPVLHMTINENTGVHPAAVSSAPNDQYWN
FT                   RQWGLNSENGIDAPGAWATNTGSGVTVAVIDSGITKHPDLDGKVLPGYDFISDRYAAGD
FT                   GNGRDSDPSDEGDWTRAGACTRRDVPSSWHGTHVAGIIGAATNNARGVAGAAPGAKILP
FT                   VRALGHCGGTDVDIADGITWASGGEVPGVPTNHNPAKVINLSLGGPSNYCPITYQRAID
FT                   AAVSRGSTVVVAAGNEAMDVRKSTPGNCRNVVVVGATGETGAQSYFSNYGSTVDVSAPG
FT                   GDDRTGDMILSTLNNGETTPAAPTYGYMEGTSQAAPHVSAVVALMIAANPNLTPARIKE
FT                   ILKQSVNPAKCKTGCGTGIVDARKAVKAAKSA"
FT   gene            complement(664267..664497)
FT                   /locus_tag="PPA0599"
FT   CDS_pept        complement(664267..664497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0599"
FT                   /product="conserved protein"
FT                   /note="RNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82354"
FT                   /db_xref="GOA:Q6AA62"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA62"
FT                   /protein_id="AAT82354.1"
FT                   /translation="MHDDQMIRLGQYLKFANLAETGGQARELIASGMVSVNGKVETRRG
FT                   RQLHPGDEVTVTNGGQTVTATVDLTEPDVPW"
FT   gene            complement(664528..665328)
FT                   /locus_tag="PPA0600"
FT   CDS_pept        complement(664528..665328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0600"
FT                   /product="ABC-transporter, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82355"
FT                   /db_xref="GOA:Q6AA61"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA61"
FT                   /protein_id="AAT82355.1"
FT                   /translation="MSTSAEAFASAEPMVHITGLHKEFGPLHILKGIDLDVAPGEVCVL
FT                   IGPSGSGKSTLLRCINQLETFEVGEIWVGGQRVGYEHDPLPDGRLKRLSDKGIAAQRAR
FT                   VGMVFQRFNLFPHMTALGNVMEAPIKVSGLTKEEAKPLAMSLLDRVGMADRANHYPTEL
FT                   SGGQQQRVAIARAMAMKPELMLFDEPTSALDPELFGEVLNVLKDLAGEGMTMIVVTHEM
FT                   GFAREVADHVVFMDDGVVVETGSASQVIGNPKSNRLRGFIDSVL"
FT   gene            complement(665325..665873)
FT                   /locus_tag="PPA0601"
FT   CDS_pept        complement(665325..665873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0601"
FT                   /product="ABC-type transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82356"
FT                   /db_xref="GOA:Q6AA60"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA60"
FT                   /protein_id="AAT82356.1"
FT                   /translation="MPFGDLQFASVETEKVVTALAAAIIGLGLNEGAYLAEITRSGLES
FT                   VDVGQTEAAKALGMKPSLIMRRAIIPQAMRVIIPPPGNETIGMLKTTSLVLALPFTLDL
FT                   QYATSAIANCTYAPIPLLVVAACWYLVMTSVLMIGQHFLEQYFGRGFNGRSSSKRLRRQ
FT                   AAIQAAGTTYKNIALEVEQ"
FT   gene            complement(665919..666251)
FT                   /locus_tag="PPA0602"
FT   CDS_pept        complement(665919..666251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0602"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0602"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82357"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA59"
FT                   /protein_id="AAT82357.1"
FT                   /translation="MRCHSDTEPSLNANIIKSLNNDPTIATIVPNDIKIRHPPQRRHSQ
FT                   LHTRTVIDTDGSTIISYDSAGLRPGSCDEPNYQWSVVWLYLREVKIITGISYTILLTRQ
FT                   CPSEPP"
FT   gene            complement(666300..667298)
FT                   /locus_tag="PPA0603"
FT   CDS_pept        complement(666300..667298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0603"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0603"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82358"
FT                   /db_xref="GOA:Q6AA58"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA58"
FT                   /protein_id="AAT82358.1"
FT                   /translation="MSSRATLSDVAKACGVSSQTVSRALNDSPLVRPETRAKVMAAVET
FT                   VGYEPNLAARALAAGGSRAVGILLTTRLTHGMSTTFTALVGTLREHSRPFVLDTAIEND
FT                   EESLRAALARLRGYSVQATILLAQRAKSVAIASQQRHGDKLVSVIAGHPDSPESPIVAI
FT                   DQALGARLATKHLIEQGYRNLLHVPGDLEWQDASERLSSYIAVCKEVGIDPAWMPANSW
FT                   GAEAGAAVAEELIAGHLPDAVLAGNDDIAIGMCHTFLTHGVRIPDDIGIVGFDDIPQAR
FT                   WMTPSLTTVVQDFEALGRQAVEAAEALIAGEAPESCQLSPTLAVRHSSRRH"
FT   gene            667515..668735
FT                   /locus_tag="PPA0604"
FT   CDS_pept        667515..668735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0604"
FT                   /product="conserved protein, putative sugar binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82359"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA57"
FT                   /protein_id="AAT82359.1"
FT                   /translation="MEVLMSDSLPISRRRDLGLGATLAAGVGLSACGEGGDKGGSATAK
FT                   ASQLNLDTLSGEITFQAQGLKGTFDGFFNDLIKKFEKEHSGCTIKWTDLPGTDDFDTTM
FT                   VTQASNGTMADVVNMPSSTIMALSRADYLLDIETSVPGIGDKFVPDVWGKLKLGKDNEH
FT                   TALPWYFGPFVVTYNKDIFKDVGLDPEIPPKTMTEYLDFVKKITAAGKQAVYGNTSWYM
FT                   LAEWRALGVKVMNDDFTKFTFASESNALLWLTTMADMYAKGEFRRTRLPGASIGPRFTV
FT                   KDPWLSARRMRPFFATSKRMPPRHMPVPVLAQSLSMTASSRCFPGNTSRSRRRPRTLRS
FT                   RPLSQSGSPVWTRARMPSLRLAPSAPRKRPRLRPTCLTSMSRMASAPRWLTMSTLPLWV
FT                   IPSRRMP"
FT   gene            668823..669146
FT                   /locus_tag="PPA2403"
FT   CDS_pept        668823..669146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA2403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA2403"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82360"
FT                   /db_xref="GOA:Q6AA56"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA56"
FT                   /protein_id="AAT82360.1"
FT                   /translation="MSGPGIHPRSHTKRFFMSRPRGSRRSGGHRHGRIQAVNGSARFRK
FT                   PWVPYLWVGVPLLLVIYFYVYPFFNTLRLSFTDTTPLGEGETGSVLEITEKSSQTTHYG
FT                   MLF"
FT   gene            669182..669667
FT                   /locus_tag="PPA0605"
FT   CDS_pept        669182..669667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0605"
FT                   /product="putative sugar transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0605"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82361"
FT                   /db_xref="GOA:Q6AA55"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA55"
FT                   /protein_id="AAT82361.1"
FT                   /translation="MTMLPLILGVFVKEHVPGIGIFRTLFYLSAISSLVVIALAWSAIL
FT                   KDNGLVNNFLVGSGLINSPVPFLTGRWWLIISSCLITLWSGVPYYMLMYLTALANIDKL
FT                   LYEAAVIDGAGAVKSFFTVTVPGMKIMMALVSILSMIGCRRLPLRHDRWFHHYRSGF"
FT   gene            669695..670585
FT                   /locus_tag="PPA0606"
FT   CDS_pept        669695..670585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0606"
FT                   /product="putative transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82362"
FT                   /db_xref="GOA:Q6AA54"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA54"
FT                   /protein_id="AAT82362.1"
FT                   /translation="MTTSTVFPASSALCVRKRSINKSKFHGWGLFRHYIALLVVFVVLV
FT                   SPVFLPLLGAFKSSGDPIYGKGATAFPQHWSLNAFGELFRTTDIVRYIANLFAVCGLNI
FT                   VSALVFSSVCGYMLSRKGWPGRGVVTAVALSALIFPFESIMLSLYSQVRSFGFYDTIIG
FT                   IWPPGMIGPFHVLLMRAAFLGIPDEIEDAAYIDGAGEVRRFFTIFLPQVKGSLVVGLTA
FT                   FIFAWQDYLWPLLITQSSSNYTMMIGIAQLQSSFGTDYRIVLAGAITAVIPIFLVFLAS
FT                   QRYFFRGIEEGGLKF"
FT   gene            670670..672040
FT                   /locus_tag="PPA0607"
FT   CDS_pept        670670..672040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0607"
FT                   /product="glycosyl hydrolase, putative alpha-L-fucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0607"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82363"
FT                   /db_xref="GOA:Q6AA53"
FT                   /db_xref="InterPro:IPR000933"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR016286"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA53"
FT                   /protein_id="AAT82363.1"
FT                   /translation="MTDNADLDPAELEAAGALGGSEDPGYQWPTDPLVVKNLKHWQDLT
FT                   FGVIVHWGIYSAIGQGGSWSLHRDDLGWFTDKAPQFPGDPNDDAGYQDWYYDQAKTFRG
FT                   EDFDASEWAQACADAGMTYCVFTTKHHDGFCMYDSGYTNLKATSESSGLRRDILREVVD
FT                   AFRGAGLETGAYFSKADWSHACYWDRSKRIHDRFHNYDLEAQPERWQRFVDFTMDQITE
FT                   ILSNYGPMNVLWLDAGWVSTPEEPIGIDDIATRAREIQPGIIVVDRAVHGPHENYRTPE
FT                   QEIPEDILDYPWEACLTLTKEWCSLSPDDPAKPTSLIIANLIKIVSRGGNYLLGIGPDA
FT                   TGHMPDSVRRGLREIGGWMDVCGEGIMAARPADPEISAQGDNLEWYLTTKDSHLFAWGV
FT                   ANEDVVGADRLVVEGEYRQARVLGGPVLETQTRDGRTVIEVPASPTQYAIGLELIEH"
FT   gene            672188..672763
FT                   /locus_tag="PPA0608"
FT   CDS_pept        672188..672763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0608"
FT                   /product="L-fucose isomerase"
FT                   /EC_number="5.3.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82364"
FT                   /db_xref="GOA:Q6AA52"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR012888"
FT                   /db_xref="InterPro:IPR012889"
FT                   /db_xref="InterPro:IPR038391"
FT                   /db_xref="InterPro:IPR038392"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA52"
FT                   /protein_id="AAT82364.1"
FT                   /translation="MGVCADLTVTASWDCIAEILDLTPDIPHARGFNATERSGAVTVAA
FT                   AMAAYTQLGILAFAIYGHDVQNADDALTDDVSARILSFGRAALAVGLMRVRSYLAMGTV
FT                   SMGIAGCHVPEQALQDYLGMRSQYIDMVELGRRITAGIYDHVEWKWAMAWVSASVRTEI
FT                   RLTSSTAMLTSVNSWSIRSRWCWLPETS"
FT   gene            672646..673701
FT                   /locus_tag="PPA0609"
FT   CDS_pept        672646..673701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0609"
FT                   /product="L-fucose isomerase"
FT                   /EC_number="5.3.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0609"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82365"
FT                   /db_xref="GOA:Q6AA51"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR012889"
FT                   /db_xref="InterPro:IPR015888"
FT                   /db_xref="InterPro:IPR038392"
FT                   /db_xref="InterPro:IPR038393"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA51"
FT                   /protein_id="AAT82365.1"
FT                   /translation="MGLSIGEDRNPADKQHSDADKREQLEYSVKMVLVARDLMNGNLRL
FT                   ADMGFKEEAGGYDAIAAGFQGKRQWTDGKLNGDVMETLLNTSFDSDGLRQPQVFATEGD
FT                   ALNGIAMLLGSLLTQRPQFFSDVRTYWSPEAVRRVTGHELTGRAAGGFVDFRNSGASTL
FT                   NATECEAEADGTPVIKHWWDLTEDDIQADLAATTFHSATQEYFPGGGFSTHFTTVGDTT
FT                   VTAVRMNMVAGVGPTLQIVEGRTLPDEGTDTIVERADPTWPTTFFVSRIPSSGAFSSVY
FT                   DWMDKWGANHTSTGYSHIGADVLTLAAMLRIPVSMHNIETKDIFRPRTWSSSEPSSNRR
FT                   ARDTDRRVRPS"
FT   gene            673809..674105
FT                   /locus_tag="PPA0610"
FT   CDS_pept        673809..674105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0610"
FT                   /product="class II aldolase and adducin N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0610"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82366"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA50"
FT                   /protein_id="AAT82366.1"
FT                   /translation="MPESSIVMPEVPLADYATPSTPGVVEATSKYAKTHTVCLMEYHGA
FT                   FTWGPDVWAAYMAMERLEYTAQITYLLERRDGLRELPDDEIVKLVSMRPQYGL"
FT   gene            complement(674068..674490)
FT                   /locus_tag="PPA0611"
FT   CDS_pept        complement(674068..674490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0611"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0611"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82367"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA49"
FT                   /protein_id="AAT82367.1"
FT                   /translation="MRAPTWIYAMLCILIRYVVSPGPGELARYVVEVYTGVAPVLATEP
FT                   NGVKPAIGELYLDVTKLAWTADPSGNTSERIAITSVGATVTLSNDSDGPGHHCSRGPGS
FT                   DDCCSGHLGLDRRQRLRSAAHRRLITTRIAVASTPV"
FT   gene            674491..675255
FT                   /locus_tag="PPA0612"
FT   CDS_pept        674491..675255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0612"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0612"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82368"
FT                   /db_xref="GOA:Q6AA48"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA48"
FT                   /protein_id="AAT82368.1"
FT                   /translation="MGALGWRSWFSELPPDDCFEPRRIGYPMLNRHSLICHNVVMQFPH
FT                   AGRPALDGVSLVMPAGSVNVVVGASGSGKSTLLMCLAGLEAPTRGRVVHGDVDVYGLDD
FT                   RRRAAWRLQTIGLVFQNSELVPELTLRDNIALPLELLGTGRRDALKRADHLAEILDLSE
FT                   SNKRRPSEVSGGQAQRAAVGRALAHRPAVVLADEPTGALDTTNRHAVIDLLDELVRAEG
FT                   STLVMVTHDEHTLPGNARIIRLADGRIVGDAS"
FT   gene            675252..677426
FT                   /locus_tag="PPA0613"
FT   CDS_pept        675252..677426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0613"
FT                   /product="hypothetical protein, putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0613"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82369"
FT                   /db_xref="GOA:Q6AA47"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA47"
FT                   /protein_id="AAT82369.1"
FT                   /translation="MKGVRLALRLSRGAGRHERVRSLVMIVGVALATLGLAVGVTLPRV
FT                   TAQQQEVRDARTPILAPDEPADGHTGFKVQELQVDGTPWTSFVVNHPADRLPPGLKHWP
FT                   QPGHTIVSPRLKSLMDAGVVNISSLGTIDPVVVDRAALASPDELFSITTTSDQAGCREL
FT                   KAFGLTRIGDSGVSSRTVWIEVIGLVALPAAVLLWTSLSLSAASRRDRFMTLVRMGCDP
FT                   DWCGQVFAVEVSGTAGLGALLGLALFIPVQNALGSSGTLGLTWWPWQARLRWPEWLIIV
FT                   VIMVIASGWLARRALRRLLASRRPPRRRARLGTVRHLLGIVGLLLVVAAIGLEGWICLT
FT                   MALAHDGQRLGDHAAGYIMGAAVFGTLGAVMSAHLIIVWCAGREQLRLPTRLGLTLARA
FT                   HYLDSAAMVIALTIMVGLAGFGSGFLVSGTHDTAGDPHHVLVQVPFTDRTATEQQALRR
FT                   VTRPRRMIYTATDGRTLVAASCADLAAFDPYPRSCPRTPATRRDASSTWTFGHDKHTTV
FT                   RTIKPVSRLPVTYDDDALLARNDPRLAGLTPDILEFTADSTTGDLDRLVDQLHGAAPSY
FT                   AAYAGAENPDTLQAFIQQQGIVRSGLAAGFLLILVACTAAFVELRWGMRRTIAVQQAVG
FT                   TPARILRRSFLMQMIVTILPAQTMSLVVGVLAGWAINAAIGSTDANQSFDPTIAALPVT
FT                   MWAVSVLAIMVTAFATGVPRFQLSAVRDTT"
FT   gene            677448..677726
FT                   /locus_tag="PPA0614"
FT   CDS_pept        677448..677726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0614"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0614"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82370"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA46"
FT                   /protein_id="AAT82370.1"
FT                   /translation="MLKLQYGAIAGCLTEAKASRCEKCRMASGVKQGEPSAGNTVHRGA
FT                   VPNDLISAAIVAADFDDLELYRLDIAMHESSSRRNTVPAHCVQVTTS"
FT   gene            complement(677784..678638)
FT                   /locus_tag="PPA0615"
FT   CDS_pept        complement(677784..678638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0615"
FT                   /product="ABC-type transporter, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82371"
FT                   /db_xref="GOA:Q6AA45"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA45"
FT                   /protein_id="AAT82371.1"
FT                   /translation="MVFSTIINFDSFSQLVPLVRGSIIAGIILGVLAGLIGPMIHARDL
FT                   AFAIHGTSELSFAGAAVALFFGASVTKGAVVGSLVAALILGLLGVKAAERNASIGIMLP
FT                   FGMGIGVLFLSLYKGRSSNKFGLLTGQIVAVDTTELSTLVVVAIFVAVCLGIIWRPLFF
FT                   ASVDPEAAKARGVPMRFLSIVFMLLLGLTTAMAVQLVGALLVLSLLITPTAAAAKVTAH
FT                   PLAMSLLSIVFATVSAVGGIMLSLGPGLPISPYVTTVSFLIYLVCLGLGAIRQRRGWSR
FT                   RIV"
FT   gene            complement(678653..679456)
FT                   /locus_tag="PPA0616"
FT   CDS_pept        complement(678653..679456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0616"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0616"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82372"
FT                   /db_xref="GOA:Q6AA44"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA44"
FT                   /protein_id="AAT82372.1"
FT                   /translation="MRIEPARLTDAKVAFGNRVLWSGLNLIVEPGEFIAVLGPNGVGKT
FT                   TLLRVLLGQIPLTAGTAMVAGRPVRRGSTHIGYVPQQRSLETTAPIRGRDLVGMGIDGH
FT                   KWGFGWFSRSRRRRIDEAIASVGATAFANAPLTMMSGGEQQRLRIAQALVTNPQLLLCD
FT                   EPLSSLDLRHQQEVTRLIDNARRTRNLGVLFVTHEINPVLPYVDRVVYVAGGKVRVGTP
FT                   DEVLRSDVLSEMYGSHVEVFHRGNRIIVLADEERSTHLHAPGRRI"
FT   gene            complement(679498..680415)
FT                   /locus_tag="PPA0617"
FT   CDS_pept        complement(679498..680415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0617"
FT                   /product="solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0617"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82373"
FT                   /db_xref="GOA:Q6AA43"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA43"
FT                   /protein_id="AAT82373.1"
FT                   /translation="MHRHLLAIATLSACALAMAGCSNSGPDSGSGPSASSDKVDVVAST
FT                   NVWGSVAQAIGGDKVNVHSIIDSPDQDPHDYEATAKDKLAFSKAKIAITNGGGYDDWAT
FT                   KLVKSTSPQADFIDAVETSGLKKPGDKEFNEHVFYSIDSVRKVAKVVESDLVKTSPDNK
FT                   STFETNLKDFESKLTDLKARATKVGKKHPHSTAIATEPVAGYLLEDMKIKNITPDEFVE
FT                   QSETEAGPSTKVVHETTDLLTQKKASILLVNGQTSDDVTKALQKAASKANVHEVGVWET
FT                   FPEGVDNYPDFIGKAIDSIDKGLA"
FT   gene            complement(680534..681085)
FT                   /locus_tag="PPA0618"
FT   CDS_pept        complement(680534..681085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0618"
FT                   /product="hydrolase, putative isochorismatase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0618"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82374"
FT                   /db_xref="GOA:Q6AA42"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA42"
FT                   /protein_id="AAT82374.1"
FT                   /translation="MSQTWLIVIDPQTIFASPTSPWGSPAFPTIIDPIDRMVAAFHGRT
FT                   IVTRWIPTATRCGSWCDYFDRWTFADRPANDPIFDLVDEAQPWAERPTIDVATFGKWGS
FT                   QLSAVTGEHPHLLLAGVSTDCCVITTALAAADAGAWVKVVSDACAGSAPDNHEAALTVM
FT                   DLYSPQIDVVTSSQVLATLA"
FT   gene            complement(681082..682545)
FT                   /locus_tag="PPA0619"
FT   CDS_pept        complement(681082..682545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0619"
FT                   /product="transport-protein, putative permease for
FT                   cytosine/purines"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0619"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82375"
FT                   /db_xref="GOA:Q6AA41"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA41"
FT                   /protein_id="AAT82375.1"
FT                   /translation="MTQTATKTNATTHKGIETTGIEIVKESQRTAQPQDLFLPWFASNV
FT                   SVFGMSYGAFMLGFGVSFWQAIAATLVGVIVSFGFCGIIAIAGKRGSAPTMVLSRAAFG
FT                   TQGNKIPGVISWMTSIGWETSLAITAVLATTTIFRRLGWSSGNSVKICATIIVAFLIVG
FT                   GAVAGYHIIMKLQAVLTWITGILTVIYLVMAVSHIDWHAATSLPAASFPAFVGTLTLIM
FT                   TGTGLGWTNIAADWSRYQSRTSPGFAIAFWNVFGASLPLVILITGGLLLAASSKNLSDA
FT                   IGADPIGALATILPTWFLIPFLLAAILSLLAGAINGIYSSGLTLLTLGIRVPRPAASLI
FT                   DETILTIGTLYVVFVAPNFISPFQSFLVTLGVPLSGWTGIMMADITLRRRPYDEADLFN
FT                   GSGRYGHFDPISIITFVIVTVIGWGLVVNTYEGVNWNDWQGFLLGPIGLGGREGDWAHA
FT                   NLGVFGALVLGYVVTLIARRGTVRRQESR"
FT   gene            682635..686093
FT                   /locus_tag="PPA0620"
FT   CDS_pept        682635..686093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0620"
FT                   /product="NAD-dependent aldehyde dehydrogenases"
FT                   /EC_number="1.2.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0620"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82376"
FT                   /db_xref="GOA:Q6AA40"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA40"
FT                   /protein_id="AAT82376.1"
FT                   /translation="MSIDADTWGSPSPRPADLADEAVDQVHTWLRDANGASKRRTDRAQ
FT                   IAAGLLSDVLSHPAGLPFTLAFIDRVVRPEDARTAAANLAELAKVDCSFLPAALQVAVR
FT                   AGGRMAPVAPNVVVPAARHALRQLVGHLVVDARPAQLTRTLKALRSAGVRLNLNLLGEA
FT                   VLGDREAASRLEGTMALLAREDVDYVSIKISAVVNQLDLWAHKATVDEVVEQLLPLYHL
FT                   AENSPKPKFINLDMEEYHDLDLTMEVFQKLLDRPELRHVEAGIVLQAYLPDSLSALQGL
FT                   VEWADRRTAAGGAGIKVRLVKGANLAMEKVDAEIHGWQQTPWPSKLATDTNYKRILDWA
FT                   LTPERTHSVRYGVAGHNLFDIALTKLLCEHRGVRDRVEFEMLLGMAPDQVERIGADVGG
FT                   LLLYTPVVDPAHFDVAISYLVRRLEENAASENFMSAIFQLGHDSQLFAREEARFRTAVA
FT                   GITREVPKPRREQEPDRAPDLSNGFVQSTDSDPSLPNIRVWAGEVAEKMKGCELGESTL
FT                   ANNHLDTIAEVNAVIATALEAQHSWAGRGGNARAEILRTVTHAFATRRGDLLAVAGAET
FT                   GKILAEGDVEVSEAIDFAAWYVDRAEELEGVDGAQFVPPRVTVVTPPWNFALSITAGST
FT                   LAALAAGSSVLLKPAPQARHCAAVISECLWEAGIPRDVLQLVDVEENEAGKHLVSHPEV
FT                   DRVILTGAWETAKLFRSWRHDLPVLAETSGKNSIIVTENADYDLAAADIIKSAFGNAGQ
FT                   KCSAASLIILVGQAYRSQRLRHQILDAASSIRVGSPSDLRSQMGPLAEPASGKLLDGLT
FT                   KLDPGQEWALEPVRIDEEGRYWSPGVRSGIKPGDPYHLTEYFGPITGIMYAPDLATAIA
FT                   YQNGTAFGLTAGLHSLDPAEIEFWAERANAGNLYVNRSITGAIVGRQPFGGWKRSAVGP
FT                   GAKAGGYHYLQVLGTWRRAEVSAPTPADRPCALVEQFVGHIEGLVTRDERAWLLDAVAR
FT                   DAREWDEWFGRSIDVGGLERERNILRYRPASTQVRGCADAKLVDVARVVAAGLLAAGDN
FT                   ISVCLDPSLGEGLGRALRSVGVAVTTASDEDWYASLGASRVRLVGGNPSRAADEADGDP
FT                   DLALWANEVTSAPQVELLPFLREQSVSMTAHRFGNPDAGVLSVRL"
FT   gene            complement(686124..687173)
FT                   /locus_tag="PPA0621"
FT   CDS_pept        complement(686124..687173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0621"
FT                   /product="zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0621"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82377"
FT                   /db_xref="GOA:Q6AA39"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA39"
FT                   /protein_id="AAT82377.1"
FT                   /translation="MTHTMPALVLNGPGDVQVAEKPIPTPGPGEVVLAVEATTICGTDL
FT                   RIISGEKTAGVRPGVTLGHEIAGRIASLGEGVEGLVVGQQATISIVVSCGTCRACLAGR
FT                   EHLCSHCELVGYGLDGGLAPWLCVPAQAVSRGNIIPVATEIPATRLALAEPLSCVLNGH
FT                   RRHGGVNPGETVVIIGGGAIGLLHTALNLACGAGRVILCEKHADRRDRAAAMGAVTTCP
FT                   EHLSEVVTEHTGGYGAELVIVAIGRNELTEESLNLAAPGGRVSWFAGFPKGSTTTITPN
FT                   TVHYQELTISGGSNASRADVHRAVDMLGRGNIDETPIVTHTFGLSQWTEAVDAVRGHVG
FT                   VKIAIDPRR"
FT   gene            687293..689023
FT                   /locus_tag="PPA0622"
FT   CDS_pept        687293..689023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0622"
FT                   /product="putative dihydroxyacetone (glycerone) kinase
FT                   protein"
FT                   /EC_number="2.7.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0622"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82378"
FT                   /db_xref="GOA:Q6AA38"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA38"
FT                   /protein_id="AAT82378.1"
FT                   /translation="MTRLVNNPDNFPSQAVAGLVSAFPNHLRPVFGGVVRAARTDRKVA
FT                   LVVGGGSGHYPAFAGWVGPGFADGAVCGNIFSSPSASQAYAVCKAADRGAGLLIGFGNY
FT                   AGDVLHFGQAAERLRSEGIDARCLLVTDDIASAPDHLKRRGIAGDLPVFKVTAAACEEG
FT                   RDIDEVVAIFDRVNDRTRSLGVAFAGCTLPGADEPLFRVEAGQMGVGMGIHGEPGIHDE
FT                   TLGTADEVAAMLVNRLLADRPENPGTRVVPIVNGLGSTKYEELFVLWNDISRHLEKAGL
FT                   AIVDPQVGEFVTSLDMAGVSLTLVWLDDVIEPLWLAACDTPAYRRGTVGQVDFDTTPLP
FT                   QEVERVMVANPGSRASRSLAGVIVEALEVVATRLSERSSELGRLDSVAGDGDHGIGMAR
FT                   GSRAALAEARRVSGDGAGAATTLNAAGSAWSEHAGGTSGALWGAVLTAIGAVLGDEDPA
FT                   GEDTIPRAARAALDAVIRLGGASVGDKTMVDAMDPFVTTLESSSDPLPQAWESACHAAD
FT                   MAAQATSEVTATVGRARPLGDKSLGTPDPGAVSFHEVVVAVGSVLSKSALSNGRFRAQR
FT                   "
FT   gene            complement(689014..689517)
FT                   /locus_tag="PPA0623"
FT   CDS_pept        complement(689014..689517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0623"
FT                   /product="putative purine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0623"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82379"
FT                   /db_xref="GOA:Q6AA37"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA37"
FT                   /protein_id="AAT82379.1"
FT                   /translation="MTAYHADASDLEGKEILTWETFGDAAEELAAQIHHSGFDPEILIA
FT                   VARGGMIPGGALTYSLGVKLTDAINVEFYTDVQETLPDPVLLAPMLDTESIRNKRILIV
FT                   DDVVDSGRTLALVLELLRGFEADVRSAVLYAKPTTVINPDFVWKATDKWIVFPWSAKPP
FT                   VGQR"
FT   gene            complement(689607..690107)
FT                   /locus_tag="PPA0624"
FT   CDS_pept        complement(689607..690107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0624"
FT                   /product="N-acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0624"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82380"
FT                   /db_xref="GOA:Q6AA36"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA36"
FT                   /protein_id="AAT82380.1"
FT                   /translation="MDVNIRTMEERDLPTASRIYNQSAVATTYSYTVVNTNVEDRLSWW
FT                   RELIADSRPLLVAEVDGTMAGYANYHRFREGGGYDVTAEVTIWLDPQARGQGVGRKLMT
FT                   ELIRRARADDRLRNLLSVIDSDNERSISFHSAMGFVEVGRLPHIAYKLGNWRTAVLMQL
FT                   TLD"
FT   gene            690354..692018
FT                   /locus_tag="PPA0625"
FT   CDS_pept        690354..692018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0625"
FT                   /product="NAD(P) transhydrogenase subunit alpha"
FT                   /EC_number="1.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0625"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82381"
FT                   /db_xref="GOA:Q6AA35"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008142"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="InterPro:IPR026255"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA35"
FT                   /protein_id="AAT82381.1"
FT                   /translation="MRWVTASGVRHFSLHIAPNLGKRATPVSWVRTFGRKVTIMIIGIP
FT                   RELLPGENRVAATPTTVPALLKLGYEVVVEAGAGEHAAQPDRAYEEAGARIVEPGEAWK
FT                   ADLVLAVNEPTDDQISLMRAGAVLVTFLHPRQDLALTEKLAAAGVTGLSMDMVPRISRA
FT                   QSMDALSSMANISGYRAVVEAAFAYGRTFGGQVTAAGKVPPAKVFVIGTGVAGLAALGA
FT                   ANSMGAEVYATDVRPETAEQVQSMGAIFLHVRTGDSDQGVSSDGYAKETSDDYNARAAE
FT                   LYMEQAGKDDVIITTAAIPGKPSPKLITAEMVYAMKPGSVIVDLAALGGGNCELTRPGE
FT                   SYVTDNGVTIIGYTDLPSRLPGQASQLYGTNLVNLLKLATPEKNGELVLNFDDEVIRTM
FT                   TVCHEGQVAFPPPPVQVAAAPKPVAKAEIASAPATPEKKPRPWPQTFGIVAVLSIALIA
FT                   LLTFSPMEFVALFGTFAIAVVVGYYVVWNVTHALHTPLMSVTNAISGIIIVGAITQLGS
FT                   ESWGIRIVAALTVLIASINIFGGFTVTQRMLKMFRKA"
FT   gene            692022..693443
FT                   /locus_tag="PPA0626"
FT   CDS_pept        692022..693443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0626"
FT                   /product="NAD(P) transhydrogenase subunit beta"
FT                   /EC_number="1.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0626"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82382"
FT                   /db_xref="GOA:Q6AA34"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA34"
FT                   /protein_id="AAT82382.1"
FT                   /translation="MTSTLLIAPLAGSLVNFVNASFIVAGLLFIFALAGLSKFETSKKG
FT                   NAYGILGMVIAIVATIVALVKLPGYSPVSIVLLFIPMLIGGAFGVWKAVKVEMTGMPEL
FT                   IAQLHSFVGLAAVLIGFNAFAEEGTGASTFQLSEIWIGIFIGALTFTGSLVAWGKLSGK
FT                   VASKPLTLPGRNWINLGLLVVIIACGIWFSNVSGGIAWLPLALLTLASLFLGFHLVAAI
FT                   GGADMPVVISMLNSYSGWAAAFSGFSLHIPVLIVTGALVGFSGAILSYIMCKAMNRSFV
FT                   SVILGGFGDAPAVEGEGPAGEITEIKADELASQLSEASSVIIAPGYGMAVAQAQYPVAE
FT                   LAKKLRDNGVDVKFAIHPVAGRLPGHMNVLLAEAHVPYDIVMEMDEINDDFADADVVLI
FT                   IGANDTVNPAAMDPGTPISGMPVLHVWEGHEVVVFKRSMKPGYAGVENPLFFADNTRML
FT                   FGDAKASVDALVAAL"
FT   gene            693589..693909
FT                   /locus_tag="PPA0627"
FT   CDS_pept        693589..693909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0627"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0627"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82383"
FT                   /db_xref="GOA:Q6AA33"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA33"
FT                   /protein_id="AAT82383.1"
FT                   /translation="MTYVIGLPCVDVKDRACVEECPVDCIYEGERSLYIHPEECVDCGA
FT                   CEPVCPVEAIYYEDDLPGDQEKFLDINAEFFNELGSPGGAARLGPTHKDHPAVETLPPQ
FT                   GE"
FT   gene            693906..695009
FT                   /locus_tag="PPA0628"
FT   CDS_pept        693906..695009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0628"
FT                   /product="aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0628"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82384"
FT                   /db_xref="GOA:Q6AA32"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019880"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA32"
FT                   /protein_id="AAT82384.1"
FT                   /translation="MSRRNVSASLPTFPWDTIAEARRKAQSHPDGIVDLSMGTPVDPAP
FT                   GVAIAALTAAGDAHGYPQVWGTPALRAGILDHMKQVWGAPASLEETSVLPVIGTKELVA
FT                   SLPGQLGLGPDSTIVIPACAYPTYRVGAQLAGAKIVAVNEPDEVDVAPDLIWINSPANP
FT                   SGRVLDLDEMKAWVDLARSTGAVLASDECYGEFVWEGESVSVLDERVNSGDVTGLLACL
FT                   SMSKRSNMAGYRAGFAVGDAELTSELLTVRKHSGLMIPAPVVAAMQAALADRSHVLEQV
FT                   KRYRLRRNVLKPALEKAGFRIDHSEGSLYLWATHDEDCRVTLDRLADLGILCSPGDFYV
FT                   AGGSDHVRIGLTATDERINAAAQRIQP"
FT   gene            complement(695010..695948)
FT                   /locus_tag="PPA0629"
FT   CDS_pept        complement(695010..695948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0629"
FT                   /product="conserved protein, putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0629"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82385"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA31"
FT                   /protein_id="AAT82385.1"
FT                   /translation="MTKPSPRRTRPAATRQRRKRRSANPVRSIAALMVVLTILAGLGWG
FT                   GYKVWKAVDPFATTEPEGCRVVVLGQSYDLDLEQSQNAAIITAESIRRGLPTRAAAIAL
FT                   TTAMQESKLRNIDYGDRDSLGLFQQRPSQGWGTAKQIMDPWYSSGKFYGELVKFSNWKT
FT                   VSINDAAQQVQRSGYPEAYRKHEPLAKAWASALTGHSPSALTCINRSSKTTTVQELART
FT                   ARRALAPKVATQVTGPTVTFTATDPVLVRAAVALTMASTSLGPIDRATVATTSWRADSE
FT                   HYASWGAAAGPSASPAASGTGWVSGTVTARS"
FT   gene            complement(695950..696912)
FT                   /locus_tag="PPA0630"
FT   CDS_pept        complement(695950..696912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0630"
FT                   /product="transferase, putative tetrahydrodipicolinate
FT                   N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0630"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82386"
FT                   /db_xref="GOA:Q6AA30"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR019875"
FT                   /db_xref="InterPro:IPR026586"
FT                   /db_xref="InterPro:IPR032784"
FT                   /db_xref="InterPro:IPR038361"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AA30"
FT                   /protein_id="AAT82386.1"
FT                   /translation="MTQTTTSQTASADRRAWGWGLATVHEDGGVLDTWYPEPQLGCPDD
FT                   SSAPADLHRVTEAGRDAIRNVHTEVVHTVIDLDAAPVDVSDAYLRLHLLSSRLAIPRTI
FT                   NLDGIFGVLPNNAWTTIGPIRMADLEKARMEARIAHAPFTVLLIDKFPRMVDFVVPTGV
FT                   RIGDADRVRLGAHLAVGTTVMHEGFVNFNAGTLGHSMVEGRISQGVIVGDGTDIGGGAS
FT                   IMGTLSGGGKERVTIGRGCLLGAEAGIGISLGDNCVVEAGLYVTAGTKVTLPNGKVVKA
FT                   SELSGASDILYIRDSTTGIVKARGRGNHKIELNSDLHQN"
FT   gene            complement(697007..697303)
FT                   /locus_tag="PPA0631"
FT   CDS_pept        complement(697007..697303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0631"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82387"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA29"
FT                   /protein_id="AAT82387.1"
FT                   /translation="MVIIDPFLVFPLAGATISKAHAPLSLSSHLCIPQNSSRPHGPLTD
FT                   ETAGSPASALVAAGDTSVNRARTDQPQSETADCCVFIDLPCLTVEEPSRRFQQ"
FT   gene            697293..698423
FT                   /locus_tag="PPA0632"
FT   CDS_pept        697293..698423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0632"
FT                   /product="glycine amidinotransferase"
FT                   /EC_number="2.1.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0632"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82388"
FT                   /db_xref="GOA:Q6AA28"
FT                   /db_xref="InterPro:IPR033195"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA28"
FT                   /protein_id="AAT82388.1"
FT                   /translation="MMTKIVNSWNDWDPLKRVIVGRADNSVIPPEEPATSEKVPVDSAM
FT                   RGMWGPRPLETVEKANAQLDNLVDVLEKHGVQVDRPTPLQWNQAIGTPDFRNDSMMTCM
FT                   PPRDILLTIGSEIMASANSFRCRYFEYLAYWPLMNSYFEDDPEFKWTQAPRPRLTDKSY
FT                   KHNYYDERVSLEERLERTAAKDFVTTEVEPMWDAADVMRMGKDLFIQHGLTTNRKSMEW
FT                   FKRYYPDFRVHAVNFPGDPYPIHIDATFVPLRPGLIINNPNRPLPQEQRKIFEANDWQI
FT                   VDAAQPAHDTPPELCYSSVWLSMNCLVLDPKTVICEASEVHQMEQMDKLGMNVIPVAFR
FT                   DAYPFGGGLHCATADVYREGTCEDYFPNQVDDPTLV"
FT   gene            698547..699608
FT                   /locus_tag="PPA0633"
FT   CDS_pept        698547..699608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0633"
FT                   /product="conserved protein, putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0633"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82389"
FT                   /db_xref="GOA:Q6AA27"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA27"
FT                   /protein_id="AAT82389.1"
FT                   /translation="MDMEPGIINVKQEVPGVGTMNQKVGFVSMLLSATGMGLVGTFGRL
FT                   STPVDPTTGSKYIIGDFLATGRMMVGVLGFLLIIVILGKWSELRRIRISPAIVGGGLAI
FT                   GTSLALYVSATLMTTIANAVFLIYTGPLFATILARIFLKERVGLRNGIFFMLVFTGMLL
FT                   TVGLVQLGGGSVVSFGLQFGAVEGLPRKPLGDLFGLGSGVFYGLALFFYRYRGDVPSEI
FT                   RGFWNFVFGTVGASVVLALRIVFLDQTNPVAVMTGRNWLWAIVLFAVCGLGAIGLLVVA
FT                   GKNLKAVELSTTAYWECVIALLLGWLVWGESLTLTSSIGGALIVLGGAGPVVFELFGRD
FT                   HLPKDERSVPDCG"
FT   gene            699624..700919
FT                   /locus_tag="PPA0634"
FT   CDS_pept        699624..700919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0634"
FT                   /product="proline/betaine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0634"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82390"
FT                   /db_xref="GOA:Q6AA26"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA26"
FT                   /protein_id="AAT82390.1"
FT                   /translation="MSEDRSRVVRKVIVASFLGNFVEWFDYATYSYLAVIISRVFFPQG
FT                   TSRDALVQTFAIFALSFLLRPIGAVLWGCWGDKYGRRWSLSVSILMMAVASFLIGCLPS
FT                   FAVAGAFAPIGLLVCRMVQGFSASGEYAGAATFLAEYAPACRRGCYVSIVPASTAAGLL
FT                   MGSLSAAMIAGCLPQGAVGTWGWRLPFLAAGPLGLLARHVWLELEDSPVYQELSESETG
FT                   AAVGLGPLKTLLREHQRSLLVSIGVASLNAVGFYLVLTYLPTYLSNELGFSSRASFLSV
FT                   NISLLFYLLAIFVMGWLSDHVGRKRMLVVASVGFVLFSVPLFIVMGTGQLWKACLAEGV
FT                   LCLFLTANDGTMASYLAESFPTEFRYTGFAVSQNLANAVFGGTASAVCTWVIGVTGSRL
FT                   APAWYLTAVSLLSLCAMVASHEHTGRDLSEVV"
FT   gene            complement(700932..701540)
FT                   /locus_tag="PPA0635"
FT   CDS_pept        complement(700932..701540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0635"
FT                   /product="putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0635"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82391"
FT                   /db_xref="GOA:Q6AA25"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA25"
FT                   /protein_id="AAT82391.1"
FT                   /translation="MVQRMTAKGHHRRQKLIRSAASLLNSGGPSAVTMRAAARMADLSP
FT                   SSTVYYFDDHEELLAEAAKLNIRAWAHIAETIADEAENHRLKTGVDDVIEYLIRAMITR
FT                   PAPLLGHYLELISAGDNETISNAYHAGRGRLNNAISRILAVANLPYPAELVIAVIDGGI
FT                   VTALSEGRDPHATVEVLLRQLISLPTHKAPMSQAPPTTD"
FT   gene            701664..702743
FT                   /locus_tag="PPA0636"
FT   CDS_pept        701664..702743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0636"
FT                   /product="succinyl-diaminopimelate desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0636"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82392"
FT                   /db_xref="GOA:Q6AA24"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010174"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA24"
FT                   /protein_id="AAT82392.1"
FT                   /translation="MDLKPAGDLHELFRRLVDIESVSMHEAPIADAVEETLAPHRHLEV
FT                   TRLGNSVVARTHLGRSERVVIAGHLDTVPVVENLPSYIEQRSDGDYLVGRGTCDMKGGI
FT                   AVALALAVSLENPVRDVTWAFYECEEIAAEHNGLEKIASWRPDLIDGDFAILMEPTDGR
FT                   VEGGCQGTMRFTLEVPGRAAHSARSWVGHNAIHDLSAVLERLNRWQERDPFVEVDGLTF
FT                   REGLNATMLDAGVAGNVIPPTATIQINYRFAPDKTTEQARQYMEDLFHEWPMNVLDLSA
FT                   PARPGLDRPLAKSFVAAVGGEPGPKYGWTDVARFGQLGIPAVNFGPGNALCAHQVDECC
FT                   RLGSLDECYRALHTWLASR"
FT   gene            702788..703093
FT                   /locus_tag="PPA0637"
FT   CDS_pept        702788..703093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0637"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0637"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82393"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA23"
FT                   /protein_id="AAT82393.1"
FT                   /translation="MAWLLVVVVIIVIGLAVMAGSGKFGQVPPIVDDRPAPDLPEGDLS
FT                   AESLRSVRFAVVPRGYSMSQVDQLLDRLASQMETGQGPDLTNTGRPIPDATGPDTE"
FT   gene            703134..703301
FT                   /locus_tag="PPA0638"
FT   CDS_pept        703134..703301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0638"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0638"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82394"
FT                   /db_xref="InterPro:IPR021465"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA22"
FT                   /protein_id="AAT82394.1"
FT                   /translation="MAAMKPRTGDGPMEVTKEGRGIIMRVPVEGGGRLVVELNADEAQE
FT                   LLACFKDVVG"
FT   gene            complement(703365..704549)
FT                   /locus_tag="PPA0639"
FT   CDS_pept        complement(703365..704549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0639"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0639"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82395"
FT                   /db_xref="GOA:Q6AA21"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011875"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA21"
FT                   /protein_id="AAT82395.1"
FT                   /translation="MYVSVLTREYPPTIYGGAGVHVAQLVPQLRTLIDVDVQCMGQPRE
FT                   EATAHAENYPEGANGALRAFGADLSMVDAIPDEVDLVHSHTWYTNLAGLLAGVFHDVPH
FT                   VISAHSLEPDRPWKAEQLGGGYRLSSWAEKTAYDAADAVIAVSEGMRADVLRAYPELDP
FT                   DKVHVVRNGVNTDEFHPVTETDVCRDIGMDPDRPSVVFVGRITRQKGLVHLVHAATELD
FT                   PETQLVLLAGAPDTPQIGEEFKAAFEEVRSSRRAPVIWVPEMLPRSSVRQVFSAATVFA
FT                   CPSVYEPLGIVNLEAMACATPVVASRVGGIPEVVVDGSTGHLVDGVPTDLSTPEDVATF
FT                   ESAFAAAINDLTRNMERAKAFGTAGRQRCIDEFSWPRIAAQTVEVYQTAIKRHG"
FT   gene            704693..705919
FT                   /locus_tag="PPA0640"
FT   CDS_pept        704693..705919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0640"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.27"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0640"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82396"
FT                   /db_xref="GOA:Q6AA20"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AA20"
FT                   /protein_id="AAT82396.1"
FT                   /translation="MAKTRPKVLSIVLAGGEGKRLMPLTMDRAKPAVPFGGTYRLIDFV
FT                   LSNLANSGLTQIAVLTQYKSHSLDRHISITWRMSTMLGSYVTPVPAQQRLGPRWYQGSA
FT                   DAIYQSLNLINDQSPDYVVVFGADNIYRMDVDAMLQYHIDSGLGCTVAGIRVPRKDASA
FT                   FGIIDADQNHKITEFLEKPADPPGLPDASDESFASMGNYIFSREALVQALHDDAHSADS
FT                   RHDMGGDVIPRFVNAADAQVYDFRDNEVPGNTEKDADYWRDVGTIDAYHDAHMDLVSVE
FT                   PEFNLYNPDWPIWTMQEQAPGAKFVMRGSCDDTLVSAGCIISGTDIYRTVLGPRARIER
FT                   WARVDESIVMNNVAIGSNATVHRAILDKNVIVPDGAQVGVDHDHDRARGFTVSPGGVTV
FT                   VGKGITVPY"
FT   gene            complement(706002..706655)
FT                   /locus_tag="PPA0641"
FT   CDS_pept        complement(706002..706655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0641"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0641"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82397"
FT                   /db_xref="GOA:Q6AA19"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA19"
FT                   /protein_id="AAT82397.1"
FT                   /translation="MSPAQPRHQVPDARSWEYADGFVAPSPALQEAREAARADQWEVLG
FT                   NGTTALLTFLARTMQAGSVVTIGTDAGVSGLALLEGMTDHGVLTSIDPDAERQAAARKV
FT                   LSLARIRSNQVRLITGTPLDVLPKLRDGAYDIVLINGDRLEYVEYVSQALRLLRPGGVV
FT                   VVNDALANNHIADPDNEDDDTLIIRETLDSVLETEEFTPVLLPVGEGLLLATKS"
FT   gene            706725..707606
FT                   /locus_tag="PPA0642"
FT   CDS_pept        706725..707606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0642"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0642"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82398"
FT                   /db_xref="GOA:Q6AA18"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AA18"
FT                   /protein_id="AAT82398.1"
FT                   /translation="MSAPVFGRLLTAMVTPMTFDGAVDLRRTGELAHKLVEEQNNDGIV
FT                   VNGTTGESPTTTDSEKAEIVKAVVEAVGSDAAVVAGVGTNDTAHTIELAHQAAEAGADG
FT                   LLVVTPYYSKPSQAGIIEHFTAVADATDLPIMLYDIPGRTGTPIETKTLIELADHARIV
FT                   AVKDAKGLVVESATVMASTTLAYYSGDDAITPALLSVGGVGLVGTSTHFTGRRMHEVID
FT                   AYVDGRIDEALSTYREILPVLTGVFAAQGATMVKAGLAHQGFTVGRVRPPQTMPTPEQA
FT                   ETFFGVLDRTQL"
FT   gene            707657..708070
FT                   /locus_tag="PPA0643"
FT   CDS_pept        707657..708070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0643"
FT                   /product="conserved protein, putative twin arginine
FT                   translocation complex component"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0643"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82399"
FT                   /db_xref="GOA:Q6AA17"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA17"
FT                   /protein_id="AAT82399.1"
FT                   /translation="MSTAGPAEIAVLIVIAVLMFGPDKLPEMARKAARIYHYLKDIANN
FT                   TRDQLRSELGPQFADLDYQDLKPQNFVRKYVLDSLQDDIDEIKADLSDVRSDLDLGLAD
FT                   IRNSEGLPETPVSAPSSVVHDEAVPVPFDLEAT"
FT   gene            complement(708223..709797)
FT                   /locus_tag="PPA0644"
FT   CDS_pept        complement(708223..709797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0644"
FT                   /product="endoglycoceramidase"
FT                   /EC_number="3.2.1.123"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0644"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82400"
FT                   /db_xref="GOA:Q6AA16"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR041036"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA16"
FT                   /protein_id="AAT82400.1"
FT                   /translation="MYHHSWHSPDARRRGVTRWATTFIAALTAACMAQMPAQASPHTSD
FT                   AAPHIATSKTITDAGPIGQSGRWYTDGQGRAILTAGVNMVSKRHPYSPEADGFDDADAA
FT                   WLQKNGFDSVRLGVIWKGVEPKPGEYDDAYLASITRTVRTLRAHGIMTLLDAHQDMYNE
FT                   KFEGEGAPDWAVLDKGAPNLLKVGFPANQVFNLGLIKAYDSFLDNAKGPGGVGLQDRYA
FT                   AMWKHVAQVVGQEPGVMGYDIINEPWPGHHYPICYVAFGWCGRAMVSLDTLYEKVGRAI
FT                   TSVDPDGIVTYEPYSTWNMGLDSRPARPSSPKAAISWHVYCPMNAIFGSYVGCNLPDTR
FT                   TFHNADQAAQFNNSASLLSEFGATKDPGTLMGVTSKARAHLVGWLYWTYNGNSDPTTQN
FT                   AADEELVRHINRPGPVTDEQVDHTKLAILAVPHLRAAAGTPTSTTWDQSTRTYQATWTA
FT                   KRVAGDGDFAAGSVSEIAVPAIHYPNGYKVEVKGAKVISKAGDTRLQVSSTGEGPVSVT
FT                   ITPAGQA"
FT   gene            complement(709853..711013)
FT                   /locus_tag="PPA0645"
FT   CDS_pept        complement(709853..711013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0645"
FT                   /product="ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0645"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82401"
FT                   /db_xref="GOA:Q6AA15"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA15"
FT                   /protein_id="AAT82401.1"
FT                   /translation="MSTENPVVKAIADALSHVNDPEIKRPITDLNMIDEITVDEQGRAF
FT                   VRILLTVAGCPLKTELREQATEAVRSVDGVTSVSVELGTMTDEQRDALKVQLRGDVPER
FT                   VIPFAQPGNTTKVIAVSSGKGGVGKSSVTVNLALALAQLGREVGLLDADIYGHSVPDML
FT                   GLGDAHPTPLDDMLLPVPGLGIKSISIGMMKPNKSDVIAWRGPILDRALTQLLADVHWG
FT                   DLDYLLIDLPPGTGDIAMSLGQKLPNAEVLVVTTPQQAASEVAERAGTMAGIMQQRVLG
FT                   VVENMSWLEVTAPKSRETFRVELFGTGGGQKAADALSERLGTTIPLLGQIPLDVELRSG
FT                   GDDGDPIVITHPDSPAAEAITELAKTIDARPRGLVGINLGVQPVSH"
FT   gene            complement(711075..711590)
FT                   /locus_tag="PPA0646"
FT   CDS_pept        complement(711075..711590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0646"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0646"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82402"
FT                   /db_xref="GOA:Q6AA14"
FT                   /db_xref="InterPro:IPR010406"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA14"
FT                   /protein_id="AAT82402.1"
FT                   /translation="MADNDQWLHDADRLDIPGPRKVKRPRVQLDSEKFGQFAEATARFM
FT                   GTAKFLVYMTVIVCSWVIWNLVAIYKLRFDPYPFILLNLFFSTQASYSAPLILLAQNRQ
FT                   EDRDRVSMAEDRRVAAQSRADMEFLAREVASIRMQMGELATRDYLRSELRDELRSLLEE
FT                   IEASPASH"
FT   gene            complement(711583..712848)
FT                   /locus_tag="PPA0647"
FT   CDS_pept        complement(711583..712848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0647"
FT                   /product="putative magnesium (Mg2+) transporter MgtE"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0647"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82403"
FT                   /db_xref="GOA:Q6AA13"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA13"
FT                   /protein_id="AAT82403.1"
FT                   /translation="MNRSQSVFISRIRGLPVMDASGDQVGKVRDVVVQMRTPGRAPLVR
FT                   GLVVELFARRRIFVPMVRVHAIDAVQIMISGTVNTRVFSRRVSETLVIEDLFDRTFRRN
FT                   GTPVWVMDVSMAPVRSREWEINEVALAESGRSRFIRKAPSNPTIVDWREVPSLVLASRQ
FT                   STERTIAEMHEMKPADMARELHDMNPHRRAEVAMALDDDQLANAIEELPEDEQVSLITV
FT                   LDPDRAADILEEMDPDDAADLIKELPDTTAHQLLARMEPDDADDVRSLMAYDEFTAGAM
FT                   MTPEPVIVAADATVADALALVRNEDITPAEASMVFVCRPPTETPTGRYLGAVHVQRLLR
FT                   EPPSTMVSAIIDSDLEPMHTDAPVGAVSRYFATYNLVVVPVVNDANQLVGAVAVDDLLD
FT                   HLLPADWRGDQMDGEFVEVNHG"
FT   gene            712954..713463
FT                   /locus_tag="PPA0648"
FT   CDS_pept        712954..713463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0648"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0648"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82404"
FT                   /db_xref="GOA:Q6AA12"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA12"
FT                   /protein_id="AAT82404.1"
FT                   /translation="MLSVVPGRASAIFNLEYPQSVVVVDDYATAQKIVDQLSDKEFPVE
FT                   NLCIVGTDLKTMERVTGRRTWGSVLGQGAVSGLGMGLLVGLMMMFFTPGGAVLSLLLTG
FT                   LIVGVVIGMITAAITYSMSGGERDFNSVQQVVATHYEVLAEHKVAAQAREMVSDMPFMR
FT                   AKAFEG"
FT   gene            713577..714449
FT                   /locus_tag="PPA0649"
FT   CDS_pept        713577..714449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0649"
FT                   /product="putative cytochrome oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0649"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82405"
FT                   /db_xref="GOA:Q6AA11"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA11"
FT                   /protein_id="AAT82405.1"
FT                   /translation="MANTVTTRNAVPRGVVVLFAVTAVAITVTLALGSTVCATDASASC
FT                   PNWPGCYVGRLTPLDATQPWVEFIHRVISASVGLFALASVIVGMVYRHADKLLAALPIV
FT                   ALLGALTSGVFGMMTIKWGINSVEASFDLLAAIISMGAMWRAYFVARKPRSSWRWNGRT
FT                   KLGIGAVAFLVIGHFFAVQVAGCGSLTRCMGWAMFVRGAGDGPFAGWIAQQAIMGIGML
FT                   LAIVSLVARWGRRNGWDILCAVFIVIELVVGVLIAVNGSSHGLGTLHAIPAVLILCLTM
FT                   TATMRSARG"
FT   gene            complement(714480..715976)
FT                   /locus_tag="PPA0650"
FT   CDS_pept        complement(714480..715976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0650"
FT                   /product="Xaa-Pro aminopeptidase I"
FT                   /EC_number="3.4.11.9"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0650"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82406"
FT                   /db_xref="GOA:Q6AA10"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA10"
FT                   /protein_id="AAT82406.1"
FT                   /translation="MTETRSTELNEQLRQAEKQRIPKRQTPFSKAFVEFIPTDWAPYPD
FT                   ELPEPLSSAPSATAHRDALAARFDSDRLVIPAGHLMRRNNDCDYPFRPNTAFAYYSGLG
FT                   TDREPNAVLVVDTTAETRDVLYFKPRAPRTDREFYADPTYGEMWVGQRESLEEMAAMTG
FT                   LVCRDISQLDDALSTGDATVRVIRDADETVTATVDSLRPRGSEDADDEFYEFSSAARFC
FT                   KDDWEVEQLRDACRKSKVGFESMIAEIPEAVRKGRGERWMEGTFGRVARHLGNEVGYGS
FT                   ICAAGDHANTLHWVRNDGDLRPGELILIDAGIEVDSLYTADITRTLPISGTFSPAQRRV
FT                   YQAVLEAQDAAAAVAKVGHDHAEIHQAAIRVICEYLHEWGILPVSVEESLSPEGGQHRR
FT                   WMVHGTSHHLGLDVHDCNQARRQDYSGPLKKGMCVSDEPGIYFKQTDLLVPEEFRGIGV
FT                   RIEDDLCITDGEPEWLSKDCPRQVDEIEAWMQEIWGRACH"
FT   gene            716602..716958
FT                   /locus_tag="PPA2404"
FT   CDS_pept        716602..716958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA2404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA2404"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82407"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA09"
FT                   /protein_id="AAT82407.1"
FT                   /translation="MYRRWRSQKVLQTASMQRVSRLSSESARDSGLRGVKCLQEIASSA
FT                   VVIHSIGSPFVNTLVDSILPQVSRRPSRPYFSCRHCRRSASYRNALCSSRREGQLGADI
FT                   VPAGSEGQLDGPGC"
FT   gene            717501..718238
FT                   /locus_tag="PPA0651"
FT   CDS_pept        717501..718238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0651"
FT                   /product="conserved protein DUF164"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0651"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82408"
FT                   /db_xref="InterPro:IPR003743"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA08"
FT                   /protein_id="AAT82408.1"
FT                   /translation="MKAAAQDQWKLLDLAQTDRRIAQAEHRRRTLPELAELKDLAVQRR
FT                   TLAEEVVAKSTALSDAKMEQERIEGDLEPARARMERNQKTVDAGTITDHKALRGLTEEI
FT                   EHLGRRISRLEDDELDAMQAVEDAERAHADADRRRIELDGHIRTVLASRDAGLKGIDDE
FT                   LSELRRVRQTQAGGIPTDLFKLYELLRERTGMGCAKLVHGVCEGCGIATNAADLRRYEA
FT                   AGDDEVVRCEECDRILVRTGESI"
FT   gene            complement(718048..718599)
FT                   /locus_tag="PPA0652"
FT   CDS_pept        complement(718048..718599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0652"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0652"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82409"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA07"
FT                   /protein_id="AAT82409.1"
FT                   /translation="MLVSSSLSAAQPTRTLKRATLKRVRDLTVFLALLQVGFAMPSPSP
FT                   MTRWALTPPFHPHRLETGSLFSVALSRGSPRVGVTHHPALWSPDFPRQLTAAAITRMAR
FT                   PTANSTDIPASPPQEGLRWTLRYAPGCDRIPRIAPLHRHQLPRICAGQRHWWQCRIPRI
FT                   PRAPALRTPYRCARAAVRIA"
FT   gene            719343..719537
FT                   /locus_tag="PPA0653"
FT   CDS_pept        719343..719537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0653"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0653"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82410"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA06"
FT                   /protein_id="AAT82410.1"
FT                   /translation="MVKPMKYRKLVGLLREAGFTPTQGKGDHEKWRNGTTWTIITQTTE
FT                   CSPKVVKDALDAIERSKQQ"
FT   gene            719534..719905
FT                   /locus_tag="PPA0655"
FT   CDS_pept        719534..719905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0655"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0655"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82411"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA05"
FT                   /protein_id="AAT82411.1"
FT                   /translation="MNSLIVTATRWSGGWELEIGEQQHTQVRNLCNARQQVVDYLDTMD
FT                   ESVDHADVDITIIPEIGALADEVAQAREATRAAAEATEMAARQSRAAAQHLRAAGYSVS
FT                   DSAVIMGVSRGRVSQLVNL"
FT   gene            720198..721412
FT                   /locus_tag="PPA0656"
FT   CDS_pept        720198..721412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0656"
FT                   /product="iron transport system substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0656"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82412"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA04"
FT                   /protein_id="AAT82412.1"
FT                   /translation="MTTPALESGEKPELTRSGMTDPPRLEPLAPCALGRRRERRRSRAR
FT                   RPPDDALLLPGRARRSQKASFAMPATPKFLRRAVAVSMLPVIMLAGCAGAPKDSSASSS
FT                   ASASQSNAGPITITNCGQKVTLDKPATRAVTLNQGATEDVLAIGGESKLAGTAYLDSGI
FT                   PKKWKKAYDSVKVLAKEYPSKETFLSAKPDLAVSSYSSAFTDKAVGTREELKKQGIATY
FT                   ISPFGCPKGTPSAEATWENVWKEMREVGTLIGQKDAADKVIAEQRMSLKEVSGNKHGNG
FT                   TSIVWFDSGDKVPFIGAGHGGPQLLMDAVGAKNLFANLDGGWADGSWEKIVGSNPDVIV
FT                   VADADWSTAKDKIAYLKKDPVLSQMKAVKDNKFVTVPFSQTTPGAELVDGAKTLNDGLA
FT                   RVTGK"
FT   gene            721409..722443
FT                   /locus_tag="PPA0657"
FT   CDS_pept        721409..722443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0657"
FT                   /product="iron transport system, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0657"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82413"
FT                   /db_xref="GOA:Q6AA03"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA03"
FT                   /protein_id="AAT82413.1"
FT                   /translation="MSRWRSWLLLGIVVAALIGSALVVLGIGAVRVPVSDVARVVARRF
FT                   RLIEGADVTVLNDQIVWQMRAPRVIGSMAVGALLAMCGAVLQTLTGNDLADPYLLGISS
FT                   GASVGAVFVLIVGISSTLGQSVLMTLASFIGAVVALVMVLTMATGRSGELPAGRTILAG
FT                   VAVGQLCGAAVSVMIMIFGESNAARSALSWTLGSFAGLRWGSTITLVVATVPALVVGMA
FT                   LCHILDAFAFGDISAMSLGVPVNTVRWAIMVSTALLTALSVAFAGPIGFVGLTVPHIVR
FT                   FWTGSRHARLLPISALAGALLMVWSDTAARCLRPDTEIPVGVITAIVGAPVLVVLLRRQ
FT                   ASRS"
FT   gene            722464..723237
FT                   /locus_tag="PPA0658"
FT   CDS_pept        722464..723237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0658"
FT                   /product="ABC transporter, nucleotide binding/ATPase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0658"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82414"
FT                   /db_xref="GOA:Q6AA02"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA02"
FT                   /protein_id="AAT82414.1"
FT                   /translation="MLRAEALGWSVDGKTILSGVSVDVRPQMMTMIIGLNGSGKTTLLH
FT                   LLAGLRKPGMGRVWLGKRDLARIGAKERSRMMALLEQNPSAHVELTVRDVVQLGRIPHL
FT                   GRWRMGNLSRRQGHDDDVVEKAMATTGVSELTDRAWSSLSGGERQRVQLARALAQEPEI
FT                   LFLDEPTNHLDLPHQIDLLERVRGLGLTTVTVIHDLDLAAAYADDLIVLDSGRMVAGGP
FT                   ASTVLTPDLVRDHFGVDGEVWSSSRRGFTWNGLQT"
FT   gene            723234..723854
FT                   /locus_tag="PPA0659"
FT   CDS_pept        723234..723854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0659"
FT                   /product="conserved protein, putative NADH:ubiquinone
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0659"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82415"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA01"
FT                   /protein_id="AAT82415.1"
FT                   /translation="MTTRIAVSLRWDDAIDLDRAMTQQVAADCTAHLQGPGPTLIDVLD
FT                   SIDDTRIELVGWSSEDGPVPLSWLRRVAGQWVRDHADGPNVVVHAGAVRPGQTISNEWR
FT                   AVTGSEAPLRSPAWQEFPPFRHHLLACRGPRCNAAGAADLHARLKDKLAHALDTEILVT
FT                   VTGCMFPCNHAPLIVVWPDGRCIQLTADNLDRIVEDLIGPSRQ"
FT   gene            complement(724101..726386)
FT                   /locus_tag="PPA0660"
FT   CDS_pept        complement(724101..726386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0660"
FT                   /product="carbon starvation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0660"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82416"
FT                   /db_xref="GOA:Q6AA00"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA00"
FT                   /protein_id="AAT82416.1"
FT                   /translation="MDTVPPRTYNNSNFPEGLPAVSLSDEERARQQRWTPLRVTIWILI
FT                   SAIAGLGWWMLAVRRGETVNGIWFVFAAIGSYFIGYRFYAKYIQDKLVHPDDSRATPAE
FT                   YDYNGRDFVPTDRRILYGHHFAAIAGAGPLVGPVLSAQMGYLPSTIWIIVGVILAGAVQ
FT                   DYLVLVISMRRGGRSLGQMAREELGRFGGIAALIATLTIMLIIVAILAMVVVNSLAASS
FT                   WGVWSVGLTIPIALLMGFYLRYLRPGKVFEVSIIGIVLLVLAIASGAWIENTAVASALH
FT                   LSKPFLAWAIIIYGFIAAVLPVWMLLAPRDYLSTFMKVGVIAMLAISIVIVRPVINVPA
FT                   MTVYATNGAGPVFSGKLFPFLFVTIACGALSGFHATISSGTTPKLIEKESQARLIGYGG
FT                   MLMESFVAIMALVAALSVDRGIYFAMNSPAGATGNTVKSAIAYVNSLGLSGVHANANTL
FT                   TTTAKLVGETSIVSRTGGAPTLAVGLATIMHKIFGGEAMMSFWYHFAIMFEALFILTSV
FT                   DAGTRVARFMLSDALGNFWPRLKDHSWKVGSWLTTAIMVAGWGSILLMGVTDPLGGINT
FT                   LFPLFGIANQLLAAVALSICLVIFARAGHTWRLLIIFVPMLFTAIITVYGSWLKIFSPD
FT                   PKLGYWANHMTYKRAIADGKTSLGQAKNIDEMHTVVGNTAIQGTMSIIFVVCALIVMIV
FT                   ACIRTVQALRGRNIIDTEDPAKPSKIFAPSGLMPTKAERDLQVEWDAFYEEHPELDLES
FT                   VHKDKEHA"
FT   gene            complement(726769..727623)
FT                   /locus_tag="PPA0661"
FT   CDS_pept        complement(726769..727623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0661"
FT                   /product="methionine aminopeptidase"
FT                   /EC_number="3.4.11.18"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0661"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82417"
FT                   /db_xref="GOA:Q6A9Z9"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q6A9Z9"
FT                   /protein_id="AAT82417.1"
FT                   /translation="MSAIKPYPQSPRRHVPGNIARPPYVGLGDVPETYDGSHVQSAETI
FT                   AAMEEAGRIACGAMYEAGKAVEPGVTTDELDRIAHEYMCDHGAYPSTLDYRNYPKSCCT
FT                   SVNEVICHGIPDSRPLEDGDIVKIDVTAYKNGVHGDNCYTFGCGNVDQASLDLIDHTQQ
FT                   AMNRAIKAVKPGRSISIIGRIIENYAKRFGHGVVRDYTGHGVHSAFHSGLVVFHYDEPR
FT                   YDVTLEEGMTLTIEPMLTLGDQSNHQWDDGWTVLTNDGSRCAQFEQTLVVEKDGARILT
FT                   TLE"
FT   gene            complement(727635..727865)
FT                   /locus_tag="PPA0662"
FT   CDS_pept        complement(727635..727865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0662"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0662"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82418"
FT                   /db_xref="UniProtKB/TrEMBL:Q6A9Z8"
FT                   /protein_id="AAT82418.1"
FT                   /translation="MSETPEILTLLGHETRFMWVRRRRPDVARITLKIAANSVTKSASS
FT                   WRPSLPCTAPDTYLGFIDEEERHEPRHAHTT"
FT   gene            complement(728027..728896)
FT                   /locus_tag="PPA0663"
FT   CDS_pept        complement(728027..728896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0663"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0663"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82419"
FT                   /db_xref="GOA:Q6A9Z7"
FT                   /db_xref="InterPro:IPR018929"
FT                   /db_xref="UniProtKB/TrEMBL:Q6A9Z7"
FT                   /protein_id="AAT82419.1"
FT                   /translation="MASGPQAGWYRDPDGTPDRYRWFDGERWTDRTTTSPDPAPQHSGK
FT                   GHREHDNGRSSSWLWAIIIVILVVAVVVAFALHRSTSSDHNAEPDLNSSSPTVSAWNEK
FT                   STTPSASSSAVTCPRGQHPGNQDSNDGRLHGGGVSVESIPNWRHENLTLPWVMGQSAQI
FT                   DDVYPGWMSVSGVGGLPVAEGFSDPQTAATMMMDCFASSDYYAGYTGEKEIRSEALTID
FT                   GHPAWWKRSEVYVSLPSLPQVRGDVVDVVVVNTGQTDFLGMYFNSATIGDSTRQTLVDH
FT                   ARQSLKVD"
FT   gene            728895..730301
FT                   /locus_tag="PPA0664"
FT   CDS_pept        728895..730301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0664"
FT                   /product="glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0664"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82420"
FT                   /db_xref="GOA:Q6A9Z6"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:Q6A9Z6"
FT                   /protein_id="AAT82420.1"
FT                   /translation="MSAVYRSHDQPCYQLETHNGHTGKVSRQTEFVLRSMEERNIRFVR
FT                   LWFTDVLGSLKSVAIAPAEVEGAFVEGVGFDGSAIEGYARVYEADMVAHPDPATFQVLP
FT                   WRSGTSTARMFCDITNPDGTSSAADPRHVLKRTMGRAAEMGFTFYVHPEIEFYLLNDEH
FT                   HPGESPVALDNGGYFDHTTLGAGTDFRRDAINVLEQMGISVEFSHHEAAPGQHEIDLRY
FT                   ADALTMADNIMTFRVVIREIASLKGIKATFMPKPFTDHAGSGMHSHVSLFEGDTNAFYD
FT                   AADEARMSPVAKYFVAGLLHHAPEIIAVTNQWVNSYRRLSGGGEAPNYICWGRNNRSAL
FT                   VRIPMYKPDKASSARVELRSIDSAANPYLAYSLVLAAGLDGIEKELPLPEEASDDVWQL
FT                   SARERHALGIKQLPQSLGAAIRCMEESELVAETLGEHVYDYFLRNKRAEFEEYNRQVSQ
FT                   FELDRYLPHL"
FT   gene            complement(730320..731162)
FT                   /locus_tag="PPA0665"
FT   CDS_pept        complement(730320..731162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0665"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0665"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82421"
FT                   /db_xref="InterPro:IPR041629"
FT                   /db_xref="UniProtKB/TrEMBL:Q6A9Z5"
FT                   /protein_id="AAT82421.1"
FT                   /translation="MQPDAPSLVEVTIMAARAERSVKRLATTWVATARCLLPQPNTDPL
FT                   DPGEAQLWGRHHIAHLMVIFTDTLQTVTTPTTIRPMTLARVIDERRKATNTLAAIGHEV
FT                   IADDTASRLASQAQRLLDNVESVLLATPGPPATVDSLVGPVRVTDQLRATLLAMAAMGL
FT                   HDGIDIPSGAIIESCRTLSAVLDETHGGRTIELRVPPACAVQLAAIESGPNHHRGTPPN
FT                   VAETAPVTFLQLATGFSHWPEMRSAGRVQASGSHVDDVAGVFPVVDMAGVFRDIFADA"
FT   gene            731253..734204
FT                   /locus_tag="PPA0666"
FT   CDS_pept        731253..734204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0666"
FT                   /product="glutamate-ammonia-ligase adenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0666"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82422"
FT                   /db_xref="GOA:Q6A9Z4"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6A9Z4"
FT                   /protein_id="AAT82422.1"
FT                   /translation="MDRKSSVTIDLLRLGVMDTDAASANHHRIAENIGADPNRLADWEH
FT                   HLETCCDPDLALNVLAELAQDSAQCLGEVLDHDASACRLVRLLGASSELGRHLIAHPDD
FT                   LAEVIRDPVRLGHDEICDDLLEVVGAHKEGEFTVAGTPTGPASDRLRLANRRHLVRIAS
FT                   RDVSADDPTEIIEDVAAELADLADGIVTAALALARADCPDHADARLAIIAMGKCGAQEL
FT                   NYISDVDVMYVAEPANDDVSGASAVTIATKLAASVARMCSAHSGAGSIWQVDAALRPEG
FT                   NAGPLVRTMDSMRTYYEKWAKNWEFQALLKARPMAGDLDLGQRFVEMVSPMVWQVGEAE
FT                   GFVPETRAMRTRVVSLIAAKNKGREIKLGAGGLRDVEFTAQLLQLVHGRQDESLRVRAT
FT                   LPALRALAAGGYISRGAAERLKEAYRLERVMEHRVQMFRLRRTHLLPDDEDGLRRLARA
FT                   VGLRTADEVRRVWTATSKAVLRAHGQVFYSPVVEAVARIPTQDLRMSAEAAKVRLSALG
FT                   FHDEDAGLRHIEALTSGTSRAVRIQTALMPAMLAWLADGPSPDHGLLAFRQVSEALGES
FT                   PWYLRALRDEGAMAQRLAVVLSTSRYAVDVLTRAPETVQVLVDDDLTPLSREDLARQMN
FT                   AVARRHHDVEEAVGAIRAVRRRKLFRILVADILNVTGIRRIGQALTDLTGATIDAALTA
FT                   VSREVEDAPPIGIVAMGRWGGQELSYASDADCLFVVGDGPGVGEKALKIVTKLRNLLGK
FT                   HGADPAVVLDADLRPEGRSGPMVRSLESYRKYYGKWSSTWESQALLRASHGAGDRELTN
FT                   ELLEYVDQVRYPADGLTGSQLAEIRKLKARMESERIPRGVDPRRHLKLGPGGLSDIEWT
FT                   AQIIQLQHAGHDPALRTTSTIDALNAALAAGYIDEGQHAKLCDSWLAASRLRNAIMVVR
FT                   GRPSDVIPSDSTDLDVIAKASGMGQGASEHLVEDHLRHCRRASRVVDAVFWNQ"
FT   gene            complement(734198..735520)
FT                   /locus_tag="PPA0667"
FT   CDS_pept        complement(734198..735520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0667"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0667"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82423"
FT                   /db_xref="GOA:Q6A9Z3"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:Q6A9Z3"
FT                   /protein_id="AAT82423.1"
FT                   /translation="MTSTDPHDYRDDIRHDREFVNDTEAVIRLGSMLLSSGTGSYRVKR
FT                   AMCDAGLALGIDRLDASVSLTEITATAHRGDNFRTVAREVYRVRVDSSRIAALEDLAHN
FT                   LPAGTTGRELESRLDYISRTVRPKWAEWQTVLAGGVACAGFAILNKFSLADSLVVLAAA
FT                   SVGQFVRGRLNRRWLNQFGVAALASAAACLIYLMLADLLTNTGLHTIHGPGYVASLLFL
FT                   VPGFPMITSILDMVRMDFTAGLSRATYSVGLILAATMSAWVFSAATGLQPLPAQTVFPY
FT                   PWAWFAYAVATACGVAGFAILFNSSPCTVAWAAALGACGNLCRLALVGVNLPAQLAAGV
FT                   GGIVIGFLASPLSVRTKLPRITLTVPACVIMVPGASMYRTVYWLNGQDMTKALTFGVDA
FT                   VLTVILIACGLAVARMCTDPAWARNLPVPSPHAFKFSEDNH"
FT   gene            complement(735527..736708)
FT                   /locus_tag="PPA0668"
FT   CDS_pept        complement(735527..736708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0668"
FT                   /product="NIF3 (NGG1p interacting factor 3)"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0668"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82424"
FT                   /db_xref="GOA:Q6A9Z2"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017221"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:Q6A9Z2"
FT                   /protein_id="AAT82424.1"
FT                   /translation="MADNSSRTSIPQSCSDQITVSQVRATLDQWYPPSLAESWDAPGLV
FT                   CGDPDDTVKRIVCALEATDTVVDAAIEAHADMLVVHHPLLMRGATSVAADTPKGRIVHR
FT                   LIRHRIALMSAHTNADAAVGGVNDVLARLLGVTVECPLEPAAQPVDLWGVQVPVDAAEA
FT                   LRNALFGAGAGQFDGYDLCSFESVGRGQFRPLSGSHPALGTTNQVETVEEVRIHVVAPA
FT                   MMRSTIRKALVDAHPYEVPAYDVKTIDSGSRPGPATPGIGRIGHLDEPMTLRSFTQRVS
FT                   ERLPHTVWGVRTAGNPDQLITTVALCSGAGDSLLDAAAASGADVYLTSDLRHHPADEHL
FT                   RANGPALIDTAHWASESPWCADVARRLHDELGLPCQDLGIRTDPWTIGTTVAQ"
FT   gene            736909..737958
FT                   /locus_tag="PPA0669"
FT   CDS_pept        736909..737958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0669"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0669"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82425"
FT                   /db_xref="GOA:Q6A9Z1"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:Q6A9Z1"
FT                   /protein_id="AAT82425.1"
FT                   /translation="MMIGLALCVVPLAFYAWLVDRRPGAWSNGIVLAVGLGMAGLTAAG
FT                   IIVRTVPVIGSLIVGTLVVVAALGTAVLPFLLIVNGVEMWRKEGRSLSNVLSGALGVGL
FT                   LVLMAWCLRSVFSPFEPWAVAGISATMALGWLSFGFLGYLASVFVIHRAKPLPGNHQIV
FT                   VLGSALVKGKVPKLLASRLDRGIGQWRTDRDAGFHSVIIPSGGKGDDEPRAEGEAMAEY
FT                   LVEHGIPRECVVVENQAANTDENISLSRQVMPTQVRSVPSRRAEAARQRQNPQVVVATS
FT                   SYHAVRAAELCRRQGLRVRVLGAPTATYFLPSAMLREYIALLASRPWINGIMLVLVLAF
FT                   WPIVTMALR"
FT   gene            737973..738608
FT                   /locus_tag="PPA0670"
FT   CDS_pept        737973..738608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0670"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82426"
FT                   /db_xref="UniProtKB/TrEMBL:Q6A9Z0"
FT                   /protein_id="AAT82426.1"
FT                   /translation="MAVVAAVAAIVGCSRTTPAVPEAVVPTSSVTSTPRYSPLSQASAT
FT                   PQRMTSATSQRVTNVGGAQGALTCRRGEKAAMAFSDVDAALGARITVLTIRNCGSSVMI
FT                   LPVMPQLRQITEAGARVPVAWQPYDPKARSKRLAPGKVTSWELSWHSNGDCEHRGAWRL
FT                   EAKVGTTTAMLVGCLDLGSSYALTGESSTGPGGSDAVPVPEAAVRWSD"
FT   gene            complement(738690..740111)
FT                   /locus_tag="PPA0671"
FT   CDS_pept        complement(738690..740111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0671"
FT                   /product="glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0671"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82427"
FT                   /db_xref="GOA:Q6A9Y9"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:Q6A9Y9"
FT                   /protein_id="AAT82427.1"
FT                   /translation="MFEGPDDLLAYVKKEGIEMIDVRFCDLIGIMQHFTVPAREFDKDQ
FT                   YENGLAFDGSSIRGFQKINESDMALLPDPTTAWIDPFRERKTLIVNFNVHDPITKEAYS
FT                   RDPRNIARKAEAYLASTGIGDTAFFAPEAEFYVFDDIRFDTRQNTSYYSIDSEAGAWNT
FT                   GRTEDGGNRGYKVKYKGGYFPVAPTDHFGDLRDEIVTIMERLGMKVERAHHEVGTAGQA
FT                   EINWRFDTLSRSADDVMKFKYIVKNVAWQHGKTATFMPKPIFGDNGSGMHVHSSIWKGG
FT                   EPLFFDESGYAQLSDMARYYIGGILKHAPSLLAFTNPSANSYHRLVPGFEAPVNLVYSQ
FT                   RNRSACMRIPITGPNPKAKRVEFRCPDPSANPYMAFAALLLAGLDGIQNKIEPPAPVDK
FT                   DIYELPPEEHAAMDHVPGNLGAVLDNLEADHEFLLAGDVFTPDLIETWVELKRGDLAAL
FT                   QQRPHPYEFDLYYDI"
FT   gene            740180..740647
FT                   /locus_tag="PPA0672"
FT   CDS_pept        740180..740647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0672"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0672"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82428"
FT                   /db_xref="GOA:Q6A9Y8"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="InterPro:IPR016795"
FT                   /db_xref="UniProtKB/TrEMBL:Q6A9Y8"
FT                   /protein_id="AAT82428.1"
FT                   /translation="MCFERVTGRAGRIHRVSGTEAAPGVSIGLPAEGRGSLASWCKRIG
FT                   ALIIDWGASMVLASAIFGPAVIRGGGWPMWMPMAVFFVESVLFTAMTGGSFGQIVARVA
FT                   VVRLDDLGPVGWWRAVARTAMKCLVIPAVVIGAERRGLDDLVLGTVVVNRK"
FT   gene            740653..741765
FT                   /locus_tag="PPA0673"
FT   CDS_pept        740653..741765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0673"
FT                   /product="putative glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0673"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82429"
FT                   /db_xref="GOA:Q6A9Y7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q6A9Y7"
FT                   /protein_id="AAT82429.1"
FT                   /translation="MRVMVLSRGIPSPEAPLRGIFEYDQAVALHQQGHEVILAVLDARS
FT                   VRHWRKFGTRVEHAVDRNDGMTVVRLDVPLGAASARIDHRVHAIAARHLHRIVTSQWGI
FT                   PDVSHAHFARFAAAAARAGFPEPLVWTEHDSHLAHPDQRLNEDIIIAGDRADAVISVSQ
FT                   GLCDRLAGHGVTSTVVPNIVDVELFDRPDRRHEGTIVVSVATLNPGKGMIELAQAVERL
FT                   PEVQLRIIGDGPQRHQLEAIAAGNPRIVLLGPQSRDRIAEELAGADAFALASHAETFGV
FT                   ACAEALAAGLPVLTTACGGPQEFIDDSNGVVVPIGDVDALTEGLCQVLARSWDHEQIAG
FT                   YVRSRFAAAPVVDQLETVYRKAVADHGMAG"
FT   gene            741789..742397
FT                   /locus_tag="PPA0674"
FT   CDS_pept        741789..742397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0674"
FT                   /product="conserved protein DedA family"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0674"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82430"
FT                   /db_xref="GOA:Q6A9Y6"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:Q6A9Y6"
FT                   /protein_id="AAT82430.1"
FT                   /translation="MNLTAWMASINGVIAANAPHPWVIGALWGLCVIDGFFPPVPSESL
FT                   VVALAAIGHPSRWLIIPVAAAGAICGDNIAYWVGRQIGHTKLFTGGPKRQKTVAWATHQ
FT                   LRVRGPLCILVARYIPGGRVVVNAMAGATRFSYRVFLPIDALAGVLWACYATAIGAGAA
FT                   SFLGNNHILAATVGIIGAIIIGVILDQILRRLMPAPQSD"
FT   gene            complement(742472..743860)
FT                   /locus_tag="PPA0675"
FT   CDS_pept        complement(742472..743860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0675"
FT                   /product="PTS system, glucose-specific IIBC component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0675"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82431"
FT                   /db_xref="GOA:Q6A9Y5"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="UniProtKB/TrEMBL:Q6A9Y5"
FT                   /protein_id="AAT82431.1"
FT                   /translation="MAKDAVATSTKKKRQIPGFSQMQRIGRSLMLPIASLPVAALLMRF
FT                   GSADVLGADGLAKHASWMQPVADVLAGAGGAIFDNLPLIFALGVAVGYAKKADGSTALA
FT                   ALVGYLTFTGAGTSDKTQGGVLHALAPYFSQKTGVINYGVLGGIVIGLIAAKMYEKYRR
FT                   TKLPTYLAFFGGRRLVPIVTAAASVVAGVIMAIIYPAFDWLFNKQVGGFIMAHGSNPGT
FT                   GFVFGTINRLLIPFGLHHLLNSLPWFQLGNCTNAAGETLHGDITCFFSGASGTNAWTGS
FT                   FMTGFFPIMMFALPGAALAIYHTAKPERKKLTGGVMISVALTAFLTGITEPLEYAFAYV
FT                   AFPLYLVHALLTGSSLALCNALGIKDGFGFSAGLTDYIINFGRASELSGGPGKVLLLIL
FT                   IGLVYAVIYYVVFRFAITKWNLRTPGREDEGNDTTGGASVFDEAQLAASESTGKADAQK
FT                   EGRI"
FT   gene            744036..744761
FT                   /locus_tag="PPA0676"
FT   CDS_pept        744036..744761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0676"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0676"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82432"
FT                   /db_xref="GOA:Q6A9Y4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6A9Y4"
FT                   /protein_id="AAT82432.1"
FT                   /translation="MKYVTVRDYLVELIDTRLSVGDVVPSERELAERFGISRMTVRQAV
FT                   DSLVSSGMLERRRGSGTYVRAPKVHVQSRISSFSEEMRQRGMIPDTRVLRDEEISAAPD
FT                   VAVWLGIEPGEPVHYIYRVRLADGVPMAVERTWIAARVMPDLLTDGVPASIYGAMAAAG
FT                   LVPTWGEDAIEAVSGDALVCEHLQIPVGSAVLAINRRTYADDTAISYSRSWYRGDRYKL
FT                   WVPISGPHRTLYPPRGGSR"
FT   gene            744758..745006
FT                   /locus_tag="PPA0677"
FT   CDS_pept        744758..745006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0677"
FT                   /product="PTS system, glucose-specific IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0677"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82433"
FT                   /db_xref="GOA:Q6A9Y3"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q6A9Y3"
FT                   /protein_id="AAT82433.1"
FT                   /translation="MKRVEHILAALGGVDNVVSIEPCVTRLRCQVRRCEQVDEQALRRA
FT                   GAHGVTVQGHSVQVIVGPDADLLASDLEDLWEEDRES"
FT   gene            745136..745366
FT                   /locus_tag="PPA0678"
FT   CDS_pept        745136..745366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0678"
FT                   /product="PTS system, glucose-specific IIAB fragment"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0678"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82434"
FT                   /db_xref="GOA:Q6A9Y2"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q6A9Y2"
FT                   /protein_id="AAT82434.1"
FT                   /translation="MSKAEQILAALGGDDNIDDLEACITRLRVEVDDPSLVDEPALKAA
FT                   GAFGVVQQGTSVQVVVGPEADTLAEDIEDLR"
FT   gene            745366..745860
FT                   /locus_tag="PPA0679"
FT   CDS_pept        745366..745860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0679"
FT                   /product="putative PTS system component IIA"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0679"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82435"
FT                   /db_xref="GOA:Q6A9Y1"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:Q6A9Y1"
FT                   /protein_id="AAT82435.1"
FT                   /translation="MTAIASPLDGTLMPLSEVPDPVFAQGLVGPGVALEPTGEGDVTVV
FT                   APVAGRIVKLHPHAFVIQAEGFGVLVHLGIDTVQLDGEGFTLHAEEGHEVVVGDPLITW
FT                   NPAGVVAGGRSAVCPIVVLDASSGRIGDAAVTGERIACGDQLFQWLDVPEQDANVCAQH
FT                   D"
FT   gene            745628..746395
FT                   /locus_tag="PPA0680"
FT   CDS_pept        745628..746395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0680"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0680"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82436"
FT                   /db_xref="GOA:Q6A9Y0"
FT                   /db_xref="InterPro:IPR009898"
FT                   /db_xref="UniProtKB/TrEMBL:Q6A9Y0"
FT                   /protein_id="AAT82436.1"
FT                   /translation="MLRRVTRSSWETHSSPGIRPGSLRVAAVRSARSSSSTLPAEGSVT
FT                   PLLPGSGLPAAINCSSGWTFLSRMPMSVPSTTDRARRHPEVAALVGVVAGIFSAIVKFG
FT                   WEVPFPPRTPERNATNPPQQLLEQLGFSDHFAHTLVYFNGNGLPVMSFIIHFGFAIFFG
FT                   VAYCVGAERFPKITLWQGVAFGVVVYVVFHVIVMPGLGTVPAPWHQPWQEHLSELLGHI
FT                   VWMWSIEVVRRDLRSRITGEPDPWVEPSMTAGR"
FT   gene            complement(746343..747545)
FT                   /locus_tag="PPA0681"
FT   CDS_pept        complement(746343..747545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0681"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0681"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82437"
FT                   /db_xref="GOA:Q6A9X9"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:Q6A9X9"
FT                   /protein_id="AAT82437.1"
FT                   /translation="MARDRRHCGGSVTLQDDSPISGKRPASSLFWPAIAVIMTTVTWTL
FT                   AMPRPTDLKIYRDCVRAMLNDPKALYTASSVSGLGFTYPPFAAIALTPLALIPSLPVTI
FT                   LHYGVSAIALAIMIDLIWRRCGHKPQPLLTAIFVAVLNFSEPIGKTFVYGQVNLQLAAL
FT                   VVIDVFLLPRRWRGVGVGVATGFKLTPGIFALWYLVTGQFKAALRAAAAGLVTIAIGLA
FT                   VMPTASWEYWTHYMLTPNRLGGLTWAGNQSLSGMLLRLGHGNLTLVWLVLVALCCALAG
FT                   IASRRLWQEGGADQVWSLLCAGLCGCLVSPVSWSHHWVWGSLIIVAGLADRRRCQQVLA
FT                   LIWALATLTWMVWWFPAGRNRELTAAWWQKILTDAYEFVGVATLIVLLSSMAQPTDRAR
FT                   Q"
FT   gene            complement(747509..749314)
FT                   /locus_tag="PPA0682"
FT   CDS_pept        complement(747509..749314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0682"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0682"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82438"
FT                   /db_xref="GOA:Q6A9X8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q6A9X8"
FT                   /protein_id="AAT82438.1"
FT                   /translation="MAGTNIVNADRISKSWGTRTVLSEVSLGLSTGDVIGVVGRNGDGK
FT                   STLLALLTGSLEPDSGTVTRTNGISIGVLAQAETRRDQTVRDLVVGGQPDHVWAANREA
FT                   RPIVEDMLSDIDLDRAMADLSGGERRRAALVSIMLGDHDLLVLDEPTNHLDVEAVACLA
FT                   GHLRHLQERGVAMLVVSHDRWFLDEICTDIWEVHDATVEAYQGGYSAYTLARVERARIA
FT                   ASNEAKRQNLARKELAWLRRGAPARSSKPRYRVEAANALIADVPEPRDKLQLARFSATR
FT                   LGKDVLDLNDVTVTVSSDELGERTLLDKVTCSIGPGDRIGLVGVNGAGKTTLLNLFDGS
FT                   RKPDSGRVKQGKTLRLAHLRQEVDDLDSTMTVLESVNDVKARTKLATGRDASATDLLEG
FT                   FGFTGQKLVTRIGDLSGGERRRLQLLRLLMDEPNVLLLDEPTNDLDIDTLRLLEDYLDS
FT                   WPGTLIVVSHDRWFLERVCDVVWALMGDGTVALLPGGISQYLEHRRDRKTGPSKSSRVG
FT                   STSRADEPKISAAELRQARKDMDRLDRQMGKVRDELAALHEEMATKADDYQALVHLQTK
FT                   ANELDARMTSLEEQWLETADIVEDQ"
FT   gene            complement(749322..750092)
FT                   /locus_tag="PPA0683"
FT   CDS_pept        complement(749322..750092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0683"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0683"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82439"
FT                   /db_xref="GOA:Q6A9X7"
FT                   /db_xref="InterPro:IPR025445"
FT                   /db_xref="UniProtKB/TrEMBL:Q6A9X7"
FT                   /protein_id="AAT82439.1"
FT                   /translation="MPKSQAAKELAAKQKAQAKAEKERRKHSDNPKDWGTGKQLVETFK
FT                   LTRQVDPQLLWWVIGSFVAGVVVFTVLGLILTDLWWAWLIVGIFAGAAAAMWVFQWRAK
FT                   RSMYARFKGQTGSAEVALSLLDKKKWTSTPAIAFTRQQDVVHRAVGPGGIVLIGEGHGN
FT                   GLRNLLATETKRHEQVAYGTPVTSIIMGDGKGQVPLEDLDKHIKKLPKTLSTSQVDEVV
FT                   NRLKALDAMRPKVPLPKGPMPSSMKGARAAMRGR"
FT   gene            complement(750294..751985)
FT                   /locus_tag="PPA0684"
FT   CDS_pept        complement(750294..751985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0684"
FT                   /product="sialidase B"
FT                   /EC_number="3.2.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0684"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82440"
FT                   /db_xref="GOA:Q6A9X6"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="InterPro:IPR026856"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:Q6A9X6"
FT                   /protein_id="AAT82440.1"
FT                   /translation="MHQRISRRSALISGGAALFLSVTGQFSEHSPALATQEADVLEVFN
FT                   RENSPSHFFRIPFMVSTANDTLVIGCDANRATTGDSADNIDALIRRKPNASRYSISDGW
FT                   EAPSLIKPLEMRDYSNKYGYAPASSSVIDGAIIEDSVRHRLMIVIDLWAWNGGVFEHLN
FT                   VSPDGPVNGGRPRKFPLGDGFATVAGRDMLLLSTHNVTGDADGLRGNINLNIDRSQFDL
FT                   VADLDGPRDKHGRIQIYELIGIPRPYTTAGVDDSNLALGRRSRYSLDDGFNLFEAGIPL
FT                   YVFQHGSARITPMRVFYKDSILQVFNTNHIVEIYSYDDGRTWNMGKLVTRQFRPVDSRY
FT                   TLVAPGRSIQIRAGEHAGRIVVPTYMMLPAGISCTTVYTDDGGETWQRGTPMPATIDLH
FT                   ESAITEVLPGVLRSFNRHSASSGGKVLTAESVDGGHSWSTLTSAFGDDDQGVACQVSAL
FT                   MLKQTIASPTTGEQLPALIVVSADDRRRRHGIAHVAVVHRSSRTFGPRSELEWVSHADI
FT                   TSPQTLFAYSSIAQLSDGRVLVLFESSPTDSWADGLQRMYLQELAS"
FT   gene            complement(752060..754375)
FT                   /locus_tag="PPA0685"
FT   CDS_pept        complement(752060..754375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0685"
FT                   /product="sialidase A precursor"
FT                   /EC_number="3.2.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0685"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82441"
FT                   /db_xref="GOA:Q6A9X5"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR026856"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:Q6A9X5"
FT                   /protein_id="AAT82441.1"
FT                   /translation="MTITDTYTEELAIDLTGSALLPARKGMDVQRIDGEDGSLLVEFSA
FT                   TSSGCLFELVGKNGRLSVDVDEDRLLGRIDLNGESRSLDAEDALGMADGTIHSVGLTAD
FT                   ETGTHLFADGYETFSATLRVWCQDLGATNIVINPSGVLDVRRFKMWNSALSLQAMAAKA
FT                   PTATPFVEFAGSELSARDARRIGELAHGALRARTRLRGKGQGGTVLAAQGSAGELSFEI
FT                   VNGDLLLHVEVDDEPIAHVRAPGKWDDGNWHDLVAISGRGAIDLYVDGFLVAHEPGEAF
FT                   FADLGKVERVTVGKDLEGARLFGEAQTASIFSSALTDAQVKRLANVAPLRTQALFDTGY
FT                   LGSKSYRIPSLIRLDSGSFIAGADQRVSIANDSPNDINFVIRRSEDGRRWDEAQIVLEY
FT                   PGEGALGASVIDSVLFQDHNSGRVFCLIDQFPGGVGQPNAEPGSGFDEQGRQLLFDRDA
FT                   TAYVIDAEGIVTTESGEPTDYTVDETGNVFAAGAPAGNIHLATGVDPHESLLTLRTCNL
FT                   ILIHSDDDGRTWSRPINLNPALKQPWMRFLGTSPGNGIQLEHGTHRGRLLAPVYYNHEE
FT                   GKTFSCAAVYSDDGGQTWNLGKSPNDERELFGKIVSSRNLNDDRGSTHESALVETPDGV
FT                   VHSFMRNQHPSGRVAHAASVDGGETWGEVTFVEQLTEIFSQPNAISVRDELGTESVVFA
FT                   NASMMLPFRGCGVLRQSFDGGKTWPHNRVLNPRHHVYQCMTQQDEQTLLVLWEREWQGL
FT                   FLTEVPLSWLTTSRSTLE"
FT   gene            complement(754448..755980)
FT                   /locus_tag="PPA0686"
FT   CDS_pept        complement(754448..755980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0686"
FT                   /product="sialic acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0686"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82442"
FT                   /db_xref="GOA:Q6A9X4"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6A9X4"
FT                   /protein_id="AAT82442.1"
FT                   /translation="MASSDDIITIKEMGDKRRWWQYLDATKWKLFIAALIGVTLDGYDF
FT                   VLITLALPEIKAAFGLTLVQSAALVSAAFITRWLGGLILGGVGDRFGRKPAMIIATVLF
FT                   AIGSLLMGFSPNFMFLFIMRMVVGFAMAGEYGSSATYVIESWHPRIRGKASSFLLSGYA
FT                   IGAILAVQVDKYLVPWVDSWHAGWGWRALFITGIVPIAVALYMRRRLPEASDWETAKSR
FT                   EREKSSESRDAFQVLFSGRRMSLNITLVIAAMAGLLAIFALNILPFWGVLAVAIACGAI
FT                   FVCLIVQFDPRRWVIGIGIMIVILSAFMYGWPILGLLPTYLTGAGYAASTVANLLTIAQ
FT                   FGNMIGYFVTGFMGDWIGMRKWYFTSILIAQIIVFPLFFAGIKSAWLIGLLLFFNQLFG
FT                   QGVSGLAPRWVSSYFPVEQRAAGVGFIYNVGALGGAIGPFVGASLAKSHGLGSALGVLS
FT                   VGFGLIVVLGVRLNLPRKLQALVNPEAVRPEDGDDRYINSVDLSSEFASSEC"
FT   gene            756191..756592
FT                   /locus_tag="PPA2405"
FT   CDS_pept        756191..756592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA2405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA2405"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82443"
FT                   /db_xref="UniProtKB/TrEMBL: