(data stored in ACNUC1104 zone)

EMBL: AE017333

ID   AE017333; SV 1; circular; genomic DNA; STD; PRO; 4222645 BP.
XX
AC   AE017333;
XX
PR   Project:PRJNA13082;
XX
DT   21-SEP-2004 (Rel. 81, Created)
DT   19-FEB-2015 (Rel. 123, Last updated, Version 12)
XX
DE   Bacillus licheniformis DSM 13 = ATCC 14580, complete genome.
XX
KW   .
XX
OS   Bacillus licheniformis DSM 13 = ATCC 14580
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
OS   Bacillus phage BLi_Pp2
OC   Viruses; Caudovirales; Myoviridae.
XX
OS   Bacillus phage BLi_Pp3
OC   Viruses; Caudovirales; Myoviridae.
XX
RN   [1]
RP   1-4222645
RX   DOI; 10.1159/000079829.
RX   PUBMED; 15383718.
RA   Veith B., Herzberg C., Steckel S., Feesche J., Maurer K.H., Ehrenreich P.,
RA   Baumer S., Henne A., Liesegang H., Merkl R., Ehrenreich A., Gottschalk G.;
RT   "The complete genome sequence of Bacillus licheniformis DSM13, an organism
RT   with great industrial potential";
RL   J Mol Microbiol Biotechnol 7(4):204-211(2004).
XX
RN   [2]
RP   1-4222645
RA   Veith B., Herzberg C., Steckel S., Feesche J., Maurer K.H., Ehrenreich P.,
RA   Baeumer S., Henne A., Liesegang H., Merkl R., Ehrenreich A., Gottschalk G.;
RT   ;
RL   Submitted (30-APR-2004) to the INSDC.
RL   Institute of Microbiology and Genetics, Georg August University Goettingen,
RL   Goettingen Genomics Laboratory, Grisebachstr. 8, Goettingen D-37077,
RL   Germany
XX
RN   [3]
RC   Protein update by submitter
RP   1-4222645
RA   Wiegand S., Hertel R., Dietrich S., Volland S., Liesegang H.;
RT   ;
RL   Submitted (14-SEP-2012) to the INSDC.
RL   Institute of Microbiology and Genetics, Georg August University Goettingen,
RL   Goettingen Genomics Laboratory, Grisebachstr. 8, Goettingen D-37077,
RL   Germany
XX
RN   [4]
RC   Protein update by submitter
RP   1-4222645
RA   Wiegand S., Hertel R., Dietrich S., Volland S., Liesegang H.;
RT   ;
RL   Submitted (27-DEC-2012) to the INSDC.
RL   Institute of Microbiology and Genetics, Georg August University Goettingen,
RL   Goettingen Genomics Laboratory, Grisebachstr. 8, Goettingen D-37077,
RL   Germany
XX
DR   MD5; 078d8411a224b5efac04cefb1af33cde.
DR   BioSample; SAMN02603292.
DR   CABRI; DSM 13.
DR   EnsemblGenomes-Gn; BLi00008.
DR   EnsemblGenomes-Gn; BLi00009.
DR   EnsemblGenomes-Gn; BLi00010.
DR   EnsemblGenomes-Gn; BLi00011.
DR   EnsemblGenomes-Gn; BLi00012.
DR   EnsemblGenomes-Gn; BLi00022.
DR   EnsemblGenomes-Gn; BLi00033.
DR   EnsemblGenomes-Gn; BLi00034.
DR   EnsemblGenomes-Gn; BLi00035.
DR   EnsemblGenomes-Gn; BLi00036.
DR   EnsemblGenomes-Gn; BLi00037.
DR   EnsemblGenomes-Gn; BLi00077.
DR   EnsemblGenomes-Gn; BLi00078.
DR   EnsemblGenomes-Gn; BLi00098.
DR   EnsemblGenomes-Gn; BLi00099.
DR   EnsemblGenomes-Gn; BLi00100.
DR   EnsemblGenomes-Gn; BLi00176.
DR   EnsemblGenomes-Gn; BLi00177.
DR   EnsemblGenomes-Gn; BLi00178.
DR   EnsemblGenomes-Gn; BLi00179.
DR   EnsemblGenomes-Gn; BLi00180.
DR   EnsemblGenomes-Gn; BLi00193.
DR   EnsemblGenomes-Gn; BLi00194.
DR   EnsemblGenomes-Gn; BLi00195.
DR   EnsemblGenomes-Gn; BLi00196.
DR   EnsemblGenomes-Gn; BLi00197.
DR   EnsemblGenomes-Gn; BLi00566.
DR   EnsemblGenomes-Gn; BLi00567.
DR   EnsemblGenomes-Gn; BLi00568.
DR   EnsemblGenomes-Gn; BLi00569.
DR   EnsemblGenomes-Gn; BLi00570.
DR   EnsemblGenomes-Gn; BLi00571.
DR   EnsemblGenomes-Gn; BLi00572.
DR   EnsemblGenomes-Gn; BLi00604.
DR   EnsemblGenomes-Gn; BLi00605.
DR   EnsemblGenomes-Gn; BLi00606.
DR   EnsemblGenomes-Gn; BLi00607.
DR   EnsemblGenomes-Gn; BLi00608.
DR   EnsemblGenomes-Gn; BLi00609.
DR   EnsemblGenomes-Gn; BLi00610.
DR   EnsemblGenomes-Gn; BLi00903.
DR   EnsemblGenomes-Gn; BLi00904.
DR   EnsemblGenomes-Gn; BLi00905.
DR   EnsemblGenomes-Gn; BLi00906.
DR   EnsemblGenomes-Gn; BLi00907.
DR   EnsemblGenomes-Gn; BLi00908.
DR   EnsemblGenomes-Gn; BLi00909.
DR   EnsemblGenomes-Gn; BLi00910.
DR   EnsemblGenomes-Gn; BLi00911.
DR   EnsemblGenomes-Gn; BLi00912.
DR   EnsemblGenomes-Gn; BLi00913.
DR   EnsemblGenomes-Gn; BLi00914.
DR   EnsemblGenomes-Gn; BLi00915.
DR   EnsemblGenomes-Gn; BLi00916.
DR   EnsemblGenomes-Gn; BLi00917.
DR   EnsemblGenomes-Gn; BLi00918.
DR   EnsemblGenomes-Gn; BLi00919.
DR   EnsemblGenomes-Gn; BLi00920.
DR   EnsemblGenomes-Gn; BLi00921.
DR   EnsemblGenomes-Gn; BLi00953.
DR   EnsemblGenomes-Gn; BLi01296.
DR   EnsemblGenomes-Gn; BLi02217.
DR   EnsemblGenomes-Gn; BLi02650.
DR   EnsemblGenomes-Gn; BLi02982.
DR   EnsemblGenomes-Gn; BLi03231.
DR   EnsemblGenomes-Gn; BLi03232.
DR   EnsemblGenomes-Gn; BLi03233.
DR   EnsemblGenomes-Gn; BLi03234.
DR   EnsemblGenomes-Gn; BLi03235.
DR   EnsemblGenomes-Gn; BLi03236.
DR   EnsemblGenomes-Gn; BLi03237.
DR   EnsemblGenomes-Gn; BLi03238.
DR   EnsemblGenomes-Gn; BLi03239.
DR   EnsemblGenomes-Gn; BLi03240.
DR   EnsemblGenomes-Gn; BLi03241.
DR   EnsemblGenomes-Gn; BLi03242.
DR   EnsemblGenomes-Gn; BLi03243.
DR   EnsemblGenomes-Gn; BLi03244.
DR   EnsemblGenomes-Gn; BLi03245.
DR   EnsemblGenomes-Gn; BLi03246.
DR   EnsemblGenomes-Gn; BLi03247.
DR   EnsemblGenomes-Gn; BLi03248.
DR   EnsemblGenomes-Gn; BLi03249.
DR   EnsemblGenomes-Gn; BLi03250.
DR   EnsemblGenomes-Gn; BLi03253.
DR   EnsemblGenomes-Gn; BLi03254.
DR   EnsemblGenomes-Gn; BLi03255.
DR   EnsemblGenomes-Gn; BLi03277.
DR   EnsemblGenomes-Gn; BLi03708.
DR   EnsemblGenomes-Gn; BLi04336.
DR   EnsemblGenomes-Gn; BLi04337.
DR   EnsemblGenomes-Gn; BLi04338.
DR   EnsemblGenomes-Gn; BLi04339.
DR   EnsemblGenomes-Gn; EBG00001011725.
DR   EnsemblGenomes-Gn; EBG00001011726.
DR   EnsemblGenomes-Gn; EBG00001011727.
DR   EnsemblGenomes-Gn; EBG00001011728.
DR   EnsemblGenomes-Gn; EBG00001011729.
DR   EnsemblGenomes-Gn; EBG00001011730.
DR   EnsemblGenomes-Gn; EBG00001011733.
DR   EnsemblGenomes-Gn; EBG00001011734.
DR   EnsemblGenomes-Gn; EBG00001011735.
DR   EnsemblGenomes-Gn; EBG00001011736.
DR   EnsemblGenomes-Gn; EBG00001011737.
DR   EnsemblGenomes-Gn; EBG00001011738.
DR   EnsemblGenomes-Gn; EBG00001011739.
DR   EnsemblGenomes-Gn; EBG00001011740.
DR   EnsemblGenomes-Gn; EBG00001011741.
DR   EnsemblGenomes-Gn; EBG00001011742.
DR   EnsemblGenomes-Gn; EBG00001011743.
DR   EnsemblGenomes-Gn; EBG00001011744.
DR   EnsemblGenomes-Gn; EBG00001011745.
DR   EnsemblGenomes-Gn; EBG00001011746.
DR   EnsemblGenomes-Gn; EBG00001011747.
DR   EnsemblGenomes-Gn; EBG00001011748.
DR   EnsemblGenomes-Gn; EBG00001011749.
DR   EnsemblGenomes-Gn; EBG00001011750.
DR   EnsemblGenomes-Gn; EBG00001011751.
DR   EnsemblGenomes-Gn; EBG00001011752.
DR   EnsemblGenomes-Gn; EBG00001011753.
DR   EnsemblGenomes-Gn; EBG00001011754.
DR   EnsemblGenomes-Gn; EBG00001011755.
DR   EnsemblGenomes-Gn; EBG00001011756.
DR   EnsemblGenomes-Gn; EBG00001011757.
DR   EnsemblGenomes-Gn; EBG00001011758.
DR   EnsemblGenomes-Gn; EBG00001011760.
DR   EnsemblGenomes-Gn; EBG00001011761.
DR   EnsemblGenomes-Gn; EBG00001011762.
DR   EnsemblGenomes-Gn; EBG00001011763.
DR   EnsemblGenomes-Gn; EBG00001011765.
DR   EnsemblGenomes-Gn; EBG00001011766.
DR   EnsemblGenomes-Gn; EBG00001011767.
DR   EnsemblGenomes-Gn; EBG00001011768.
DR   EnsemblGenomes-Gn; EBG00001011769.
DR   EnsemblGenomes-Gn; EBG00001011770.
DR   EnsemblGenomes-Gn; EBG00001011771.
DR   EnsemblGenomes-Gn; EBG00001011773.
DR   EnsemblGenomes-Gn; EBG00001011777.
DR   EnsemblGenomes-Gn; EBG00001011779.
DR   EnsemblGenomes-Gn; EBG00001011780.
DR   EnsemblGenomes-Gn; EBG00001011781.
DR   EnsemblGenomes-Gn; EBG00001011782.
DR   EnsemblGenomes-Gn; EBG00001011783.
DR   EnsemblGenomes-Gn; EBG00001011784.
DR   EnsemblGenomes-Gn; EBG00001011785.
DR   EnsemblGenomes-Gn; EBG00001011786.
DR   EnsemblGenomes-Gn; EBG00001011787.
DR   EnsemblGenomes-Gn; EBG00001011788.
DR   EnsemblGenomes-Gn; EBG00001011789.
DR   EnsemblGenomes-Gn; EBG00001011790.
DR   EnsemblGenomes-Gn; EBG00001011791.
DR   EnsemblGenomes-Gn; EBG00001011792.
DR   EnsemblGenomes-Gn; EBG00001011793.
DR   EnsemblGenomes-Gn; EBG00001011794.
DR   EnsemblGenomes-Gn; EBG00001011795.
DR   EnsemblGenomes-Gn; EBG00001011796.
DR   EnsemblGenomes-Gn; EBG00001011797.
DR   EnsemblGenomes-Gn; EBG00001011798.
DR   EnsemblGenomes-Gn; EBG00001011799.
DR   EnsemblGenomes-Gn; EBG00001011800.
DR   EnsemblGenomes-Gn; EBG00001011801.
DR   EnsemblGenomes-Gn; EBG00001011802.
DR   EnsemblGenomes-Gn; EBG00001011803.
DR   EnsemblGenomes-Gn; EBG00001011804.
DR   EnsemblGenomes-Gn; EBG00001011805.
DR   EnsemblGenomes-Gn; EBG00001011806.
DR   EnsemblGenomes-Gn; EBG00001011807.
DR   EnsemblGenomes-Gn; EBG00001011808.
DR   EnsemblGenomes-Gn; EBG00001011809.
DR   EnsemblGenomes-Gn; EBG00001011810.
DR   EnsemblGenomes-Gn; EBG00001011811.
DR   EnsemblGenomes-Gn; EBG00001011812.
DR   EnsemblGenomes-Gn; EBG00001011813.
DR   EnsemblGenomes-Gn; EBG00001011814.
DR   EnsemblGenomes-Gn; EBG00001011815.
DR   EnsemblGenomes-Gn; EBG00001011816.
DR   EnsemblGenomes-Gn; EBG00001011817.
DR   EnsemblGenomes-Gn; EBG00001011818.
DR   EnsemblGenomes-Gn; EBG00001011819.
DR   EnsemblGenomes-Gn; EBG00001011820.
DR   EnsemblGenomes-Gn; EBG00001011821.
DR   EnsemblGenomes-Gn; EBG00001011822.
DR   EnsemblGenomes-Gn; EBG00001011823.
DR   EnsemblGenomes-Gn; EBG00001011824.
DR   EnsemblGenomes-Gn; EBG00001011826.
DR   EnsemblGenomes-Gn; EBG00001011828.
DR   EnsemblGenomes-Gn; EBG00001011829.
DR   EnsemblGenomes-Gn; EBG00001011830.
DR   EnsemblGenomes-Gn; EBG00001011831.
DR   EnsemblGenomes-Gn; EBG00001011832.
DR   EnsemblGenomes-Gn; EBG00001011833.
DR   EnsemblGenomes-Gn; EBG00001011834.
DR   EnsemblGenomes-Gn; EBG00001011835.
DR   EnsemblGenomes-Gn; EBG00001011836.
DR   EnsemblGenomes-Gn; EBG00001011837.
DR   EnsemblGenomes-Gn; EBG00001011838.
DR   EnsemblGenomes-Gn; EBG00001011839.
DR   EnsemblGenomes-Gn; EBG00001011840.
DR   EnsemblGenomes-Gn; EBG00001011841.
DR   EnsemblGenomes-Gn; EBG00001011842.
DR   EnsemblGenomes-Gn; EBG00001011843.
DR   EnsemblGenomes-Gn; EBG00001011844.
DR   EnsemblGenomes-Gn; EBG00001011845.
DR   EnsemblGenomes-Gn; EBG00001011846.
DR   EnsemblGenomes-Gn; EBG00001011847.
DR   EnsemblGenomes-Gn; EBG00001011848.
DR   EnsemblGenomes-Gn; EBG00001011849.
DR   EnsemblGenomes-Gn; EBG00001011850.
DR   EnsemblGenomes-Gn; EBG00001011851.
DR   EnsemblGenomes-Gn; EBG00001011852.
DR   EnsemblGenomes-Gn; EBG00001011853.
DR   EnsemblGenomes-Gn; EBG00001011854.
DR   EnsemblGenomes-Gn; EBG00001011855.
DR   EnsemblGenomes-Gn; EBG00001011856.
DR   EnsemblGenomes-Gn; EBG00001011857.
DR   EnsemblGenomes-Gn; EBG00001011858.
DR   EnsemblGenomes-Gn; EBG00001011859.
DR   EnsemblGenomes-Gn; EBG00001011860.
DR   EnsemblGenomes-Gn; EBG00001011861.
DR   EnsemblGenomes-Gn; EBG00001011863.
DR   EnsemblGenomes-Gn; EBG00001011864.
DR   EnsemblGenomes-Gn; EBG00001011865.
DR   EnsemblGenomes-Gn; EBG00001011866.
DR   EnsemblGenomes-Gn; EBG00001011867.
DR   EnsemblGenomes-Gn; EBG00001011868.
DR   EnsemblGenomes-Gn; EBG00001011869.
DR   EnsemblGenomes-Gn; EBG00001011870.
DR   EnsemblGenomes-Gn; EBG00001011871.
DR   EnsemblGenomes-Gn; EBG00001011872.
DR   EnsemblGenomes-Gn; EBG00001011873.
DR   EnsemblGenomes-Gn; EBG00001011874.
DR   EnsemblGenomes-Gn; EBG00001011875.
DR   EnsemblGenomes-Gn; EBG00001011876.
DR   EnsemblGenomes-Gn; EBG00001011877.
DR   EnsemblGenomes-Gn; EBG00001011878.
DR   EnsemblGenomes-Gn; EBG00001011879.
DR   EnsemblGenomes-Gn; EBG00001011880.
DR   EnsemblGenomes-Gn; EBG00001011881.
DR   EnsemblGenomes-Gn; EBG00001011882.
DR   EnsemblGenomes-Gn; EBG00001011883.
DR   EnsemblGenomes-Tr; BLi00008-1.
DR   EnsemblGenomes-Tr; BLi00009-1.
DR   EnsemblGenomes-Tr; BLi00010-1.
DR   EnsemblGenomes-Tr; BLi00011-1.
DR   EnsemblGenomes-Tr; BLi00012-1.
DR   EnsemblGenomes-Tr; BLi00022-1.
DR   EnsemblGenomes-Tr; BLi00033-1.
DR   EnsemblGenomes-Tr; BLi00034-1.
DR   EnsemblGenomes-Tr; BLi00035-1.
DR   EnsemblGenomes-Tr; BLi00036-1.
DR   EnsemblGenomes-Tr; BLi00037-1.
DR   EnsemblGenomes-Tr; BLi00077-1.
DR   EnsemblGenomes-Tr; BLi00078-1.
DR   EnsemblGenomes-Tr; BLi00098-1.
DR   EnsemblGenomes-Tr; BLi00099-1.
DR   EnsemblGenomes-Tr; BLi00100-1.
DR   EnsemblGenomes-Tr; BLi00176-1.
DR   EnsemblGenomes-Tr; BLi00177-1.
DR   EnsemblGenomes-Tr; BLi00178-1.
DR   EnsemblGenomes-Tr; BLi00179-1.
DR   EnsemblGenomes-Tr; BLi00180-1.
DR   EnsemblGenomes-Tr; BLi00193-1.
DR   EnsemblGenomes-Tr; BLi00194-1.
DR   EnsemblGenomes-Tr; BLi00195-1.
DR   EnsemblGenomes-Tr; BLi00196-1.
DR   EnsemblGenomes-Tr; BLi00197-1.
DR   EnsemblGenomes-Tr; BLi00566-1.
DR   EnsemblGenomes-Tr; BLi00567-1.
DR   EnsemblGenomes-Tr; BLi00568-1.
DR   EnsemblGenomes-Tr; BLi00569-1.
DR   EnsemblGenomes-Tr; BLi00570-1.
DR   EnsemblGenomes-Tr; BLi00571-1.
DR   EnsemblGenomes-Tr; BLi00572-1.
DR   EnsemblGenomes-Tr; BLi00604-1.
DR   EnsemblGenomes-Tr; BLi00605-1.
DR   EnsemblGenomes-Tr; BLi00606-1.
DR   EnsemblGenomes-Tr; BLi00607-1.
DR   EnsemblGenomes-Tr; BLi00608-1.
DR   EnsemblGenomes-Tr; BLi00609-1.
DR   EnsemblGenomes-Tr; BLi00610-1.
DR   EnsemblGenomes-Tr; BLi00903-1.
DR   EnsemblGenomes-Tr; BLi00904-1.
DR   EnsemblGenomes-Tr; BLi00905-1.
DR   EnsemblGenomes-Tr; BLi00906-1.
DR   EnsemblGenomes-Tr; BLi00907-1.
DR   EnsemblGenomes-Tr; BLi00908-1.
DR   EnsemblGenomes-Tr; BLi00909-1.
DR   EnsemblGenomes-Tr; BLi00910-1.
DR   EnsemblGenomes-Tr; BLi00911-1.
DR   EnsemblGenomes-Tr; BLi00912-1.
DR   EnsemblGenomes-Tr; BLi00913-1.
DR   EnsemblGenomes-Tr; BLi00914-1.
DR   EnsemblGenomes-Tr; BLi00915-1.
DR   EnsemblGenomes-Tr; BLi00916-1.
DR   EnsemblGenomes-Tr; BLi00917-1.
DR   EnsemblGenomes-Tr; BLi00918-1.
DR   EnsemblGenomes-Tr; BLi00919-1.
DR   EnsemblGenomes-Tr; BLi00920-1.
DR   EnsemblGenomes-Tr; BLi00921-1.
DR   EnsemblGenomes-Tr; BLi00953-1.
DR   EnsemblGenomes-Tr; BLi01296-1.
DR   EnsemblGenomes-Tr; BLi02217-1.
DR   EnsemblGenomes-Tr; BLi02650-1.
DR   EnsemblGenomes-Tr; BLi02982-1.
DR   EnsemblGenomes-Tr; BLi03231-1.
DR   EnsemblGenomes-Tr; BLi03232-1.
DR   EnsemblGenomes-Tr; BLi03233-1.
DR   EnsemblGenomes-Tr; BLi03234-1.
DR   EnsemblGenomes-Tr; BLi03235-1.
DR   EnsemblGenomes-Tr; BLi03236-1.
DR   EnsemblGenomes-Tr; BLi03237-1.
DR   EnsemblGenomes-Tr; BLi03238-1.
DR   EnsemblGenomes-Tr; BLi03239-1.
DR   EnsemblGenomes-Tr; BLi03240-1.
DR   EnsemblGenomes-Tr; BLi03241-1.
DR   EnsemblGenomes-Tr; BLi03242-1.
DR   EnsemblGenomes-Tr; BLi03243-1.
DR   EnsemblGenomes-Tr; BLi03244-1.
DR   EnsemblGenomes-Tr; BLi03245-1.
DR   EnsemblGenomes-Tr; BLi03246-1.
DR   EnsemblGenomes-Tr; BLi03247-1.
DR   EnsemblGenomes-Tr; BLi03248-1.
DR   EnsemblGenomes-Tr; BLi03249-1.
DR   EnsemblGenomes-Tr; BLi03250-1.
DR   EnsemblGenomes-Tr; BLi03253-1.
DR   EnsemblGenomes-Tr; BLi03254-1.
DR   EnsemblGenomes-Tr; BLi03255-1.
DR   EnsemblGenomes-Tr; BLi03277-1.
DR   EnsemblGenomes-Tr; BLi03708-1.
DR   EnsemblGenomes-Tr; BLi04336-1.
DR   EnsemblGenomes-Tr; BLi04337-1.
DR   EnsemblGenomes-Tr; BLi04338-1.
DR   EnsemblGenomes-Tr; BLi04339-1.
DR   EnsemblGenomes-Tr; EBT00001537939.
DR   EnsemblGenomes-Tr; EBT00001537940.
DR   EnsemblGenomes-Tr; EBT00001537941.
DR   EnsemblGenomes-Tr; EBT00001537943.
DR   EnsemblGenomes-Tr; EBT00001537944.
DR   EnsemblGenomes-Tr; EBT00001537946.
DR   EnsemblGenomes-Tr; EBT00001537947.
DR   EnsemblGenomes-Tr; EBT00001537948.
DR   EnsemblGenomes-Tr; EBT00001537950.
DR   EnsemblGenomes-Tr; EBT00001537951.
DR   EnsemblGenomes-Tr; EBT00001537952.
DR   EnsemblGenomes-Tr; EBT00001537954.
DR   EnsemblGenomes-Tr; EBT00001537955.
DR   EnsemblGenomes-Tr; EBT00001537957.
DR   EnsemblGenomes-Tr; EBT00001537958.
DR   EnsemblGenomes-Tr; EBT00001537959.
DR   EnsemblGenomes-Tr; EBT00001537961.
DR   EnsemblGenomes-Tr; EBT00001537962.
DR   EnsemblGenomes-Tr; EBT00001537964.
DR   EnsemblGenomes-Tr; EBT00001537965.
DR   EnsemblGenomes-Tr; EBT00001537966.
DR   EnsemblGenomes-Tr; EBT00001537968.
DR   EnsemblGenomes-Tr; EBT00001537969.
DR   EnsemblGenomes-Tr; EBT00001537972.
DR   EnsemblGenomes-Tr; EBT00001537974.
DR   EnsemblGenomes-Tr; EBT00001537975.
DR   EnsemblGenomes-Tr; EBT00001537976.
DR   EnsemblGenomes-Tr; EBT00001537978.
DR   EnsemblGenomes-Tr; EBT00001537979.
DR   EnsemblGenomes-Tr; EBT00001537981.
DR   EnsemblGenomes-Tr; EBT00001537982.
DR   EnsemblGenomes-Tr; EBT00001537984.
DR   EnsemblGenomes-Tr; EBT00001537985.
DR   EnsemblGenomes-Tr; EBT00001537987.
DR   EnsemblGenomes-Tr; EBT00001537988.
DR   EnsemblGenomes-Tr; EBT00001537989.
DR   EnsemblGenomes-Tr; EBT00001537990.
DR   EnsemblGenomes-Tr; EBT00001537991.
DR   EnsemblGenomes-Tr; EBT00001537993.
DR   EnsemblGenomes-Tr; EBT00001537995.
DR   EnsemblGenomes-Tr; EBT00001537997.
DR   EnsemblGenomes-Tr; EBT00001537998.
DR   EnsemblGenomes-Tr; EBT00001537999.
DR   EnsemblGenomes-Tr; EBT00001538001.
DR   EnsemblGenomes-Tr; EBT00001538002.
DR   EnsemblGenomes-Tr; EBT00001538004.
DR   EnsemblGenomes-Tr; EBT00001538005.
DR   EnsemblGenomes-Tr; EBT00001538006.
DR   EnsemblGenomes-Tr; EBT00001538007.
DR   EnsemblGenomes-Tr; EBT00001538008.
DR   EnsemblGenomes-Tr; EBT00001538010.
DR   EnsemblGenomes-Tr; EBT00001538012.
DR   EnsemblGenomes-Tr; EBT00001538013.
DR   EnsemblGenomes-Tr; EBT00001538014.
DR   EnsemblGenomes-Tr; EBT00001538016.
DR   EnsemblGenomes-Tr; EBT00001538017.
DR   EnsemblGenomes-Tr; EBT00001538018.
DR   EnsemblGenomes-Tr; EBT00001538020.
DR   EnsemblGenomes-Tr; EBT00001538022.
DR   EnsemblGenomes-Tr; EBT00001538024.
DR   EnsemblGenomes-Tr; EBT00001538026.
DR   EnsemblGenomes-Tr; EBT00001538027.
DR   EnsemblGenomes-Tr; EBT00001538029.
DR   EnsemblGenomes-Tr; EBT00001538031.
DR   EnsemblGenomes-Tr; EBT00001538033.
DR   EnsemblGenomes-Tr; EBT00001538034.
DR   EnsemblGenomes-Tr; EBT00001538036.
DR   EnsemblGenomes-Tr; EBT00001538037.
DR   EnsemblGenomes-Tr; EBT00001538039.
DR   EnsemblGenomes-Tr; EBT00001538040.
DR   EnsemblGenomes-Tr; EBT00001538042.
DR   EnsemblGenomes-Tr; EBT00001538043.
DR   EnsemblGenomes-Tr; EBT00001538044.
DR   EnsemblGenomes-Tr; EBT00001538046.
DR   EnsemblGenomes-Tr; EBT00001538047.
DR   EnsemblGenomes-Tr; EBT00001538049.
DR   EnsemblGenomes-Tr; EBT00001538051.
DR   EnsemblGenomes-Tr; EBT00001538052.
DR   EnsemblGenomes-Tr; EBT00001538054.
DR   EnsemblGenomes-Tr; EBT00001538056.
DR   EnsemblGenomes-Tr; EBT00001538057.
DR   EnsemblGenomes-Tr; EBT00001538059.
DR   EnsemblGenomes-Tr; EBT00001538060.
DR   EnsemblGenomes-Tr; EBT00001538062.
DR   EnsemblGenomes-Tr; EBT00001538063.
DR   EnsemblGenomes-Tr; EBT00001538065.
DR   EnsemblGenomes-Tr; EBT00001538066.
DR   EnsemblGenomes-Tr; EBT00001538067.
DR   EnsemblGenomes-Tr; EBT00001538068.
DR   EnsemblGenomes-Tr; EBT00001538070.
DR   EnsemblGenomes-Tr; EBT00001538072.
DR   EnsemblGenomes-Tr; EBT00001538073.
DR   EnsemblGenomes-Tr; EBT00001538075.
DR   EnsemblGenomes-Tr; EBT00001538076.
DR   EnsemblGenomes-Tr; EBT00001538078.
DR   EnsemblGenomes-Tr; EBT00001538080.
DR   EnsemblGenomes-Tr; EBT00001538081.
DR   EnsemblGenomes-Tr; EBT00001538083.
DR   EnsemblGenomes-Tr; EBT00001538084.
DR   EnsemblGenomes-Tr; EBT00001538086.
DR   EnsemblGenomes-Tr; EBT00001538087.
DR   EnsemblGenomes-Tr; EBT00001538089.
DR   EnsemblGenomes-Tr; EBT00001538090.
DR   EnsemblGenomes-Tr; EBT00001538092.
DR   EnsemblGenomes-Tr; EBT00001538094.
DR   EnsemblGenomes-Tr; EBT00001538095.
DR   EnsemblGenomes-Tr; EBT00001538097.
DR   EnsemblGenomes-Tr; EBT00001538099.
DR   EnsemblGenomes-Tr; EBT00001538101.
DR   EnsemblGenomes-Tr; EBT00001538102.
DR   EnsemblGenomes-Tr; EBT00001538104.
DR   EnsemblGenomes-Tr; EBT00001538105.
DR   EnsemblGenomes-Tr; EBT00001538107.
DR   EnsemblGenomes-Tr; EBT00001538108.
DR   EnsemblGenomes-Tr; EBT00001538110.
DR   EnsemblGenomes-Tr; EBT00001538112.
DR   EnsemblGenomes-Tr; EBT00001538113.
DR   EnsemblGenomes-Tr; EBT00001538114.
DR   EnsemblGenomes-Tr; EBT00001538115.
DR   EnsemblGenomes-Tr; EBT00001538116.
DR   EnsemblGenomes-Tr; EBT00001538117.
DR   EnsemblGenomes-Tr; EBT00001538118.
DR   EnsemblGenomes-Tr; EBT00001538119.
DR   EnsemblGenomes-Tr; EBT00001538120.
DR   EnsemblGenomes-Tr; EBT00001538121.
DR   EnsemblGenomes-Tr; EBT00001538122.
DR   EnsemblGenomes-Tr; EBT00001538123.
DR   EnsemblGenomes-Tr; EBT00001538124.
DR   EnsemblGenomes-Tr; EBT00001538125.
DR   EnsemblGenomes-Tr; EBT00001538126.
DR   EnsemblGenomes-Tr; EBT00001538127.
DR   EnsemblGenomes-Tr; EBT00001538128.
DR   EnsemblGenomes-Tr; EBT00001538129.
DR   EnsemblGenomes-Tr; EBT00001538130.
DR   EnsemblGenomes-Tr; EBT00001538131.
DR   EnsemblGenomes-Tr; EBT00001538132.
DR   EnsemblGenomes-Tr; EBT00001538133.
DR   EnsemblGenomes-Tr; EBT00001538134.
DR   EnsemblGenomes-Tr; EBT00001538135.
DR   EnsemblGenomes-Tr; EBT00001538136.
DR   EnsemblGenomes-Tr; EBT00001538137.
DR   EnsemblGenomes-Tr; EBT00001538138.
DR   EnsemblGenomes-Tr; EBT00001538139.
DR   EnsemblGenomes-Tr; EBT00001538140.
DR   EnsemblGenomes-Tr; EBT00001538141.
DR   EnsemblGenomes-Tr; EBT00001538142.
DR   EnsemblGenomes-Tr; EBT00001538143.
DR   EuropePMC; PMC1393173; 16517658.
DR   EuropePMC; PMC2289816; 18307761.
DR   EuropePMC; PMC2632123; 19060158.
DR   EuropePMC; PMC2727956; 19707558.
DR   EuropePMC; PMC2772482; 19767427.
DR   EuropePMC; PMC3359204; 22420404.
DR   EuropePMC; PMC3728045; 23886069.
DR   EuropePMC; PMC3858371; 24348917.
DR   EuropePMC; PMC3871023; 24079885.
DR   EuropePMC; PMC4030025; 24885003.
DR   EuropePMC; PMC4121233; 25089821.
DR   EuropePMC; PMC4374763; 25811873.
DR   EuropePMC; PMC4746201; 28330118.
DR   EuropePMC; PMC4959183; 27208128.
DR   EuropePMC; PMC4982221; 27525040.
DR   EuropePMC; PMC5241413; 28101462.
DR   EuropePMC; PMC5503854; 28697584.
DR   EuropePMC; PMC5964695; 29788916.
DR   GOA; P86720.
DR   GOA; Q65MB1.
DR   InterPro; IPR023774; Put_metal_dep_hydrolase_YfiT.
DR   InterPro; IPR024775; DinB-like.
DR   InterPro; IPR027632; Lant_SP_1948.
DR   InterPro; IPR034660; DinB/YfiT-like.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00516; ylbH.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01410; BsrC.
DR   RFAM; RF01412; BsrG.
DR   RFAM; RF01487; rliI.
DR   RFAM; RF01690; Bacillaceae-1.
DR   RFAM; RF01735; epsC.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01820; RsaE.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02273; FsrA.
DR   SILVA-LSU; AE017333.
DR   SILVA-SSU; AE017333.
DR   StrainInfo; 29491; 1.
DR   UniProtKB/Swiss-Prot; P86720; LANLB_BACLD.
DR   UniProtKB/Swiss-Prot; Q65MB1; Y869_BACLD.
XX
FH   Key             Location/Qualifiers
FH
FT   source          order(1..1317753,1345263..1422555,1464175..4222645)
FT                   /organism="Bacillus licheniformis DSM 13 = ATCC 14580"
FT                   /focus
FT                   /strain="DSM 13"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:279010"
FT                   /culture_collection="ATCC:14580"
FT                   /culture_collection="DSM:13"
FT   source          1317754..1345262
FT                   /organism="Bacillus phage BLi_Pp2"
FT                   /mol_type="genomic DNA"
FT                   /note="PBSX homolog phage; inducible by mitomycin C,
FT                   deletion mutant is not inducible"
FT                   /db_xref="taxon:1230651"
FT   source          1422556..1464174
FT                   /organism="Bacillus phage BLi_Pp3"
FT                   /mol_type="genomic DNA"
FT                   /note="putative PBLD homologe phage; inducible by mitomycin
FT                   C after deletion of BLi_Pp2"
FT                   /db_xref="taxon:1230652"
FT   gene            311..1651
FT                   /gene="dnaA"
FT                   /locus_tag="BLi00001"
FT   CDS_pept        311..1651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="BLi00001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00001"
FT                   /db_xref="EnsemblGenomes-Tr:AAU38992"
FT                   /db_xref="GOA:Q65PM2"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PM2"
FT                   /protein_id="AAU38992.1"
FT                   /translation="MKNISDLWNQALGQIEKKLSKPSFETWMKSTKAHSLQGDTLIITA
FT                   PNEFARDWLESRYLHLIADTIYDLTGEELSIKFVIPQNQNEEDFMPKSPIKKMSKEEPA
FT                   DFPQNMLNPKYTFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHA
FT                   IGHYVIDHNPSAKVVYLSSEKFTNEFINSIRDNKAVDFRNRYRNVDVLLIDDIQFLAGK
FT                   EQTQEEFFHTFNTLHEETKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETR
FT                   IAILRKKAKAEGLDIPNEVMLYIANQIDSNIRELEGALIRVVAYSSLINKDINADLAAE
FT                   ALKDIIPSSKPKVITIKDIQRIVGQQFNIKLEDFKAKKRTKSVAFPRQIAMYLSREMTD
FT                   SSLPKIGEEFGGRDHTTVIHAHEKISKLLSDDEQLQQQIKEIKEQLR"
FT   gene            1828..2964
FT                   /gene="dnaN"
FT                   /locus_tag="BLi00002"
FT   CDS_pept        1828..2964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="BLi00002"
FT                   /product="DNA polymerase 3 beta subunit DnaN"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00002"
FT                   /db_xref="EnsemblGenomes-Tr:AAU38993"
FT                   /protein_id="AAU38993.1"
FT                   /translation="MKFTIQKDRLVESVQDVLKAVSSRTTIPILTGIKIVASDEGVSLT
FT                   GSDSDISIESFIPKEDGDLEIVTIEQPGSIVLQARFFSEIVKKLPMSTVEIEVQNQYLT
FT                   IIRSGKAEFNLNGLDASEYPLLPQIEEHHAFQIPTDLLKNLIRQTVFAVSTSETRPILT
FT                   GVNWNVTGGELICTATDSHRLALRKAKLDINEDSSYNVVIPGKSLTELSKILDDHQELV
FT                   DIVITETQVLFKTKNVLFFSRLLDGNYPDTNRLIPQESKTNLIVNTKEFLQAIDRASLL
FT                   AREGRNNVVKLSAAANESIEISSNSPEIGKVVETVNAEQIEGEDLKISFSPKYMLDALK
FT                   VLEGEDIHVSFTGAMRPFLIRTPNDDSIVQLILPVRTY"
FT   gene            3132..3347
FT                   /gene="yaaA"
FT                   /locus_tag="BLi00003"
FT   CDS_pept        3132..3347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaA"
FT                   /locus_tag="BLi00003"
FT                   /product="RNA-binding motif-containing protein YaaA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00003"
FT                   /db_xref="EnsemblGenomes-Tr:AAU38994"
FT                   /protein_id="AAU38994.1"
FT                   /translation="MTKTVAIDTEMITLGQFLKLADVIQSGGMAKWFLSEYEVLVNDEP
FT                   DNRRGRKLYVGDVVTIEGFGSFQVVG"
FT   gene            3364..4476
FT                   /gene="recF"
FT                   /locus_tag="BLi00004"
FT   CDS_pept        3364..4476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="BLi00004"
FT                   /product="DNA replication/repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00004"
FT                   /db_xref="EnsemblGenomes-Tr:AAU38995"
FT                   /db_xref="GOA:Q65PL9"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PL9"
FT                   /protein_id="AAU38995.1"
FT                   /translation="MYIQNLTLSSYRNYERLDLQFENKVNVIIGENAQGKTNLMEAIYV
FT                   LAMAKSHRTSNDKELIRWDEDYAKIEGRVIKKNGSVPIQLVISKKGKKGKVNHIEQQKL
FT                   SQYVGAVNTIMFAPEDLNLVKGSPQVRRRFLDMEIGQVSPVYLHDLSLYQKILSQRNHF
FT                   LKQLQTRKQTDQTMLDVLTEQLTEFAAKVVMKRLQFVDQLEKWAQPIHSGISRGLEELT
FT                   LKYHTSLHVSDSPDLSKMINSYQETFSKLRDKEIERGVSLSGPHRDDVLFYVNGRDVQT
FT                   YGSQGQQRTTALSLKLAEIDLIQEEIGEYPILLLDDVLSELDDYRQSHLLHTIQGRVQT
FT                   FVTTTSVDGIDHKTLNEAEIFRVENGTLSD"
FT   gene            4494..4736
FT                   /locus_tag="BLi00005"
FT   CDS_pept        4494..4736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00005"
FT                   /product="hypothetical protein"
FT                   /note="YaaB-like"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00005"
FT                   /db_xref="EnsemblGenomes-Tr:AAU38996"
FT                   /protein_id="AAU38996.1"
FT                   /translation="MYIHLGDDFVVSTREIVAIFDYKAKTSPIVEEFLSKQKQRIVSSN
FT                   STPKSIVVTLQSIYFSPLASGTLKKRAQSKPEIDS"
FT   gene            4796..6709
FT                   /gene="gyrB"
FT                   /locus_tag="BLi00006"
FT   CDS_pept        4796..6709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="BLi00006"
FT                   /product="DNA gyrase beta subunit GyrB"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00006"
FT                   /db_xref="EnsemblGenomes-Tr:AAU38997"
FT                   /protein_id="AAU38997.1"
FT                   /translation="MEQQNNYDENQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIV
FT                   DNSIDEALAGYCTEINVAIEKDNSITVKDNGRGIPVGIHEKMGRPAVEVIMTVLHAGGK
FT                   FDGSGYKVSGGLHGVGASVVNALSTELDVTVYRDGKIHYQEFERGVPKADLKVIGDTEV
FT                   TGTTTHFKPDPEIFTETTEYDYDTLATRVRELAFLTKGVKITIEDKREGKERKNEYCYE
FT                   GGIKSYVEHLNRSREVIHEEPVYIEGSKDGITVEVALQYNDSYTSNIYSFANNIHTYEG
FT                   GTHEAGFKTGLTRVINDYARRNGVFKESDPNLSGEDVREGLTAIISIKHPDPQFEGQTK
FT                   TKLGNSEARTITDALFSEALEKFLLENPDSAKKIVEKGVMAARARMAAKKARELTRRKS
FT                   ALEVSNLPGKLADCSSKDPTISELYIVEGDSAGGSAKQGRDRHFQAILPLRGKILNVEK
FT                   ARLDKILSNNEVRSMITALGTGIGEDFNLEKARYHKVVIMTDADVDGAHIRTLLLTFFY
FT                   RYMRQIIEQGYVYIAQPPLYKVQQGKRVEYAYNDQQLEEILKELPQNPKPGLQRYKGLG
FT                   EMNATQLWETTMDPETRTLLQVTLKDAIDADETFEMLMGDKVEPRRNFIEENARYVKNL
FT                   DI"
FT   gene            6900..9368
FT                   /gene="gyrA"
FT                   /locus_tag="BLi00007"
FT   CDS_pept        6900..9368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="BLi00007"
FT                   /product="DNA gyrase alpha subunit GyrA"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00007"
FT                   /db_xref="EnsemblGenomes-Tr:AAU38998"
FT                   /protein_id="AAU38998.1"
FT                   /translation="MSEQHKPQVQEVNISQEMRTSFLDYAMSVIVSRALPDVRDGLKPV
FT                   HRRILYAMNDLGMTSDKPYKKSARIVGEVIGKYHPHGDSAVYEAMVRMAQDFNYRYMLV
FT                   QGHGNFGSVDGDSAAAMRYTEARMSKISMEILRDINKDTIDYQDNYDGSEKEPVVMPAR
FT                   FPNLLVNGAAGIAVGMATNIPPHQLGEVIDGVLAVSKNPDITLPELMEIIPGPDFPTAG
FT                   LILGRSGIRKAYETGRGSITLRAKAQIEETSSGKPVIIITEIPYQVNKARLIEKIADLV
FT                   RDKKIDGITDLRDESDRNGMRIVIELRRDANANVLLNNLYKQTALQTSFGINLLALVDG
FT                   QPKVLSLKQCLEHYLDHQKVVIRRRTAFELRKAEARAHILEGLRVALDHLDEVISLIRN
FT                   SQTAEIAKNGLIEKFSLTEKQAQAILDMRLQRLTGLEREKIEEEYQSLVELIAELKAIL
FT                   ADEEKVLEIIREELTEVKERFNDERRTEIVTSGLETIEDEDLITRENIVVTLTHNGYIK
FT                   RLPSSTYRSQKRGGKGIQGMGTNEDDFVEHLISTSTHDTILFFSNKGKVYRAKGYEIPE
FT                   FGRTAKGIPIINLLEVEKGEWINAIIPVGEFDDESYLFFTTKHGISKRTPLSQFANIRN
FT                   NGLIALSLRDEDELIAVRLTDGNKQIIIGTKNGLLIRFPETDVRQMGRTAAGVKGINLT
FT                   DDDVVVGMEILEEDSHVLIVTEKGYGKLTPASEYRVQSRGGKGLKTCKITENNGSLVTV
FT                   KATTGEEDLMIITASGVIIRMDIKDISTTGRVTQGVRLIRLGEQEHVATVALVEKDEEN
FT                   DSEEQEADES"
FT   gene            9713..11250
FT                   /gene="rrsA"
FT                   /locus_tag="BLi00008"
FT   rRNA            9713..11250
FT                   /gene="rrsA"
FT                   /locus_tag="BLi00008"
FT                   /product="16S ribosomal RNA"
FT   gene            11358..11434
FT                   /gene="trnI1"
FT                   /locus_tag="BLi00009"
FT                   /note="tRNA-Ile-GAT"
FT   tRNA            11358..11434
FT                   /gene="trnI1"
FT                   /locus_tag="BLi00009"
FT                   /product="tRNA-Ile"
FT   gene            11446..11521
FT                   /gene="trnA1"
FT                   /locus_tag="BLi00010"
FT                   /note="tRNA-Ala-TGC"
FT   tRNA            11446..11521
FT                   /gene="trnA1"
FT                   /locus_tag="BLi00010"
FT                   /product="tRNA-Ala"
FT   gene            11594..14522
FT                   /gene="rrlA"
FT                   /locus_tag="BLi00011"
FT   rRNA            11594..14522
FT                   /gene="rrlA"
FT                   /locus_tag="BLi00011"
FT                   /product="23S ribosomal RNA"
FT   gene            14656..14770
FT                   /gene="rrfA"
FT                   /locus_tag="BLi00012"
FT   rRNA            14656..14770
FT                   /gene="rrfA"
FT                   /locus_tag="BLi00012"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(14785..15762)
FT                   /gene="yaaC"
FT                   /locus_tag="BLi00013"
FT   CDS_pept        complement(14785..15762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaC"
FT                   /locus_tag="BLi00013"
FT                   /product="YaaC"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00013"
FT                   /db_xref="EnsemblGenomes-Tr:AAU38999"
FT                   /protein_id="AAU38999.1"
FT                   /translation="MQDKGWKDLKLFYSVETAQHFLEMVYKNQGMEDAKKNSYKNGERF
FT                   IFFLKHAEAFYKQAKIATLEIKPILLFYGMAQLLKACLLMTDPSYPSHTSVLAHGVTTR
FT                   KRKKQNYRFYEDEVKIQRNGLCMHVIRSLFQLSGLEDERFNMKQLLARIPEINKVLAFQ
FT                   RKPNPIVKAAVEDRLIWLPSETPDAYNMSSKRFIEHVEYHLNWSFCREEKEGIIFSAAQ
FT                   KECRPSTSTTLLYDLEHGAYYFPAERDRFLKLPEILVHYLVAYNLSMIARYETEWWYDL
FT                   LLQSASDDYVIIQQFLHIVESKFPYYIAELLIRKKENNKKDQLI"
FT   gene            15884..17350
FT                   /gene="guaB"
FT                   /locus_tag="BLi00014"
FT   CDS_pept        15884..17350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="BLi00014"
FT                   /product="inosine-5'-monophosphate dehydrogenase GuaB"
FT                   /EC_number="1.1.1.205"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00014"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39000"
FT                   /protein_id="AAU39000.1"
FT                   /translation="MWESKFSKEGLTFDDVLLVPAKSEVLPRDVDLSVELTPSLKLNVP
FT                   IISAGMDTVTEAQMAIAMARQGGLGIIHKNMSIEQQAEQVDKVKRSERGVITNPFFLTP
FT                   EHQVFDAEHLMGKYRISGVPIVDNEEDQKLVGIITNRDLRFISDYSMKISDVMTKEELV
FT                   TAPVGTTLDEAEKILQKYKIEKLPLLDDQGVLKGLITIKDIEKVIEFPNSAKDVHGRLL
FT                   VGAAVGVTGDTMTRVRKLVEANVDVIVVDTAHGHSQGVLDTVKKIRDTYPELNIIAGNV
FT                   ATAEGTKALIEAGANVVKVGIGPGSICTTRVVAGVGVPQVTAIYDCATEARKHGAAIIA
FT                   DGGIKYSGDIVKALAAGGHAVMLGSLLAGTSESPGETEIYQGRRFKVYRGMGSVAAMEK
FT                   GSKDRYFQEENKKFVPEGIEGRTPYKGPVADTVYQLVGGLKSGMGYCGTKDLHALREDA
FT                   QFIRMTGAGLRESHPHDVQITKESPNYTIS"
FT   gene            17505..18830
FT                   /gene="dacA"
FT                   /locus_tag="BLi00015"
FT   CDS_pept        17505..18830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacA"
FT                   /locus_tag="BLi00015"
FT                   /product="D-alanyl-D-alanine carboxypeptidase DacA"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00015"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39001"
FT                   /protein_id="AAU39001.1"
FT                   /translation="MKSKRLKQLIMLIVAFAVTVGAFSPMSTAKAANDPINVDAKAAIL
FT                   VEASSGKILYSKNADQRLPVASMAKMMTEYLLLEAIHEGKVKWDQKYTPDDYVYEISQD
FT                   RSLSNVPLRKDGSYTVKELYQATAIYSANAAAIALSEIVAGSESKFVELMNKKAKELGM
FT                   KDFKFVNATGLENKDLHGKHPSGTNANEENEVSARDMALLADHLVSDYPEILDTASIAK
FT                   TKFRKGTDDEMDMPNWNFMLKGLVQQYEGVDGLKTGSTDSAGSCFTATAERNGMRVISV
FT                   VLNAKGDLHTARFKETKKMLDYAFENFTMKEFYAKGAQVKGNETVTVDKGKETEVGIVT
FT                   EKAFSMPVKNGEEKNYKAKVTLNKDELTAPVKKGEKVGTLTASYKGEEKDYGFLGSDVS
FT                   GVNLVTKEDDEKANWFILTMRSIGGFFAGIWNSIVEMVTGWF"
FT   gene            19017..19901
FT                   /gene="pdxS"
FT                   /locus_tag="BLi00016"
FT   CDS_pept        19017..19901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxS"
FT                   /locus_tag="BLi00016"
FT                   /product="pyridoxal-5'-phosphate synthase synthase subunit
FT                   PdxS"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00016"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39002"
FT                   /db_xref="GOA:Q65PL2"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PL2"
FT                   /protein_id="AAU39002.1"
FT                   /translation="MAQTGTDRVKRGMAEMQKGGVIMDVVNAEQAKIAEEAGAVAVMAL
FT                   ERVPADIRAAGGVARMADPTIVEEVMNAVSIPVMAKARIGHIVEARVLEALGVDYIDES
FT                   EVLTPADEEFHLNKNEFTVPFVCGCRDLGEATRRIAEGASMLRTKGEPGTGNIVEAVRH
FT                   MRKVNAQVRKVVGMSDDELMTEAKNLGAPYELLKEIKAEGRLPVVNFAAGGVATPADAA
FT                   LMMQLGADGVFVGSGIFKSDNPAKFAKAIVEATTHFTDYKLIAELSKELGTAMKGIEIS
FT                   NLLPEQRMQERGW"
FT   gene            19923..20513
FT                   /gene="pdxT"
FT                   /locus_tag="BLi00017"
FT   CDS_pept        19923..20513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxT"
FT                   /locus_tag="BLi00017"
FT                   /product="pyridoxal-5'-phosphate synthase glutaminase
FT                   subunit PdxT"
FT                   /EC_number="2.6.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00017"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39003"
FT                   /db_xref="GOA:Q65PL1"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PL1"
FT                   /protein_id="AAU39003.1"
FT                   /translation="MLTIGVLGLQGAVREHIRSIEACGAAGKVIKWPEELKEIDGLILP
FT                   GGESTTMRRLIDTYQFMKPLQEFAASGKPVFGTCAGLIILAKNIAGTNDAHLGVLDVTV
FT                   ERNSFGRQVDSFEADLTVKGLEGPFTGVFIRAPHILEAGADVEVLSEHNGRIVAAKQGN
FT                   LLGCSFHPELTDDHRMTKLFVEMVEKHKREAVV"
FT   gene            20841..22118
FT                   /gene="serS"
FT                   /locus_tag="BLi00018"
FT   CDS_pept        20841..22118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="BLi00018"
FT                   /product="seryl-tRNA ligase SerS"
FT                   /EC_number="6.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00018"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39004"
FT                   /db_xref="GOA:Q65PL0"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PL0"
FT                   /protein_id="AAU39004.1"
FT                   /translation="MLDVKLLRANFEEIKQKLAHRGEDLSDFDQFEELDTKRRELIVKV
FT                   EELKGKRNEVSQQVAALKREKKDADHLIKEMREVGEDIKKLDEELRTVESSLDKIMLSI
FT                   PNIPHESVPVGETEDDNVEVRKWGELPEFSFEPKPHWDIADQLDILDFERAGKVTGSRF
FT                   VFYKGLGARLERALYNFMLDLHVDEYGYTEVIPPYMVNRASMTGTGQLPKFEEDAFKIR
FT                   EEDYFLIPTAEVPITNLHRDEILSADELPINYAAFSACFRSEAGSAGRDTRGLIRQHQF
FT                   NKVELVKFVKPEDSYEELEKLTNQAEKVLQLLELPYRVMSMCTGDLGFTAAKKYDIEVW
FT                   IPSQNTYREISSCSNFEAFQARRANIRFRREAKGKPEHVHTLNGSGLAVGRTVAALLEN
FT                   YQQEDGSVIIPKALRPYMGNRDVIQP"
FT   gene            complement(22148..23278)
FT                   /gene="glxK"
FT                   /locus_tag="BLi05000"
FT   CDS_pept        complement(22148..23278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glxK"
FT                   /locus_tag="BLi05000"
FT                   /product="glycerate kinase GlxK"
FT                   /EC_number="2.7.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:BLi05000"
FT                   /db_xref="EnsemblGenomes-Tr:AFR74782"
FT                   /protein_id="AFR74782.1"
FT                   /translation="MKIVIAPDSFKESMTSLEAARSIEKGFKEILPDAEYVNIPVADGG
FT                   EGTVQALVDATGGDIVYQTVTGPLGKPVKAAYGLLGDGKTAVIEMAEASGLHLVPPEQR
FT                   NPLLTTTRGTGELILDAAEKGVSQIIIGLGGSATNDGGAGMASALGVKFLNRAGEEIEN
FT                   GGGALAEIAKIDVSGLDPKLKHIQFEAACDVDNPLTGPRGASAVFGPQKGANSEMTAHL
FT                   DQNLKHYAAAVKAELGCEIDSLPGAGAAGGLGAGLCAFLKAELKSGVDIVLDTLSFSER
FT                   IKGADLVITGEGKIDGQTVSGKTPAGVAKRACSENIPVIAFAGSLGEGCELVYDIGISA
FT                   LFSIVPGISSLENALADGSSNLTRCARNVAAVWSLE"
FT   gene            complement(23294..24562)
FT                   /gene="yojA"
FT                   /locus_tag="BLi00019"
FT   CDS_pept        complement(23294..24562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yojA"
FT                   /locus_tag="BLi00019"
FT                   /product="putative gluconate transporter YojA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00019"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39005"
FT                   /protein_id="AAU39005.1"
FT                   /translation="MDIQINAIGALCALVISIFLILKKVPPAYGMMIGALAGGLIGGAD
FT                   LIETTDLMIAGAKNMIPAVLRILAAGVLAGVLIQSGSAAVIAETIVNQIGEKRALLALT
FT                   LATAILTTVGVFVDVAVITVAPIALAIARRTFISKAAILLAMIGGGKAGNIMSPNPNAI
FT                   AASDAFHVPLTSVMAAGIIPAIFGLGATYLLAKRLSNKGTKVAANEIETQTAQQLPAFW
FT                   AAVSGPVVSILLLALRPAAGITIDPIIALPAGGLVTAIASGQAGKLRDFAASGLSKMSG
FT                   VAVMLLGTGTLAGIIANSKLNSLITDTLVGLGLPSFLLAPISGMLMSMATASTTAGTAV
FT                   ASSVFGPTLLDLGVAGLAGAAMIHAGATVLDHLPHGSFFHTTGGSVFMAMKERLKLIPY
FT                   ESVIGLILTIISTLIFGIFQFFI"
FT   gene            complement(24652..25770)
FT                   /gene="ysfB"
FT                   /locus_tag="BLi00020"
FT   CDS_pept        complement(24652..25770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ysfB"
FT                   /locus_tag="BLi00020"
FT                   /product="putative sugar diacid recognition protein YsfB"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00020"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39006"
FT                   /protein_id="AAU39006.1"
FT                   /translation="MNYLSKELAEEIVERTMSIIRHNINMMDENGVIIASGDRSRIGDE
FT                   HAGAKDALAAEKVISITPEECSALTGTKPGVNLPIVFHDEIIGVIGITGPPSEVSRYGE
FT                   LVKMAAELTVEQAFLTKQLTWDQRLREETVIQMIQGTDLASLDFFERAERLNIPLDGQR
FT                   TCLVFELPSADMKPAFIKKLEKHLTAKDLYANISLKEVAVILAGAPTKSRSDLFSAWNG
FT                   WLSQWKTVRGALGEQADQLQQLPFSYQSAKQTLKIAENNCSLYDYREFAIPVLLSKIEH
FT                   PDQEIHFQNIWDRLSQADQKGELTHTLLCYIEENGEIGETSSRLFIHRNTLNYRLRKIE
FT                   LATGCNPKRFDDLFKLYTAITLFSPFCANEQF"
FT   gene            complement(25800..26222)
FT                   /locus_tag="BLi00021"
FT   CDS_pept        complement(25800..26222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00021"
FT                   /product="putative cell proliferation coordinating protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00021"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39007"
FT                   /protein_id="AAU39007.1"
FT                   /translation="MWKHFISRLPQDYTLNRPIETGKLQKAEELLGVSFPDELVSLLKM
FT                   TNGINDTFGDHLIWPADRIIEENLDMRCTDCFKPFDCLLFIAGAGNGDLFAYSILNGSI
FT                   RKNDIYVWNHIDDSRIWVAPSLKSFIKGWIDGTITI"
FT   gene            26352..26444
FT                   /gene="trnS1"
FT                   /locus_tag="BLi00022"
FT                   /note="tRNA-Ser-TGA"
FT   tRNA            26352..26444
FT                   /gene="trnS1"
FT                   /locus_tag="BLi00022"
FT                   /product="tRNA-Ser"
FT   gene            complement(26577..27218)
FT                   /gene="dck"
FT                   /locus_tag="BLi00023"
FT   CDS_pept        complement(26577..27218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dck"
FT                   /locus_tag="BLi00023"
FT                   /product="deoxyadenosine/deoxycytidine kinase Dck"
FT                   /EC_number="2.7.1.74"
FT                   /EC_number="2.7.1.76"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00023"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39008"
FT                   /protein_id="AAU39008.1"
FT                   /translation="MSVYDIPKDAIITVAGTVGVGKSTLTKELAKRLGFKTSLEEVVNN
FT                   PYLEAFYQDFERWSFHLQIFFLAERFKEQKYIYESGGGFVQDRSIYEDTGIFAKMHADK
FT                   GTMSKVDYKTYTSLFEAMVMTPYFPRPDVLVYLEGDLETILDRIQKRGREMELLTDRSY
FT                   WEEMYTRYENWISGFNACPVVRVNIDEYDLFNNSASLDPIIEKISEAIQR"
FT   gene            complement(27215..27838)
FT                   /gene="dgk"
FT                   /locus_tag="BLi00024"
FT   CDS_pept        complement(27215..27838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgk"
FT                   /locus_tag="BLi00024"
FT                   /product="deoxyguanosine kinase Dgk"
FT                   /EC_number="2.7.1.113"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00024"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39009"
FT                   /protein_id="AAU39009.1"
FT                   /translation="MNTAPFIAVEGPIGAGKTTLASMLSEKLSLSLVKEIVEENPFLDK
FT                   FYDEKDEWSFQLEMFFLCNRYKQLEDTEKKYLHHHMPVVSDYHIYKNLIFAERTLEGKK
FT                   LEKYRKIYQLLTEDLPKPNVIIYIRASLPTLLERIKKRGRPFEQEMDKQYLEQLINDYE
FT                   AAIKQFKESDPPIPVIEINGDQEDFVISEAVFNRIADQVKEYIE"
FT   gene            complement(27925..29244)
FT                   /gene="yaaH"
FT                   /locus_tag="BLi00025"
FT   CDS_pept        complement(27925..29244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaH"
FT                   /locus_tag="BLi00025"
FT                   /product="glycoside hydrolase family protein YaaH"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00025"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39010"
FT                   /protein_id="AAU39010.1"
FT                   /translation="MRKEAFPIQIYVVKRGDTLYQIANRYRTTVNEIVATNEIPNPNRL
FT                   VVGQTIVIPIAGEFYEVRQGDTLASIGARFNISPAELARINRIQVSAVLPVGLLLYIPP
FT                   RPRRNIETNAYIEPRGESVSPALQQAAREASPYLTYLGAFSFQAKRDGTLEEPPLNNLK
FT                   EIADRHRTTMMMIVTNLENEAFSDELGRIILTDQNVKNRLLDNIVAAARRYGFKDIHFD
FT                   FEYLRPEDREAYNQFLRDARARFRQEGWLISTALAPKTRADQPGQWYEAHDYRAHGEIV
FT                   DFVVLMTYEWGYSGGPPMAVSPIGPVRDVIEYALTEMPASKIVMGQNLYGYDWTLPYTP
FT                   GGPLARAISPQRAIEIASENNAAIQYDETAQAPNFRYTDNAGKQHEVWFEDARSIQAKF
FT                   DLIRELNLRGISYWKLGLSFPQNWLLIADQFNVVKETFPS"
FT   gene            complement(29282..29824)
FT                   /gene="yaaI"
FT                   /locus_tag="BLi00026"
FT   CDS_pept        complement(29282..29824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaI"
FT                   /locus_tag="BLi00026"
FT                   /product="putative isochorismatase hydrolase YaaI"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00026"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39011"
FT                   /protein_id="AAU39011.1"
FT                   /translation="MSNSALIIVDIINDFQFDMGNVLSKKTRNITEHLLALKEHAAKMK
FT                   WPIIYINDHFGIWQADIAAIIKKCKNGRSEYIIDRLAPNDSDYFLIKPKHSAFYGTALE
FT                   TLLHELHVDHLIITGIAGNICVLFTANDAYMREYEITIPRDCIASNNEKDNKYALTMME
FT                   NVLFANITTAKAITSET"
FT   gene            29907..30395
FT                   /gene="tadA"
FT                   /locus_tag="BLi00027"
FT   CDS_pept        29907..30395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tadA"
FT                   /locus_tag="BLi00027"
FT                   /product="tRNA-specific adenosine deaminase TadA"
FT                   /EC_number="3.5.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00027"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39012"
FT                   /protein_id="AAU39012.1"
FT                   /translation="MRMTQDEFYMKEAVNEARKAEEKGEVPIGAVLVLDGEIIARAHNL
FT                   RETEQRSVAHAEMLVIEEACRKLGTWRLERAVLYVTLEPCPMCAGAAVLSRIDKVVFGA
FT                   SDPKGGCAGTLMNLLQEERFNHQAEVVSGVMEEECGRMLSDFFRKLRAKKKAEKQSEL"
FT   gene            30881..32581
FT                   /gene="dnaX"
FT                   /locus_tag="BLi00028"
FT   CDS_pept        30881..32581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="BLi00028"
FT                   /product="DNA polymerase 3 gamma/tau subunit DnaX"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00028"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39013"
FT                   /protein_id="AAU39013.1"
FT                   /translation="MSYQALYRVFRPQLFEDVVGQEHITKTLQNALLQKKFSHAYLFSG
FT                   PRGTGKTSAAKLFAKAVNCERAPVSEPCNECSACKGITNGSISDVIEIDAASNNGVDEI
FT                   RDIRDKVKFAPSAVTYKVYIIDEVHMLSIGAFNALLKTLEEPPEHCIFILATTEPHKIP
FT                   LTIISRCQRFDFKRITSQAIVGRMKKIVEAEQLKVQDGALDIIASAADGGMRDALSLLD
FT                   QAVSFSGEELTVDDALLITGAVSQHYIGKLASTLHEKNVSGALETLNELLQQGKDPAKL
FT                   IEDMIFYFRDMLLYQTAPDLEGVLEKVKVDEEFQTLSRQIPASDLYEMIDILNKSHQEM
FT                   KWTNHPRIFFEVAVVKLCQGPKAGASAAAQPEVDNLVNKVRQLEQEIERLKTQGVQVSS
FT                   APAQAKEASRPQKSIKSAYKAPVGRIHEILKDATRPDLEKLKGCWGQLLAQLKQQNKVS
FT                   HAALLNDSEPVAASSKAFVLAFKYEIHCKMVAEDNNGVRTNLEQILDGMLGGRIDIVGV
FT                   PEAQWGKIREEFLQDHQPEDSEANEPKEEDPLVAEAKKLFGAELIEIKE"
FT   gene            32608..32931
FT                   /gene="yaaK"
FT                   /locus_tag="BLi00029"
FT   CDS_pept        32608..32931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaK"
FT                   /locus_tag="BLi00029"
FT                   /product="DNA-binding protein YaaK"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00029"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39014"
FT                   /db_xref="GOA:Q65PK0"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PK0"
FT                   /protein_id="AAU39014.1"
FT                   /translation="MRGGMGNMQKMMKQMQKMQKDMQKAQEELAEKVLEGTAGGGMVTV
FT                   KVNGQKEVIDVIIKEEVVDPEDVEMLQDLVLAATNDALKKVDEVTNETMGKFTKGMNMP
FT                   GLF"
FT   gene            32945..33541
FT                   /gene="recR"
FT                   /locus_tag="BLi00030"
FT   CDS_pept        32945..33541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="BLi00030"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00030"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39015"
FT                   /db_xref="GOA:Q65PJ9"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PJ9"
FT                   /protein_id="AAU39015.1"
FT                   /translation="MQYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLSMKEDVVLDFAK
FT                   ALVNAKRNLTYCSVCGHITDQDPCYICEDTRRDKSVICVVQDPKDVIAMEKMKEYNGLY
FT                   HVLHGAISPMDGIGPEDIKIPELLKRLQDDQVTEVILATNPNIEGEATAMYISRLLKPS
FT                   GIKLSRIAHGLPVGGDLEYADEVTLSKALEGRREM"
FT   gene            33562..33786
FT                   /gene="yaaL"
FT                   /locus_tag="BLi00031"
FT   CDS_pept        33562..33786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaL"
FT                   /locus_tag="BLi00031"
FT                   /product="DUF2508 family protein YaaL"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00031"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39016"
FT                   /protein_id="AAU39016.1"
FT                   /translation="MGFLRKKKLRKEFDNKLVEQLIHQKEEWNRQKRLIENSLEPSPEV
FT                   LYELKVAEAKYFFYLREAKKRNLRIGSWK"
FT   gene            33851..34117
FT                   /gene="bofA"
FT                   /locus_tag="BLi00032"
FT   CDS_pept        33851..34117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bofA"
FT                   /locus_tag="BLi00032"
FT                   /product="pro-sigmaK processing inhibitor BofA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00032"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39017"
FT                   /protein_id="AAU39017.1"
FT                   /translation="MGSVIFIGAIVALVALLFFSKASFKPLRLIGRIAVRFVVGALFLF
FT                   CVNLFGESVGIHVPINIVTTGVSGLLGVPGVAALIVIKQFIAI"
FT   gene            34411..35948
FT                   /gene="rrsB"
FT                   /locus_tag="BLi00033"
FT   rRNA            34411..35948
FT                   /gene="rrsB"
FT                   /locus_tag="BLi00033"
FT                   /product="16S ribosomal RNA"
FT   gene            36056..36132
FT                   /gene="trnI2"
FT                   /locus_tag="BLi00034"
FT                   /note="tRNA-Ile-GAT"
FT   tRNA            36056..36132
FT                   /gene="trnI2"
FT                   /locus_tag="BLi00034"
FT                   /product="tRNA-Ile"
FT   gene            36144..36219
FT                   /gene="trnA2"
FT                   /locus_tag="BLi00035"
FT                   /note="tRNA-Ala-TGC"
FT   tRNA            36144..36219
FT                   /gene="trnA2"
FT                   /locus_tag="BLi00035"
FT                   /product="tRNA-Ala"
FT   gene            36292..39220
FT                   /gene="rrlB"
FT                   /locus_tag="BLi00036"
FT   rRNA            36292..39220
FT                   /gene="rrlB"
FT                   /locus_tag="BLi00036"
FT                   /product="23S ribosomal RNA"
FT   gene            39355..39469
FT                   /gene="rrfB"
FT                   /locus_tag="BLi00037"
FT   rRNA            39355..39469
FT                   /gene="rrfB"
FT                   /locus_tag="BLi00037"
FT                   /product="5S ribosomal RNA"
FT   gene            39637..39828
FT                   /gene="gin"
FT                   /locus_tag="BLi05001"
FT   CDS_pept        39637..39828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gin"
FT                   /locus_tag="BLi05001"
FT                   /product="forespore-specific protein Gin"
FT                   /note="inhibitor of SigG and of SigE"
FT                   /db_xref="EnsemblGenomes-Gn:BLi05001"
FT                   /db_xref="EnsemblGenomes-Tr:AFR74783"
FT                   /protein_id="AFR74783.1"
FT                   /translation="MSKSNHGETCIICEENKTEGIHLYTKFLCSDCEKKIVSTSTSDPE
FT                   YSDYVKKLKSLRTPPLYS"
FT   gene            40021..40638
FT                   /gene="xpaC"
FT                   /locus_tag="BLi00038"
FT   CDS_pept        40021..40638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xpaC"
FT                   /locus_tag="BLi00038"
FT                   /product="putative 5-bromo-4-chloroindolyl phosphate
FT                   hydrolysis protein XpaC"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00038"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39018"
FT                   /protein_id="AAU39018.1"
FT                   /translation="MKPILHFMIRATAASALSVLLWFTSFFAFNQTFLLSSAYAAGAWI
FT                   AVYLGGKWYGTYLFLKENQLTRREYAYIKQNLREAKLKIARLRKALFAVKNIQTIKQNL
FT                   EILRIVRKIYSITKNEPKRFYQVERFYYQSLDSIVELTEKHAFLASQPKRNANLEVSLS
FT                   ETRMMIDKLAKQLEDDLYDLLKTDIDHLEFELDVAKHSMKKS"
FT   gene            40654..41847
FT                   /gene="yaaN"
FT                   /locus_tag="BLi00039"
FT   CDS_pept        40654..41847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaN"
FT                   /locus_tag="BLi00039"
FT                   /product="YaaN"
FT                   /note="TelA family"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00039"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39019"
FT                   /protein_id="AAU39019.1"
FT                   /translation="MSEYKPSLHKTGAQLEFDDLLSDPFGQGEAPVSGVEEKLRGQQVN
FT                   LVDTLSEEKRRQAFQLAEQIDPKNHNSITLYGTQAQSKLLNFSHEMLEHVQKKDVGEIG
FT                   QVLSDLMKKLEQVSPDELKTEKRNFFSRLFGRVSHSVQEVLSRYQKTGAQIDRISVKLE
FT                   HSKSALINDNKMLERLYEKNKEYYEALNVYIAAGQLKLEELNHKTIPELKEKSKTEHHH
FT                   MAVQEVNDMIQFADRLEKRVYDLTLSRQITLQSAPQIRLIQHTNQVLAEKIQSSIMTAI
FT                   PLWKNQVAIALTLLRQRRAVEAQKQVSATTNELLLKNAEMLKANTIETAKENERGFIDI
FT                   ETLKQVQDNLIGTLEETLKIQEEGRSKRLQAEEEIRAMEDGLKAKLLDMKENQNRRS"
FT   gene            41910..43430
FT                   /gene="yaaO"
FT                   /locus_tag="BLi00040"
FT   CDS_pept        41910..43430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaO"
FT                   /locus_tag="BLi00040"
FT                   /product="putative Orn/Lys/Arg decarboxylase YaaO"
FT                   /EC_number="4.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00040"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39020"
FT                   /protein_id="AAU39020.1"
FT                   /translation="MQNVISASGSAWMPKKIEKMTKGSVYMKTPLYTALVNHAEGHHYS
FT                   FHVPGHHNGDVFFDEAKTFFETILKVDLTELTGLDDLHEPSGVIKEAQDLVSRLYGAEE
FT                   SFFLVNGSTVGNLAMILAVCQPGDTILVQRNCHKSVFHAIELSGAHPVFLTPEIDEAMA
FT                   VPTHILYETVEDAISQYPHAKGIVLTYPNYYGHAVDLKPIIEKAHQHDISVLVDEAHGA
FT                   HFVLGHPFPQSSLKAGADAVVQSAHKTLPAMTMGSYLHLNSGRINRDRLAYYLSVLQSS
FT                   SPSYPIMASLDIARAYAEDILKTNRTADIEKELINMREVFSQINGADIVEPADARIRQD
FT                   PLKLCIRSAYGHSGFELKSIFEANGIHPELADERQVLLILPLEGKNMPAPELISTISKD
FT                   MKDTAVRNDLPAGIGIPSEKVTALPYRKSKLSAFKKESVPFTEAAGRISAESVTPYPPG
FT                   IPLIMAGERITKETISRLTRLVDLNVHIQGSNQLKQKQLTVYIEEEKS"
FT   gene            43427..44065
FT                   /gene="tmk"
FT                   /locus_tag="BLi00041"
FT   CDS_pept        43427..44065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="BLi00041"
FT                   /product="thymidylate kinase Tmk"
FT                   /EC_number="2.7.4.9"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00041"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39021"
FT                   /db_xref="GOA:Q65PJ3"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PJ3"
FT                   /protein_id="AAU39021.1"
FT                   /translation="MNGLFITFEGPEGAGKTTILQAAADQLTKNGHSVLATREPGGIEI
FT                   SERIREVILNPSHTAMDPKTEALLYAAARRQHLVEKVKPALEEGKIVLCDRFIDSSLAY
FT                   QGYARGLGIDEVFSVNQFAIGSLMPNVTIYFDIDPEEGIKRIDLNDAREKNRLDLEKLH
FT                   FHQLVQKGYEEVMNRFPGRFRIVDASQSVELVLKRVNNIIEEALKENQL"
FT   gene            44141..44470
FT                   /gene="yaaQ"
FT                   /locus_tag="BLi00042"
FT   CDS_pept        44141..44470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaQ"
FT                   /locus_tag="BLi00042"
FT                   /product="DUF970 family protein YaaQ"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00042"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39022"
FT                   /protein_id="AAU39022.1"
FT                   /translation="MKLIIAVVQDQDSNRLLKALTDHNFRVTKLASTGGFLKSGNTTFM
FT                   LGVDDIRVDKALSLIKENGSKRDQLIAPVSPMGGNADSYVPYPVEVEVGGATVFVLPIE
FT                   QFHQF"
FT   gene            44482..44922
FT                   /gene="yaaR"
FT                   /locus_tag="BLi00043"
FT   CDS_pept        44482..44922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaR"
FT                   /locus_tag="BLi00043"
FT                   /product="DUF327 family protein YaaR"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00043"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39023"
FT                   /protein_id="AAU39023.1"
FT                   /translation="MKISQELRTMIEKQQTPPARGENVSASFKEKMNIQSGKLRVEQLT
FT                   MLLTDIEAFGKRLSKSRNFKDLARFKGLIKRFVKETVENGLTVENSRSFDLYGNSRTLS
FT                   IVKELDEKLVQLTEDLMDQEKSSIELLERIGEIKGLLINLYT"
FT   gene            44934..45923
FT                   /gene="holB"
FT                   /locus_tag="BLi00044"
FT   CDS_pept        44934..45923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="BLi00044"
FT                   /product="DNA polymerase 3 delta' subunit HolB"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00044"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39024"
FT                   /protein_id="AAU39024.1"
FT                   /translation="MATTWTEMQKLQPRVMKLLQNSIERNRLAHAYLFEGRKGTGKLDA
FT                   ATLLAKSFFCLEDGAEPCESCRNCQRIESGNHPDVHVVHPDGLSIKKGQIQALQEEFSK
FT                   TGLESHKKLYIISHADQMTVNAANSLLKFLEEPSSDTIAVLLTEQPQKLLDTIISRCQV
FT                   LSFQSLQPESIEKELVKQEVSPNIAALLSNMTNNLSEALELSRNDQFAESRAKVIKLYE
FT                   VLHQRKGHAFFYIQDQWMPFFKEKDHQEMGLDMLLFIYRDVLSIQLGHEDKILFQDLFQ
FT                   SLKQHALQTTQQRVTNQILAVLEAKKRLYSNVNAQGLMEHLVLMLQEG"
FT   gene            45926..46753
FT                   /gene="yaaT"
FT                   /locus_tag="BLi00045"
FT   CDS_pept        45926..46753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaT"
FT                   /locus_tag="BLi00045"
FT                   /product="stage 0 sporulation protein YaaT"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00045"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39025"
FT                   /protein_id="AAU39025.1"
FT                   /translation="MYNVIGVRFKKAGKIYYFDPNGFQIDKDSCVIVETVRGVEYGQVV
FT                   IANKKVDENDVVLPLRKVIRVADERDRLIVEENQEAALSAFDVCQKKVNEHGLEMKLVD
FT                   VEFTFDRNKVIFYFTADGRVDFRELVKDLASIFKTRIELRQIGVRDEAKMLGGIGPCGR
FT                   MLCCSTFLGDFEPVSIKMAKDQNLSLNPTKISGLCGRLMCCLKYENDEYETAKEQLPDI
FT                   GEVIATSSGPAKVVGLNILERILQVELTDCDKVVEYTWDELLQEGVVSAQTTD"
FT   gene            46768..47130
FT                   /gene="yabA"
FT                   /locus_tag="BLi00046"
FT   CDS_pept        46768..47130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabA"
FT                   /locus_tag="BLi00046"
FT                   /product="DNA replication initiation control protein YabA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00046"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39026"
FT                   /db_xref="GOA:Q65PI8"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PI8"
FT                   /protein_id="AAU39026.1"
FT                   /translation="MDKKELFDTVISLEEQIGSLYRQLGDLKQHIGEMIEENNHLQLEN
FT                   EHLRKRLEETDQRLKSVKSDEKEIKAEKTGHADIGEGHDNLARLYQEGFHICNIHYGSV
FT                   RKEGDCLFCLSFLNKK"
FT   gene            47195..47938
FT                   /gene="yabB"
FT                   /locus_tag="BLi00047"
FT   CDS_pept        47195..47938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabB"
FT                   /locus_tag="BLi00047"
FT                   /product="putative RNA methyltransferase YabB"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00047"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39027"
FT                   /protein_id="AAU39027.1"
FT                   /translation="MIQLKDDERLDYLLAEDMKIVQSPTVFAFSLDAVLLSKFAYVPIQ
FT                   KGNIIDLCTGNGIVPLLLSTRTKAAITGVEIQERLYDMALRSVEYNNLQKQIHLIRDDL
FT                   KNMPQVLGYNKADVVTCNPPYFKTPQKTEQNLNEHLAIARHEIYCTLEDVIRVSSKLLK
FT                   QGGKLALVHRPGRLLEIFELMKAFQIEPKRVQFVYPKKSKEANTILVEGIKDGRPDLKI
FT                   LPPLFVYDEQDQYTHEIRKILYGDE"
FT   gene            47925..48218
FT                   /gene="yazA"
FT                   /locus_tag="BLi00048"
FT   CDS_pept        47925..48218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yazA"
FT                   /locus_tag="BLi00048"
FT                   /product="GIY-YIG endonuclease family protein YazA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00048"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39028"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PI6"
FT                   /protein_id="AAU39028.1"
FT                   /translation="METNSHYFYVLSCRDGSLYAGYTNNIEKRLKTHNDGKGAKYTRAR
FT                   LPVKLHYAECFSTKREAMQAEYYFKKLSRKNKERYIEEKRREGVDYQPAKEF"
FT   gene            48232..49068
FT                   /gene="rsmI"
FT                   /locus_tag="BLi00049"
FT   CDS_pept        48232..49068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmI"
FT                   /locus_tag="BLi00049"
FT                   /product="putative S-adenosylmethionine-dependent
FT                   methyltransferase RsmI"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00049"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39029"
FT                   /protein_id="AAU39029.1"
FT                   /translation="MGMLYLVPTPIGNLEDMTFRAVSVLKEADIIAAEDTRQTKKLCHV
FT                   YEIETQLVSYHEHNKESSGHKILEWLKEGKNVALVSDAGMPTISDPGAEIVRDFIEMGG
FT                   YVVPLPGANAALTALIASGIAPQPFFFFGFLDRSKRERKKQLEALKNRQETMIFYESPH
FT                   RLKETLAAIREVFGNRQIALTRELTKKFEEFIRGSIEEALTWSEQEQVRGEFCLVIEGS
FT                   REETIEEAVWWEHLSEKEHVEHYISEGYPSKEAIKKTAVDRGVPKRKIYDAYHIQN"
FT   gene            complement(49117..49401)
FT                   /gene="abrB1"
FT                   /locus_tag="BLi00050"
FT   CDS_pept        complement(49117..49401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abrB1"
FT                   /locus_tag="BLi00050"
FT                   /product="transition state transcriptional regulator AbrB"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00050"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39030"
FT                   /protein_id="AAU39030.1"
FT                   /translation="MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIIL
FT                   KKYKPNMTCQVTGEVSDDNLKLAGGKLVLSPEGAEQIINEIQAQLQSQK"
FT   gene            49915..51903
FT                   /gene="metS"
FT                   /locus_tag="BLi00051"
FT   CDS_pept        49915..51903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metS"
FT                   /locus_tag="BLi00051"
FT                   /product="methionyl-tRNA ligase MetS"
FT                   /EC_number="6.1.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00051"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39031"
FT                   /protein_id="AAU39031.1"
FT                   /translation="MPQEKNTFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRLRGFD
FT                   VRYLTGTDEHGQKIQQTAEKENITPQELVDRAAEDIQQLWKKLDISNDDFIRTTEERHK
FT                   KVIEKVFQKLLDNGDIYLDEYEGWYSIPDETFYTETQLVDVERNEKGEVIGGKSPDSGH
FT                   PVELIKEESYFFRMGKYADRLLAFYEENPEFIQPESRKNEMINNFIKPGLEDLAVSRTT
FT                   FDWGIKVPGNPKHVIYVWIDALFNYITALGFNTENDENYQKYWPADVHLVGKEIVRFHT
FT                   IYWPIMLMALDLPLPKKVFAHGWLLMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLR
FT                   EVPFGSDGVFTPEGFVERINYDLANDLGNLLNRTVAMVNKYFDGRIQSYEGPVTAFDEP
FT                   LSSFSQKTIEAYEQAIENMEFSVALSSLWQFVSRTNKYIDETAPWVLAKDKDKEKELQS
FT                   VMYHLAESLRITAVLLQPFLTQTPEKIFAQLGVTDASLKTWDSIQSFGQLKSVTVQKGE
FT                   PLFPRLEAEDEVAYIKSKMQGTAPKEEPKQEEKAHERLPEITIDDFMSTELRVAEVIHA
FT                   EPVKKADRLLKLQLDLGFEKRQVVSGIAKHYKPEELVGRKVICVTNLKPVKLRGELSQG
FT                   MILAGEDNGVLSLAAVDSSLANGTRIK"
FT   gene            51988..52755
FT                   /gene="yabD"
FT                   /locus_tag="BLi00052"
FT   CDS_pept        51988..52755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabD"
FT                   /locus_tag="BLi00052"
FT                   /product="putative deoxyribonuclease YabD"
FT                   /EC_number="3.1.21.-"
FT                   /note="TatD-like"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00052"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39032"
FT                   /protein_id="AAU39032.1"
FT                   /translation="MLFDTHAHLNAEQFNEDLEEVIARAKEEKVEHIVVVGFDRPTIKR
FT                   AMELIEEYDFIYAAIGWHPVDAIDMTDEDLAWIKDLSAHEKVVAIGEMGLDYHWDKSPK
FT                   DVQKEVFRKQIALAKEVGLPIVIHNRDATEDVVSILREEGAEEVGGIMHCYTGSAEIAQ
FT                   ECIDMNFYLSFGGPVTFKNAKKPKEVVKQIPNDRLLIETDCPYLTPHPYRGKRNEPSYV
FT                   KLVAEQIAELKGMTYEEIAAVTTENAKKLFGIS"
FT   gene            52872..54197
FT                   /gene="yabE"
FT                   /locus_tag="BLi00053"
FT   CDS_pept        52872..54197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabE"
FT                   /locus_tag="BLi00053"
FT                   /product="YabE"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00053"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39033"
FT                   /protein_id="AAU39033.1"
FT                   /translation="MRWFSHNKRDGGLAEKIERRVDRLVDTLYNLPEEKEAFFIIQKMK
FT                   KLFSVKLSKSRWILIAAGLLVAGSGTAYGAHELAKQQVTISINGKKQDVRTNAKTVGEL
FT                   LKSLDIETRKEDHISPAEDTKLTANMNVEYVAAKPVHFTVDGQEKEIWTTAGTVGKLLK
FT                   DLNLELAEHDQIDPSVDKEITKDMKLTLQRAFKVTVKDAGKDKDLWTTSTTVADFLKHH
FT                   KISIKGDDEVKPALDKKLTKDQAIHITRIKKVTDVVEENIPFEVRKKEDDSLEKGKEKV
FT                   VQDGKHGKLKKHYAVVMKNGKEVSRELIKEETAAESKAKIIAVGTKQAAVAKVSANVSR
FT                   GNQSSGKEFYVSSTAYTASCNGCSGHTATGVNLKNNPGAKVIAVDPSVIPLGSKVHVEG
FT                   YGYAVAADTGSAIKGRKIDVFFPNKSTAYRWGNKRVKIKVLN"
FT   gene            54365..54925
FT                   /gene="rnmV"
FT                   /locus_tag="BLi00054"
FT   CDS_pept        54365..54925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnmV"
FT                   /locus_tag="BLi00054"
FT                   /product="ribonuclease M5"
FT                   /EC_number="3.1.26.8"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00054"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39034"
FT                   /protein_id="AAU39034.1"
FT                   /translation="MKIKEIIVVEGRDDTAKIKSAVDADTIETNGSAIGEDVIKRIRLA
FT                   QETRGVIILTDPDFPGEKIRKTIAEKVPGCKHAFLPKHLAKPKNKRGIGVEHASLEAIR
FT                   ECLMTVQEEMEATEPEIEARDLIEAGLIGGPLAKQRRERLGEILNIGYTNGKQLQKRLQ
FT                   MFQIKKSDYLSALDAVLREEEHE"
FT   gene            54918..55796
FT                   /gene="rsmA"
FT                   /locus_tag="BLi00055"
FT   CDS_pept        54918..55796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmA"
FT                   /locus_tag="BLi00055"
FT                   /product="dimethyladenosine transferase RsmA"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00055"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39035"
FT                   /db_xref="GOA:Q65PH9"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PH9"
FT                   /protein_id="AAU39035.1"
FT                   /translation="MNKDIATPIRTKEILNKYGFSFKKSLGQNFLIDTNILDRIVDHAG
FT                   VTERTGVIEIGPGIGALTEQLAKRAKKVTAFEIDQRLLPILEDTLSPYDNVTVIHQDVL
FT                   KADVRAVMDEQFQDCDEVMVVANLPYYVTTPIIMKLLEENLPLKGIVVMLQKEVADRMA
FT                   AKPSSKEYGSLSIAVQFYTEAKTVMNVPKTVFVPQPNVDSAVIRLTLRKEPAVAVQDAA
FT                   FFFQVVKASFAQRRKTLFNNLVNNLPNGKENKSKIERALQDSHIDGKRRGESLSIEEFA
FT                   VLSDRLREVLL"
FT   gene            55938..56837
FT                   /gene="yabG"
FT                   /locus_tag="BLi00056"
FT   CDS_pept        55938..56837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabG"
FT                   /locus_tag="BLi00056"
FT                   /product="sporulation-specific protease YabG"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00056"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39036"
FT                   /protein_id="AAU39036.1"
FT                   /translation="MCGVKSMQFKIGDMVVRKSYRRDILFRIIRIDQSANGEPVAVLHG
FT                   DEVRLIADAHLGDLEIVREAEWQMRKREEETRMKESLDLLRQDYKLLHDKHEYRATNQY
FT                   NNQQQYFHMPGRVLHLDGDSAYLKKCLALYEKIGVPVYGIHCYEKKMSSVIEELIDEYR
FT                   PDLLVITGHDAYSKQKGDINNLDAYRHSKDFIETVQKARRKIPHLDQLVIFAGACQSHF
FT                   ESLIRAGANFASSPSRVNIHALDPVYIVAKISFTPFMDRINVWEVLRNTLTREKGLGGI
FT                   ETRGVLRIGMPYKTKAND"
FT   gene            57062..57322
FT                   /gene="veg"
FT                   /locus_tag="BLi00057"
FT   CDS_pept        57062..57322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="veg"
FT                   /locus_tag="BLi00057"
FT                   /product="DUF1021 family protein Veg"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00057"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39037"
FT                   /protein_id="AAU39037.1"
FT                   /translation="MAKTLSDIKRSLDGHLGKRLTLKANGGRRKTIERSGILAETYPSV
FT                   FVIQLDQDENSFERVSYSYADILTETVELRFSDDKTSSVAL"
FT   gene            57479..57664
FT                   /gene="sspF"
FT                   /locus_tag="BLi00058"
FT   CDS_pept        57479..57664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspF"
FT                   /locus_tag="BLi00058"
FT                   /product="small acid-soluble spore protein SspF"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00058"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39038"
FT                   /protein_id="AAU39038.1"
FT                   /translation="MGRRRSIMSEEFKNELAKDLGFYDTVKTEGWGGIRARDAGNMVKR
FT                   AIELAEQHMAQNQQNH"
FT   gene            57962..58831
FT                   /gene="ispE"
FT                   /locus_tag="BLi00059"
FT   CDS_pept        57962..58831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="BLi00059"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
FT                   IspE"
FT                   /EC_number="2.7.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00059"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39039"
FT                   /db_xref="GOA:Q65PH5"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PH5"
FT                   /protein_id="AAU39039.1"
FT                   /translation="MRILEKAPAKINLSLDVRHKRPDGYHEVEMVMTTIDLADRVELTE
FT                   LAEDKVTVSSHNRFVPDDQRNLAYQAAMLMKERYGIKKGVSIFITKVIPVAAGLAGGSS
FT                   DAAAVFRGLNRLWDLKLSMNELAELGAEIGSDVSFCVHGGTALATGRGEKIRHIETPPH
FT                   CWVVLAKPTIGVSTAEVYKQLKVDEIEHPDVQGMIAAIEEKNFQKMCDKLGNVLESVTL
FT                   NMHPEVAMIKNQMKRFGADAVLMSGSGPTVFGLVQYESKVQRIYNGLRGFCDQVYAVRM
FT                   IGEQNELD"
FT   gene            58888..59721
FT                   /gene="purR"
FT                   /locus_tag="BLi00060"
FT   CDS_pept        58888..59721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purR"
FT                   /locus_tag="BLi00060"
FT                   /product="purine operon repressor PurR"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00060"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39040"
FT                   /protein_id="AAU39040.1"
FT                   /translation="MKFRRSGRLVDLTNYLLTHPHVLVPLTFFSERYQSAKSSISEDLT
FT                   IIKQTFEQQGIGTLQTVPGAAGGVKYIPKVKRDEAEEFVKSLGESLIDSERILPGGYLY
FT                   LTDILGKPSVLTKAGKIFASAFSDREIDVVMTVATKGIPLAYAVASYLDVPTVVVRKDN
FT                   KVTEGSTVSINYVSGSSNRIQTMSLAKRSLQTGSHVLIIDDFMKAGGTINGMINLLDEF
FT                   NAHVAGIGVLVEAQGVKERLVDEYMSLLTLSEIDMKEKKVEIQNGNFQRFFAENE"
FT   gene            59739..60116
FT                   /gene="yabJ"
FT                   /locus_tag="BLi00061"
FT   CDS_pept        59739..60116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabJ"
FT                   /locus_tag="BLi00061"
FT                   /product="purine operon regulator YabJ"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00061"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39041"
FT                   /protein_id="AAU39041.1"
FT                   /translation="MTKVVQTKEAPAAIGPYSQGIVVNNMFYSSGQIPLTPSGEMVTGD
FT                   ITEQTHQVFRNLKAVLKEAGASLETVVKATVFLADMNQFTEVNEVYGQYFDTHKPARSC
FT                   VEVARLPKDALVEIEVIALVK"
FT   gene            60296..60589
FT                   /gene="spoVG"
FT                   /locus_tag="BLi00062"
FT   CDS_pept        60296..60589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVG"
FT                   /locus_tag="BLi00062"
FT                   /product="putative septation protein SpoVG"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00062"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39042"
FT                   /db_xref="GOA:Q65PH2"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PH2"
FT                   /protein_id="AAU39042.1"
FT                   /translation="MEVTDVRLRRVNTDGRMRAIASITLDHEFVVHDIRVIDGNNGLFV
FT                   AMPSKRTPDGEFRDIAHPINSSTRGKIQDAVLNEYHRLGDVEEIEYEEIGAS"
FT   gene            60864..62264
FT                   /gene="glmU"
FT                   /locus_tag="BLi00063"
FT   CDS_pept        60864..62264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="BLi00063"
FT                   /product="bifunctional UDP-N-acetylglucosamine
FT                   pyrophosphorylase/glucosamine-1-phosphate
FT                   N-acetyltransferase GlmU"
FT                   /EC_number="2.7.7.23"
FT                   /EC_number="2.3.1.157"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00063"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39043"
FT                   /db_xref="GOA:Q65PH1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PH1"
FT                   /protein_id="AAU39043.1"
FT                   /translation="MDNRDNGGQYMDKRFAVVLAAGQGTRMKSKLYKVLHPVCGKPMVE
FT                   HVVDEARKLSLEKLVTIVGHGAEDVKKQLGEKSEYALQAEQLGTAHAVKQAKSILGSEK
FT                   GTTIVICGDTPLLTAETMEAMLTEHQKKAAKVTILTAVAEDPTGYGRIIRNENGDVAKI
FT                   VEHKDATEEERLVKEINTGTYCFDNEALFQTIEQVSNDNVQGEYYLPDVIEILKNQGET
FT                   VAAYQTVNFQETLGVNDRVALSQAEIYMKQRINKRHMQNGVSLIDPDNTYISPEAVIGR
FT                   DTVIYPGTVIKGRVVIGEDAVIGQNSELENSTVGSRTVIKQSVIVDSEVGDDVTIGPFA
FT                   HIRPDSKIGNEVRIGNFVEVKKSEFGDRSKASHLSYIGDAEIGTDVNLGCGSITVNYDG
FT                   KHKFKTKIENGAFIGCNSNLVAPVTIGEGAYVAAGSTITDDVPGRALSIARARQVNKED
FT                   YAENIHKK"
FT   gene            62285..63235
FT                   /gene="prs"
FT                   /locus_tag="BLi00064"
FT   CDS_pept        62285..63235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prs"
FT                   /locus_tag="BLi00064"
FT                   /product="ribose-phosphate pyrophosphokinase Prs"
FT                   /EC_number="2.7.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00064"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39044"
FT                   /protein_id="AAU39044.1"
FT                   /translation="MSKYEDDNLKIFSLNSNPGLAKEIADIVGVELGKSSVKRFSDGEV
FT                   QINIEESIRGCDCYVIQSTSAPVNEHIMELLIMVDALKRASAKTINIVMPYYGYARQDR
FT                   KARSREPITAKLVANLLETAGATRVIALDLHAPQIQGFFDIPIDHLMGVPILGNYFEEK
FT                   NFKDIVIVSPDHGGVTRARKLADRLKAPIAIIDKRRPKPNVAEVMNIIGHIEGKTAILI
FT                   DDIIDTAGTITLAANALVESGAEEVYACCTHPVLSGPAIERIDNSKIKELVVTNSIELP
FT                   EEKKIAKFKQLSVAPLLAEAIIRVHEKQSVSFLFD"
FT   gene            63316..63942
FT                   /gene="rplY"
FT                   /locus_tag="BLi00065"
FT   CDS_pept        63316..63942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplY"
FT                   /locus_tag="BLi00065"
FT                   /product="50S ribosomal protein L25"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00065"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39045"
FT                   /db_xref="GOA:Q65PG9"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PG9"
FT                   /protein_id="AAU39045.1"
FT                   /translation="MAILKAEERTDSRRSSLRRIRQSGYVPGVIYGRNLENKSVALDSI
FT                   ELLKILRAEGKNTIINLDINGDQHSVMVTELQTDPLKDSIVHADFKVVDMEAEMEATVP
FT                   VNLTGEAEGIKQGGVLQQPLYELSVTAKPKNIPQTIEVDISSLEVNDVLTVGDIPTKGD
FT                   YSYNHEPDEVVASILPPQKQEETEAESAAQDVEEPEKGTEEEKEE"
FT   gene            64059..64625
FT                   /gene="pth"
FT                   /locus_tag="BLi00066"
FT   CDS_pept        64059..64625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="BLi00066"
FT                   /product="peptidyl-tRNA hydrolase Pth"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00066"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39046"
FT                   /db_xref="GOA:Q65PG8"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PG8"
FT                   /protein_id="AAU39046.1"
FT                   /translation="MLVFAGLGNPGKTYENTRHNVGFMTIDELSKEWNIPLDKTKFNGQ
FT                   YGIGFVSGKKVLLVKPLTYMNLSGECLRPLLDYYEIPVDNLKVIYDDLDLPTGRIRLRT
FT                   KGSAGGHNGIKSTIQHLGTSEFNRIRIGIGRPVNGMKVVDYVLGAFTDEEEPAIKEAVR
FT                   QSAKACEASLEKPFLEVMNEFNAKV"
FT   gene            64682..64912
FT                   /gene="subA"
FT                   /locus_tag="BLi00067"
FT   CDS_pept        64682..64912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="subA"
FT                   /locus_tag="BLi00067"
FT                   /product="supressor SubA"
FT                   /note="suppressor of recU mutations"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00067"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39047"
FT                   /protein_id="AAU39047.1"
FT                   /translation="MALHYYCRHCGVKVGSLDHSYVNSEQLGFNHLTNDERNDMISYMD
FT                   NGDLHVKTICEDCQEALERNPDYHQYHSFIQ"
FT   gene            64977..68510
FT                   /gene="mfd"
FT                   /locus_tag="BLi00068"
FT   CDS_pept        64977..68510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="BLi00068"
FT                   /product="transcription-repair-coupling factor Mfd"
FT                   /EC_number="3.6.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00068"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39048"
FT                   /protein_id="AAU39048.1"
FT                   /translation="MNNIQSYITKSDDFKSIVNGLNEGLKEQLLAGLSGSARSLFTAAL
FT                   TKETRRPVFLITHNLYQAQKITDDLTGLIKDQPVLLYPVNELISSEIAVASPELRSQRL
FT                   DVLNRLASGETPIVVAPAAAVRRMLPPVEVWQNSQIHIETGRDIDTEQLLQKLVQMGYE
FT                   RTDMVAAPGEFSIRGGIIDVYSLTEENPVRIELFDTEVDSIRIFNTDDQRSLETRDEVT
FT                   IGPAKELIVRDEDRQRALEQIDQGLANSLKKLKLDKQKEILDQNIAEDKERLKEGHIGQ
FT                   EMVKYLSYFYEKPASLLDYFPKNTLLILDEISRIHEMEDQLQKEEAEWITSLLEEGKIL
FT                   HDTSMSFPFHSLISKQSRPILYYSLFLRHVQHTSPQNIVNVSSKQMQSFHGQMNVLKNE
FT                   IERFKKSKYTTVFLGDSKERVEKLASVLSDYDIEAAQADQDAALAQGQIYIMEGGLQSG
FT                   FELPMIKLAVITEEELFKKRVKKQARKQKLTNAERIKSYSELQIGDYVVHVNHGIGKYL
FT                   GIETLEINGIHKDYLNIHYQGSDKLYVPVDQIDQVQKYVGSEGKEPKLYKLGGSEWKRV
FT                   KKKVESSVQDIADDLIKLYAEREASKGYAFSPDHEMQREFEAAFPYQETEDQLRSIHEI
FT                   KRDMEKERPMDRLLCGDVGYGKTEVAIRAAFKAIADGKQVAILVPTTILAQQHYETILE
FT                   RFQDYPINIGLLSRFRTRKEANETIKGLKNGTVDIVIGTHRLLSKDVVYKDLGLLIIDE
FT                   EQRFGVTHKEKIKRIKANVDVLTLTATPIPRTLHMSMLGVRDLSVIETPPENRFPVQTY
FT                   VVEYNGALVREAIERELARGGQVYFLYNRVEDIERKAEEISMLVPDAKVTYAHGKMTEN
FT                   ELESVMLNFLEGESDVLVSTTIIETGVDIPNVNTLIVFDADKMGLSQLYQLRGRVGRSN
FT                   RVAYAYFTYRKDKVLTEVAEKRLQAIKEFTELGSGFKIAMRDLTIRGAGNLLGAQQHGF
FT                   IDSVGFDLYSQMLKEAIEARKGDAPQAEKFEPEIDLELDAYIPQTYVTDGKQKIDMYKR
FT                   FRAISTIEEKSELQDEMIDRFGEYPKEVEYLFAIAEAKVYAIKERVELIKQDKDAVRLT
FT                   IDEKASAEIDGQKLFELGSKYGRQIGLGMEGKKLKISIQVKNRKPEEWLETLLDILKGL
FT                   QNVKKQTIASS"
FT   gene            68648..69184
FT                   /gene="spoVT"
FT                   /locus_tag="BLi00069"
FT   CDS_pept        68648..69184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVT"
FT                   /locus_tag="BLi00069"
FT                   /product="stage V sporulation protein SpoVT"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00069"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39049"
FT                   /protein_id="AAU39049.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRDGEVI
FT                   LKKYSPISELGDFAKEYADALYDSMGHSVLICDRDVYIAVSGGSKKDYLNKSISDMVEK
FT                   AMDQRTSVLDGDAKTIQLIDGIDEEVASYTVGPIVANGDPIGAVVIFSKDQSIGEVEHK
FT                   AVETAAGFLARQMEQ"
FT   gene            69398..70990
FT                   /gene="yabM"
FT                   /locus_tag="BLi00070"
FT   CDS_pept        69398..70990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabM"
FT                   /locus_tag="BLi00070"
FT                   /product="YabM"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00070"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39050"
FT                   /protein_id="AAU39050.1"
FT                   /translation="MGFLKGQRQLLWQGAFVLSLAGILSKILSAVYRVPFQNIVGDVGF
FT                   YIFQQVYPMIGISVMLATSGFPVIISKLLNDYGSANRAKILRVSMLFLSAVGLGFFLLL
FT                   FAGAGAIAGFMGDPDLAGVIRAVSFSYLLLPFVSLLRGYFQGSERMLPTALSQIGEQTL
FT                   RVGAILVLTWWLVKSGFSLYDAGAGAAFGSLVGGLAAFFILAVFWAKREKKATAARMEA
FT                   GTGDILKQLCLYSVTICTAGLMLILIQLVDALHLYSLLAGQGMGELQAKHTKGVYDRGQ
FT                   PLLQLGTVFAASIATALVPSLTKAKKKGETAVLEEKIRYSLKMSFVIGTGAAAGLICIL
FT                   EPVNVMLFKNSDGTAALQIFSASILFASLAMTMTAVLQGLGNTCLPAVSVCCGFLVKAV
FT                   LNELLIPGFGISGAAFATMMSFAAVAGLNFFQLKRKGWIKLSEYRIAGVLLSAVIMSAA
FT                   LAVWLFAFEAAIPHKSRWISAAESLSAVFVGGVVFLSGIFTLRVFSEKELELVPFGSKL
FT                   LTLKRERGGRHGR"
FT   gene            70980..72449
FT                   /gene="yabN"
FT                   /locus_tag="BLi00071"
FT   CDS_pept        70980..72449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabN"
FT                   /locus_tag="BLi00071"
FT                   /product="putative nucleotide pyrophosphohydrolase YabN"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00071"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39051"
FT                   /protein_id="AAU39051.1"
FT                   /translation="MAGKITVVGLGAGDMNQLTLGVYKRLTQAEVLYVRTKDHPLIEDL
FT                   KKEIAEIHFFDEVYEKHDQFEDVYEEIVERLFEEAKQGDVLYAVPGHPFVAEKTVQLLL
FT                   ERRGAHQADVVVEGGHSFIDATLNALQIDPIDGFQFVDAVRFSADEVELRHHLIICQVY
FT                   DQMTASEVKLTLMEKLPDDYEVVIVTAAGSSMQDIRTVPLYELDRSVGINNLTSVYVPP
FT                   VKDEEILHQEFSMFRSVIRKLRGPDGCPWDRKQTHESLKKYLIEECYEVLEAIDEEDPD
FT                   HLVEELGDVMLQVLLHAQIGEDDGLFTIDDVIRGITAKMIRRHPHVFGEVSVRDEADVM
FT                   VNWEEIKKQEKQADDKSLLDDIPKPLPALSKANKLQKKAAKTGFDWSNVQDIWDKVQEE
FT                   MKEFSSEISEAEQHSKKMKEEFGDLLFALVNIGRFYKIEPEEALAMTNAKFYRRFTYIE
FT                   QSAKRMGKDLESMTLEEMDELWNEAKGIERS"
FT   gene            72456..72719
FT                   /gene="yabO"
FT                   /locus_tag="BLi00072"
FT   CDS_pept        72456..72719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabO"
FT                   /locus_tag="BLi00072"
FT                   /product="putative ribosomal RNA-binding protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00072"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39052"
FT                   /protein_id="AAU39052.1"
FT                   /translation="MRLDKFLKVSRLIKRRTLAKEVADQGRISINGQQAKASSVVKAGD
FT                   ELAVRFGQKLVTVKVNELKDTTKKEEAADMYTVLKEEKLGGE"
FT   gene            72796..73104
FT                   /gene="yabP"
FT                   /locus_tag="BLi00073"
FT   CDS_pept        72796..73104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabP"
FT                   /locus_tag="BLi00073"
FT                   /product="spore protein YabP"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00073"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39053"
FT                   /protein_id="AAU39053.1"
FT                   /translation="MNVYYDQHNPSGGASGPEHNVTMKGRKLLDISGVKQVESFDNEEF
FT                   LLETVMGMLAVRGENLQMKNLDVEKGVVSIKGRVLDLVYLDEQQGEKAKGFFSKLFK"
FT   gene            73101..73727
FT                   /gene="yabQ"
FT                   /locus_tag="BLi00074"
FT   CDS_pept        73101..73727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabQ"
FT                   /locus_tag="BLi00074"
FT                   /product="spore protein YabQ"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00074"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39054"
FT                   /protein_id="AAU39054.1"
FT                   /translation="MTLTTQFYTMLAMAGMGAWLGASLDTYTRFVVRSKTARWLLFLHD
FT                   FLFWVVQGLLFFYVLLSVNEGEFRIYIFLAVMLGFAAYQSLFKQVYIKLLEWMISFFIF
FT                   ISRLVSKMMRMMVFRPVVWTFQAILAIILFTMRNIYVLFRFFAVCLYKILKFAGYPIYF
FT                   ILYQCCRLLPAPVRGLLRRFLQKGAGFFEKGKKLFITIKAKLLKK"
FT   gene            73744..74121
FT                   /gene="divIC"
FT                   /locus_tag="BLi00075"
FT   CDS_pept        73744..74121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="divIC"
FT                   /locus_tag="BLi00075"
FT                   /product="cell division initiation protein DivIC"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00075"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39055"
FT                   /protein_id="AAU39055.1"
FT                   /translation="MNDPTRRNISQIQNEYKEQMERKQQQLKRKRRGLYRRLMVFGAVV
FT                   LLSAIVIVSSLWSQTSDISAKQEKKAELLKQLEQLEAKKSDLKDEIVKLKDEDYVAELA
FT                   RKDYYLSKDGEIIFKFEDKSK"
FT   gene            74201..74599
FT                   /gene="yabR"
FT                   /locus_tag="BLi00076"
FT   CDS_pept        74201..74599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabR"
FT                   /locus_tag="BLi00076"
FT                   /product="putative S1 RNA-binding domain protein YabR"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00076"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39056"
FT                   /protein_id="AAU39056.1"
FT                   /translation="MSIEVGSKLQGKVTGITNFGAFVELPGGSTGLVHISEVADNYVKD
FT                   INDHLKVGDQVEVKVINVEKDGKIGLSIKKAVDRPQSSRPARPKNDFRSKETFEQKMNK
FT                   FLKDSEDRLSSLKRNTESKRGGRGARRG"
FT   gene            74750..74823
FT                   /gene="trnM1"
FT                   /locus_tag="BLi00077"
FT                   /note="tRNA-Met-CAT"
FT   tRNA            74750..74823
FT                   /gene="trnM1"
FT                   /locus_tag="BLi00077"
FT                   /product="tRNA-Met"
FT   gene            74834..74905
FT                   /gene="trnE1"
FT                   /locus_tag="BLi00078"
FT                   /note="tRNA-Glu-TTC"
FT   tRNA            74834..74905
FT                   /gene="trnE1"
FT                   /locus_tag="BLi00078"
FT                   /product="tRNA-Glu"
FT   gene            75115..77604
FT                   /gene="spoIIE"
FT                   /locus_tag="BLi00080"
FT   CDS_pept        75115..77604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIE"
FT                   /locus_tag="BLi00080"
FT                   /product="serine phosphatase SpoIIE"
FT                   /EC_number="3.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00080"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39057"
FT                   /protein_id="AAU39057.1"
FT                   /translation="MEKAERRVNSPIAGPAVQKLYSWFGSMTKLMMQHLYSLFFYKGLI
FT                   YMVIGFLLGRAFILSEVIPFALPFFGAMLLIKKDKAFLACLALLAGALSISPQHSLFVL
FT                   AALFAFAICSKMTSLIIKDRVRTLPVVVFLAMAVTRCGFVYAEYGTVSGYHYIMAFVEA
FT                   GLSFILTLIFLQSLPIVTSKRAKQSLKIEEIICFMILIASVLTGLTGVSFQGMQAELIL
FT                   ARYVVLAFAFIGGASIGCTVGVVTGLILSLSNIGNLYQMSLLAFSGLLGGLLKEGKKFG
FT                   AAVGLLIGSLLISLYGEGSAELVPTLYESLIAIGLFLLTPQSITKKVAKYIPGTTEHAQ
FT                   EQQQYARKIRDVTAQKVDQFSNVFHALSESFATFYHSAPDDEGKEKEIDLFLSTVTEHS
FT                   CQSCYKKNKCWVQNFDKTYDLMKRVMQETEEKQYFKNRKLKKEFHQHCSKSKQVEALIE
FT                   DELTHFRANQTLKQKVHDSRRLVAEQLLGVSQVMADFSREIKREREQHFIQEEQIRDAL
FT                   QHFGIEIQQVEIYSLEQGNIDIEMSIPYCNGHGECEKIIAPMLSDILEEQIIVKAEQCA
FT                   GHPNGYCHVAFGSAKSYRVVTGAAHAAKGGGLVSGDSYNMMELGTGKYAAAISDGMGNG
FT                   ARAHFESNETIKLLEKILQSGIDEKVAIKTINSILSLRTTDEIYSTLDLSVIDLQDASC
FT                   KFLKIGSTPSFIKRGDQIIKVQASNLPIGIITEFDVDVVSEQLKAGDLLIMMSDGIFEG
FT                   PRHVENHDLWMKRKLKSLKTEEPQEIADLIMEEVIRTRSGLIEDDMTVIVIKLDHNTPK
FT                   WASIPAPAFFQKNQEIS"
FT   gene            77681..78418
FT                   /gene="yabS"
FT                   /locus_tag="BLi00081"
FT   CDS_pept        77681..78418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabS"
FT                   /locus_tag="BLi00081"
FT                   /product="YabS"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00081"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39058"
FT                   /protein_id="AAU39058.1"
FT                   /translation="MKKGHLNQILLLTDGCSNRGEDPQAMAAFAKEQGITVNVIGIMDE
FT                   HEMDQEAMKEVEGIALAGGGVHQVVYTSQLSQTVQMVTKKAMTQTLQGVVNSELKQILG
FT                   KHTEMDELPPDKRGEVMEVVDELGETVHLHVLVLVDTSASMNPKLPTVKEALIDLSISL
FT                   NSRIGENEFAMLIFPGKKQEVELVLDWTPKFESLSSIFSKLSAGGITPTGPAIREAIQH
FT                   FNKIGSRRRMLEDDEKRFDEFGG"
FT   gene            78387..79421
FT                   /gene="yabT"
FT                   /locus_tag="BLi00082"
FT   CDS_pept        78387..79421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabT"
FT                   /locus_tag="BLi00082"
FT                   /product="putative serine/threonine-protein kinase YabT"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00082"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39059"
FT                   /protein_id="AAU39059.1"
FT                   /translation="MKNASTSLAASLKPGAAVVGKWNNHSYKIIRQLGKGANGVVYLAD
FT                   SRKGRVALKVSDDSLSITSEVNVLKSFSKAQAKAMGPSFFDVDDMMVTGTGKKLSFYVM
FT                   EYIEGPLLLRYVNEKGEEWTPVLISQLLSSLSAIHREGWVFGDLKPENLIVTGPPPQIR
FT                   CIDVGGTTKEGRAIKEYTEFFDRGYWEFGTRKAEPSYDLFSVAMIMVNCAVKKEFKKTA
FT                   RPQEQLMSVIDGHPFLKRYKPVLASALKGSYRTADEMKGDLLEIGRPPRMQSSRQSRTA
FT                   RSSSASAPSQGLRHKRGTPQQQRLRSGRRKQRNPSKSGGVFETLLIVVSVLALYFAYIV
FT                   LFFI"
FT   gene            79524..80954
FT                   /gene="tilS"
FT                   /locus_tag="BLi00083"
FT   CDS_pept        79524..80954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tilS"
FT                   /locus_tag="BLi00083"
FT                   /product="tRNA(Ile)-lysidine synthase TilS"
FT                   /EC_number="6.3.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00083"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39060"
FT                   /db_xref="GOA:Q65PF4"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PF4"
FT                   /protein_id="AAU39060.1"
FT                   /translation="MKSIEDFMKKYELSFDGVTLIAGVSGGPDSMALLHALHHTVPASA
FT                   TLIAAHVDHMFRGEESERDMRFVQDYCEAEGIQCEAVQIDVLAFAAENNLNKQAAAREC
FT                   RYAFFQELMKRHRAEYLVLGHHGDDQVETMLMKMAKGTVGIGLAGIQPKRRFDSGWLLR
FT                   PFLKLSKDDLLAYCKENRIPFRTDPSNSEDDYTRNRFRHHVLPFLKKESEDVHKRFQSV
FT                   SEFLTEDELYLQALTKDKMNTVITSKSSSGVEISIERLLALPMPLQRRGVHLILNYLYE
FT                   NVPSAFSAHHIQVFLDWISQDGPSGSLDFPNGLKVAKSYHTCLFTFQRLQCENVSYHYE
FT                   ISGAGEEELILPGGSSLHVSGPGSTRKLQGNDVFATSPKQVQFPLYVRTRQNGDRVKLK
FT                   GMNGSKKVKDIFIDEKVPLSKRDSWPIVTDAVGNIIWIPGLKKTIFEELDVTNNDRIVL
FT                   QYRQHEKCRGLAKNETGY"
FT   gene            80938..81477
FT                   /gene="hprT"
FT                   /locus_tag="BLi00084"
FT   CDS_pept        80938..81477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hprT"
FT                   /locus_tag="BLi00084"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase
FT                   HprT"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00084"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39061"
FT                   /protein_id="AAU39061.1"
FT                   /translation="MKQDIENILISEEEIQKKVKELGATLTEEYSGKFPLAIGVLKGAM
FT                   PFMADLLKHIDTYLEMDFMDVSSYGSSTVSSGEVKIIKDLDTSVEGRDILIIEDIIDSG
FT                   LTLSYLVELFRYRKAKSIKIVTLLDKPSGRKADIKADYVGFEVPDAFVVGYGLDYAERY
FT                   RNLPYIGVLKPAVYES"
FT   gene            81574..83493
FT                   /gene="ftsH"
FT                   /locus_tag="BLi00085"
FT   CDS_pept        81574..83493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="BLi00085"
FT                   /product="ATP-dependent zinc metalloprotease FtsH"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00085"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39062"
FT                   /protein_id="AAU39062.1"
FT                   /translation="MNRVFRNTIFYLLILLVVIGVVSYFQTANPKTENMTYSDFVSNLE
FT                   NGKVENVSIQPVRGVYEVRGQLTTYEKDQYFLTHVPEGKGADQIIDQVKKTKIQIEPAQ
FT                   EANGWMTFFTTIIPFVIIFILFFFLLNQAQGGGSRVMNFGKSKAKLYTEEKKRVKFKDV
FT                   AGADEEKQELVEVVDFLKDPRKFAELGARIPKGVLLVGPPGTGKTLLAKACAGEAGVPF
FT                   FSISGSDFVEMFVGVGASRVRDLFENAKKNAPCLIFIDEIDAVGRQRGAGLGGGHDERE
FT                   QTLNQLLVEMDGFSANEGIIIIAATNRADILDPALLRPGRFDRQITVDRPDVKGREAVL
FT                   QVHARNKPLDESVNLKAIAMRTPGFSGADLENLLNEAALVAARQDKKKIDMRDIDEATD
FT                   RVIAGPAKKSRVISKKERNIVAYHEAGHTVIGLVLDEADMVHKVTIVPRGQAGGYAVML
FT                   PKEDRYFQTKPELLDKIVGLLGGRVAEEIIFGEVSTGAHNDFQRATGIARRMVTEFGMS
FT                   EKLGPLQFGQSQGGQVFLGRDFNNDQNYSDAIAYEIDKEIQRFIKECYERAKTILTENR
FT                   DKLELIAQTLLEVETLDAEQIKHLSEHGRLPDRTYSDDQEKTDDVKVNINKRDDEEKNE
FT                   DEKE"
FT   gene            83696..84472
FT                   /gene="coaX"
FT                   /locus_tag="BLi00086"
FT   CDS_pept        83696..84472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaX"
FT                   /locus_tag="BLi00086"
FT                   /product="type 3 pantothenate kinase CoaX"
FT                   /EC_number="2.7.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00086"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39063"
FT                   /db_xref="GOA:Q65PF1"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PF1"
FT                   /protein_id="AAU39063.1"
FT                   /translation="MLLVIDVGNTNTVLGIYHEGELEYHWRIETSRHKTEDEFGMLLRS
FT                   LFDYVGLMFDQIEGIIISSVVPPIMFSLERMCIKYFQIEPQIVGPGMKTGLNIKYDNPK
FT                   EVGADRIVNAVAAIHLYGSPLIVVDFGTATTYCYINERKEYMGGAIAPGITISTEALYS
FT                   RAAKLPRIEIARPDHIVGKSTVSAMQSGILYGYVGQVEGIVKRMKWQSKKNPKVIATGG
FT                   LASLIADESDCIDIVDPFLTLKGLELIYERNRVESV"
FT   gene            84484..85353
FT                   /gene="hslO"
FT                   /locus_tag="BLi00087"
FT   CDS_pept        84484..85353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="BLi00087"
FT                   /product="chaperonin HslO"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00087"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39064"
FT                   /db_xref="GOA:Q65PF0"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PF0"
FT                   /protein_id="AAU39064.1"
FT                   /translation="MDYLVKAIAYDGKVRAYAANTTETIHEAQRRHNTWPTASAALGRT
FT                   MTAAVMLGAMLKGEDKLTVKIEGGGPIGAIVADGNAKGDVRGYVSNPHVHFDLNEHGKL
FT                   DVRRAVGTSGTLSVVKDLGLRDLFTGQVEIVSGEIGEDFTYYLVSSEQVPSSVGVGVLV
FT                   NPDNTILAAGGFILQLLPGTDDETITKLETNLSQVEPISKLIQKGLTPEEVLAAVLGEE
FT                   PEVLETVPVRFTCNCSKERFARGIIGLGKDEIQQMIDEDGQAEAQCHFCNETYLFTKEE
FT                   LEALRDEI"
FT   gene            85406..86296
FT                   /gene="yacD"
FT                   /locus_tag="BLi00088"
FT   CDS_pept        85406..86296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacD"
FT                   /locus_tag="BLi00088"
FT                   /product="putative peptidyl-prolyl cis-trans isomerase
FT                   YacD"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00088"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39065"
FT                   /protein_id="AAU39065.1"
FT                   /translation="MKSRTLWPIILGAIFVNCIVIAYVLTKAQTASSSSAQEVIAHIGK
FT                   NGITREEWLSEMEERYGKSTLEDMINDRVVTQMAEKNKIKVSDDDIEREFLLIKAVYNS
FT                   FYEDENTTEKEWKEQIKHNILLEELLTKDIVISDSELKSFYNKNKDLYKFDDSYRLKHI
FT                   VVKDKDEAEQVLKELKEGSSFEAAAAEHSTDRYTAPYGGDLGFVNDQHENVPAEYLEKA
FT                   EQLKENQWVDEPIKTSQGYAIIQLKEKLPGQAFTYSEVKNQIRRQIAMDQLGDKASVKT
FT                   LWKDAKLSWFYDDKK"
FT   gene            86372..87295
FT                   /gene="cysK"
FT                   /locus_tag="BLi00089"
FT   CDS_pept        86372..87295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="BLi00089"
FT                   /product="trigger enzyme cysteine synthase CysK"
FT                   /EC_number="2.5.1.47"
FT                   /note="control of CymR activity"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00089"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39066"
FT                   /protein_id="AAU39066.1"
FT                   /translation="MVRVANSVYDLIGNTPVVKLNRLVDEDSAEVYVKLEYMNPGSSVK
FT                   DRIALAMIEDAEEKGLLKEGDTLIEPTSGNTGIGLAMVAAAKGIKAILVMPDTMSSERR
FT                   NLLRAYGAELVLTPGAEGMKGAIKKAEELAEEHGYFMPQQFNNPANAEVHRRTTGKEIA
FT                   EQFGDGLDAFIAGIGTGGTITGAGEVLKEKNPSIKIFAVEPTDSPVLSGGKPGPHKIQG
FT                   IGAGFVPKILNTEIYDEIITVKNEEAFEFARKAAREEGILGGISSGAAICAALQVAKKL
FT                   GKGKKVLAVLPSNGERYLSTPLYQFE"
FT   gene            87492..88925
FT                   /gene="pabB"
FT                   /locus_tag="BLi00090"
FT   CDS_pept        87492..88925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabB"
FT                   /locus_tag="BLi00090"
FT                   /product="para-aminobenzoate synthase subunit A"
FT                   /EC_number="2.6.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00090"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39067"
FT                   /protein_id="AAU39067.1"
FT                   /translation="MMRQRRPVARAFPFSNQQFLQQYESLSKGKEYHVLLESARGGEYS
FT                   IAGLDPVAIAKGKDGITTIQYKGDVIFKEGDPFLQFSQWFETLKTETVADFPDFQGGAV
FT                   GFLSYDYARYIEKFKILSIDDLQTPDLFFLVFDDIAVYDHEQQQLWVITHTDEETPAAA
FT                   EEKLDRLEQMWKTEHPKAAGGHQPNDNKGPAFAASFTEAGFSQAVEKVKQYIASGDVFQ
FT                   VNLSVRQSERLSAPPYEVYKMLREINPSPYMAYLETPDFQIICGSPELLIKKKGTRLET
FT                   RPIAGTRSRGADEAEDEALANELIMNEKERAEHVMLVDLERNDLGRVSKYGSVRVDEFM
FT                   VIEKYSHVMHIVSNVCGELRDECDAVDVIHAVFPGGTITGAPKVRTMEIIEELEPTRRG
FT                   LYTGSIGWFGYNQDMHFNIVIRTIYVKAGQAFMQSGAGIVIDSNPRHEYKESIKKALAM
FT                   KKALQLSEEEKKEQRRAEI"
FT   gene            88922..89506
FT                   /gene="pabA"
FT                   /locus_tag="BLi00091"
FT   CDS_pept        88922..89506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /locus_tag="BLi00091"
FT                   /product="bifunctional para-aminobenzoate synthase subunit
FT                   B/anthranilate synthase subunit 2 PabA"
FT                   /EC_number="2.6.1.85"
FT                   /EC_number="4.1.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00091"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39068"
FT                   /protein_id="AAU39068.1"
FT                   /translation="MILMIDNYDSFTYNLVQYLGELGEELVVKRNDEITLQEIEDMSPD
FT                   FLMISPGPCSPDEAGISLEAIRHFAGKIPIFGVCLGHQSIAQVFGGDVVRAERLMHGKT
FT                   SEISHDGLTVFKGLEHPLTATRYHSLIVKPDTLPDCFETSAWTEEGEIMAIRHKELPVE
FT                   GVQFHPESIMTAYGKEMLKNFIETYRKKVNA"
FT   gene            89503..90363
FT                   /gene="pabC"
FT                   /locus_tag="BLi00092"
FT   CDS_pept        89503..90363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabC"
FT                   /locus_tag="BLi00092"
FT                   /product="aminodeoxychorismate lyase PabC"
FT                   /EC_number="4.1.3.38"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00092"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39069"
FT                   /protein_id="AAU39069.1"
FT                   /translation="MIIYLNGQYVKEEEARLSPFDHGFLYGVGVFETFRLYEGKPFLLD
FT                   WHMDRLNNALEQLKIELELTKSEVLVILDRLLQLNQPQNLDARVRLNISAGPGGPGLFP
FT                   DSYKNPGVMVMMNPFQPASVPAEKEGVILQVRRNTPEGPFRLKSHHFLNNLYGKRELGH
FT                   DAAKEGIFLTEGGAVAEGIISNVFWRKGSCVYTPSLDTGILGGVTRRYVIERLADMGIE
FT                   VIEGVYPLEELLFADEAWMTNSVQEIVPFRRIGSTEFPGKDGNLSKRLQEAYTNDRKAA
FT                   KEYLS"
FT   gene            90376..91233
FT                   /gene="sul"
FT                   /locus_tag="BLi00093"
FT   CDS_pept        90376..91233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sul"
FT                   /locus_tag="BLi00093"
FT                   /product="dihydropteroate synthase Sul"
FT                   /EC_number="2.5.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00093"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39070"
FT                   /protein_id="AAU39070.1"
FT                   /translation="MALQTAVRSKQLIAKQYTLSYEDKTLIMGILNVTPDSFSDGGKYN
FT                   SIDRAVIHAKQMIEDGAHILDIGGESTRPGAEKVSLDEELSRVIPVIEKLVQEIDVPIS
FT                   VDTYKAQVADEAIKAGAAIINDVWGAKADPDMARVAAAHNVPIILMHNREERNYKDLIP
FT                   DMLSDLMECVSIAKSAGVQDHHIVLDPGIGFAKTYHDNLAVMNQLEKFSEPGYPVLLGT
FT                   SRKKFIGRVLDLPPEERAEGTGATVCLGIQKGCDIVRVHDVKQISRMAKMMDAMIDKGG
FT                   VYHR"
FT   gene            91205..91588
FT                   /gene="folB"
FT                   /locus_tag="BLi00094"
FT   CDS_pept        91205..91588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="BLi00094"
FT                   /product="dihydroneopterin aldolase FolB"
FT                   /EC_number="4.1.2.25"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00094"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39071"
FT                   /protein_id="AAU39071.1"
FT                   /translation="MIKEAFIIDKVHVEGMEFYGYHGVFKEENKLGQRFRVDLTAFLDL
FT                   SEAGKTDNIEATINYAELYKLCKEVVEGEPVNLVETLAETIAAQVLENFEAVQECTVKV
FT                   VKPDPPIPGHYKSVAIEMTRKRK"
FT   gene            91585..92085
FT                   /gene="folK"
FT                   /locus_tag="BLi00095"
FT   CDS_pept        91585..92085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="BLi00095"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase FolK"
FT                   /EC_number="2.7.6.3"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00095"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39072"
FT                   /protein_id="AAU39072.1"
FT                   /translation="MNNTAYIALGSNIGRREEYLKKAVSLLHQHPSVEVTDISSIYETD
FT                   PVGYTDQDLFLNMAAAVKTSLSPFELLDLTQRIEKELGRKRDIRWGPRTADLDILLYNR
FT                   ENIETEQLIVPHPRMHERLFVLIPLLEIYPDLEGAVNHAKNQEGVRVWKQKSGVDEFVH
FT                   IES"
FT   gene            92263..93264
FT                   /gene="yacF"
FT                   /locus_tag="BLi00096"
FT   CDS_pept        92263..93264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacF"
FT                   /locus_tag="BLi00096"
FT                   /product="putative dihydrouridine synthase protein YacF"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00096"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39073"
FT                   /protein_id="AAU39073.1"
FT                   /translation="MFKIGDIELKNRVVLAPMAGVCNSAFRLTVKEFGAGLVCAEMVSD
FT                   KAILYNNAKTMGMLYIDEREKPLSLQIFGGEKETLVEAAKFVDQNTTADIIDINMGCPV
FT                   PKITKCDAGAKWLLDPNKIYEMVSAVVEAVDKPVTVKMRMGWDEDHIFAVENARAVERA
FT                   GGKAVALHGRTRVQMYEGTANWDIIKEVKQSVSIPVIGNGDVKTPQDAKRMLDETGVDG
FT                   VMIGRAALGNPWMIYRTVHYLETGELKDEPKVREKISVCKLHLDRLIGLKGENVAVREM
FT                   RKHAAWYLKGIRGNAKVRNEINHCETRDELVQLLDAFTIEAEAKELQDAKVG"
FT   gene            93349..94848
FT                   /gene="lysS"
FT                   /locus_tag="BLi00097"
FT   CDS_pept        93349..94848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="BLi00097"
FT                   /product="lysyl-tRNA ligase LysS"
FT                   /EC_number="6.1.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00097"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39074"
FT                   /protein_id="AAU39074.1"
FT                   /translation="MSHEEHNHEELNDQLQVRRDKMNQLRESGKDPFGQRFDRTHQSTD
FT                   LIESYNEFSKEELEEKAIEVTIAGRMMTKRGKGKAGFAHIQDLKGQIQIYVRKDSVGEE
FT                   QYEWFKSSDLGDIVGVTGVMFKTNVGELSVKATSFDLLTKALRPLPDKYHGLKDIEQRY
FT                   RQRYLDLIVNPESKNTFITRSKIIQSMRRYLDDHGYLEVETPTMHAIPGGASARPFITH
FT                   HNALDMPLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYA
FT                   DYKDIMRLTENLIAHIAQEVLGTTTVQYGDYEVDLKPEWKRLHMVDAVKEATGVDFWKE
FT                   VSVEEARAYAKEHGIEISEGMSVGHIINEFFEQKVEETLIQPTFIYGHPVEISPLAKKN
FT                   PEDPRFTDRFELFIVGREHANAFTELNDPIDQKERFEAQLKEREEGNDEAHMMDEDFVE
FT                   ALEYGMPPTGGLGIGIDRLIMLLTNSPSIRDVLLFPQMRHR"
FT   gene            95153..96691
FT                   /gene="rrsC"
FT                   /locus_tag="BLi00098"
FT   rRNA            95153..96691
FT                   /gene="rrsC"
FT                   /locus_tag="BLi00098"
FT                   /product="16S ribosomal RNA"
FT   gene            96873..99801
FT                   /gene="rrlC"
FT                   /locus_tag="BLi00099"
FT   rRNA            96873..99801
FT                   /gene="rrlC"
FT                   /locus_tag="BLi00099"
FT                   /product="23S ribosomal RNA"
FT   gene            99936..100050
FT                   /gene="rrfC"
FT                   /locus_tag="BLi00100"
FT   rRNA            99936..100050
FT                   /gene="rrfC"
FT                   /locus_tag="BLi00100"
FT                   /product="5S ribosomal RNA"
FT   gene            100226..100690
FT                   /gene="ctsR"
FT                   /locus_tag="BLi00101"
FT   CDS_pept        100226..100690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctsR"
FT                   /locus_tag="BLi00101"
FT                   /product="transcriptional regulator CtsR"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00101"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39075"
FT                   /protein_id="AAU39075.1"
FT                   /translation="MGKNISDIIEQYLKQILEQNGKEILEIKRSEIADKFQCVPSQINY
FT                   VINTRFTSERGYIVESKRGGGGYIRIIKIKMNDKIDLINNIMNQIYTRLSQAASDDIIL
FT                   RLLENGVITESEAKLMVSVMDRSVLYIDLPERDELRARMMKAMLTSLKFK"
FT   gene            100705..101259
FT                   /gene="mcsA"
FT                   /locus_tag="BLi00102"
FT   CDS_pept        100705..101259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcsA"
FT                   /locus_tag="BLi00102"
FT                   /product="modulator McsA"
FT                   /note="of CtsR"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00102"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39076"
FT                   /protein_id="AAU39076.1"
FT                   /translation="MICQECKERPATFHFTKVINGEKKEMHICEQCAKENSESYSMNES
FT                   GGFSIHNLLSGLLNFDSSFTNSSEAQLFQQPDQVLRCKKCNMTFPEFRKTGRFGCSECY
FT                   KTFHSYITPVLRKVHSGNTVHAGKIPKRIGGNLHVRRQIEALKKELKELIQQEEFEKAA
FT                   NIRDQIRSLEQNLNANKEEED"
FT   gene            101259..102350
FT                   /gene="mcsB"
FT                   /locus_tag="BLi00103"
FT   CDS_pept        101259..102350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcsB"
FT                   /locus_tag="BLi00103"
FT                   /product="modulator McsB"
FT                   /EC_number="2.7.3.3"
FT                   /note="'of CtsR repression, arginine or creatine kinase'"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00103"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39077"
FT                   /db_xref="GOA:Q65PD7"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PD7"
FT                   /protein_id="AAU39077.1"
FT                   /translation="MSLQHFIQNALSNWMRQEGPESDIVLSSRIRLARNLDKVRFPTLF
FT                   SNEEASAIIALFEEQFTGYEVPGIGKFELVKMDQVQPLEKRVLVEKHLISPHLTEASFG
FT                   ACLLSENEEVSIMLNEEDHIRIQCLFPGFQLSEALKAANQVDDWIEDRIDYAFSEQRGY
FT                   LTSCPTNVGTGLRASVMMHLPALVLTRQINRIIPAINQLGLVVRGIYGEGSEALGNIFQ
FT                   ISNQITLGKSEHDIVEDLNSVVAQLIEQERSARKALYQTSQIELEDRVYRSYGVLSNCR
FT                   MIESKETARCLSDVRLGIDLGIIKGLSSNILNELMILTQPGFLQQYSGGALRPNERDIR
FT                   RAALIRERLKLENNGNRQEDETI"
FT   gene            102347..104779
FT                   /gene="clpC"
FT                   /locus_tag="BLi00104"
FT   CDS_pept        102347..104779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpC"
FT                   /locus_tag="BLi00104"
FT                   /product="ATP-dependent Clp protease ATP-binding subunit
FT                   ClpC"
FT                   /note="ATPase subunit of the ClpC-ClpP protease, involved
FT                   in competence development, heat shock regulation, motility,
FT                   sporulation, protein quality control, biofilm formation"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00104"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39078"
FT                   /protein_id="AAU39078.1"
FT                   /translation="MMFGRFTERAQKVLALAQEEALRLGHNNIGTEHILLGLVREGEGI
FT                   AAKALQALGLSPDKIQKEVESLIGRGQEMSQSIHYTPRAKKVTELAMDEARKLGHSYVG
FT                   TEHILLGLIREGEGVAARVLNNLGVSLNKARQQVLQLLGSNESGGAASGANSSANTPTL
FT                   DSLARDLTAIAKEDSLDPVIGRSKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLA
FT                   QQIINNEVPEILRDKRVMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNIILFIDEL
FT                   HTLIGAGGAEGAIDASNILKPSLARGELQCIGATTLDEYRKYIEKDAALERRFQPIQVD
FT                   QPSPEESIQILKGLRDRYEAHHRVSITDEAIEAAVKLSDRYISDRFLPDKAIDLIDEAG
FT                   SKVRLRSFTTPPNLKELEQKLDEVRKEKDAAVQSQEFEKAASLRDTEQRLREQVEETKK
FT                   TWKEKQGQENSEVTVDDIAMVVSSWTGVPVSKIAQTETDKLLNMESILHSRVIGQDEAV
FT                   VAVAKAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARALAESIFGDEEAMIRIDMSE
FT                   YMEKHSTSRLVGSPPGYVGYDEGGQLTEKVRRKPYSVVLLDEIEKAHPDVFNILLQVLE
FT                   DGRLTDSKGRTVDFRNTILIMTSNVGASELRRNKYVGFNVQDETQNYKDMKDKVMGELK
FT                   RAFRPEFINRIDEIIVFHSLEKKHLKDIVSLMSDQLTKRLKEQDLSIELTEAAKEKIAD
FT                   EGVDLEYGARPLRRAIQKHVEDRLSEELLKGHIQKGQHIVLDVEDGEFVVKTEAKTN"
FT   gene            104859..106238
FT                   /gene="radA"
FT                   /locus_tag="BLi00105"
FT   CDS_pept        104859..106238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="BLi00105"
FT                   /product="DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00105"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39079"
FT                   /protein_id="AAU39079.1"
FT                   /translation="MAKTKTKFICHSCGYESAKWMGKCPGCGAWNTMVEETIKKPAANR
FT                   RTAFSHSVQTVQKPSPLTSIETTEEPRIKTKLGEFNRVLGNGIVKGSLVLIGGDPGIGK
FT                   STLLLQVSAQLADSKENVLYISGEESVKQTKLRADRLGINSPTLHVLSETDMEYITSSI
FT                   EEMNPSFVVVDSIQTVYQSDITSAPGSVSQVRECTAELMRIAKTKGIPIFIVGHVTKEG
FT                   SIAGPRLLEHMVDTVLYFEGERHHTFRILRAVKNRFGSTNEMGIFEMREEGLTEVLNPS
FT                   EIFLEERSAGAAGSSVVASMEGTRPVLVEIQALISPTSFGNPRRMATGIDHNRVSLLMA
FT                   VLEKRVGLLLQNQDAYLKVAGGVKLDEPAIDLAVAVSIASSFRDTPPHPTDCFIGEVGL
FT                   TGEVRRVSRIEQRVQEAAKLGFKRMIIPSANVEGWTKPKGIEVVGVENVAEALRASLGG
FT                   S"
FT   gene            106242..107318
FT                   /gene="disA"
FT                   /locus_tag="BLi00106"
FT   CDS_pept        106242..107318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="disA"
FT                   /locus_tag="BLi00106"
FT                   /product="DNA integrity scanning protein DisA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00106"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39080"
FT                   /db_xref="GOA:Q65PD4"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PD4"
FT                   /protein_id="AAU39080.1"
FT                   /translation="MDKDKKGAKQDLSEILQFVAPGTPLREGIENVLRAKTGGLIVVGF
FT                   NDKVKEVVDGGFHINSSFSPAHLYELAKMDGAIILSDSGQKILYANTQLMPEATIPSSE
FT                   TGMRHRTAERVAKQTGCLIIAISERRNVITLYQENMKYILKDIGFILTKANQAIQTLEK
FT                   YKLILDHAISNLNALEFEELVTFGDVISVLHRYEMVLRIKNEINMYIKELGTEGHLIRL
FT                   QVSELITDMEQEAALFVKDYVKEKIKDPFVLLKQLQDMSSFELLDDAILLKLLGYSATT
FT                   NMEEYVFPRGYRLLHKIPRLPMPIVENVVEAFGHLKLIIEADVKDLDEVEGIGAVRAQK
FT                   IKKGLKRLQEKHYTDRQL"
FT   gene            107450..108538
FT                   /gene="yacL"
FT                   /locus_tag="BLi00107"
FT   CDS_pept        107450..108538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacL"
FT                   /locus_tag="BLi00107"
FT                   /product="YacL"
FT                   /note="SigM regulated"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00107"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39081"
FT                   /protein_id="AAU39081.1"
FT                   /translation="MLKRIVQAFFAILGGVIGIFLIPELFVLLNVQDIPLVTNPYASAC
FT                   LGAIIFFLLGIWCADHVINWVKQIEDSLIKAPVSDLLFGSLGLIFGLMLAYLIVNVIPL
FT                   KDIPYQLISTVIPIVLAAFLGYLGFRVGFKKKDEMLTLFTSRKKKGSAEEERPEEDKKL
FT                   KILDTSVIIDGRIADICQTGFLEGVIVIPQFVLEELQHIADSSDVLKRNRGRRGLDILN
FT                   RIQKELDIKVEIYEGDFEDIQEVDSKLVKLAKLTSGVVVTNDFNLNKVCELQKVAVLNI
FT                   NDLANAVKPVVLPGEEMKVQVIKDGKEHNQGVAYLDDGTMIVVEEGRNYIGKHIDVLVT
FT                   SVLQTAAGRMIFAKPKLLEKAL"
FT   gene            108555..109250
FT                   /gene="ispD"
FT                   /locus_tag="BLi00108"
FT   CDS_pept        108555..109250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="BLi00108"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase IspD"
FT                   /EC_number="2.7.7.60"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00108"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39082"
FT                   /db_xref="GOA:Q65PD2"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PD2"
FT                   /protein_id="AAU39082.1"
FT                   /translation="MNYEVVIPAAGQGKRMNAGKNKLFIEAKGIPVIIHTLKVFENHDA
FT                   CKRIILVINEQEFGEFNTLLKTYHFKTPIEMVPGGRERQQSVFAGIKAAGKEETVLVHD
FT                   GARPFIKREYIEQLVEKAKETGAAIVAVPVKDTIKRVQDGEIAGTIERSSLWAAQTPQA
FT                   FRLSILMNAHLEAEAKGFLGTDDASLVEEAGGTVAIIQGDYQNIKLTTPDDLLVAEAIL
FT                   EAEKRNEHV"
FT   gene            109243..109719
FT                   /gene="ispF"
FT                   /locus_tag="BLi00109"
FT   CDS_pept        109243..109719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispF"
FT                   /locus_tag="BLi00109"
FT                   /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase IspF"
FT                   /EC_number="4.6.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00109"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39083"
FT                   /db_xref="GOA:Q65PD1"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PD1"
FT                   /protein_id="AAU39083.1"
FT                   /translation="MFRIGQGFDVHQLVEGRPLIIGGITIPYEKGLLGHSDADVLLHTI
FT                   ADACLGAVGEGDIGKHFPDTDPEFKDADSFKLLRHVWMIVKEKGYTLGNLDCTIIAQKP
FT                   KMAPYIEDMRARIAEGLEAEISQINVKATTTEKLGFTGRAEGIAAQASVLLQKV"
FT   gene            109801..111258
FT                   /gene="gltX"
FT                   /locus_tag="BLi00110"
FT   CDS_pept        109801..111258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="BLi00110"
FT                   /product="glutamyl-tRNA ligase GltX"
FT                   /EC_number="6.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00110"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39084"
FT                   /db_xref="GOA:Q65PD0"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PD0"
FT                   /protein_id="AAU39084.1"
FT                   /translation="MGNEVRVRYAPSPTGHLHIGNARTALFNYLFARSQGGKFIIRIED
FT                   TDRKRNIEGGEQSQLNYLKWLGIDWDESVDVGGEYGPYRQSERNDIYKTYYEELLEKGL
FT                   AYKCYCTEEELEKEREEQAARGEMPRYSGKCRNLTKEEQEKLEAEGRQPSIRFKVPQGE
FT                   VIRFDDIVKGEISFETDGIGDFVIVKKDGTPTYNFAVAVDDYLMKMTHVLRGEDHISNT
FT                   PKQIMIYNALGWDIPAFGHMTLIVNESRKKLSKRDESIIQFIEQYEELGYLPEALFNFI
FT                   TLLGWSPVGEEELFTKEQFIEIFDVNRLSKSPAVFDTHKLKWVNNQYVKKLDLDQVIEL
FT                   TVPHLQKAGKVSEELSGSEQEWVRKLISLYQEQLSYGAEIVELTELFFKDDIQYNREAR
FT                   TVLEEEQVPEVLRVFAEKLEQLDSFTADEIKASIKAVQKETGHKGKKLFMPIRVATTGQ
FT                   THGPELPQSIELLGKDTVLKRLHNIIQ"
FT   gene            111560..112210
FT                   /gene="cysE"
FT                   /locus_tag="BLi00111"
FT   CDS_pept        111560..112210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="BLi00111"
FT                   /product="serine acetyltransferase CysE"
FT                   /EC_number="2.3.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00111"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39085"
FT                   /db_xref="GOA:Q65PC9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PC9"
FT                   /protein_id="AAU39085.1"
FT                   /translation="MFFKMLKEDVDVVFDQDPAARSYIEVILTYSGLHAIWAHRIAHAL
FT                   YKRKRFFIARAISQIARFFTGIEIHPGAKIGRRFFIDHGMGVVIGETCEIGNNVTVFQG
FT                   VTLGGTGKEKGKRHPTIEDDALISTGAKVLGSITVGRGAKIGAGSVVLHDVPECSTVVG
FT                   IPGRVVVQNGKKIRRDLNHQDLPDPVADRFRELENEIRQLKQELRRKEREDEL"
FT   gene            112207..113610
FT                   /gene="cysS"
FT                   /locus_tag="BLi00112"
FT   CDS_pept        112207..113610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="BLi00112"
FT                   /product="cysteinyl-tRNA ligase CysS"
FT                   /EC_number="6.1.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00112"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39086"
FT                   /db_xref="GOA:Q65PC8"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PC8"
FT                   /protein_id="AAU39086.1"
FT                   /translation="MTLTLYNTLTRKKEPFVPLEEGKVKMYVCGPTVYNYIHIGNARPA
FT                   IVFDTVRKYLEYKGYEVQYVSNFTDVDDKLIKAANELGEEVPVIAERFIKAYFEDVGSL
FT                   GCTKADCHPRVTENMDEIIDFIQTLIDKGYAYEADGDVYYKTRSFEGYGKLSHQSVDEL
FT                   RSGARIQVGEKKEDALDFTLWKAAKDNEISWDSPWGKGRPGWHIECSAMARKYLGDSID
FT                   IHAGGQDLAFPHHENEIAQSEALTGKPFAKYWLHNGYINIDNEKMSKSLGNFVLVHDII
FT                   KEHDPQVLRFFMLSVHYRHPINYSVELLENTKNAFGRLKTAYSNLQHRLKSSTNLTEGD
FT                   SEWLEKIEEQRKAFQTAMDDDFNTANAISVLFDLAKHANYYLQEKNTAEHVIQAFIQLF
FT                   DEICSVLGFSLKEQELLDKDIEELIEKRNEARRNRDFATSDQIRDQLKSMNIILEDTPQ
FT                   GTRWKRGES"
FT   gene            113613..114029
FT                   /gene="mrnC"
FT                   /locus_tag="BLi00113"
FT   CDS_pept        113613..114029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrnC"
FT                   /locus_tag="BLi00113"
FT                   /product="putative ribonuclease MrnC"
FT                   /EC_number="3.1.26.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00113"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39087"
FT                   /protein_id="AAU39087.1"
FT                   /translation="MNLETIKDAKQLNGLALAYMGDAVLEVYVRHHLLKQGMTRPNDLH
FT                   RQSRRYVSAKSQASMLFALEEQEFFTEEEQAVLRRGRNAKSGTVPKNTDVQTYRYSTAF
FT                   EAVIGYLFLENREDRLNELIKAALEKRDGREEVK"
FT   gene            114026..114775
FT                   /gene="yacO"
FT                   /locus_tag="BLi00114"
FT   CDS_pept        114026..114775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacO"
FT                   /locus_tag="BLi00114"
FT                   /product="putative TrmH-family tRNA/rRNA methyltransferase
FT                   YacO"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00114"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39088"
FT                   /protein_id="AAU39088.1"
FT                   /translation="MSQQHDYVIGKNAVIETLKSGRELYKLWMAENTVKGQAQQVVDLA
FT                   AKNGVTIHYVPRKKLDQMVSGQHQGVVAQVAAYEYAELDDLFQKAEDRNEQPFILVLDE
FT                   IEDPHNLGSIMRTADAVGAHGIVIPKRRAVGLTTTVAKASTGAIEHIPVVKVTNLSRTL
FT                   EEMKGRGIWVVGTDASGQQDYRSLDGNMPLALVIGSEGKGMGRLVKEKCDFLIRLPMAG
FT                   KVTSLNASVAAGLLMYEVYRKRSPLGE"
FT   gene            114781..115293
FT                   /gene="yacP"
FT                   /locus_tag="BLi00115"
FT   CDS_pept        114781..115293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacP"
FT                   /locus_tag="BLi00115"
FT                   /product="DUF901 family protein YacP"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00115"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39089"
FT                   /protein_id="AAU39089.1"
FT                   /translation="MDILLVDGYNMIGAWPQLKDLKENSFEEARDLLIQKMAEYQSYTG
FT                   FRVIVVFDAHLVKGIEKKKVNHRVEVIFTRENETADERIEKLVSDLNSIQTQIHVATSD
FT                   YTEQWAIFGQGALRKSARELLREVEAIERQIENRVKQITSERPAGKIPLSEDVLRIFEK
FT                   WRRGDLD"
FT   gene            115357..116028
FT                   /gene="sigH"
FT                   /locus_tag="BLi00116"
FT   CDS_pept        115357..116028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigH"
FT                   /locus_tag="BLi00116"
FT                   /product="RNA polymerase sigma factor SigH"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00116"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39090"
FT                   /protein_id="AAU39090.1"
FT                   /translation="MNLQNNQGKFSKEQFSKERFCQLEDEQVIEMVHVGDSDALDYLIT
FT                   KYRNFVRAKARSYFLIGADREDIVQEGMIGLYKSIRDFREDKLTSFKAFAELCITRQII
FT                   TAIKTATRQKHIPLNSYVSLDKPIYDEESDRTLLDVISGAKVMNPEELIINQEEFDDIE
FT                   LKMGELLSDLERKVLALYLDGRSYQEISEELNRHVKSIDNALQRVKRKLEKYLELREIS
FT                   L"
FT   gene            116111..116260
FT                   /gene="rpmG1"
FT                   /locus_tag="BLi00117"
FT   CDS_pept        116111..116260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG1"
FT                   /locus_tag="BLi00117"
FT                   /product="50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00117"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39091"
FT                   /db_xref="GOA:Q65PC3"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PC3"
FT                   /protein_id="AAU39091.1"
FT                   /translation="MKKKVTLACKNCGNRNYTTMKSSAALAERLEVKKYCNNCNSHTVH
FT                   LETK"
FT   gene            116296..116475
FT                   /gene="secE"
FT                   /locus_tag="BLi00118"
FT   CDS_pept        116296..116475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="BLi00118"
FT                   /product="preprotein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00118"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39092"
FT                   /protein_id="AAU39092.1"
FT                   /translation="MGIIKFLKNVGKEMKKVTWPKGKELTRYTITVITTVIFFAIFFAL
FT                   IDSGITQLIRLIVE"
FT   gene            116653..117186
FT                   /gene="nusG"
FT                   /locus_tag="BLi00119"
FT   CDS_pept        116653..117186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="BLi00119"
FT                   /product="transcription antitermination protein NusG"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00119"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39093"
FT                   /protein_id="AAU39093.1"
FT                   /translation="MEKKWYVVHTYSGYENKVKANLEKRVESMGMQDKIFRVVVPEEEE
FT                   TDIKNGKKKVVKKKVFPGYVLVELVMTDDSWYVVRNTPGVTGFVGSAGSGSKPTALLPG
FT                   EAEKILKRMGLEERKTEIDFELKETVKVIDGPFADFTGTIEEIDHDKNKVKVFVNMFGR
FT                   ETPVELEFTQVDKL"
FT   gene            117356..117781
FT                   /gene="rplK"
FT                   /locus_tag="BLi00120"
FT   CDS_pept        117356..117781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="BLi00120"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00120"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39094"
FT                   /db_xref="GOA:Q65PC0"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PC0"
FT                   /protein_id="AAU39094.1"
FT                   /translation="MAKKVVKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNAR
FT                   TSDQAGLIIPVEISVYEDRSFTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATVKRDK
FT                   VREIAETKMPDLNAADVEAAMRMVEGTARSMGIVIED"
FT   gene            117883..118581
FT                   /gene="rplA"
FT                   /locus_tag="BLi00121"
FT   CDS_pept        117883..118581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="BLi00121"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00121"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39095"
FT                   /db_xref="GOA:Q65PB9"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PB9"
FT                   /protein_id="AAU39095.1"
FT                   /translation="MAKKGKKYVEAAKLVDRTKAYDVNEAIELVKKTNTAKFDATVEAA
FT                   FRLGVDPRKNDQQIRGAVVLPNGTGKTQRVLVFAKGEKAKEAEAAGADYVGDADYINKI
FT                   QQGWFDFDVIVATPDMMGEVGKIGRVLGPKGLMPNPKTGTVTFEVEKAVNEIKAGKVEY
FT                   RVDKAGNIHVPIGKVSFEEGKLVENFATMYDTILKAKPAAAKGVYVKNVSVTSTMGPGI
FT                   KVDPSTFNVK"
FT   gene            118843..119343
FT                   /gene="rplJ"
FT                   /locus_tag="BLi00122"
FT   CDS_pept        118843..119343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="BLi00122"
FT                   /product="50S ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00122"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39096"
FT                   /db_xref="GOA:Q65PB8"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PB8"
FT                   /protein_id="AAU39096.1"
FT                   /translation="MSSAIETKKVVVEEITSKLKESKSTIIVDYRGLNVAEVTELRKQL
FT                   REANVEFKVYKNTMTRRAVEQAELDGLNDFLTGPNAIAFSTEDVVAPAKVLNEFAKKHE
FT                   ALEIKAGVIEGKVSTVEEVKALAELPSREGLLSMLLSVLQAPVRNLALATKAVAEQKEE
FT                   QGA"
FT   gene            119388..119759
FT                   /gene="rplL"
FT                   /locus_tag="BLi00123"
FT   CDS_pept        119388..119759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="BLi00123"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00123"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39097"
FT                   /db_xref="GOA:Q65PB7"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PB7"
FT                   /protein_id="AAU39097.1"
FT                   /translation="MALNIEEIIASVKEATVLELNDLVKAIEEEFGVTAAAPVAVAGGA
FT                   AAGGAAEEKTEFDLVLAGAGDQKIKVIKVVREITGLGLKEAKELVDNTPKPLKEGIAKE
FT                   EAEELKAKLEEVGASVEVK"
FT   gene            119899..120504
FT                   /gene="ybxB"
FT                   /locus_tag="BLi00124"
FT   CDS_pept        119899..120504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybxB"
FT                   /locus_tag="BLi00124"
FT                   /product="putative methyltransferase YbxB"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00124"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39098"
FT                   /protein_id="AAU39098.1"
FT                   /translation="MTDHYYSEKPSAKSSRSMWAFRLRNRTFTFISDSGVFSKREVDFG
FT                   SRLLIEAFREPDAEGDFLDVGCGYGPIGLSLAADFEDRMVHMIDVNERAVELSKENALN
FT                   NQIDNIKIYQSDLFANVEPAKKFASIITNPPIRAGKKTVHAIFEKSAEHLRPSGELWVV
FT                   IQKKQGGPSAIEKLKELFADVEVVQKKKAYYIIKAKKV"
FT   gene            120755..124336
FT                   /gene="rpoB"
FT                   /locus_tag="BLi00125"
FT   CDS_pept        120755..124336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="BLi00125"
FT                   /product="DNA-directed RNA polymerase beta subunit RpoB"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00125"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39099"
FT                   /db_xref="GOA:Q65PB5"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PB5"
FT                   /protein_id="AAU39099.1"
FT                   /translation="MTGQLVQYGRHRQRRSYARISEVLELPNLIEIQTSSYQWFLDEGL
FT                   REMFQDISPIEDFTGNLSLEFIDYSLGEPKYPVEESKERDVTYSAPLRVKVRLINKETG
FT                   EVKDQDVFMGDFPIMTDTGTFIINGAERVIVSQLVRSPSVYFSGKVDKNGKKGFTATVI
FT                   PNRGAWLEYETDAKDVVYVRIDRTRKLPVTVLLRALGFGSDQEIIDLIGENEYLRNTLD
FT                   KDNTENTDKALLEIYERLRPGEPPTVENAKSLLDSRFFDPKRYDLASVGRYKINKKLHI
FT                   KNRLFNQRLAETLVDPETGEILAEKGAILDRRTLDKVLPYLENGIGFKKLYPNGGVVED
FT                   EVTLQSIKIYAPTDQEGEQTINVIGNAYIEEGVKNITPSDIIASISYFFNLLHGVGDTD
FT                   DIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQDTNTITPQQLINIRPVIASI
FT                   KEFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLTRERAGMEVRDVHYSHYGRMCPI
FT                   ETPEGPNIGLINSLSSFAKVNRFGFIETPYRRVDPETGKVTPRIDYLTADEEDNYVVAQ
FT                   ANARLNDDGSFVDDSIVARFRGENTVVPKDRVDYMDVSPKQVVSAATACIPFLENDDSN
FT                   RALMGANMQRQAVPLMQPESPIVGTGMEYVSAKDSGAAVICRHPGIVERVEAKNIWVRR
FT                   YEEVDGQKVKGNLDKYSLLKFVRSNQGTCYNQRPIVSVGDEVEKGEILADGPSMEKGEL
FT                   ALGRNVMVGFMTWDGYNYEDAIIMSERLVKDDVYTSIHIEEYESEARDTKLGPEEITRD
FT                   IPNVGEDALRNLDERGIIRVGAEVKDGDLLVGKVTPKGVTELTAEERLLHAIFGEKARE
FT                   VRDTSLRVPHGGGGIILDVKVFNREDGDELPPGVNQLVRVYIVQKRKISEGDKMAGRHG
FT                   NKGVISKILPEEDMPYLPDGTPIDIMLNPLGVPSRMNIGQVLELHLGMAARRLGLHVAS
FT                   PVFDGAREEDVWETLEEAGMSRDAKTVLYDGRTGEPFDNRVSVGIMYMIKLAHMVDDKL
FT                   HARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVKSDDVVGRV
FT                   KTYEAIVKGDNVPEPGVPESFKVLIKELQSLGMDVKILSSDEEEIEMRDLEDDEDAKQN
FT                   EGLSLPNDEESEELVSADAERDVVTKE"
FT   gene            124396..127995
FT                   /gene="rpoC"
FT                   /locus_tag="BLi00126"
FT   CDS_pept        124396..127995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="BLi00126"
FT                   /product="DNA-directed RNA polymerase beta' subunit RpoC"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00126"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39100"
FT                   /db_xref="GOA:Q65PB4"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PB4"
FT                   /protein_id="AAU39100.1"
FT                   /translation="MLDVNNFEYMNIGLASPDKIRSWSYGEVKKPETINYRTLKPEKDG
FT                   LFCERIFGPQKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLVLDMSPRALEEVIYFASYVVTDPANTPLEKKQLLSEKEYRAYLDKYG
FT                   NKFQASMGAEAIHKLLQDIDLDKEVDMLKEELKTSQGQRRTRAIKRLEVLEAFRNSGNK
FT                   PSWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVEKGLAHNIKSAKRKIERVQPEVWD
FT                   VLESVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVH
FT                   VPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERPGAVGEGMIFK
FT                   DTDEALLAYQNGYVHLHTRVAVAVNSLKNETFTEEQRSKLLITTVGKLIFNEILPPSFP
FT                   YMNEPTKSNIEEKTPDRFFLDYGADVKEAIKNQEINPPFKKGILGKIIAEIFKRFHITE
FT                   TSKMLDRMKNLGFKYSTKAGITVGVSDIVVLDDKQEILEEAQGKVDNVMKQFRRGLITE
FT                   EERYERVISIWSAAKDTIQGKLMKSLDEINPIYMMSDSGARGNASNFTQLAGMRGLMAN
FT                   PAGRIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVI
FT                   IRETDCGTDRGILAKAITEGTEVIERLEERLVGRFARKPVKHPETGEVLVNENELIDED
FT                   KAIEIVEAGIEEVWIRSAFTCNTSHGVCKRCYGRNLATGTDVEVGEAVGIIAAQSIGEP
FT                   GTQLTMRTFHTGGVAGDDITQGLPRIQELFEARNPKGQATISEIDGVVAEINEVRDKQQ
FT                   EIVVQGEVESRSYTAPYNARLKVTEGEKISRGQVLTEGSVDPKELLKVTDITTVQEYLL
FT                   HEVQKVYRMQGVEIGDKHVEVMVRQMLRKVRVIDAGDTEVLPGTLLDIHQFTEANKKVL
FT                   LEGKRPATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVI
FT                   IGKLVPAGTGMLNYRKVKPVLQVQSSDEMVPAE"
FT   gene            128112..128363
FT                   /gene="ybxF"
FT                   /locus_tag="BLi00127"
FT   CDS_pept        128112..128363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybxF"
FT                   /locus_tag="BLi00127"
FT                   /product="putative ribosomal protein YbxF"
FT                   /note="similar to ribosomal protein L7AE family"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00127"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39101"
FT                   /protein_id="AAU39101.1"
FT                   /translation="MMSYDKVSQAQSIIIGTKQTVKALKRNSVKEVVVAKDADPCLTSG
FT                   VINLANEQGVPVSMAESMKKLGKACGIEVGAAAVAIIQ"
FT   gene            128468..128884
FT                   /gene="rpsL"
FT                   /locus_tag="BLi00128"
FT   CDS_pept        128468..128884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="BLi00128"
FT                   /product="30S ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00128"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39102"
FT                   /db_xref="GOA:Q65PB2"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PB2"
FT                   /protein_id="AAU39102.1"
FT                   /translation="MPTINQLVRKGRVSKVETSKSPALNKGYNSFKKEHTNVSSPQKRG
FT                   VCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIVRGALDTAGVENRAQGRSKYGTKRPKKK"
FT   gene            129050..129520
FT                   /gene="rpsG"
FT                   /locus_tag="BLi00129"
FT   CDS_pept        129050..129520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="BLi00129"
FT                   /product="30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00129"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39103"
FT                   /db_xref="GOA:Q65PB1"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PB1"
FT                   /protein_id="AAU39103.1"
FT                   /translation="MPRKGPVAKRDVLPDPLYNSKLVTRLINKMMIDGKKGKAQTILYK
FT                   SFDIIKERTGNDAMEVFEQALKNIMPVLEVKARRVGGANYQVPVEVRPERRTTLGLRWL
FT                   VNYARLRGEKTMEERLANEILDAANNTGAAVKKREDTHKMAEANKAFAHYRW"
FT   gene            129570..131648
FT                   /gene="fusA"
FT                   /locus_tag="BLi00130"
FT   CDS_pept        129570..131648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="BLi00130"
FT                   /product="elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00130"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39104"
FT                   /db_xref="GOA:Q65PB0"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PB0"
FT                   /protein_id="AAU39104.1"
FT                   /translation="MAREFSLEKTRNIGIMAHIDAGKTTTTERILFYTGRIHKIGETHE
FT                   GASQMDWMEQEQERGITITSAATTAQWKGYRVNIIDTPGHVDFTVEVERSLRVLDGAVA
FT                   VLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKTGADFLYSVGTLRDRLEANAHAIQ
FT                   LPIGAEDNFEGIIDLVENVAYYYEDDLGTRSEAREIPAEYKDKAEELRASLIEAVAELD
FT                   EELMMKYLEGEEITVDELKAAIRKGTCNVEFYPVLCGSAFKNKGVQLVLDAVLDYLPAP
FT                   TDVPAIKGTLPDSDEEVTRESSDDAPFSALAFKVMTDPYVGKLTFFRVYSGTLDSGSYV
FT                   RNSTKGKRERVGRILQMHANSREEISTVYAGDIAAAVGLKDTTTGDTLCDEKNLVILES
FT                   MEFPEPVIHVAIEPKSKADQDKMSTALAKLAEEDPTFRAHTDPETGQTIIGGMGELHLD
FT                   IIVDRMKREFKVEANVGAPQVAYRETFRASAQVEGKFVRQSGGRGQFGHVWIEFSPNEE
FT                   GKGFEFENAIVGGVVPREYIPAVQAGLEDALQNGVVAGYPVIDIKAKLFDGSYHDVDSN
FT                   EMAFKIAASMALKNAASKCNPVILEPISKVEVVIPEEYMGDIMGDITSRRGRVEGMEGR
FT                   GNAQVVRAMVPLSEMFGYATALRSNTQGRGTFTMVFDHYEEVPKSIADEIIKKNQGE"
FT   gene            131768..132958
FT                   /gene="tuf"
FT                   /locus_tag="BLi00131"
FT   CDS_pept        131768..132958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="BLi00131"
FT                   /product="elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00131"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39105"
FT                   /db_xref="GOA:Q65PA9"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PA9"
FT                   /protein_id="AAU39105.1"
FT                   /translation="MAKEKFDRSKSHANIGTIGHVDHGKTTLTAAITTVLHKKSGKGTA
FT                   MAYDQIDGAPEERERGITISTAHVEYETDNRHYAHVDCPGHADYVKNMITGAAQMDGAI
FT                   LVVSAADGPMPQTREHILLSRNVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYE
FT                   FPGDDVPVIKGSALKALEGDAQYEEKIFELMAAVDEYIPTPERETDKPFMMPVEDVFSI
FT                   TGRGTVATGRVERGQVKVGDEVEIIGLQEENKKTTVTGVEMFRKLLDYAEAGDNIGALL
FT                   RGVSREEIQRGQVLAQPGTITPHKKFKAEVYVLSKEEGGRHTPFFSNYRPQFYFRTTDV
FT                   TGIIQLPEGVEMVMPGDNIEMTVELISTIAIEDGTRFSIREGGRTVGSGVVSSIIE"
FT   gene            133280..133588
FT                   /gene="rpsJ"
FT                   /locus_tag="BLi00132"
FT   CDS_pept        133280..133588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="BLi00132"
FT                   /product="30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00132"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39106"
FT                   /db_xref="GOA:Q65PA8"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PA8"
FT                   /protein_id="AAU39106.1"
FT                   /translation="MAKQKIRIRLKAYDHRILDQSAEKIVETAKRSGASVSGPIPLPTE
FT                   KSVYTILRAVHKYKDSREQFEMRTHKRLIDIVNPTPQTVDALMRLDLPSGVDIEIKL"
FT   gene            133627..134256
FT                   /gene="rplC"
FT                   /locus_tag="BLi00133"
FT   CDS_pept        133627..134256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="BLi00133"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00133"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39107"
FT                   /db_xref="GOA:Q65PA7"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PA7"
FT                   /protein_id="AAU39107.1"
FT                   /translation="MTKGILGRKIGMTQVFAENGDLIPVTVIEAAPNVVLQKKTSENDG
FT                   YEAIQIGFDDKREKLANKPEKGHVAKAETAPKRFVKELRGVDMDAYEVGQEVKVDIFSN
FT                   GEIVDVTGTSKGKGFQGAIKRHGQSRGPMSHGSRYHRRPGSMGPVDPNRVFKGKLLPGR
FT                   MGGEQITVQNLEIVKVDAERNLLLVKGNVPGAKKSLVTVKSAVKSK"
FT   gene            134284..134907
FT                   /gene="rplD"
FT                   /locus_tag="BLi00134"
FT   CDS_pept        134284..134907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="BLi00134"
FT                   /product="50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00134"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39108"
FT                   /db_xref="GOA:Q65PA6"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PA6"
FT                   /protein_id="AAU39108.1"
FT                   /translation="MPKVALYNQNGSTAGDIELNDSVFGIEPNESVVFDAILMQRASLR
FT                   QGTHKVKNRSEVRGGGRKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYAYKLPKK
FT                   VRRLAIKSALSSKVNDNNLIVLEDLNLDAVKTKEMAAILKGLSIEKKALIVTADANETV
FT                   ELSARNLPGVTVVEANGINVLDVVGHEKLVMTKAAVEKVEEVLA"
FT   gene            134907..135194
FT                   /gene="rplW"
FT                   /locus_tag="BLi00135"
FT   CDS_pept        134907..135194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="BLi00135"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00135"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39109"
FT                   /db_xref="GOA:Q65PA5"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PA5"
FT                   /protein_id="AAU39109.1"
FT                   /translation="MKDPRDVLKRPVITERSADLMTEKKYTFEVDVKANKTEVKDAVEQ
FT                   IFGVKVEKVNIMNYKGKFKRVGRYSGMTNKRRKAIVKLTEDSKEIEIFEA"
FT   gene            135226..136059
FT                   /gene="rplB"
FT                   /locus_tag="BLi00136"
FT   CDS_pept        135226..136059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="BLi00136"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00136"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39110"
FT                   /db_xref="GOA:Q65PA4"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PA4"
FT                   /protein_id="AAU39110.1"
FT                   /translation="MAIKKYKPTSNGRRGMTSSDFAEITTDQPEKSLLAPLHKKGGRNN
FT                   QGKLTVRHQGGGHKRQYRIIDFKRDKDGIPGRVATVEYDPNRSANIALINYVDGEKRYI
FT                   LAPKGLQVGTEIMSGPEADIKVGNALPLINIPVGTVVHNIELKPGKGGQLVRSAGTSAQ
FT                   VLGKEGKYVLVRLNSGEVRMILSACRATIGQVGNEQHELINIGKAGRSRWKGVRPTVRG
FT                   SVMNPNDHPHGGGEGRAPIGRKSPMSPWGKPTLGFKTRKKKNKSDKFIVRRRKNK"
FT   gene            136117..136395
FT                   /gene="rpsS"
FT                   /locus_tag="BLi00137"
FT   CDS_pept        136117..136395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="BLi00137"
FT                   /product="30S ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00137"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39111"
FT                   /db_xref="GOA:Q65PA3"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PA3"
FT                   /protein_id="AAU39111.1"
FT                   /translation="MARSLKKGPFVDDHLMTKIEKLNEADKKQVVKTWSRRSTIFPQFI
FT                   GHTIAVYDGRKHVPVYISEDMVGHKLGEFAPTRTYKGHASDDKKTRR"
FT   gene            136413..136757
FT                   /gene="rplV"
FT                   /locus_tag="BLi00138"
FT   CDS_pept        136413..136757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="BLi00138"
FT                   /product="50S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00138"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39112"
FT                   /db_xref="GOA:Q65PA2"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PA2"
FT                   /protein_id="AAU39112.1"
FT                   /translation="MQQAKAVARTVRIAPRKARLVMDLIRGKQVGEAVSILNHTPKAAS
FT                   PIIEKVLKSAIANAEHNYEMDANNLVVTQAYVNEGPTLKRFRPRAMGRASQINKRTSHI
FT                   TIVVSEKKEG"
FT   gene            136761..137417
FT                   /gene="rpsC"
FT                   /locus_tag="BLi00139"
FT   CDS_pept        136761..137417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="BLi00139"
FT                   /product="30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00139"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39113"
FT                   /db_xref="GOA:Q65PA1"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PA1"
FT                   /protein_id="AAU39113.1"
FT                   /translation="MGQKVNPVGLRIGVIRDWESKWYAGKDYADFLHEDLKIREFINQR
FT                   LSDASVSKVEIERAANRVNITIHTAKPGMVIGKGGSEVEALRKALNSLTGKRVHINILE
FT                   IKRADLDAQLVADNIARQLENRISFRRAQKQQIQRTMRAGAQGIKTMVSGRLGGADIAR
FT                   SEYYSEGTVPLHTLRADIDYATSEADTTYGKLGVKVWIYRGEVLPTKKKTEEGGK"
FT   gene            137419..137853
FT                   /gene="rplP"
FT                   /locus_tag="BLi00140"
FT   CDS_pept        137419..137853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="BLi00140"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00140"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39114"
FT                   /db_xref="GOA:Q65PA0"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65PA0"
FT                   /protein_id="AAU39114.1"
FT                   /translation="MLMPKRVKYRREHRGKMRGRAKGGTEVHFGEYGIQAQESSWITNR
FT                   QIEAARIAMTRYMKRGGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKVLF
FT                   EISGVSEEVAREALRLASHKLPIKTKFVKREEIGGESNES"
FT   gene            137843..138043
FT                   /gene="rpmC"
FT                   /locus_tag="BLi00141"
FT   CDS_pept        137843..138043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="BLi00141"
FT                   /product="50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00141"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39115"
FT                   /db_xref="GOA:Q65P99"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P99"
FT                   /protein_id="AAU39115.1"
FT                   /translation="MKANEIRDLTTAEIEQKVKSLKEELFNLRFQLATGQLENTARIRE
FT                   VRKSIARMKTVIREREIAANK"
FT   gene            138068..138331
FT                   /gene="rpsQ"
FT                   /locus_tag="BLi00142"
FT   CDS_pept        138068..138331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="BLi00142"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00142"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39116"
FT                   /db_xref="GOA:Q65P98"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P98"
FT                   /protein_id="AAU39116.1"
FT                   /translation="MSERNQRKVYQGRVVSDKMDKTITVVVETYKKHSLYGKRVKYSKK
FT                   FKAHDENNQAKIGDIVKIMETRPLSATKRFRLVEVVEEAVII"
FT   gene            138372..138740
FT                   /gene="rplN"
FT                   /locus_tag="BLi00143"
FT   CDS_pept        138372..138740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="BLi00143"
FT                   /product="50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00143"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39117"
FT                   /db_xref="GOA:Q65P97"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P97"
FT                   /protein_id="AAU39117.1"
FT                   /translation="MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKQ
FT                   ATPGGVVKKGDVVRAVVVRSKSGARRNDGSYIKFDENACVIIRDDKSPRGTRIFGPVAR
FT                   ELRDNNFMKIVSLAPEVL"
FT   gene            138776..139087
FT                   /gene="rplX"
FT                   /locus_tag="BLi00144"
FT   CDS_pept        138776..139087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="BLi00144"
FT                   /product="50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00144"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39118"
FT                   /db_xref="GOA:Q65P96"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P96"
FT                   /protein_id="AAU39118.1"
FT                   /translation="MHVKKGDKVMVISGKDKGKQGVILAAFPKKDRVIVEGVNMVKKHS
FT                   KPTQANPQGGILNQEAPIHVSNVMPLDPKTGEVTRVGYKVENGKKVRIAKKSGQVLDN"
FT   gene            139113..139652
FT                   /gene="rplE"
FT                   /locus_tag="BLi00145"
FT   CDS_pept        139113..139652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="BLi00145"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00145"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39119"
FT                   /db_xref="GOA:Q65P95"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P95"
FT                   /protein_id="AAU39119.1"
FT                   /translation="MNRLKEKYNKEITPALMKKFEYKSVMQVPKIEKIVINMGVGDAVQ
FT                   NAKAIDSAVEELTFIAGQKPVVTRAKKSIAGFRLREGMPIGAKVTLRGERMYDFLDKLI
FT                   SVSLPRVRDFRGISKKSFDGRGNYTLGIKEQLIFPEIDYDKVTKVRGMDIVIVTTANTD
FT                   EEARELLTQLGMPFQK"
FT   gene            139675..139860
FT                   /gene="rpsN1"
FT                   /locus_tag="BLi00146"
FT   CDS_pept        139675..139860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN1"
FT                   /locus_tag="BLi00146"
FT                   /product="30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00146"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39120"
FT                   /db_xref="GOA:Q65P94"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P94"
FT                   /protein_id="AAU39120.1"
FT                   /translation="MAKKSMIAKQKRTPKFKVQEYTRCERCGRPHSVIRKFKLCRICFR
FT                   ELAYKGQIPGVKKASW"
FT   gene            139892..140290
FT                   /gene="rpsH"
FT                   /locus_tag="BLi00147"
FT   CDS_pept        139892..140290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="BLi00147"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00147"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39121"
FT                   /db_xref="GOA:Q65P93"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P93"
FT                   /protein_id="AAU39121.1"
FT                   /translation="MVMTDPIADMLTRIRNANMVRHEKLEIPASKLKREIAEILKREGF
FT                   IRDVEFIEDNKQGIIRVFLKYGQNNERVITGLKRISKPGLRVYAKSNEVPRVLNGLGIA
FT                   ILSTSQGVLTDKEARAKQAGGEVLAYVW"
FT   gene            140320..140856
FT                   /gene="rplF"
FT                   /locus_tag="BLi00148"
FT   CDS_pept        140320..140856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="BLi00148"
FT                   /product="50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00148"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39122"
FT                   /db_xref="GOA:Q65P92"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P92"
FT                   /protein_id="AAU39122.1"
FT                   /translation="MSRVGKKLLEIPSGVTVTLNDNTVTVKGPKGELTRTFHPDMKIKI
FT                   EDNVLTVERPSDNKEHRALHGTTRSIIGNMVEGVSKGFERGLELVGVGYRASKSGNKLV
FT                   LNVGYSHPVEIVPENGIEIEVPSQTKVVVKGTDKERVGATAANIRAVRSPEPYKGKGIR
FT                   YEGEMVRRKEGKSAK"
FT   gene            140888..141250
FT                   /gene="rplR"
FT                   /locus_tag="BLi00149"
FT   CDS_pept        140888..141250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="BLi00149"
FT                   /product="50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00149"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39123"
FT                   /db_xref="GOA:Q65P91"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P91"
FT                   /protein_id="AAU39123.1"
FT                   /translation="MITKTSKNAARLKRHARVRAKLSGTPERPRLNVFRSNKHIYAQVI
FT                   DDVNGVTLVSASTLDKDFNAENGSDTAAAAKVGELVAKRASEKGITNVVFDRGGYLYHG
FT                   RVKALADAAREAGLEF"
FT   gene            141269..141775
FT                   /gene="rpsE"
FT                   /locus_tag="BLi00150"
FT   CDS_pept        141269..141775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="BLi00150"
FT                   /product="30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00150"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39124"
FT                   /db_xref="GOA:Q65P90"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P90"
FT                   /protein_id="AAU39124.1"
FT                   /translation="MNMRRIDPSKLELEERLVTVNRVAKVVKGGRRFRFAALVVVGDKN
FT                   GHVGFGTGKAQEVPEAIRKAVEDAKKNLIEVPMVGTTIPHEIIGRFGAGNILLKPASEG
FT                   TGVIAGGPVRAVLELAGVSDILSKSLGSNTPINMIRATVQGLSELKRAEDVAKLRGKSV
FT                   EELLG"
FT   gene            141789..141968
FT                   /gene="rpmD"
FT                   /locus_tag="BLi00151"
FT   CDS_pept        141789..141968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="BLi00151"
FT                   /product="50S ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00151"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39125"
FT                   /db_xref="GOA:Q65P89"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P89"
FT                   /protein_id="AAU39125.1"
FT                   /translation="MAKLEITLKRSVIGRPEDQRITVRTLGLKKTNQTVVHEDNAAIRG
FT                   MINKVSHLVSVKEL"
FT   gene            141999..142439
FT                   /gene="rplO"
FT                   /locus_tag="BLi00152"
FT   CDS_pept        141999..142439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="BLi00152"
FT                   /product="50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00152"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39126"
FT                   /db_xref="GOA:P35138"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35138"
FT                   /protein_id="AAU39126.1"
FT                   /translation="MKLHELKPAEGSRKTRNRVGRGIGSGNGKTAGKGHKGQNARSGGG
FT                   VRPGFEGGQMPLFQRLPKRGFTNINRKEFAVVNLDKLNSFAEGTEVTPELLLETGVISK
FT                   LKSGVKILGDGKLEKKLTVKANKFSASAKQAIEAAGGTAEVI"
FT   gene            142441..143736
FT                   /gene="secY"
FT                   /locus_tag="BLi00153"
FT   CDS_pept        142441..143736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="BLi00153"
FT                   /product="preprotein translocase subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00153"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39127"
FT                   /db_xref="GOA:Q05207"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q05207"
FT                   /protein_id="AAU39127.1"
FT                   /translation="MFKTISNFMRVKDIRNKIIFTLLMLIVFRLGSFIPVPHVNTEVLK
FT                   AQDQMSVFGILNTFGGGALFNFSILAMGIMPYITASIIIQLLQMDVVPKFTEWSKQGEV
FT                   GRRKLAQFTRYFTIVLGFIQALGMSYGFNNMAGGALITDPGVGTYLLIAIVLTAGTAFL
FT                   MWLGEQITSHGVGNGISIIIFAGIVAGIPQTINQIYAQQFVDAGDQLFLQIIKVVVILV
FT                   AILAIVVGVIFIQQAVRKISIQYAKGSGRSPVPGGQSTHLPLKVNPAGVIPVIFAVAFI
FT                   TTPRTVATFFGSNDVTNWIQKTFDYTHPVGMGVYAALIIAFTYFYAFVQVNPEQMADNL
FT                   KKQGGYIPGVRPGKMTQDRITSILYRLTFVGSIFLAVIAILPVLFVNIAGLPSSAQIGG
FT                   TSLLIVIGVALETMKQLESQLVKRNYRGFMKH"
FT   gene            143790..144443
FT                   /gene="adk"
FT                   /locus_tag="BLi00154"
FT   CDS_pept        143790..144443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="BLi00154"
FT                   /product="adenylate kinase Adk"
FT                   /EC_number="2.7.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00154"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39128"
FT                   /db_xref="GOA:P35140"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35140"
FT                   /protein_id="AAU39128.1"
FT                   /translation="MNLVLMGLPGAGKGTQAERIVEDFGIPHISTGDMFRAAMKEETDL
FT                   GLEAKSYIDKGELVPDEVTIGIVRERLGKNDCDGGFLLDGFPRTVAQAEALEEILKGLG
FT                   KSIDHVINIQVDKDALMERLTGRRICKNCGATYHLVFNPPAKENVCDKCGGELYQREDD
FT                   NEATVSTRLEVNMKQTQPLLDFYEDKGYLVNIDGQKHINEVYADIKELLGGRDK"
FT   gene            144440..145186
FT                   /gene="map1"
FT                   /locus_tag="BLi00155"
FT   CDS_pept        144440..145186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map1"
FT                   /locus_tag="BLi00155"
FT                   /product="methionine aminopeptidase Map"
FT                   /EC_number="3.4.11.18"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00155"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39129"
FT                   /protein_id="AAU39129.1"
FT                   /translation="MIICKTPREIEIMREAGRIVALTHQELKKHIKPGISTKELDQIAE
FT                   RFITKQGAIPSFKGYNGFRGSICVSVNEELVHGIPGKRVLRDGDIISIDIGAKLNGYHG
FT                   DSAWTYPVGTISDDDQKLLDVTEESLYRGLKEAKPGERLSNISHAIQTYVESEQFSVVR
FT                   EYVGHGVGQDLHEDPQIPHYGPPNKGPRLKPGMVLAIEPMVNAGTRYVKTLADNWTVVT
FT                   VDGKKCAHFEHTIAITDAGFEILTKA"
FT   gene            145197..145526
FT                   /locus_tag="BLi00156"
FT   CDS_pept        145197..145526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00156"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39130"
FT                   /protein_id="AAU39130.1"
FT                   /translation="MYRKTPEIGQFVRMTRGREMNQYAVVIDIVDHHHVLVADGEKRKF
FT                   HSPKKKNINHLTFYDCVSPEVQNSINETGRVTNGKLRFSLLKFVREQVTDLKKGEHLNG
FT                   ERRCN"
FT   gene            145504..145722
FT                   /gene="infA"
FT                   /locus_tag="BLi00157"
FT   CDS_pept        145504..145722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="BLi00157"
FT                   /product="translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00157"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39131"
FT                   /db_xref="GOA:Q65P83"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P83"
FT                   /protein_id="AAU39131.1"
FT                   /translation="MAKDDVIEVEGTVVETLPNAMFKVELENGHTVLAHVSGKIRMHFI
FT                   RILPGDKVTVELSPYDLTRGRITYRYK"
FT   gene            145756..145869
FT                   /gene="rpmJ"
FT                   /locus_tag="BLi00158"
FT   CDS_pept        145756..145869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="BLi00158"
FT                   /product="50S ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00158"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39132"
FT                   /db_xref="GOA:Q65P82"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P82"
FT                   /protein_id="AAU39132.1"
FT                   /translation="MKVRPSVKPICEKCKVIRRKGKVMVICENPKHKQKQG"
FT   gene            145892..146257
FT                   /gene="rpsM"
FT                   /locus_tag="BLi00159"
FT   CDS_pept        145892..146257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="BLi00159"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00159"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39133"
FT                   /db_xref="GOA:Q65P81"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P81"
FT                   /protein_id="AAU39133.1"
FT                   /translation="MARIAGVDIPRDKRVVISLTYIFGIGRTTAQQILKEAGVSEDTRV
FT                   RDLTEEELGKIRDVIDKLKVEGDLRREVSLNIKRLIEIGSYRGIRHRRGLPVRGQNTKN
FT                   NARTRKGPRRTVANKKK"
FT   gene            146278..146673
FT                   /gene="rpsK"
FT                   /locus_tag="BLi00160"
FT   CDS_pept        146278..146673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="BLi00160"
FT                   /product="30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00160"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39134"
FT                   /db_xref="GOA:Q65P80"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P80"
FT                   /protein_id="AAU39134.1"
FT                   /translation="MAAARKTNTRKRRVKKNIESGIAHIRSTFNNTIVTITDVHGNALS
FT                   WSSAGALGFKGSKKSTPFAAQMAAETAAKGSIEHGLKTLEVTVKGPGSGREAAIRALQA
FT                   AGLEVTAIRDVTPVPHNGCRPPKRRRV"
FT   gene            146848..147792
FT                   /gene="rpoA"
FT                   /locus_tag="BLi00161"
FT   CDS_pept        146848..147792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="BLi00161"
FT                   /product="DNA-directed RNA polymerase alpha subunit RpoA"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00161"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39135"
FT                   /db_xref="GOA:Q65P79"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P79"
FT                   /protein_id="AAU39135.1"
FT                   /translation="MIEIEKPKIETVEISDDAKYGKFVVEPLERGYGTTLGNSLRRILL
FT                   SSLPGAAVTSIQIDGVLHEFSTIEGVVEDVTTIILNIKKLALKIYSEEEKTLEIDVQGE
FT                   GVVTAADITHDSDVEILNPDLHIATLGQNASFRVRLTAQRGRGYTPADANKRDDQPIGV
FT                   IPIDSIFTPVSRVSYQVENTRVGQITNYDKLTLDVWTDGSTGPKEAIALGSKILTEHLN
FT                   IFVGLTDEAQHAEIMVEKEEDQKEKVLEMTIEELDLSVRSYNCLKRAGINTVQELANKT
FT                   EEDMMKVRNLGRKSLEEVKAKLEELGLGLRKDD"
FT   gene            147870..148232
FT                   /gene="rplQ"
FT                   /locus_tag="BLi00162"
FT   CDS_pept        147870..148232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="BLi00162"
FT                   /product="50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00162"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39136"
FT                   /db_xref="GOA:Q65P78"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P78"
FT                   /protein_id="AAU39136.1"
FT                   /translation="MSYRKLGRTSAQRKAMLRDLTTDLIINERIETTEARAKELRSVVE
FT                   KMITLGKRGDLHARRQAAAYIRNEVADAEKNQDALQKLFSDVAPRYEERQGGYTRIMKL
FT                   GPRRGDGAPMAIIELV"
FT   gene            148374..149219
FT                   /gene="ybxA"
FT                   /locus_tag="BLi00163"
FT   CDS_pept        148374..149219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybxA"
FT                   /locus_tag="BLi00163"
FT                   /product="cobalt ABC transporter ATP-binding protein YbxA"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00163"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39137"
FT                   /db_xref="GOA:Q65P77"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P77"
FT                   /protein_id="AAU39137.1"
FT                   /translation="MNQERLIAAEDITFRYQKDADRPALDHVSFHVSKGEWLAIVGHNG
FT                   SGKSTLARALNGLILPDEGSIKVGGIKLTEETVWDVRKKVGMVFQNPDNQFVGTTVRDD
FT                   VAFGLENSGVPREDMVERVDWAVQQVNMQEFLDQEPHHLSGGQKQRVAIAGVLAARPDI
FT                   MILDEATSMLDPMGREEVLDTVRRLKDQGMVTVISITHDLNEAAKADRIIVMNSGRKFA
FT                   EGTPQEVFRLNQDLIKIGLDLPFSFQLTQMLKESGLALKGDHLTQEGLVNELWTLKSKM
FT                   "
FT   gene            149195..150064
FT                   /gene="ybaE"
FT                   /locus_tag="BLi00164"
FT   CDS_pept        149195..150064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaE"
FT                   /locus_tag="BLi00164"
FT                   /product="cobalt ABC transporter ATP-binding protein YbaE"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00164"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39138"
FT                   /db_xref="GOA:Q65P76"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P76"
FT                   /protein_id="AAU39138.1"
FT                   /translation="MDIEIKDVEHRYQMKTPFERLAIYDVNAVIKEGSYVAVIGHTGSG
FT                   KSTLLQHLNGLLKPTKGQIRLGEDVLEAGKKNKHLKALRKKVGIVFQFPEHQLFEETIL
FT                   KDIAFGPINFGMSREKAEEKAREMLKLVGLGAELSDRSPFELSGGQMRRVAIAGVLAME
FT                   PEVLVLDEPTAGLDPRGRKEIMDMFYSLHKQRNLTTILVTHSMEDAAAYADELIVMHKG
FT                   TVKAKGTPRELFSRKDDIAALGLDLPETIKFQKRLEETLGITFKAPILTIEEAASEVKA
FT                   LFQEENAL"
FT   gene            150061..150858
FT                   /gene="ybaF"
FT                   /locus_tag="BLi00165"
FT   CDS_pept        150061..150858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaF"
FT                   /locus_tag="BLi00165"
FT                   /product="cobalt ABC transporter permease YbaF"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00165"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39139"
FT                   /protein_id="AAU39139.1"
FT                   /translation="MMDNIIIGKYVPGKSVIHRLDPRTKLLTIFLFVFIVFFANNTETY
FT                   ALLGLFTVAAAALSGVPVRFLIKGMKPVFWIVLFTFLLHIFMTREGPVLADLGLFKIYE
FT                   QGLVQGIFISLRFVYLIMITTILTLTTTPIEVTDGLEHLLGPFKKLKLPVHELALMMSI
FT                   SLRFIPTLIEETDKIMKAQMARGVDFANGPVKERVKAIVPLLVPLFVSAFKRAEELATA
FT                   MEARGYRGGEGRTKYRQLTWKWKDTSVLLILAVLGVLLILLRT"
FT   gene            150869..151612
FT                   /gene="truA"
FT                   /locus_tag="BLi00166"
FT   CDS_pept        150869..151612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="BLi00166"
FT                   /product="tRNA pseudouridine synthase TruA"
FT                   /EC_number="5.4.99.12"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00166"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39140"
FT                   /db_xref="GOA:Q65P74"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P74"
FT                   /protein_id="AAU39140.1"
FT                   /translation="MRMKCTISYDGHLFYGYQVQPGQRTIQDELEKALQTLHKAKERIP
FT                   VVSSGRTDSGVHAVGQTIHFDSPLSIPEAKWPYALNALLPDDISVRKAEAVNDQFHARF
FT                   SAKRKEYRYMIYRGRHPDVFKRYYAYHVPYDLDMEKVKEASRYLVGTHDFTSFCATKTE
FT                   VKDKVRTVHELEWSDTGDGLQMRIVGSGFLYNMVRIIAGTLLDVGTGKFSPGDIEKMIL
FT                   AKNRDAAGRTAPAHGLYLWRVIYDN"
FT   gene            151773..152210
FT                   /gene="rplM"
FT                   /locus_tag="BLi00167"
FT   CDS_pept        151773..152210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="BLi00167"
FT                   /product="50S ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00167"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39141"
FT                   /db_xref="GOA:Q65P73"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P73"
FT                   /protein_id="AAU39141.1"
FT                   /translation="MRTTPMANASNIERKWLVVDAAGKTLGRLSTEVASILRGKHKPTY
FT                   TPHVDTGDHVIIINAEKIELTGKKLTDKIYYRHTQHPGGLKSRTALEMRTNYPEKMLEL
FT                   AIKGMLPKGSLGRQMFKKLNVYRGSEHPHQAQKPEVYELRG"
FT   gene            152231..152623
FT                   /gene="rpsI"
FT                   /locus_tag="BLi00168"
FT   CDS_pept        152231..152623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="BLi00168"
FT                   /product="30S ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00168"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39142"
FT                   /db_xref="GOA:Q65P72"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P72"
FT                   /protein_id="AAU39142.1"
FT                   /translation="MAQVQYYGTGRRKSSVARVRLVPGEGRIIVNNREISEHIPSAALI
FT                   EDIKQPLTLTETAGTYDVLVNVHGGGFSGQAGAIRHGIARALLEADPEYRSTLKRAGLL
FT                   TRDARMKERKKYGLKGARRAPQFSKR"
FT   gene            complement(152674..153132)
FT                   /gene="yizA"
FT                   /locus_tag="BLi00169"
FT   CDS_pept        complement(152674..153132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yizA"
FT                   /locus_tag="BLi00169"
FT                   /product="DinB family protein YizA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00169"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39143"
FT                   /protein_id="AAU39143.1"
FT                   /translation="MKGLFQYNWEVRHAWFKWCLSQPQEELVKKRSGGMGSIKKNLFHI
FT                   VDVEVSWIYAILEKPDIQPDYSHYQTIQQIARFSDLHRSEIESVIFNYSSAFEHLPVKA
FT                   AWSDEVCTQGDILRHLIAHEIHHIGQISVWTRESGSAPVSASYIGRKI"
FT   gene            153244..153687
FT                   /gene="ybaK"
FT                   /locus_tag="BLi00170"
FT   CDS_pept        153244..153687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaK"
FT                   /locus_tag="BLi00170"
FT                   /product="YbaK"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00170"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39144"
FT                   /protein_id="AAU39144.1"
FT                   /translation="MGTVVSFNNEKQKKQINLEKQLLRELSLEKMLNSAEECFAPLFHF
FT                   FSKHTDILYDGCIDFAIEAYLLGAEYGKFGYHGEPVHRAMIRSEKEEKQLLHELYEYAV
FT                   SWSEAFNVQAAYEPLYYACEYFIQSWWKEGFSQRERRFKLRLR"
FT   gene            153780..154493
FT                   /gene="cwlD"
FT                   /locus_tag="BLi00171"
FT   CDS_pept        153780..154493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cwlD"
FT                   /locus_tag="BLi00171"
FT                   /product="germination-specific N-acetylmuramoyl-L-alanine
FT                   amidase CwlD"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00171"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39145"
FT                   /protein_id="AAU39145.1"
FT                   /translation="MKKKIKWLGFLLGFVVLLCLFQYQFNNDDSWRSWNLPLSGKIIYI
FT                   DPGHGGADGGASSGELLEKDVALEVSLRIRDYLQEQGALVMLTREDDHDLAPEETRGLS
FT                   RRKAEDLRKRVDMINNSEADLYLSIHLNAIPSARWSGAQSFYYGQYEENERAAKFIQDE
FT                   LRHNLENTTRKAKRIHGIYLMQNVKKPGALVEIGFLSNPEEAKQLAKPKYQDKIAASVY
FT                   KGVLRYFTEDRDPPE"
FT   gene            154579..155640
FT                   /gene="salA"
FT                   /locus_tag="BLi00172"
FT   CDS_pept        154579..155640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="salA"
FT                   /locus_tag="BLi00172"
FT                   /product="nucleotide-binding protein SalA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00172"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39146"
FT                   /protein_id="AAU39146.1"
FT                   /translation="MLREDDVKKIVGDLDEPFLHKPLRELDAVKEIKIKPEKRHVSVKV
FT                   ALAKTGSAEQMQLQQEIVIRLKEAGAETVGLRFEELPEEVVMSYQESAKGQDQSLLNSE
FT                   KQPVFLAVASGKGGVGKSTVSVNLAVSLARIGKKVGLIDADIYGFSVPDMMGITVRPTI
FT                   EGEKVVPVERFGVKVISMGFFVEDNAPVIWRGPMLGKMLNNFFHEVEWGDVDYIILDLP
FT                   PGTGDVALDVHSMLPSCKEVIVSTPHPTAAFVAARAGAMALKTDHEIVGIVENMAYYES
FT                   VKTGEKEYVFGKGGGEKLAEELGVPILGKIPLKQPDWDDSEFAPSVYDESHPTGAIYLD
FT                   IAKKIDESIGAKA"
FT   gene            complement(155694..156275)
FT                   /gene="gerD"
FT                   /locus_tag="BLi00173"
FT   CDS_pept        complement(155694..156275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerD"
FT                   /locus_tag="BLi00173"
FT                   /product="spore germination protein GerD"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00173"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39147"
FT                   /protein_id="AAU39147.1"
FT                   /translation="MFKTAMLSISCFLFLSVTACAPTDQAAEMDYDQTKKMVVDILKTD
FT                   DGKKAIQEILNDDKLNETLVMDEKTVKETVEKTMTSKKGAEFWKKVFEDPKFAEGFAKT
FT                   LQNEHEKVLKKLMKDPEYQKMLMQVMQDPEMAKKYGELVRSQEFRSHLQEVISDTLTSP
FT                   LYRKQFEEELKKAAAESMKEEMKGGEEKQS"
FT   gene            156390..156989
FT                   /gene="kbaA"
FT                   /locus_tag="BLi00174"
FT   CDS_pept        156390..156989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kbaA"
FT                   /locus_tag="BLi00174"
FT                   /product="activator KbaA"
FT                   /note="'of the KinB-dependent pathway to sporulation,
FT                   control of the phosphorelay'"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00174"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39148"
FT                   /protein_id="AAU39148.1"
FT                   /translation="MKSRNLVRFFFSVLGVGALTTSIVGFAIEWGRYKELFLSFEVLEI
FT                   LSVLFWFIGVGMIFSVIAQMGFVIFLTIHRFALEIFRSHSLWNSIQLFLIIFVAFDLVY
FT                   LRFLFFEKDGGSIIPYIWLPLFILAVGIAAAYAKQKQSSKKTFVSALFLMFVFTVMEWF
FT                   PALRVNEEDWLYLMLLPLLACNAFQLLMLPKFQARA"
FT   gene            complement(156998..157762)
FT                   /gene="pdaB"
FT                   /locus_tag="BLi00175"
FT   CDS_pept        complement(156998..157762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdaB"
FT                   /locus_tag="BLi00175"
FT                   /product="polysaccharide deacetylase PdaB"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00175"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39149"
FT                   /protein_id="AAU39149.1"
FT                   /translation="MNHFYVWHIKRIKQLIIIMIAAFATASFFYVQNLLPLPVFSTEGG
FT                   AKAVYRGDSDTNEVALTFNISWGDQKAMPILDTLKANGIKDATFFLSASWAERHPDVVE
FT                   RIRKDGHQIGSMGYAYKNYSQMKKSEIKKDLAKARHSFQKLGLDDLTLLRPPTGQFNKD
FT                   VLDVAKQYGYTVVHYSINSDDWTNPGVQKIVQNVNGTVNAGDIVLFHASDSAKQTKEAL
FT                   PEIVHHLRSKGLKNVTVSELIANTDAKSSEVK"
FT   gene            158109..159647
FT                   /gene="rrsD"
FT                   /locus_tag="BLi00176"
FT   rRNA            158109..159647
FT                   /gene="rrsD"
FT                   /locus_tag="BLi00176"
FT                   /product="16S ribosomal RNA"
FT   gene            159829..162757
FT                   /gene="rrlD"
FT                   /locus_tag="BLi00177"
FT   rRNA            159829..162757
FT                   /gene="rrlD"
FT                   /locus_tag="BLi00177"
FT                   /product="23S ribosomal RNA"
FT   gene            162892..163006
FT                   /gene="rrfD"
FT                   /locus_tag="BLi00178"
FT   rRNA            162892..163006
FT                   /gene="rrfD"
FT                   /locus_tag="BLi00178"
FT                   /product="5S ribosomal RNA"
FT   gene            163048..163122
FT                   /gene="trnN1"
FT                   /locus_tag="BLi00179"
FT                   /note="tRNA-Asn-GTT"
FT   tRNA            163048..163122
FT                   /gene="trnN1"
FT                   /locus_tag="BLi00179"
FT                   /product="tRNA-Asn"
FT   gene            163125..163197
FT                   /gene="trnT1"
FT                   /locus_tag="BLi00180"
FT                   /note="tRNA-Thr-GGT"
FT   tRNA            163125..163197
FT                   /gene="trnT1"
FT                   /locus_tag="BLi00180"
FT                   /product="tRNA-Thr"
FT   gene            complement(163584..164753)
FT                   /gene="pbpX"
FT                   /locus_tag="BLi00181"
FT   CDS_pept        complement(163584..164753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbpX"
FT                   /locus_tag="BLi00181"
FT                   /product="putative penicillin-binding protein PbpX"
FT                   /EC_number="3.5.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00181"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39150"
FT                   /protein_id="AAU39150.1"
FT                   /translation="MARTYRTRIKKRKKQKTKRRLIIFSFLVVCGLIYLALPSGMRDHQ
FT                   ENQLQATEKKAQPEAKKKPTQNETKKSKIVTKNDNAQLDQYLKSIGFSGTALIVEDGKV
FT                   VTSKGYLYANREEMVPNTPDTVFYVGSSQKAIIATAILQLEEKGLLSVNDPVSKYLPNF
FT                   PNGSKITLYHFLTHTSGIRGHKEGRGYISPEDLIKDIEKRGVKYPTGKWDYRDSNYSVL
FT                   AYIVSMVSGEPVDQYIKKHIFKPAGMKHAGFYKTFAKESNPSTGYKLNLQKKLYTPDMP
FT                   DLSQLYGAGDIYMTAYDMYLFDKALYERKIISNESFMKMFTPNKATYGMGFYVSPGSYS
FT                   SHGVMPGYNILNSFSLTGSRYVILFSNIQNNIKSFGSVNNRIFSILNGF"
FT   gene            164928..165149
FT                   /locus_tag="BLi00182"
FT   CDS_pept        164928..165149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00182"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39151"
FT                   /protein_id="AAU39151.1"
FT                   /translation="MNKLLYRSMEDGIPVEIIYMKKSGFSKRAILVKEIKNGYVKAFCF
FT                   QKQQIRMFKIESILSVFPYKKRNSAHYA"
FT   gene            165261..166238
FT                   /gene="ybaS"
FT                   /locus_tag="BLi00183"
FT   CDS_pept        165261..166238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaS"
FT                   /locus_tag="BLi00183"
FT                   /product="YbaS"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00183"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39152"
FT                   /protein_id="AAU39152.1"
FT                   /translation="MLQTINKTLGKIMPLLTPLSVVSGVLLADYLNGLASLVPWIFAFM
FT                   TFAGSLGANFQSLKTAVAHPLPMFLALFVLHIFMPVLAWSTGHLVFSGDSLTITGLTLG
FT                   VVIPTGITSMIWAAMYKGNIGLTLSIILVDTILSPFIVPFSLSILAGAHVEMDVIGMMK
FT                   GLVGMIVIPSLLGMLVNQFSTPERTVRLSANCAPFSKVGLAAVVAINSSVVAPYLKNVD
FT                   LKFLTIAVTVFLVAFTGYLTAWLIGRLMKRPQEEIVALIFTGGMRNISAGAVLATSFFP
FT                   PQVAVPVVIGMLFQQILAALFGHLLARSELKKAHHLDKKTSLPS"
FT   gene            166273..166686
FT                   /gene="yxaJ"
FT                   /locus_tag="BLi00184"
FT   CDS_pept        166273..166686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yxaJ"
FT                   /locus_tag="BLi00184"
FT                   /product="YxaJ"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00184"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39153"
FT                   /protein_id="AAU39153.1"
FT                   /translation="MKTNRVSVMIWTLISAFLFCSMIVAASLSPLAHSGPHANEFGTLG
FT                   MWAAIGTVLLFYMLPLAVYMAGFDAMKFVMAVLCGIGLIITLTMSPVFVLIGAIGGNAS
FT                   ALLGVAGLCVLLAIVNVIWLVVAFRRTSASASF"
FT   gene            complement(166702..167571)
FT                   /locus_tag="BLi00185"
FT   CDS_pept        complement(166702..167571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00185"
FT                   /product="phenazine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00185"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39154"
FT                   /protein_id="AAU39154.1"
FT                   /translation="MDFYLVDVFAETKYTGNQLAVFKAEKNLSSDEMQKIAREINFSET
FT                   TFILGKQGNGGYDVRIFTPEKEIPFAGHPTLGTAFIIKNEIETEPSSNVILNVTAGAIP
FT                   VTFEKGADQIIWMKQNPPVFNRTFDKEMMAGVIGIDTSDMDSNFPIQEVSTGLPAVIVP
FT                   LNSLNAVKKCKINKDRFEAFMKETEASLLVFTTETYHEQNHINARVFCDCFSVPEDPAT
FT                   GSAIGGLAGYLLHHGYFNQHYLSIRAEQGFEINRPSLLHLEAQITENSTEIHVGGNVHL
FT                   IAKGSWQI"
FT   gene            complement(167677..168906)
FT                   /gene="ybbC"
FT                   /locus_tag="BLi00186"
FT   CDS_pept        complement(167677..168906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbC"
FT                   /locus_tag="BLi00186"
FT                   /product="YbbC"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00186"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39155"
FT                   /protein_id="AAU39155.1"
FT                   /translation="MGKKAIWLLAGMFVFSTLTAAAAFPDKEKKAKVSPGIEVLMNKKS
FT                   ILKGKRVGLITNPTGVNSTLTSSIDLLHQAPGIELTALYGPEHGVRGDAQAGDKVDSYI
FT                   DEKTGLPVYSLYGDTRKPTPEMLKNVDVLLFDIQDVGTRFYTYIYTMAYAMEAAKENDI
FT                   PFIVLDRPNPQNGLKVEGPVLDPDYSSFVGMYPVPLSHGMTAGELAKLFNDEFNIGADL
FT                   TVIKMKGWKRQMFFEDTGLPFVLPSPNMPTPDTSIVYPGTGLIEGTNMSEGRGTTKPFE
FT                   LIGAPYMKSTELAEKLNGLKLPGVRFRAASFNPTFSKHQNKLCHGVELYVTNRSAFKPV
FT                   NTGIAIIKTVHDLYPDDFEFLPSGNFNRLIGNGWVKTMIEQGASIDEIAKKYEAEQKRF
FT                   MNIRKKYLLY"
FT   gene            complement(168906..170837)
FT                   /gene="nagZ"
FT                   /locus_tag="BLi00187"
FT   CDS_pept        complement(168906..170837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagZ"
FT                   /locus_tag="BLi00187"
FT                   /product="N-acetylglucosaminidase NagZ"
FT                   /EC_number="3.2.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00187"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39156"
FT                   /protein_id="AAU39156.1"
FT                   /translation="MKRFLQCALIALLLSSLALQPAAREAEAKQRPEQNIKQMVSSMSL
FT                   EEKIGQMLMPDFRNWKKKGESSAKGLTEMNDEVAGIIEKYRLGGVILFAENVTGTEQTV
FT                   RLTDGLQQASPDIPLFITIDQEGGIVTRLESGTNLAGNMAVGASRSSKNAFRSGKIIGK
FT                   ELSSLGINVNFSPVLDVNNNPDNPVIGVRSFSSKPELTSKLGIQMMKGLQDEQMIATAK
FT                   HFPGHGDTAVDSHYGLPLVPHNEKRLRSVELAPFQKAIDAGIDMIMTAHVQFPAFDDTT
FT                   YKSKKDGEDIMVPATLSKKVMTDLLRKDLSFKGVVVTDALNMKAISDNFGQEEAVVMAV
FT                   KAGVDIALMPAQVTSLETEKNLARVFEALLTAVKNGDIPMEQIDQSVERILQLKIDRGI
FT                   IDHTGSEPLQKKIKYALKTVGSSKHMKYEKKMARDSATILKNDKSTLPFKPKKGDTVLI
FT                   LAPYEEQTAAIAKTISKIRKNIKVVEYRFAEKTFEEEIQKKIDEADYVITGSYVIKNDP
FT                   VVNDGVIDDSIQDSSKWATAFPRAAMKYAQANGKKFVLMSLRNPYDTANFEEAEAVIAV
FT                   YGFKGYANGRFRQPNIPAGVEAIFGKAKPKGTLPVDIPSVTRPGETLYPYGYGLNIKNG
FT                   KPLHKGGS"
FT   gene            complement(170853..172199)
FT                   /gene="amiE"
FT                   /locus_tag="BLi00188"
FT   CDS_pept        complement(170853..172199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amiE"
FT                   /locus_tag="BLi00188"
FT                   /product="aliphatic amidase AmiE"
FT                   /EC_number="3.5.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00188"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39157"
FT                   /protein_id="AAU39157.1"
FT                   /translation="MISAAASLLLLTCFFPLPSTAQTAIGNETKQRLTYPVLTKAKTPE
FT                   EAGFSSKKLKAVDRLIEQDVKAGFPGAALILIKDGKIIKKEVYGYKQKYNGLIALKHPK
FT                   KMKANTMFDLASNTKMYAVNFALQHLVSTGKLDLNKNISQYLPDFKDHPEDDVKGKNRL
FT                   RVIDLLHHNAGFPASWNYYDPKSAGHLYSQSRSKTLEYLVKTPLAYEPGTKQIYSDIDY
FT                   MLLGLIIEKITNERLDTFVENRFYRPLGLRHTLFNPLQKGFKRSHFAATERLGNTRDGT
FT                   ISFPNIRTYTLQGEVHDEKAFYSMEGVSGHAGLFSTVDDAAVLLQVMLNGGGYGRQHLF
FT                   SSSVISQFTEPSKTNPTYGLGWRLNGNTDMEWMFGKHASSKAYGHTGWTGTVTIIDPVY
FT                   QIGIVLLTNKKHSPVINPKENPNQFEGDEFATGKYGSVITAVYEALHHQ"
FT   gene            complement(172267..173634)
FT                   /gene="murP"
FT                   /locus_tag="BLi00189"
FT   CDS_pept        complement(172267..173634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murP"
FT                   /locus_tag="BLi00189"
FT                   /product="N-acetyl muramic acid-specific phosphotransferase
FT                   system EIIBC component MurP"
FT                   /EC_number="2.7.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00189"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39158"
FT                   /protein_id="AAU39158.1"
FT                   /translation="MSDEKKYAGLARLILQHIGGPSNVADHTHCMTRLRITPVNSQKTD
FT                   IDSIKALEGVIGVVEEETLQIILGTGVVQHVSDEFGKLLKSAEHVDLKESAAKHKAEIS
FT                   KKNATPFKLFLRRIASIFIPLIPALVASGLITGITKAVIQAGWLAETSQTAIILTVIGS
FT                   GLFTYLGILVGINTAKEFGGSPALGGLAGILIINPAVGEISLFGEALLPGRGGLIGILF
FT                   AAAFIAFLEKRVRRLVPHSLDIIITPTVSLLITGIVTYVVFMPVGGLISDAITSGLLAI
FT                   LDLGGIIAGFVLGATFLPLVVTGLHQGLTPVHMELINSIGDDPLLPILAMGGAGQVGAA
FT                   FAIYFKTKKAKLKRAIAGGLPSGLLGIGEPLIFGVTLPLGRPFLTACLGAGVGGAFQAY
FT                   FKIATVSIGVSGLPLSFLVHTHQVLLYILGLFISYAAGFVLTYSFGFKDDMAVEFD"
FT   gene            complement(173661..174509)
FT                   /gene="murR"
FT                   /locus_tag="BLi00190"
FT   CDS_pept        complement(173661..174509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murR"
FT                   /locus_tag="BLi00190"
FT                   /product="HTH-type transcriptional regulator MurR"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00190"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39159"
FT                   /protein_id="AAU39159.1"
FT                   /translation="MAAGGLEIIQNMLHKLPQSERKLAEYILKNPHEIVNGTIQEVSSS
FT                   AKTSGAAAIRLCKSLGLKGFQDLKMRVAGDLMKPSDQGYRDIEPQEPLHSIVQKTTSNS
FT                   IQAIRDTFENIDHEELQKAIQILINAETVHFCGIGASGIVAQDAQQKFLRINKKATAFS
FT                   DMHLVATLIANAGENDVLFAISHSGETQEIANAVRLAKKHGIKTIGLTRLGQSAVASLS
FT                   DIALYTSCSNEAPFRSAATSSRLTQLYMIDLLFLGMAAERYEDIIQYIDQTKAAIRMMG
FT                   I"
FT   gene            complement(174528..175442)
FT                   /gene="murQ1"
FT                   /locus_tag="BLi00191"
FT   CDS_pept        complement(174528..175442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murQ1"
FT                   /locus_tag="BLi00191"
FT                   /product="N-acetylmuramic acid-6-phosphate etherase MurQ"
FT                   /EC_number="4.2.1.126"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00191"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39160"
FT                   /db_xref="GOA:Q65P54"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P54"
FT                   /protein_id="AAU39160.1"
FT                   /translation="MENSHLGSLTTERRNERSKRIHQAETIDMLKIMNDEDKTVAEAVQ
FT                   EVLPDVKTAVDYAVGSLKKGGRIIYIGAGTSGRLGVLDAAECPPTFSISPESVIGIIAG
FT                   GEKALYNAVEGAEDHEAFGRRDLEAVNLSNNDTVIGIAASGRTPYVLGALKYAKKTGAK
FT                   AISLTCNENSAISQAADHSIEVVVGPEVIAGSTRMKAATAHKMILNMISTAAMIKMGKV
FT                   YENLMVDVKVSNDKLKERAIRIIQTVTGMPNETAAQALEMSNNQVKTAIIMLKTNEDAA
FT                   AAEKLLEKSEGDIEKALSIYEKS"
FT   gene            complement(175617..176093)
FT                   /gene="ybbK"
FT                   /locus_tag="BLi00192"
FT   CDS_pept        complement(175617..176093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbK"
FT                   /locus_tag="BLi00192"
FT                   /product="DUF523 family protein YbbK"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00192"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39161"
FT                   /protein_id="AAU39161.1"
FT                   /translation="MCKRGDRIMILVSSCLAGVECRYNGSHSYVEKINKLVEEKKAVMA
FT                   CPELLGGFQTPREPAEIIGGTGEDVLDGKAVIKTQSGNDVTDLYVKGAYQTLEMARQIK
FT                   ADTIVLKENSPSCGSSHIYDGSFSSKKIAGNGLTAALLKKEGFRVISEHQIDEL"
FT   gene            176252..176326
FT                   /gene="trnE2"
FT                   /locus_tag="BLi00193"
FT                   /note="tRNA-Glu-TTC"
FT   tRNA            176252..176326
FT                   /gene="trnE2"
FT                   /locus_tag="BLi00193"
FT                   /product="tRNA-Glu"
FT   gene            176477..176552
FT                   /gene="trnV1"
FT                   /locus_tag="BLi00194"
FT                   /note="tRNA-Val-TAC"
FT   tRNA            176477..176552
FT                   /gene="trnV1"
FT                   /locus_tag="BLi00194"
FT                   /product="tRNA-Val"
FT   gene            176611..176683
FT                   /gene="trnT2"
FT                   /locus_tag="BLi00195"
FT                   /note="tRNA-Thr-TGT"
FT   tRNA            176611..176683
FT                   /gene="trnT2"
FT                   /locus_tag="BLi00195"
FT                   /product="tRNA-Thr"
FT   gene            176692..176776
FT                   /gene="trnY1"
FT                   /locus_tag="BLi00196"
FT                   /note="tRNA-Tyr-GTA"
FT   tRNA            176692..176776
FT                   /gene="trnY1"
FT                   /locus_tag="BLi00196"
FT                   /product="tRNA-Tyr"
FT   gene            176781..176852
FT                   /gene="trnQ1"
FT                   /locus_tag="BLi00197"
FT                   /note="tRNA-Gln-TTG"
FT   tRNA            176781..176852
FT                   /gene="trnQ1"
FT                   /locus_tag="BLi00197"
FT                   /product="tRNA-Gln"
FT   gene            176978..177892
FT                   /gene="rocF1"
FT                   /locus_tag="BLi00198"
FT   CDS_pept        176978..177892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocF1"
FT                   /locus_tag="BLi00198"
FT                   /product="arginase RocF"
FT                   /EC_number="3.5.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00198"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39162"
FT                   /protein_id="AAU39162.1"
FT                   /translation="MLKQQISMIGVPMDLGQLRRGVDMGPSAIRCAGVNERLECLCQDI
FT                   EDLGDMTIGQREDEKEGGEPASEELRNLKAITKASVKLAETVDNIVASGAFPLVLGGDH
FT                   SIAIGTLAGLAKHYQNLGVIWYDAHADLNTKETSPSGNIHGMPLAISLGIGHEGLTAIY
FT                   GKEAKIKAENIVIIGARSLDDGEKELIRDKGIKVYTMHEIDRLGMTRVMEETIDYLRGR
FT                   TDGVHLSLDLDALDPNDAPGVGTPVAGGISYRESHLAMEMLEESKLITSAEFVEVNPIL
FT                   DEKNRTAEAAVALMGSLFGEKLL"
FT   gene            178118..178681
FT                   /gene="sigW"
FT                   /locus_tag="BLi00199"
FT   CDS_pept        178118..178681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigW"
FT                   /locus_tag="BLi00199"
FT                   /product="RNA polymerase sigma factor SigW"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00199"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39163"
FT                   /protein_id="AAU39163.1"
FT                   /translation="METMIKKRIKQVKKGDRNAFADIVDIYKDKIYQLCYRMLGNAHEA
FT                   EDIAQEAFIRAYVNIDSFDINRKFSTWLYRIATNLTIDRIRKKKPDYYLDAEVAGTEGL
FT                   TMYSQVAADVALPEDEVVSLELHSTIQEKILRLPDKYRTVIVLKYIDELSLIEISEILN
FT                   IPVGTVKTRIHRGREALRKQLRDL"
FT   gene            178695..179315
FT                   /gene="rsiW"
FT                   /locus_tag="BLi00200"
FT   CDS_pept        178695..179315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsiW"
FT                   /locus_tag="BLi00200"
FT                   /product="anti-sigma-W factor RsiW"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00200"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39164"
FT                   /db_xref="GOA:Q65P50"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P50"
FT                   /protein_id="AAU39164.1"
FT                   /translation="MSCPEHIVQLMHKYLDGDILPEDETRLKEHLQSCEGCKKHLHEME
FT                   KSIALVQSTSHLTAPANFTANVLANLPKEKRTASINRWLKAHPFLVAAALFAILMGGSF
FT                   FSSWKNDHDFSVSSQPNLVVKNNTVIVPEGEVVKGDVTVKNGKLIIEGKVDGDVTIVNG
FT                   EKYTASAGQVTGQIHEINEVFDWIWYKIKSTGKSVFGVKESKE"
FT   gene            179481..180302
FT                   /gene="ybbP"
FT                   /locus_tag="BLi00201"
FT   CDS_pept        179481..180302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbP"
FT                   /locus_tag="BLi00201"
FT                   /product="YbbP"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00201"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39165"
FT                   /protein_id="AAU39165.1"
FT                   /translation="MAFEDIPFLQYLGDAVDILLVWYVIYKLMMVIRGTKAVQLLKGIV
FT                   VIVLVRLASQYLGLSTLQWLVDQAITWGFLAIIIIFQPELRRALEQLGRGRFFSRSGTP
FT                   EEEQQQKTIDAITKAIKYMAKRRIGALLTIERETGMGDYIETGIPLNAKVSSELLINIF
FT                   IPNTPLHDGAVIMKNDEVAAAACYLPLSESPFISKELGTRHRAAVGISEVTDSLTVVVS
FT                   EETGGISVAKNGDLHRDLSEEALKNMLEAEFKKNSRETSSNRWYWRAKKNG"
FT   gene            180295..181611
FT                   /gene="ybbR"
FT                   /locus_tag="BLi00202"
FT   CDS_pept        180295..181611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbR"
FT                   /locus_tag="BLi00202"
FT                   /product="putative signal peptide-containing protein YbbR"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00202"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39166"
FT                   /protein_id="AAU39166.1"
FT                   /translation="MDKFLNNPWAVKVVALLFAFLLYFAVHSAQAPTPKKPGESFFPTS
FT                   TTDEATLTDIPVKSFYDDENYVVTGVPQTVNVTIKGPTGTVKKVRQVKDFEIYADMQNL
FT                   KTGRHKVELKARNVADGLTLTINPSVTTVTIEEKTTKEFPVEVDFYNKNKMKDGYTPEL
FT                   PIINPKNVSVTGSKAVIDRIQNIKATINLEGVDQTVEKEAKLTVYDKDGNVLPVEVSPS
FT                   VVKITVPVTSPSKKIPVKVDRKGSLPDGISISSLDISPGEVTVYGPQNVLDSLEFVEAD
FT                   EIDLSKIKDDTELEAGIKVPDGAKKVSPEKVKIKVKVDKEEEKKLKNVSIKTAGLNDSR
FT                   DLEFLDPKSGKLDITAKGSTAAIEKLQPSDVELYVNVADLDDGEHNVKLEVNGPQNMTW
FT                   SLPRQSIRVKISSQTTQNEKNNGQDEEEENHSEKDSQPS"
FT   gene            181608..182978
FT                   /gene="glmM"
FT                   /locus_tag="BLi00203"
FT   CDS_pept        181608..182978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmM"
FT                   /locus_tag="BLi00203"
FT                   /product="phosphoglucosamine mutase GlmM"
FT                   /EC_number="5.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00203"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39167"
FT                   /db_xref="GOA:Q65P47"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P47"
FT                   /protein_id="AAU39167.1"
FT                   /translation="MNQKGAILMGKYFGTDGVRGVANSELTPELAFKVGRFGGYVLTKD
FT                   KERPKVLIGRDTRISGHMLEGALVAGLLSIGAEVMRLGVISTPGVAYLTKAMDAEAGVM
FT                   ISASHNPVQDNGIKFFGGDGFKLSDEQELEIERLMDQPEDHLPRPVGADLGMVNDYFEG
FT                   GQKYLQFLKQSADEDFTGIHVALDCAHGATSSLATHLFADLDADVSTMGTSPNGLNIND
FT                   GVGSTHPEALAEFVKEKGADVGMAFDGDGDRLIAVDEKGNIVDGDQIMYICAKYLKSEG
FT                   RLTDNTVVSTVMSNLGFYKALEAEGIKSVQTAVGDRYVVEAMKKGGFTLGGEQSGHLIF
FT                   LDYNTTGDGLLSAIMLMNTIKMTGKPLSELAAEMQKFPQLLLNVKVTDKHKVTENEKVK
FT                   AVIEEVEKEMNGDGRILVRPSGTEPLVRVMAEAKTKELCEKYVGRIADVVKAEMGAE"
FT   gene            183421..185223
FT                   /gene="glmS"
FT                   /locus_tag="BLi00204"
FT   CDS_pept        183421..185223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="BLi00204"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase GlmS"
FT                   /EC_number="2.6.1.16"
FT                   /note="isomerizing"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00204"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39168"
FT                   /db_xref="GOA:Q65P46"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65P46"
FT                   /protein_id="AAU39168.1"
FT                   /translation="MCGIVGYIGQLDAKEILLKGLEKLEYRGYDSAGIAVANEDGVHVF
FT                   KEKGRIADLRAAVDANVKSQAGIGHTRWATHGEPSRLNAHPHQSASGRFTLVHNGVIEN
FT                   YVQLTREYLHDVTLKSDTDTEVVVQVIEQFVNNGLDTEEAFRQTLMLLKGSYAIALFDH
FT                   ENKETIYVAKNKSPLLVGLGDNFNVVASDAMAMLQVTNEYVELMDKEMVIVTDKKVVIK
FT                   NLDGELMSRASYIAELDASDIEKGTYPHYMLKEIDEQPLVMRKIIQTYQDENGKLSIPG
FT                   DISNAVAEADRVYIIACGTSYHAGLVGKQFIETWAKVPAEVHVASEFSYNMPLLSEKPL
FT                   FIFISQSGETADSRAVLVQVKKLGHKALTLTNVPGSTLSREADYTLLLNAGPEIAVAST
FT                   KAYTAQIAVLAILAAVTAESRGKELGFDLVKELGIIGNAMEALCDQKDEMEMIAREYLT
FT                   VTRNAFFIGRGLDYFVCLEGSLKLKEISYIQAEGFAGGELKHGTIALIEDGTPVIALAT
FT                   QEHVNLSIRGNVKEVTARGANPCVISLKGLEEADDRFVLPEVHPELAPLVSVIPLQLIA
FT                   YYAALHRGCDVDKPRNLAKSVTVE"
FT   gene            185414..185737
FT                   /locus_tag="BLi00205"
FT   CDS_pept        185414..185737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00205"
FT                   /product="DUF2846 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00205"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39169"
FT                   /protein_id="AAU39169.1"
FT                   /translation="MNNETYIEVNRTSQLMNKMRKFTVLIDGVEAGKIKDGGRLRIDLE
FT                   PGEHEIQVKIDWCVSQALRFTLDEGEVLKFRCGSPVRGWKMFFGLFYVLADPEKYSFIE
FT                   LEE"
FT   gene            complement(185880..186488)
FT                   /locus_tag="BLi00206"
FT   CDS_pept        complement(185880..186488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00206"
FT                   /product="putative ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00206"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39170"
FT                   /protein_id="AAU39170.1"
FT                   /translation="MFNLILKDIILQKKTLAASFLVLCVYLMLDISPIWVGVVFSIVIS
FT                   MYAFSIDEKSSIHMLLNSLPYTRKEIVSSKYIVVVLFTSMVAAAIFIVHFIIHREFTIW
FT                   KDILLMVAIVMTAASFMLPFCYKFKSNYLVIASIAAFGLYMLTINFLVQNLNDQIREFI
FT                   HMLLTLQNTFLYLIVAISIITLYGCSWLLSIRIYRNKVF"
FT   gene            complement(186469..187353)
FT                   /locus_tag="BLi00207"
FT   CDS_pept        complement(186469..187353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00207"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00207"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39171"
FT                   /protein_id="AAU39171.1"
FT                   /translation="MMDNVIELRHVHKSFDGFQLKDFSMSVKKGFITGFIGGNGVGKST
FT                   TIKLIMNLLQPDSGTITVFGMNYKEHEKEIKQRIGFVFDSNIFYEHLTLAKMKDIVKRS
FT                   YVNWDEQVFNDYVNTFNLPLTKKIKTFSKGMIMKASLTVALSHHAELIIMDEPTSGLDP
FT                   IFRRELLEILHQLMQDGDKTIFFSTHITTDLDKIADYITFIDKGEHIFTKDFYEIEEQY
FT                   AIVKGGMELLDRETEQEFIAVRKSTHGFEALTANKSRTEKIFGDMALIEKPTLEDIMFY
FT                   TKKGAKEHVQLNS"
FT   gene            complement(187350..187727)
FT                   /locus_tag="BLi00208"
FT   CDS_pept        complement(187350..187727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00208"
FT                   /product="putative HTH-type transcriptional repressor"
FT                   /note="YtrA-like"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00208"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39172"
FT                   /protein_id="AAU39172.1"
FT                   /translation="MKIIISNSSKQPIYEQIYTQIKDQILANELKPGQPLPSMRQLAKD
FT                   MNVSLITSKRAYEELEKNGFIYSVVGKGSFVSDQNDEIMKEGKMKAIEEQLSAVIKNSK
FT                   DIGVTLTELKDLLTILYQEEE"
FT   gene            187962..188210
FT                   /locus_tag="BLi00209"
FT   CDS_pept        187962..188210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00209"
FT                   /product="HTH-type transcriptional regulator"
FT                   /note="YbzH-like"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00209"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39173"
FT                   /protein_id="AAU39173.2"
FT                   /translation="MQWLKEPDRHFKPHEGIDMNTIGVCVSQITDKLKMTQSTASQYLA
FT                   ILLRAGLIKAERIGKYTYYKRDEEAIGKLADFLKTEI"
FT   gene            188355..189527
FT                   /gene="ybcL"
FT                   /locus_tag="BLi00210"
FT   CDS_pept        188355..189527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcL"
FT                   /locus_tag="BLi00210"
FT                   /product="putative major facilitator superfamily protein
FT                   YbcL"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00210"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39174"
FT                   /protein_id="AAU39174.1"
FT                   /translation="MFSTWKIYLLAIISFLVGTSEYIISGILDQIAHTLGITLAAAGQL
FT                   ITIFSLVYAVFTPVLMALTASMDRRKLMMYALGLFVIGNILAFTLPGYGWFVAARVVMA
FT                   LGAGMVVVTALTIAAKIAPAGKQGSAIATVVMGFTASLIIGVPLGRMTAEALGWKSVFG
FT                   GIALLGFIAMIVLFLTLPHTEGDKPVPLLQQLSLLKKRKVAMGLSVTFFWLGGYSVAYT
FT                   YLSPYLLTVSGISGNLLSGVLLIFGIASLVGSKFGGYSTDKWGVPFTLVGGMALHIIAL
FT                   ILLSLVTHSYVGVLLILILWSFAAWSTGPTQQYHLATLEPELSGVLLGINQSMMQFAMA
FT                   AGAGIGGIFVEKVSLASITWFGALGVMIAIVVVLTTFSSRKAAHVREISS"
FT   gene            complement(189776..190180)
FT                   /locus_tag="BLi00212"
FT   CDS_pept        complement(189776..190180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00212"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39175"
FT                   /protein_id="AAU39175.1"
FT                   /translation="MNFQLEEAIEILERTPQTLSQLLTGLSNPWISCDEGEDTWNAFDV
FT                   VGHLIEGEKNNWLPRIKMIVTKGATETFPPFDRFSQLNQNDGKTIEQLLNEFAEIRRAN
FT                   LKTLRQILDPETDFEQTGMHPEFGIVKLRE"
FT   gene            complement(190209..191945)
FT                   /gene="bmrA"
FT                   /locus_tag="BLi00213"
FT   CDS_pept        complement(190209..191945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bmrA"
FT                   /locus_tag="BLi00213"
FT                   /product="antimicrobial peptide ABC transporter ATP-binding
FT                   protein and permease BmrA"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00213"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39176"
FT                   /protein_id="AAU39176.1"
FT                   /translation="MKTENNNSMKPFFSMILTSGVPRLALSAGLTASLVTTLVGLSIPL
FT                   LTREMVDGFSANSINLALSGILALVFIVQAVCDGFSTYFLSYAGQKVVASLRERMWFKL
FT                   LRLPVRYFDEKTSGETVSRVVNDTGIVESLISDHFPQFVSGIITIVGSVVILLIMDWKM
FT                   TLLMLISVPITTFIMIPLGMKMQRISKTMQDETASFTGHVQQTLSEIRLMKASNAEHTE
FT                   KMKGLSGISKLFQYGLKEARIFALVSPFMHLVIMIVIVAIIGYGGIRVSEGTMSAGSLI
FT                   AFLLYLFQIIFPITSFTMFFTQLQKAKGATERIIEIMHSEEEEGQEGLEMDISNLPIHV
FT                   ENVTFTYAGGEPVLRGVSFDVDPGQMIAFVGPSGGGKTTMFGLLERFYEPDSGAINIGE
FT                   TPISKLSMKSWRSQIGYVSQDSPMMSGTIRENLCYGLDHADSIDDQELWKVAEMAYADT
FT                   FIKQFPEQLDTEVGERGVKLSGGQRQRIAIARAFLRDPKILMMDEATASLDSQSEAIVQ
FT                   QALARLMEGRTTFVIAHRLSTIVNADQIMFIEKGEITGRGRHHELIASHALYREFAERQ
FT                   LT"
FT   gene            192140..192784
FT                   /gene="ywbO"
FT                   /locus_tag="BLi00214"
FT   CDS_pept        192140..192784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ywbO"
FT                   /locus_tag="BLi00214"
FT                   /product="YwbO"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00214"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39177"
FT                   /protein_id="AAU39177.1"
FT                   /translation="MTINIKVYSDYVCPFCFLGKDQLEKAIEGKDVEVEWLPFELRPRP
FT                   SEQLDPLNDPAKLAMWDGAIKPRIEAWGVNMKLPNVSPHPYTDLAHEGYHFAKEHGKGK
FT                   AYNDRVYKAFFQEEQDIGDIDVLTSLAKEAGLDEHAFKEALSARTYQDVQRKALQHAYE
FT                   EAGITAVPTFIIGNERIAGAAAKEVFEQAIEKESRQKPVDGLQCDLDGNNC"
FT   gene            192969..193277
FT                   /locus_tag="BLi00215"
FT   CDS_pept        192969..193277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00215"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39178"
FT                   /protein_id="AAU39178.1"
FT                   /translation="MVKTKLSKPFVYEATGCLHRPGNDIRALFSYINSNIPEGEDIEVY
FT                   SCWDGEEDKEKDDRLDFFIDIENLQLGKHVKLDKKKYIDEIAGLFYFEERQLVKIRK"
FT   gene            193352..193876
FT                   /locus_tag="BLi00216"
FT   CDS_pept        193352..193876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00216"
FT                   /product="putative activator of Hsp90 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00216"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39179"
FT                   /protein_id="AAU39179.1"
FT                   /translation="MSDHKAVHSVQAKAEGKTLVMERSFEAPRELVFKAFSGSVHLESW
FT                   WGPKGWQTANSRFEFQPDGVWLYCMECRDQNQGEFYGRKSCGKAVFQEIAAPEKIVYTD
FT                   MFTDEEGNVVPGMPEILNEVYFQERDVGTKLITRSHFSSPKELQQLLDKGMVEGFSSQL
FT                   ERLEDYLKAIR"
FT   gene            193985..194875
FT                   /gene="aadK"
FT                   /locus_tag="BLi00217"
FT   CDS_pept        193985..194875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aadK"
FT                   /locus_tag="BLi00217"
FT                   /product="aminoglycoside 6-adenylyltransferase AadK"
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00217"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39180"
FT                   /protein_id="AAU39180.1"
FT                   /translation="MRTEQEIIDLVLKVAREDSRVRAVGMNGSRTNPNVPRTNPNVPKD
FT                   PFRDYDIVYVVTDMQSFLDEPGWVDVFGERIIMQTPEAMELFPNELGNRFSYLMLFTDG
FT                   SRIDLILVPLEEKLEYSREDGLTVILLDKDQDLPVIPPPTDREYWVQKPSPQCFADCCN
FT                   EFWWTSTYVAKGLWRQEILYALDHLNLVRAMLLKMLEWKVGFETGFSLSIGKNAKFLDR
FT                   YVDQNTWERLLETYPPADYKRVWNSLFKMWELFEETAAAVAEHLNEQYLFAEAEKVRQY
FT                   LRRVQQLKPDAKEID"
FT   gene            194939..195886
FT                   /locus_tag="BLi00218"
FT   CDS_pept        194939..195886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00218"
FT                   /product="kinase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00218"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39181"
FT                   /protein_id="AAU39181.1"
FT                   /translation="MFSIKKMLQNHYGIDSVNISPEQGGWTALAYQVTDGEAAFFLKVY
FT                   DKNRASTAKWAALIDDYIPVLGWLGDHTALNGRLPVPLLTTAGEYKCEDDDAVYMLYEY
FT                   IAGETIGDQPLGKGCVEKLAGIIAELHRYDETIPVKTEGIKEKYDISFLDEMTQWLDHL
FT                   PCELATLIQPYSGAIRDMMESALSLADDLKCSGRRLALCHTDVHGWNLMKTGGELILID
FT                   WEGLKLAPVEADLMFFANQPYAQEFLRVYCETHKGFEIDQNALRFYQIRRRLEDIWEFT
FT                   EQLAFDIQTEKEKAETMSLLKNELEAIKDSKTGY"
FT   gene            195909..196628
FT                   /gene="yfnB"
FT                   /locus_tag="BLi00219"
FT   CDS_pept        195909..196628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfnB"
FT                   /locus_tag="BLi00219"
FT                   /product="HAD-hydrolase YfnB"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00219"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39182"
FT                   /protein_id="AAU39182.1"
FT                   /translation="MKNYRTLFFDVDDTLLDFGAAEKSALRMLFEEQQIRLTAEIEANY
FT                   KRINQGLWRVFEKGEMDRDQVVNTRFSLLFKEYGLEADGVLLEKKYRSFLEEGHQLIDG
FT                   AFELIKSLRDQYDLYIVTNGVSKTQYKRLQASGLYPMFKGIFVSEDTGFQKPMKEYFDY
FT                   VFERIPHFSVDQGLIIGDSLTADIEGGRLAGLDTCWMNPGMIANDTGIVPTYQIQKLDE
FT                   LYYILNIEKESAAGHCL"
FT   gene            196922..198292
FT                   /gene="ybxG"
FT                   /locus_tag="BLi00220"
FT   CDS_pept        196922..198292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybxG"
FT                   /locus_tag="BLi00220"
FT                   /product="amino acid permease YbxG"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00220"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39183"
FT                   /protein_id="AAU39183.1"
FT                   /translation="MANKELKRGLGARHIQMIALGGTIGVGLFMGSSSTIKWTGPSVLL
FT                   AYAICGIFIFFIMRAMGEMLYVEPSTGSFATFGHQYIHPLAGYMTAWSNWFQWVIVGMS
FT                   EIIAVGEYMKYWFPDLPAWIPGIIAMAILGGANLVSVKSFGEFEFWFAMIKIVTIVLMI
FT                   AAGFGIIFFGFGNGGQAIGFSNLWSHGGFFTGGFSGFFFALSLVIAAYQGVELIGITAG
FT                   EAKDPQNTLRHAIQSIIWRILIFYIGAIFVIVTVYPWDELNAIGSPFVSTFAKVGITAA
FT                   AGIINFVVMTAAMSGCNSGIFSAGRMLYTLGVNGQAPKFFTKISRNGVPLYGTIAVLIG
FT                   LAIGVVLNYIAPPNIFVYVYSASVLPGMIPWFVILLSHIGFRKAKGAEIDKHPFKMPFA
FT                   PVTNYLTIGFLLMVLVGMWFNNDTRVSLIVGVIFLAVVAASYYVFGIGKRASADGNK"
FT   gene            complement(198676..199974)
FT                   /gene="citM"
FT                   /locus_tag="BLi00221"
FT   CDS_pept        complement(198676..199974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citM"
FT                   /locus_tag="BLi00221"
FT                   /product="Mg(2+)/citrate complex secondary transporter
FT                   CitM"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00221"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39184"
FT                   /protein_id="AAU39184.1"
FT                   /translation="MLAILGFFMMLVFMVLIMTKRLSVLTALVLTPIVFALIAGFGFSD
FT                   VGDMMISGIQQVAPTAVMIMFAILYFGIMIDTGLFDPMVTKILKMVKGDPLKIVVGTAV
FT                   LTMLVALDGDGSTTYMITTSAMLPLYLLLGIRPIILAGIAGVGMGIMNTIPWGGATPRA
FT                   ASALGVDPAELTGPMIPVIVSGMLCMIGVAYMLGKAERKRLGVIELKHPAGANETAAAA
FT                   EDEWKRPKLWWFNLLLTLSLIGLLISGKVSLTVLFIIAFCIALIVNYPNLDHQRQRISA
FT                   HSSNVLAIGSMIFAAGVFTGILTGTKMVDEMAISLASMIPEQMGGFIPMIVALTSGIFT
FT                   FLMPNDAYFYGVLPILSETAVAYGVNKVEIARASIIGQPIHMLSPLVPSTHLLVGLVGV
FT                   SIDDHQKFAIMWAVLAVIVMTGCALLIGSISIY"
FT   gene            complement(200179..201138)
FT                   /gene="yflP"
FT                   /locus_tag="BLi00223"
FT   CDS_pept        complement(200179..201138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yflP"
FT                   /locus_tag="BLi00223"
FT                   /product="putative signal peptide-containing protein YflP"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00223"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39185"
FT                   /protein_id="AAU39185.1"
FT                   /translation="MKNFAIIMICLLILMSGDERQSSAPRPPGGPVEIVVPAEPSGGWD
FT                   LTAQAIQSVLKQKQVIKSEVKIVYKPGSGGDKGWKYINSSDTYTIGMTSSLMLSNYILG
FT                   QSKLKTDDFTPLAILAKEWQTIALPKGSEIKSGKDLLNEIKKNPGKVKIGFSPGLGNDD
FT                   QLSFVRAADMYGVDPFNIQYLQYESSEELIQALIRHEIDAASMTLSEAKTYERSGSITL
FT                   GAVTSDKRLPAYPHVPTWREQGIPFVFSHWRGVLGPKNMTKEEISYWDQVFKKITSSPE
FT                   WKQKINEQEWESYYLNSKETQRFLEEQSAFYQNIMAGD"
FT   gene            complement(201141..201821)
FT                   /gene="citT"
FT                   /locus_tag="BLi00224"
FT   CDS_pept        complement(201141..201821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citT"
FT                   /locus_tag="BLi00224"
FT                   /product="two-component response regulator CitT"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00224"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39186"
FT                   /protein_id="AAU39186.1"
FT                   /translation="MIDIVIAEDDFRVAQIHERLIEQLDGFNIIGKAANAKETMEILEV
FT                   RKADLLLLDIYMPDEMGTTLIPVIRKRFPEVDIMIITAATETCHLQESLRAGIVHYLIK
FT                   PVTAEKFKQVLLQYKKKRQTLLSQPQVSQSMIDQIFGDFSSGSRQAEDLPTGINSITLQ
FT                   KIRDVLRDAAKGMTAEELGEKMGASRTTARRYAEYLVSKEEARAELEYGIIGRPERKYY
FT                   LADE"
FT   gene            complement(201818..203434)
FT                   /gene="citS"
FT                   /locus_tag="BLi00225"
FT   CDS_pept        complement(201818..203434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citS"
FT                   /locus_tag="BLi00225"
FT                   /product="two-component sensor histidine kinase CitS"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00225"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39187"
FT                   /protein_id="AAU39187.1"
FT                   /translation="MPVVKKRVNFSLQTKIMGLIAALLILVIGLLTVTFAVQQTKEGRK
FT                   QSEQLAVQTAKTISYMPPVKELFQKKRGHKGEAQEVIEQMKEQTGAYTIYVLNEKGEIK
FT                   IASEKRGQTKLTRSRKILFGGSHISKTKNDGRMVIRGSAPIIQEQSGYSKVIGSVSVDF
FT                   LLNETEQRIKENVRKLSFMAVLVLLIGFAGAAALAKSIRKDTLGLEPQEIASLYRERNA
FT                   MLRAIKEGIIATNREGVVTMMNVSAAEMLRLPEPVVNRPIDDILPGAGIMSVLQQRQML
FT                   LNQEVCVNDQVFILNTKMMLQNGQTYGIVVSFRQKTELKRLIDTLTEVQKYSEDLRAQT
FT                   HEFSNKLYVILGLLELGEYEAAIDLIKEEYAIQNEQHDILFKNIHSQQVQAILLGKMGK
FT                   ASEKKVKLSIDENSTLEPLPEHIGMSHLITIIGNLIDNAFEAVAEQNVRLVSFFITDIG
FT                   RDIVIEVADTGCGVAPDKMKAIFERGYSSKGMKRGYGLANVKESVRELGGWIEVANQKG
FT                   GGAVFTVFIPKEKQTREGESI"
FT   gene            complement(203932..204828)
FT                   /locus_tag="BLi00226"
FT   CDS_pept        complement(203932..204828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00226"
FT                   /product="HTH-type transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00226"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39188"
FT                   /protein_id="AAU39188.1"
FT                   /translation="MNLHALRLFYSVAETGSVTQAAKQLSISQPAVTSQIKKLEREIDC
FT                   TLFVPKGRGILLTQSGAELAKQAKRLFSLEKEIESYVEQLREGSIGKLRIASTFLPANY
FT                   LLPRWLSRFKQQFPKTEVEITTTNFQKACEQLINYEADIGLIGGTTEFGPFLKGTLLLE
FT                   DDMLFVVNQKHKFASKHVALEEIVKEPFVFREEGSFSREKLISLCNLHNAGKPNMGVQI
FT                   NGLNETIRTVMEGYGVTFVSALEVNEYIARGDIAKVHVDKAVIKNPISLCVRTEDHLSP
FT                   SALNFIQMIDSTDEYPL"
FT   gene            204951..206168
FT                   /locus_tag="BLi00227"
FT   CDS_pept        204951..206168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00227"
FT                   /product="(S)-2-hydroxy acid-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00227"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39189"
FT                   /protein_id="AAU39189.1"
FT                   /translation="MSTLILNKTAYSKSPYDVWLKGLDEPVAMLTSTDRADECRNYDVI
FT                   EAFDDYPVNGCIEMRALELNETYHFKTIIASSEFDMLRAGKLRSLLGIKGQSYKSALLF
FT                   RNKILMKEQVRKAGVKVPDFKKIDSAADLYTFVQTFGFPVVVKPIYGSGSVDTTVLRNR
FT                   QDVWNVLAKGLPDHLEVESFIEGDMYHIDGLILDEEIVLSWPSRYINGCLAFQDHQFLG
FT                   SLQLELKNPLTRRLTDFVQKALAALPVPNTTTFHAEVFHTPDDELVFCEVASRTGGAMV
FT                   REATVQTFGFDINEVCVKAQCGLEFHIPEVDNNPDRLSGWLLIPPKDGVLKEIKPAPAA
FT                   DWIAKQNISAQAGDRFHGSSSSVDAIASCLIIGRTEAELRGRISRLATWFHDHTVWEKN
FT                   SDVCAI"
FT   gene            206152..207378
FT                   /locus_tag="BLi00228"
FT   CDS_pept        206152..207378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00228"
FT                   /product="major facilitator superfamily protein"
FT                   /note="YqjV-like"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00228"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39190"
FT                   /protein_id="AAU39190.1"
FT                   /translation="MFAQFKAFSRLHPLIRFLLIGTLVTKAAKSMTTPFLALYLHMKTG
FT                   ADFGTIGLVIGLGYFSSTVGGVVGGALSDKIGRKKVMLSSIFIWSFVFILFGLVHDFMW
FT                   FLLLNILSWLCHSCFEPVSKALMAELSEREMRFRIFSLRYLAINVGAAVGPLLGAYFGL
FT                   AKTGTPFIITGLVYFGYAILLSLMMIRLTTVKETKIAPEKVQAGSVLKTLKQDKALRLY
FT                   IAGGILFLFSYSQMESTLLQYLNNDFANGVKIFSTLITLNAVTVILLQVPLTRLFERYK
FT                   SLTTISIGTVFCILGNIGFSIANGWIVFMLSMFVLTIGEILCFPSMNVLLDELAPDHMK
FT                   GAYYGMQNLYNIGEFLGPWLGGMMLALYGGKAVFLIAACSVFLALGAYHVGRRKFLSAQ
FT                   HYGVSPFSY"
FT   gene            207449..207697
FT                   /gene="csgA"
FT                   /locus_tag="BLi00229"
FT   CDS_pept        207449..207697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csgA"
FT                   /locus_tag="BLi00229"
FT                   /product="putative sigma-G-dependent sporulation-specific
FT                   protein CsgA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00229"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39191"
FT                   /protein_id="AAU39191.1"
FT                   /translation="MDTTLGYLRESLSNHLEHGIGQNIYRKIVSGRYANEEEFVEHLEE
FT                   REMEFLNQVLEHEMKYALNEQDHKRTRELNEVYELLF"
FT   gene            207714..207905
FT                   /gene="ybxH"
FT                   /locus_tag="BLi00230"
FT   CDS_pept        207714..207905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybxH"
FT                   /locus_tag="BLi00230"
FT                   /product="YbxH"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00230"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39192"
FT                   /protein_id="AAU39192.1"
FT                   /translation="MGAIERNGYTFEPEYSVTRQNGAIHVYRRGRFVEEIPFEFHGEFP
FT                   EHDLIEELVNHYCYENKI"
FT   gene            complement(208026..208292)
FT                   /gene="ybyB"
FT                   /locus_tag="BLi00231"
FT   CDS_pept        complement(208026..208292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybyB"
FT                   /locus_tag="BLi00231"
FT                   /product="YbyB"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00231"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39193"
FT                   /protein_id="AAU39193.1"
FT                   /translation="MKQKNLISGLAVVAGVTAYMLKDETNRQKLKSYLQNVKEKIPYFS
FT                   EKHNVDSFPVEKAGHPSPHDIEDNKMVSEGSMYPVQYYDEKKK"
FT   gene            complement(208350..210427)
FT                   /pseudo
FT                   /gene="yyaL"
FT                   /locus_tag="BLi00232"
FT                   /note="hypothetical protein YyaL"
FT   gene            210927..212846
FT                   /gene="thrZ"
FT                   /locus_tag="BLi00234"
FT   CDS_pept        210927..212846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrZ"
FT                   /locus_tag="BLi00234"
FT                   /product="threonyl-tRNA ligase ThrZ"
FT                   /EC_number="6.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00234"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39196"
FT                   /protein_id="AAU39196.1"
FT                   /translation="MSESLIKVQFKEGNTKEFPKGITIKRIAESISTTLRKHAVVAKVD
FT                   EKFVDLSYTLDKDVKLDIFTLDSKEGLSVLRHTSTHILAHAVKRLYSSVSLGIGPVIED
FT                   EFFYDLKLEHSLSPEDLLAIEREMEKIIKENIEIKRIVVSYEEAEKLFEENNEPLKLEI
FT                   LRGIPKGQEITLYQQGEFIDLCRGPHLPSTGFIKAFKLTRVSGAYWRGNRQKEVLQRVY
FT                   GVAFKKKDDLNEYLYFLEQAAKHDHRQLGKQLDLFMFSEEAPGMPFYLPKGQIVRKELE
FT                   KLSRELQNNASYDEVHTPFMMNYRLWEKSGHWDHYQENMYFSEVDNTKFAIKPMNCPGH
FT                   MLIFKNNLYSYRDLPIRLAEYGQVHRHEFSGSLNGLLRVRTFCQDDAHIFVREDQIESE
FT                   IKKVFHLIDQVYRTIGFEYSVELSTRPDDSLGNNHLWEVSEGSLKNVLDDLAIKYQVNE
FT                   GDGAFYGPKIDFHIKDALKRSHQCGTIQLDFQMPEKFDLTYINHNNEKVRPVVIHRAIF
FT                   GSIDRFFGILIEHFAGVFPVWLAPIQVQIIPISHIHLEYCLGIKSELKQHGIRVQINES
FT                   NQKLGYKIREAQVQKIPYTLVVGDNEIKENGVNVRKYGEEQQKNVSIESFKKNILQQIK
FT                   TRSV"
FT   gene            213173..213847
FT                   /locus_tag="BLi00235"
FT   CDS_pept        213173..213847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00235"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39197"
FT                   /protein_id="AAU39197.1"
FT                   /translation="MTLLKKQYEMFKCVTDENYLKEYKKQNHFDWVNFDFFRKLHFNKR
FT                   AIRFNHVFPKTKEKTREWEKFVKNFCNQHNYTGQRVEEDADSFVNFLSKKKGNESYIAQ
FT                   LAKHELNIYLVTIGKGNGFVDAFCYPITCFNITSTETKKHNYLYIKGKQGVRVFKIEQS
FT                   VAIWIENYKNLLCIKEATNLTHNSLNTQEKNQLKIAIDNFKKLGLLDIWKRESINEKSK
FT                   QH"
FT   gene            213825..215015
FT                   /locus_tag="BLi00236"
FT   CDS_pept        213825..215015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00236"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39198"
FT                   /protein_id="AAU39198.1"
FT                   /translation="MKSLNNIKNKIVIVGTVDSLGAAIVWTGLPLYAYSITGSFLYTSS
FT                   LFFTSAIARILATFFGGYLADVSSSKRIMLRCLSINWFFYSLLFLGLSLGLTWIIFPIM
FT                   LISQCFSTISIMNQNLWFNSLCSKETLASEISGRNSWFLISKTVGFSLGPLMYHWLNAY
FT                   SLIINLLTILIAITLILTIKDLGYVNNKKKKESIFSSFKEVYKNQLLKRLNIIEILNGL
FT                   TFPVLTSLSIYILEKNLNASSLIISLFWLIGGVGAITANLMLSRLKLFKLQYIHQFIIS
FT                   FVLVVGGLLLMTIASYSFVYLIGFSLFTLGTPIINNLLRSKVFIFAPSHMKGKVTSVIT
FT                   SSSDLGTIIALSLSWIVVEKFGVLIFMSFVILTSVSRICLFFYTLHKVENKVDVEG"
FT   gene            215019..215837
FT                   /locus_tag="BLi00237"
FT   CDS_pept        215019..215837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00237"
FT                   /product="UPF0276 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00237"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39199"
FT                   /protein_id="AAU39199.1"
FT                   /translation="MSNCIGVGLSFRQNFFKDLDVIKQDVDFLEIISERYFDKKNEEEL
FT                   NTIRNYFPLIPHGLSLSIGTYEPLSKKKEKQISNLLAELQINSYTDHLAMSSVKDIELL
FT                   DFFPVMYKEETFEFLINKYDQLKKGRLKNLYLENITYTFNWHNNDFSELDFWYKLLNET
FT                   NIGMLLDVSNLYINSINHKYDPYAFFDKLPKDKINYLHVAGFIRNKYGFLIDSHSEPVH
FT                   KEVWKLAEYIIKKAPVKGVILERDLNYQNYHDVKNDIKIIKSLVYKYQTN"
FT   gene            216134..216445
FT                   /locus_tag="BLi00238"
FT   CDS_pept        216134..216445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00238"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39200"
FT                   /protein_id="AAU39200.1"
FT                   /translation="MTAINLIIFAVLIALTAFFVATEFAIVKVRATKIDRLILEGKKGA
FT                   VSAKKVVTHLDEYLSACQLGITVTALGIGWVGESTFEVILHPIFAYFNVSEQVTHILI"
FT   gene            216687..217076
FT                   /locus_tag="BLi00239"
FT   CDS_pept        216687..217076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00239"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39201"
FT                   /protein_id="AAU39201.1"
FT                   /translation="MQKERIHIAILLDEYGGTSGLVTVEDILEEIVGEIRDEFDVDEIP
FT                   DIRKLKDGHFIINSKLLIEDVNDLLDINLSHEEVDTIGGWFMTQNMDAEAGSELEADGY
FT                   IFKVQKIDGRQIHFLEVKREKNSNQ"
FT   gene            complement(217065..217298)
FT                   /locus_tag="BLi05002"
FT   CDS_pept        complement(217065..217298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi05002"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi05002"
FT                   /db_xref="EnsemblGenomes-Tr:AFR74784"
FT                   /protein_id="AFR74784.1"
FT                   /translation="MPTNRLINEKSPYLLQHAHNPVDWYPWGEEAFEKAKRENKPVLVS
FT                   IGYSTCHWSMVVFHNKKNLKSFRLSFFKSLLI"
FT   gene            218025..219308
FT                   /locus_tag="BLi00241"
FT   CDS_pept        218025..219308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00241"
FT                   /product="putative major facilitator superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00241"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39202"
FT                   /protein_id="AAU39202.1"
FT                   /translation="MAGYSERTVESYIDSPDRLKRLYKRVLFIVSLSQIFGGAGLAAGI
FT                   TVGALLAKQMLGTDAFSGVPSALFTLGSAGAAFGVGRLSQRYGRRTGLTAGFMVGGIGA
FT                   IGVVAAAVINSIILLFVSLLIYGAGTATNLQARYAGTDLADKKQRAKAISVTMVMTTFG
FT                   AVAGPNLVDVMGKFASIIGVPPLAGPFILSAAAFILAGLVLYILLRPDPLEIAKKIETY
FT                   RQENKLADESKSAGASDDQKGITIGAAVMVLTQIVMVAIMTMTPVHMQHHGHSLGDVGI
FT                   VIGFHIGSMYLPSLVTGILVDKIGRTAISIASGVTLLLAGAVAALAPSDSLVLLIVALS
FT                   LLGLGWNFGLISGTAQIIDSTEPSTRAKVQGTLDVLIALAGASGGALSGMVVAHSSYAV
FT                   LSLAGGLLSLALIPAVIWPRRKTNTQKG"
FT   gene            complement(219333..220106)
FT                   /locus_tag="BLi00242"
FT   CDS_pept        complement(219333..220106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00242"
FT                   /product="putative S-adenosyl-L-methionine-dependent
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00242"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39203"
FT                   /protein_id="AAU39203.1"
FT                   /translation="MRKNAATEEAIQRWNRFADSYAANHTEQGDIHKEVFLNPVIFSLI
FT                   ETVKNQKVLDAGCGEGYLSRMLAAREAVVTAVDYSTRMLEIAKERTPDGLHIHYRHGNC
FT                   EDLHFLDEQSFDIIISNMVIQDLANDEKAFQEMHRLLKDGGCFIFSILHPCFVTPESGW
FT                   ERTKDGQKLHWNVDRYFYEGAYEQPLGGEEKMFLFHRTLTSYINTIIKAGFQLEAVEEP
FT                   RPSKEMLKKYPSFEEDLRCPDFIVFKLRKPGGDVR"
FT   gene            220274..221146
FT                   /locus_tag="BLi00243"
FT   CDS_pept        220274..221146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00243"
FT                   /product="putative NAD(P)-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00243"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39204"
FT                   /protein_id="AAU39204.1"
FT                   /translation="MKMLVTGATGKLGSKIVEKLLETVPADQLAVSVRNPEKAEALRAR
FT                   GVDVRHGDFDRPETLESAFRGIDRLLIISADGDNETRIRQHGNAVAAAERAGVRFIAYT
FT                   SIANARESKNFLAPTHKATEEAILQTGIPYSFLRNNWYLENEMSSIQGVLAGAPWVTSA
FT                   ENGKVGWALQQDYADAAAAVLSGEGHENTVYELSGKLLTQEEIASALGEVLGKEVPVQH
FT                   VDDAAYRDIMKNAGVPDFLIPMVVDIQKGIREGTLEVESDDFEKVLGRPLTPIKEGLAQ
FT                   IVARISEAK"
FT   gene            complement(221501..222007)
FT                   /locus_tag="BLi00244"
FT   CDS_pept        complement(221501..222007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00244"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39205"
FT                   /protein_id="AAU39205.1"
FT                   /translation="MQNRADGSKINIQKTKGERVWNAFGYFFYLGSIILLAAVWGSLPE
FT                   KVPAHYNALGEVDRWGSKWELFILPGIGLIILLFMQFLEKHPEIHNHPKRLNETNAEHF
FT                   YLLSRKLINRLKNACLIIFSLILIESVSIALDWGSGFGGWFLPIALLGTVMLVAIGLIQ
FT                   QRKIK"
FT   gene            222245..223879
FT                   /locus_tag="BLi00245"
FT   CDS_pept        222245..223879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00245"
FT                   /product="putative sodium-dependent phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00245"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39206"
FT                   /protein_id="AAU39206.1"
FT                   /translation="MEIDVQKLLFEFIGGLGIFLLGIKFMGEGLQKSAGDKLRDILDRF
FT                   TSNPLMGVLAGMIVTVLIQSSSGTTVITVGLVSAGFMTLRQAIGVIMGANIGTTATAFI
FT                   IGFDVGAYALPIIAIGSFLLFFLKSKKFQNIGQILFGFGALFYGLELMSSGMKPLRTVE
FT                   AFHDLTVSMSANPILGVLVGTLFTVLVQSSSATIGILQGLFADSLIDLNGALPVLFGDN
FT                   IGTTITAVLASLGASVAAKRAAAVHVLFNLIGTAIFLILLKPFTALILMLQSSLGLDPK
FT                   MVIAFAHGIFNTSNTLIQLPFVGILALIVTKLIPGKDSVVDYKATHLDPLFIQQSPSIA
FT                   LGQAKEEVLRMGEFAVKGLEETKEFFNTKQAKHAQSAFQIEDAINNLDRKITDYLIELS
FT                   ATTLSEQESEEHHMLMDTVRDIERIGDHFENLVELGEYQQSNRVKISEAAMADLTEMLD
FT                   LTISTVKESITALGENNEDAARRVVEKENQIDKMERKLRKKHILRLNDGLCSGQAGVIF
FT                   VDITSNLERIGDHAVNIAEAVLGEEKH"
FT   gene            224030..224290
FT                   /gene="yubF"
FT                   /locus_tag="BLi00246"
FT   CDS_pept        224030..224290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yubF"
FT                   /locus_tag="BLi00246"
FT                   /product="YubF"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00246"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39207"
FT                   /protein_id="AAU39207.1"
FT                   /translation="MHKYRRRNTTAFTVMSYFTFFAGVFLFGIGLYNADNLQLNEKGYY
FT                   IAVMILVAVGAILTQKVTRDNAEDNEIIAEQERRQNLSSGE"
FT   gene            complement(224324..224779)
FT                   /locus_tag="BLi00247"
FT   CDS_pept        complement(224324..224779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00247"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39208"
FT                   /protein_id="AAU39208.1"
FT                   /translation="MQTDKQLFEETKQTAETLLLSKAENDEELMAYLEKQDLSTLNRLK
FT                   VYFSGPTLKISHVIKASLASSIFASIVTTVCSGQANSILPDVSKGYFPALLSILLIMSS
FT                   IWVFGTITKSQRNKEQNFLHFRKKTNHTKIIGMIDFVLENKYKSISN"
FT   gene            complement(224849..225295)
FT                   /locus_tag="BLi00248"
FT   CDS_pept        complement(224849..225295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00248"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39209"
FT                   /protein_id="AAU39209.1"
FT                   /translation="MRNEKQLFQKAEHTAKLLESHKSDEELLTYLANQESVTLNQLKIY
FT                   FSNPSFTLTYLIKGIFFSSMTAVIMAAFLSGQISSLNHGLSRLFSFFFMFYLIFSFLWI
FT                   VKMLISSRKGPMQTILHFQKRAEYSRITGMIDFILDERFKKEFN"
FT   gene            complement(225332..225658)
FT                   /locus_tag="BLi00249"
FT   CDS_pept        complement(225332..225658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00249"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39210"
FT                   /protein_id="AAU39210.1"
FT                   /translation="MKRRKQPKPLKLSAAFFSIILASFITAILSGQADSIFPFISGISI
FT                   IILAVIFTGCLFWVLRQLVILKKKPIQFITHFSKKAEFARIVKMIDYVLQQKYKKALKN
FT                   IPNQ"
FT   gene            complement(225997..226416)
FT                   /locus_tag="BLi00250"
FT   CDS_pept        complement(225997..226416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00250"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39211"
FT                   /protein_id="AAU39211.1"
FT                   /translation="MREETKCALIIDESLPLGLIANTAAILGAALGKNKPDLIGETVTD
FT                   GSGIDHLGIVKIPIPILKGNAELLHQLSQKLLTDEFNDILTVDFTDVAQSIHTYEAYIE
FT                   AFQSTAASDYRYFGIGICGDKKKVARLTGSLGLLR"
FT   gene            complement(226413..227321)
FT                   /gene="ybfH"
FT                   /locus_tag="BLi00251"
FT   CDS_pept        complement(226413..227321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfH"
FT                   /locus_tag="BLi00251"
FT                   /product="YbfH"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00251"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39212"
FT                   /protein_id="AAU39212.1"
FT                   /translation="MKTRRETAGHLAAVITIIIWGTTFVSTKVLLEDFPPVDILFYRFL
FT                   IGLIVLIMVHPHVLTFRSWRQEALFAGAGLCGVTLYFLLENIALTLTYASNAGMIVAVI
FT                   PMITAVLAHFLLSGEKLEPRFFIGFAAAFTGLALIFFNGQMMLKLNPLGDILAAASAFV
FT                   WAAYAILMKKISTFGYHTIQCTQRIFLYGLLFMVPALFLFDFRFDASPFSSPVNWLNIL
FT                   FLGAGASALCFVTWNWSVGVLGAVKTSAYIYMVPVITIAASVIILQEKLTWVAFCGGAL
FT                   TLAGLYISETKPKPQLKEEQI"
FT   gene            complement(227318..228113)
FT                   /pseudo
FT                   /gene="ybfI"
FT                   /locus_tag="BLi00252"
FT                   /note="putative HTH-type transcriptional regulator YbfI"
FT   gene            228229..228642
FT                   /locus_tag="BLi00255"
FT   CDS_pept        228229..228642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00255"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39215"
FT                   /protein_id="AAU39215.1"
FT                   /translation="MKKKWIASIAFTMMLGIGITIYCLFFEHSKLSELTSDGEWELSYS
FT                   KERGDQYWNGYVSKKTSEDAELKRVVFFVNGKETVDYEKDEQEEGGTHSDIVNVVWLGD
FT                   APEKSEQFEAVVERNQNGEYHKERIKLTAKNGL"
FT   gene            228704..229171
FT                   /locus_tag="BLi00256"
FT   CDS_pept        228704..229171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00256"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39216"
FT                   /protein_id="AAU39216.1"
FT                   /translation="MDKEYITELISSKLRLIRAESGYTQEKMANVLGMSKKTLVQIEKG
FT                   RSAAGWAHVVAVCALFRNSEVLQAVLGDEPLEVVETVAHRSIDRPKGKTLGGKVWWRDI
FT                   EKKGEFRLQQNLISHHYRILDSYDDLWFSTFEKQDAVARLDELLNEQDGVE"
FT   gene            complement(229306..229965)
FT                   /locus_tag="BLi00257"
FT   CDS_pept        complement(229306..229965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00257"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39217"
FT                   /protein_id="AAU39217.1"
FT                   /translation="MGYTSHCLRKSGQPVFTEKDQSLLASLAPLIGRHLQQFRHHLPKK
FT                   DVFHMKHVGGILILSEDLQLLSCNRAALHWLNILRGWESIGSEAVPRPVRAVCTRAAAE
FT                   TTAPAKTVISIPGHSCLSIKASRLDGFGPSGQIAVSFEPASPAETIPLIAEAYSLSDRE
FT                   KDIAYRVIRGLSTKAIGDELHISAYTVQDHLKSFFLKTGAGNRRELMWKLLDDVLE"
FT   gene            230062..231117
FT                   /gene="ybdH"
FT                   /locus_tag="BLi00258"
FT   CDS_pept        230062..231117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdH"
FT                   /locus_tag="BLi00258"
FT                   /product="putative glycerol dehydrogenase YbdH"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00258"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39218"
FT                   /protein_id="AAU39218.1"
FT                   /translation="MQPEDIVRSGPNQYVCREGIVKELPSFANAFERPVIISGVKSFKA
FT                   FTRYTTPPADWKVVQHTGCSSLNKIKKAAEEAESADVIIGIGGGTVLDTAKAAADLLNI
FT                   EVMTIPTIPGTCAASTPLSVIYDDEGNFSGVQYQKRSSYLTLVDPLLLLSSPVAYVKSG
FT                   IGDTLAKWYEAEAIIRNTADSLSIMVQTGLRQSVYIRDILLTESLKAIESLEKGESSPA
FT                   FTNVLEAVIALAGTVGGYAGRYGRMAGAHAIHNGLTFIPETHRVLHGQKVAYGILVQLA
FT                   LEGRTDEIAELIPFYEGLGFPRRLSDLGILENIEAAKRIIAAHAARPDESLCLMGSFHE
FT                   ADVIAAIESLE"
FT   gene            231290..232996
FT                   /gene="yvaQ"
FT                   /locus_tag="BLi00259"
FT   CDS_pept        231290..232996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yvaQ"
FT                   /locus_tag="BLi00259"
FT                   /product="putative sensory transducer protein YvaQ"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00259"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39219"
FT                   /protein_id="AAU39219.1"
FT                   /translation="MKSPRWNNITIGGKYGIIFFVMLTAFLTSVLITYGLLKDTSQTVQ
FT                   DTKSKNETAVQSAKLMSLYQNKYLHIPEYIINAQDEKLTDYMKYSQEFADTAKKLKKEL
FT                   HSDEQLDMFDQIIENNHSLDEYFFSEIVPNVQQINTEKFLTLQKKANKLKEETMTLGES
FT                   LKENAVKTNVESIGQAQSNMTKTIYILGVSILISAIVSAGLLIIVSRQIKKNLKRVVAA
FT                   SEEIAKGHLNFEALDYKGKDEIGQLSQAVNHMGGSLREMIVEVSGIAAEVDKQCLTFTS
FT                   VSADVREGSEQIAVTVEELANGATNQANEAANISEQTQELTGQIQHAHESGETLARFSK
FT                   EVLHVSVDGDKQMAQSLEQMNVINHVMEASVEKVSVLEEQTQSIHKLVEMITGMAEQTN
FT                   LLALNASIEAARAGDAGKGFAVVAGEVKRLAEEVKSSVGSITEIVTAIQTETSSMAGDL
FT                   KTGFSEVHKGKNQIETSGRYFSEIKNKVTDMAGRVSDISEALSHFRRSSEEINGSVEHI
FT                   AAISEESAAGSEEISASVHEQSGSIEKMDESARLLGEMVERMNVMIKRFKL"
FT   gene            233022..234086
FT                   /gene="xylF"
FT                   /locus_tag="BLi00260"
FT   CDS_pept        233022..234086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylF"
FT                   /locus_tag="BLi00260"
FT                   /product="putative D-xylose ATP transporter permease XylF"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00260"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39220"
FT                   /protein_id="AAU39220.1"
FT                   /translation="MLSIYVKRGLLALALFSLLTAVAGCSFNSAEKSANREEKVKLIAD
FT                   SDKLYVGFAIDTLKEERWYKDKEAFEKEVKNLGGEVKTLAANGNKEVQIQQAELLISEG
FT                   VDVLVVVPADADAAAEIVKKAHSAGVKVISYDRLIRNADVDYYVSFDNEKVGELQAEAI
FT                   VKKAKKGNFVYIGGSSLDNNAVLFRNGAMKVLEPLKRQGKVKLVLDEYTKDWLPEEAKK
FT                   NMKKALNKTRDIDAVIAANDGTAGGVIEALQEAGLAGKIPVSGQDAEIQGVRRIVNGTQ
FT                   TMTVYKPIPALAKKSAEMAVQAAKGEAIQTDTTVENGKAKVPAILLEPYAVTKGNINET
FT                   VIKDGHLSKKDINK"
FT   gene            complement(234125..234892)
FT                   /locus_tag="BLi00261"
FT   CDS_pept        complement(234125..234892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00261"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39221"
FT                   /protein_id="AAU39221.1"
FT                   /translation="MKKSISSLMIGLLAVVLGACSSNHDDQQSQASDQAKTAQSGQQDQ
FT                   EKQIKAMQKKLDQQKVDDTKTVAVVNDEKITGKDYNSVLSTAQMQYQQTGQDPTSKDAA
FT                   QQIKKQAIDSLIGQALITQEADKKGYKASEKEIEKQLDESKKQYKNEQDFEEAVKKAGL
FT                   NMNTLKSDIADSIKTEKYIDKELPTDQVTDKEIKDYYDQFAAQQKDSGQKNTPAFDDVK
FT                   QQIQDMLKQQKRQEKLGQQVEKLKKSADVKVEI"
FT   gene            complement(235047..235811)
FT                   /locus_tag="BLi00262"
FT   CDS_pept        complement(235047..235811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00262"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39222"
FT                   /protein_id="AAU39222.1"
FT                   /translation="MFEDERLNRLIYLYTPLYAEDFPIILFWIPKSGCTTLNRWFFFQN
FT                   GLLEDVNRRCAGEVHHYRNAIYTQKPNYVKDLLTDLREGKKDTYKVVRNPFRRAVSSFL
FT                   AAICSPNFICLFNSDINTGLSFTQFLHHLKDLGTDINAIDRHLGPQYIEGEEEFVTNYI
FT                   YLEQFSAQIREIENKYKLLKSPLSQLSQSPHHLSDIMIKKGKFADTVLTMSTFDWAFPT
FT                   FESFYNDETKELVHDIFAKDFEVYGFDSKHIK"
FT   gene            236083..237024
FT                   /gene="vgb"
FT                   /locus_tag="BLi00263"
FT   CDS_pept        236083..237024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vgb"
FT                   /locus_tag="BLi00263"
FT                   /product="virginiamycin B lyase Vgb"
FT                   /EC_number="4.2.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00263"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39223"
FT                   /db_xref="GOA:Q62ZD8"
FT                   /db_xref="InterPro:IPR011217"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q62ZD8"
FT                   /protein_id="AAU39223.1"
FT                   /translation="MRDAWGKIACRKKEGRVSMQIRMTEYQVPDPESGPYGITVCANGR
FT                   IWFTEQKGNRIGMLTESGDITEYTIPTESAGASIITSGIDGELWFTEYKAGKIGKITPQ
FT                   GKITEYALPPGAAPFGIAAGCDDAMWYTDMAGHQIGRLSSSGEITEYKLPKPGAFPSFI
FT                   TRGADGALWFTQNQSGSIGRITADGDISEYPLPQEQSGPVGITAGPDGALWFTEINANQ
FT                   IGRITVSGKISEYQLPTAHARPHAIAAGGDGALWFTEWGAGQIGRITVDGDITEYPIPT
FT                   ADSEPHGIAAGSAHSIWFAEECGRIGKISIQN"
FT   gene            complement(237061..237441)
FT                   /gene="ycbP"
FT                   /locus_tag="BLi00264"
FT   CDS_pept        complement(237061..237441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbP"
FT                   /locus_tag="BLi00264"
FT                   /product="DUF2512 family protein YcbP"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00264"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39224"
FT                   /protein_id="AAU39224.1"
FT                   /translation="MEHVKALAIKGIMTIVILYLVLGLGFSFSFENTLFITIVLGAVSY
FT                   LLGDLFILPKTNNITATLADLGVAFLVVWLMALAMGTAANTAALAAFFAAVAMAIGEYI
FT                   FHFYLMNKGLGSPNRRMETRTE"
FT   gene            complement(237468..238922)
FT                   /gene="ybgF"
FT                   /locus_tag="BLi00265"
FT   CDS_pept        complement(237468..238922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgF"
FT                   /locus_tag="BLi00265"
FT                   /product="putative amino acid permease YbgF"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00265"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39225"
FT                   /protein_id="AAU39225.1"
FT                   /translation="MEQSNTNRQNFQRKMQTRHLIMLSLGGVIGTGLFLSSGYTISQAG
FT                   PAGTILAYLAGALIVYLVMLCLGELSVAMPVTGSFHMYASRFIGPGTGFTVAWLYWLTW
FT                   AVALGSEFTAAGLLMQRWFPDTSVWMWSAVFAALIFALNAVSVRFFAESEFWFSSIKVL
FT                   AIILFIILGGAAIFGIIPIQNADAAPLLSNFAGEGGLFPNGFLPIFMAMLSVNFAFSGT
FT                   ELIGIAAGESAEPEKNIPKAIKTTLWRLVLFFIGTIFVLSCLIPVKEAGVIKSPFVDVF
FT                   DRIGVPYAADIMNFVILTALLSAANSGLYACSRMLWSLSKEKTLHPVFQKLTSRGIPLN
FT                   ALIFSMLGGILSLLSSVFAPDSVYIVLVSISGFAVVAVWMSIAASQFMFRRRFLAEGNT
FT                   ADDLKYRTPLYPAVPIAAFLLCLASCIGIAFDPNQRIALFCGVPFMALCYTIYYATNRK
FT                   NSWNPSEPVKNASLHVSFSEYEEKKN"
FT   gene            complement(238922..239869)
FT                   /gene="ybgG"
FT                   /locus_tag="BLi00266"
FT   CDS_pept        complement(238922..239869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgG"
FT                   /locus_tag="BLi00266"
FT                   /product="homocysteine S-methyltransferase YbgG"
FT                   /EC_number="2.1.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00266"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39226"
FT                   /protein_id="AAU39226.1"
FT                   /translation="MTNPIRTSLQQFSVIILDGAMATELERYGCDLNDSLWSAKILIEN
FT                   PELIKQVHLDYFRAGADCAITASYQSTVEGFTKRGLSEQEALHLIRESVRLAAEARDEF
FT                   WAAPENREGRPKPFVAASVGPYGAFLADGSEYQGNYGVTEDELADFHRRRMGALIEAGA
FT                   DILACETIPCLSEAKAIVHLLKEFPDTHAWISFSAKDGRHISDGTKAGECAKWLDQHDQ
FT                   VAAVGVNCTRLEHVSSLIGGIKKHTAKPIIVYPNSGEQYDPETKTWHGAACKASFGESA
FT                   RSWYNQGAQLIGGCCRTTPEDIKAVAAWARKLEV"
FT   gene            240031..240819
FT                   /locus_tag="BLi00267"
FT   CDS_pept        240031..240819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00267"
FT                   /product="UPF0249 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00267"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39227"
FT                   /protein_id="AAU39227.1"
FT                   /translation="MPPHTFLKKQIRGIGSMKKLIINADDFGYSRGVNYGIIDAYKLGI
FT                   LTSATFMTNMPGAGHAARLARESPGLGIGVHLVLTCGRPLLSDHRTIVDSKGSFRNLAF
FT                   YQGAFTIDADEVYREWKTQIETCINMGLKPDHLDSHHHINAYPGISDVFLSLAKEYRLP
FT                   VRRNMESAIITEKGVKTTDSFSPVLEAALKGEEAVSELFEKHNTVEVMTHPAYLDKELL
FT                   TNSSYTYPRVDELEFLTDPDVVIRLNKLADVQLVSFRNLT"
FT   gene            240833..242206
FT                   /locus_tag="BLi00268"
FT   CDS_pept        240833..242206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00268"
FT                   /product="N-acetylglucosamine-specific phosphotransferase
FT                   system EIICB component"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00268"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39228"
FT                   /protein_id="AAU39228.1"
FT                   /translation="MKHILQLLGKSLLIPITVLPIAGLLLRLSAEDMLDIPLFQASGVI
FT                   LNNMDVLIAIGIAMGFARSKDKGIPALTGYLAITVLKEGIGILNPDLDMSVFGGVLAGL
FT                   MAAFIYNQFQHARLPSMFSFFGGEKFPITMIVLVTIPVAGFFSVVWPYAEAAIDAFSQS
FT                   LVGLGAFGVFVFGFLNRFLLPFGLHHVMNTYIYFGLGRYETASGEAVTGEITRFLNGDP
FT                   TAGYFLGGFFITMMFGIPAIALAIAHAARTRKKETKALMSSGAATSLITGITEPVEFTF
FT                   LFTSPLLYFLHSVYTGLAGAVLCLLGIRHGFSWGAGAIDYLLNLNLSDGGLLIIPVGVA
FT                   FFALYYVTFYFVIIKRNVPVIGREQETPEGDRLQQSMAAGILKYMGGRENVVTCENCIT
FT                   RLRLKLKDTSLADEAQLKRLGAHGVIIIDRHHIQIVIGTDAGTVKKDLQNLIDESAPD"
FT   gene            242328..243104
FT                   /locus_tag="BLi00269"
FT   CDS_pept        242328..243104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00269"
FT                   /product="putative transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00269"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39229"
FT                   /protein_id="AAU39229.1"
FT                   /translation="MKKDEYYSIGVFSEMTGTSIRTLHYYDEIGLLKPEKETGTGRRLY
FT                   TDRDAKDLQKIICFKFLGYSLEQIRAFMKDACFDAGLIEALQEQKRVLEERKEHIETGL
FT                   KAIDRTIGLLEEEEEIDSSVFMSLLNSIQTEKEQREWLEQQVSKSFADDVFGKSEEEMA
FT                   KLDQEYVRLSKEAKRLMGKPVDDPEVQDMADRYMKTSLEFVGEGVLSALGQMETIESRQ
FT                   LAEKFPSPFTKEEEEWLQRVFEYYMIHNDFCPESGG"
FT   gene            complement(243147..243869)
FT                   /locus_tag="BLi00270"
FT   CDS_pept        complement(243147..243869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00270"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00270"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39230"
FT                   /protein_id="AAU39230.1"
FT                   /translation="METVKEILVVYGRIITILPLLLVVTLFMGKRSIGEMPVFDFLIII
FT                   TLGAVVGADIADPKIEHLHTAAAVAAIALLQRLASNLMIKYRTLGRLITFEPTIVIKNG
FT                   TFIVGNLKRIKYSVDNILQMLREKDVFNVSDVEMAFVEANGNLTVYKKPNKMEITAEDM
FT                   GIQKSSGEFSYPVIVDGKVYTSVLQQLNVTESWLKNQLKKKGLERMDEIFFASVNQNHE
FT                   LHVSLDNQTTKIEPELLH"
FT   gene            complement(243857..244567)
FT                   /locus_tag="BLi00271"
FT   CDS_pept        complement(243857..244567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00271"
FT                   /product="putative carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00271"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39231"
FT                   /protein_id="AAU39231.1"
FT                   /translation="MKLSSKLILGLTVSSLAGKFLEKLLIQDNVSPNITASFNQEADIP
FT                   DIDASSYIHHFASVIGSVVIGRNVFIGPFSSIRGDVGLKIFISHDCNIQDGVVLHGLKN
FT                   YEYNSPVTEHSVFKDRESYSIYIGEKVSLAPQCQIYGPVRIDKNVFVGMQSLVFDAYIQ
FT                   EDTVIEPGAKIIGVTIPPKRFVSAGRVISNQEDANRLPEITDSYPYHDLNSKMTSVNLE
FT                   LAKGYKKEERQWKL"
FT   gene            complement(245091..245489)
FT                   /locus_tag="BLi00273"
FT   CDS_pept        complement(245091..245489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00273"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00273"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39232"
FT                   /protein_id="AAU39232.1"
FT                   /translation="MNMKRSRIGRLALTFAAMAAGLASRKTADMLPDIVNVYLGDALWA
FT                   LMIFFGAGFLFKNAKTASAALIALVFCFMIECSQLYHAPWIDNIRAAPLGGLILGYGFL
FT                   WSDLLAYVLGVSAGAAGEMLFRKRKRQP"
FT   gene            complement(245634..247064)
FT                   /gene="glnT"
FT                   /locus_tag="BLi05003"
FT   CDS_pept        complement(245634..247064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnT"
FT                   /locus_tag="BLi05003"
FT                   /product="sodium/glutamine symporter GlnT"
FT                   /db_xref="EnsemblGenomes-Gn:BLi05003"
FT                   /db_xref="EnsemblGenomes-Tr:AFR74785"
FT                   /protein_id="AFR74785.1"
FT                   /translation="MQQFLQEVIGVTNDFLWSKLLIIMLLASGLFFTFKSKFFQVRLLK
FT                   DMFRVLKEGTPDKNGISPFQAFCISMAARVGTGNITGIAIAIALGGPGAIFWMWIIAII
FT                   GSASSFVESTLAQIYKIKDKDGFRGGPAYYMEKGLKKRWMGAVFAVLITLSFGIVFNAV
FT                   QSNTITVAFENSFGTDRLTLGIIITIVFGIITFGGIKRIAKLSEYIVVCLAVLYIGVAV
FT                   FVMLMNITKLPDVISLIIGHAFGLEQAAGGAIGAALMNGIKRGLFSNEAGMGSAPNAAA
FT                   AATTSHPVKQGLVQALGVFTSTLVICSSTAFIILFSDAYKEPGLSGIELTQASLSTHIG
FT                   AWASGFLAIMVFLFSFSTLIGNYYYGETNIEFLHTNKAWLFIYRICVLAMVIFGSVSKV
FT                   QLVWDLADLFMGLMVIVNLIAIFLLSKVAFAALKDYVKQRKAGKDPVFYKDVIKNHEGI
FT                   ECWEHSGTEQKSESKNAI"
FT   gene            complement(247089..248072)
FT                   /gene="glsA"
FT                   /locus_tag="BLi00274"
FT   CDS_pept        complement(247089..248072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glsA"
FT                   /locus_tag="BLi00274"
FT                   /product="L-glutaminase low affinity for glutamine GlsA"
FT                   /EC_number="3.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00274"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39233"
FT                   /protein_id="AAU39233.1"
FT                   /translation="MNEVLEERYDARFWQSRLEDLVEHYRPFSSSGRNAEYIPALGKID
FT                   SNQLGICVIGSDQTMIKAGNSDVSFTLQSISKVISFIAACLTKGISYVLDRVDVEPTGD
FT                   AFNSIIRLEMHKPGKPFNPMINAGALTVSSILPGESALGKIESLHDVIEKMIGKRLEIN
FT                   EEVFRSEWQTAHRNRALAHYLKETGFLEADVEETLEVYLKQCSMEGSTEDIALIGMILA
FT                   NDGYHPFRREHVIPKDVARLTKALMLTCGMYNASGKFAAFVGIPAKSGVSGGIMCAVPA
FT                   SVKREQPFQHGCGIGIYGPAIDDYGNSMTGGMLLKHIAREWDLSIF"
FT   gene            248462..249790
FT                   /gene="glnK"
FT                   /locus_tag="BLi00275"
FT   CDS_pept        248462..249790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnK"
FT                   /locus_tag="BLi00275"
FT                   /product="two-component sensor histidine kinase GlnK"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00275"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39234"
FT                   /protein_id="AAU39234.1"
FT                   /translation="MMGGNRGSVMTKAARLVKKDGYILMVMMLTVPLAGELKFYPLNET
FT                   FRVSFGVPTFFFLLLLLRNVPAVLSGFLTGAAVVGFRVLLDGFGPGQIDWLSSFYYHYP
FT                   TFFFYFTYAFLFYLAKVKRFQFRPLYIGFLGFGIELIADGAELAVQYMMFESTVTPGKI
FT                   RDMMAIAFSHSFIVLSFFNVMKLYETQSREKQIREQNEHMLMIVSNLYEETVHLKKTLK
FT                   NTEEITNESYQLYRLLNRQSDNNSSVRQISQKVLRLAGEIHEVKKDNQRIFAGLSKLIS
FT                   KESFRDYMAAEDLVRLVTGINRKYAESLEKDIDFHYSIDGEHPKYHVYTVLSVINNIMA
FT                   NAVEAIQKQGSIRLSLYRRGDDMLECRVEDDGPGIPEKVGDVVFEPGYTSKYDEFGTPS
FT                   TGIGLSYVKETVEELGGSIRFRNDASGVVFTIRLPVQQLIQKG"
FT   gene            249797..250732
FT                   /gene="glnL"
FT                   /locus_tag="BLi00276"
FT   CDS_pept        249797..250732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnL"
FT                   /locus_tag="BLi00276"
FT                   /product="two-component response regulator GlnL"
FT                   /note="regulation of the glsA-glnT operon"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00276"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39235"
FT                   /protein_id="AAU39235.1"
FT                   /translation="MRFFIADDDRAVRSILKQIIEDEDLGEVAGEAEDGCDLEGHVLNL
FT                   QQIDILFVDLLMPLRDGIETVRHLHGVFSGKIIMISQVESKEMIGEAYSLGIEYYIHKP
FT                   INRIEILNVIQKVKERIELERSIHDIQSSLNRLVSLGGGGKNGFREKSIQETGEFLLSE
FT                   LGIVGESGSQDLIAILQYLFDDEQTSLYEKDFPPLKQIFHQIAVQKLGPAASPAEINRE
FT                   VKASEQRIRRAVSHSLNHFASLGLTDFSNPRFESYASRFFDFTVISKKMKELQKDSAAV
FT                   LPSARVNTKKFIQVFFLEAKRLSESAGKRG"
FT   gene            complement(250775..251311)
FT                   /gene="ynaD"
FT                   /locus_tag="BLi00277"
FT   CDS_pept        complement(250775..251311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ynaD"
FT                   /locus_tag="BLi00277"
FT                   /product="putative N-acyltransferase YnaD"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00277"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39236"
FT                   /protein_id="AAU39236.1"
FT                   /translation="METLYTERLTLRKMELEDADVLCQYWSDPEVTKYMNIAPFTDVSQ
FT                   ARDMIQMINDLSLEGQANRFSIIAKETGEVIGTCGFNMIDQENGRAEIGYDLGRNHWGK
FT                   GFASEAVKKLIDYGFTSLNLNRIEAKVEPENTPSIKLLNSLSFQKEGLLREYEKAKGRL
FT                   IDVYMFSLLKREYAG"
FT   gene            complement(251407..253206)
FT                   /gene="blaR"
FT                   /locus_tag="BLi00278"
FT   CDS_pept        complement(251407..253206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blaR"
FT                   /locus_tag="BLi00278"
FT                   /product="putative beta-lactamase-inducing
FT                   penicillin-binding protein BlaR"
FT                   /EC_number="3.5.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00278"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39237"
FT                   /protein_id="AAU39237.1"
FT                   /translation="MSSSFFIPFLVSQILLSLFFSLIILIKKLLKAQITVGTHYHLSVI
FT                   SLLALIAPFLPFHYLKSNHFDWILNLGGASSTLSHTRSTDKTAEAIGQHANWVQDFSMS
FT                   IEQSSFKMIDSAFFAVWILGIAVMLIATLYSNRKIGKIKKSLQMVNNKELLTLFRTCKE
FT                   EIRFHQKVILGCSPLIKSPITFGVVRPYIILPKDISMFSADEMKCVLLHELYHCKRKDM
FT                   LINYFLCLSKIVYWFNPLVWYLSKEAKTEMEISCDFAVLKTLDKKLHLKYGEVILKFTS
FT                   LKQRTSSLVAASEFSSSYKHIKRRIVTVVNFKAASPLLKVKSALVFALVLGIILAGTPS
FT                   VSILTMQRDTHFLSGANVEYEDDSTFFDGFSGGFVLFDSNRKKYTIYNRKESTARFAPA
FT                   STYKVFSALLALESGIITKNNSQMTWDGTQYPYKEWNQDQDLFSAMSSSATWYFQKLDR
FT                   QIGEDHLRRYLKSIHYGNEDFSGPANYWLDGSLQISPLEQVNMLKKFYDNEFDFKQSNI
FT                   QTVKDSIRLEESNGRILSGKTGTSVINGELHAGWFVGYVETAENTFFFAVHIQGEKRAA
FT                   GSTAAEIALSILDKKGIYPSASR"
FT   gene            complement(253208..253594)
FT                   /gene="blaI"
FT                   /locus_tag="BLi00279"
FT   CDS_pept        complement(253208..253594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blaI"
FT                   /locus_tag="BLi00279"
FT                   /product="penicillinase repressor BlaI"
FT                   /EC_number="3.5.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00279"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39238"
FT                   /protein_id="AAU39238.1"
FT                   /translation="MKKIPQISDAELEVMKVIWKHSSINTNEVIKELSKTSTWSPKTIQ
FT                   TMLLRLIKKGALNHHKEGRVFVYTPNIDENDYIEVKSHSFLNRFYNGTLNSMVLNFLEN
FT                   DQLSGEEINELYQILEEHKNRKKE"
FT   gene            254017..254940
FT                   /gene="penP"
FT                   /locus_tag="BLi00280"
FT   CDS_pept        254017..254940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="penP"
FT                   /locus_tag="BLi00280"
FT                   /product="beta-lactamase PenP"
FT                   /EC_number="3.5.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00280"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39239"
FT                   /protein_id="AAU39239.1"
FT                   /translation="MKLWFSTLKLKKVAAVLLFSCVALAGCGSNHSNASHSAEKDEKTE
FT                   MKDDFAKLEEQFDAKLGIFALDTGTNRTVTYRPDERFAFASTIKALTVGVLLQQKSIED
FT                   LNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNTAQNLILKQIGGPESLK
FT                   KELRKIGDEVTNPERFEPELNEVNPGETQDTSTARALATSLQAFALEDKLPSEKRELLI
FT                   DWMKRNTTGDALIRAGVPEGWEVADKTGAGSYGTRNDIAIIWPPKGDPVVLAVLSSRDK
FT                   KDAKYDDKLIAEATKVVVKALNMESK"
FT   gene            255315..257036
FT                   /gene="phoD"
FT                   /locus_tag="BLi00281"
FT   CDS_pept        255315..257036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoD"
FT                   /locus_tag="BLi00281"
FT                   /product="alkaline phosphatase D"
FT                   /EC_number="3.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00281"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39240"
FT                   /protein_id="AAU39240.1"
FT                   /translation="MKKLSEESLKDNTFDRRRFIQGAGKIAGLSLGLAIAQSMGAMEVN
FT                   AAPRFSEYPFTLGVASGDPLSDSVVLWTRLAPDPLNGGGMPNEAVSVKWELAEDERFRR
FT                   VVKRGTEKATPHLAHSVHAEVSGLKPNHVYYYRFKCGNQLSPVGKTKTLPAPGADVAKF
FT                   TFAFASCQQYEHGYYTAYQHMAKEKLDLVFHLGDYIYEYGPNEYVSKTGNVRTHSGPEI
FT                   MSLLDYRNRHAQYRSDANLKAAHAAFPWVVTWDDHEVENNYANVIPEKGQSVEAFIKRR
FT                   AAAYQAYYEHMPLRRQSLPNGPDMQLYRNFSYGNLADISVLDTRQYRDDQANGDGNKPP
FT                   SDESNDPKRTLLGAEQEAWLFDNLSRSEAHWNIIAQQIFFAQWNFGTSAAPIYSMDSWD
FT                   GYPAQRKRVIDFIKSQKLNNIVVLTGDVHASWANNLLVDFDNPKSDIFGVEFVGTSITS
FT                   GGNGADKRADTDKILSNNPHIKFFNDYRGYVRCTVTPEEWRTDYRVVPYVTEPGAAVST
FT                   RASYVYHKDYTGLKRTASNIVPGGVKKSNEVEEDRFLAHTRAHQKQVKQKEKKVTQ"
FT   gene            257058..257270
FT                   /gene="tatAD"
FT                   /locus_tag="BLi00282"
FT   CDS_pept        257058..257270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatAD"
FT                   /locus_tag="BLi00282"
FT                   /product="twin-arginine translocase component TatAD"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00282"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39241"
FT                   /protein_id="AAU39241.1"
FT                   /translation="MLSNIGIPGLILVLVIALIIFGPSKLPEIGRAFGKTLTEFKSATK
FT                   SLVSADDNEIGQGSDAKKQSDPSAR"
FT   gene            257341..258075
FT                   /gene="tatCD"
FT                   /locus_tag="BLi00283"
FT   CDS_pept        257341..258075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatCD"
FT                   /locus_tag="BLi00283"
FT                   /product="twin-arginine translocase component TatCD"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00283"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39242"
FT                   /protein_id="AAU39242.1"
FT                   /translation="MKKRETHLIAHLEELRQRIIKTLLTFILFLITGFLFVQDIYDWLI
FT                   RDLDEKLAVLGPGDILWVYMMIAGVLAIAATIPVAAFQTWRFVAPALTDHERRTALFYI
FT                   PGLFIFFILGIVFGYFVLFPLVLQFLIGLSAGHFQTMFTAEHYFRFMMNLTLPFGFLFE
FT                   MPLIVMFLTSLGILNPAKLSKMRKISYFALIVVSVVITPPDFISDVLVIVPLLVLYELS
FT                   ISLSAFIYRKKTAAQQGAEAQG"
FT   gene            258271..259197
FT                   /gene="ycbC"
FT                   /locus_tag="BLi00284"
FT   CDS_pept        258271..259197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbC"
FT                   /locus_tag="BLi00284"
FT                   /product="5-dehydro-4-deoxyglucarate dehydratase YcbC"
FT                   /EC_number="4.2.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00284"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39243"
FT                   /db_xref="GOA:Q65NX1"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017655"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65NX1"
FT                   /protein_id="AAU39243.1"
FT                   /translation="MSQLRKAPEGILGFPVAPFNREGKLEEEALYENIRFLLDEGLEAV
FT                   FIACGSGEFQSLSTKEYEQMVEIAVSAADGKVPVYTGVGGNLSTALEWARISEEKGADG
FT                   YLILPPYLIHGEQEGLYQYTKTIIESTDLNAIIYQRDNAVLTLEQIQRLTDLEQLVGLK
FT                   DGIGDMALNISLSYTIGDRLGWLNGMPMAEVTMPAYAPIGFTSYSSAISNYIPHISRMF
FT                   YEALLNGNDRLVKEIYEQVIIPINEIRKLRKGYAVSLIKAGMEIMGLHVKNTARPPIVP
FT                   VEKEHCRQLENILKNAMARYPKTTAAL"
FT   gene            259219..260685
FT                   /gene="ycbD"
FT                   /locus_tag="BLi00285"
FT   CDS_pept        259219..260685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbD"
FT                   /locus_tag="BLi00285"
FT                   /product="aldehyde dehydrogenase YcbD"
FT                   /EC_number="1.2.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00285"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39244"
FT                   /protein_id="AAU39244.1"
FT                   /translation="MSVAAESKTYFNFINGRWVKAESGGMEQSLNPADTRDIVGLVQKS
FT                   SIEDVDRAVEAAKQAKKAWRKLSGAERGQFLYKAADIMEQRLDEIAECATREMGKTLPE
FT                   AKGETARGIAILRYYAGEGLRKTGDVIPSTDSSAFMYTDRVPLGVVGVISPWNFPVAIP
FT                   IWKMAPALIYGNTVVIKPATETAVTCLKVISCFEEAGIPSGVVNAVTGPGSSAGQRLAE
FT                   HPDVNGITFTGSNQTGKIIGRTAFERGAKYQLEMGGKNPVIVADDADLDIAVEAVISGA
FT                   FRSTGQKCTATSRVIVLNGVYDRFKEKLLQQTKEITIGDSLKEDVWMGPIANKQQLDNC
FT                   LSYIAKGKQEGADLIFGGERLADGKYENGYYIRPAIFDNVTSGMTIAQEEIFGPVIALI
FT                   KADTLEEALETANDVKFGLSASIFTQNIRRMLSFTDEIEAGLIRVNAESAGVELQAPFG
FT                   GVKQSSSHSREQGEAAKEFFTAVKTVFVKP"
FT   gene            260726..262102
FT                   /gene="gudP"
FT                   /locus_tag="BLi00286"
FT   CDS_pept        260726..262102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gudP"
FT                   /locus_tag="BLi00286"
FT                   /product="D-glucarate permease GudP"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00286"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39245"
FT                   /protein_id="AAU39245.1"
FT                   /translation="MKKNRAASPDTAGKRSSVRWFVVSMLFLVTSINYADRATLSIVGD
FT                   SVQHELGLSSVAMGYVFSAFGWAYVVGQIPGGWLLDRFGSKIVIAASIFFWSLFTLLQG
FT                   ALGFFAAGTAVILLFALRFLVGLSEAPSFPGNGRVVASWFPSSERGTASAIFNSAQYFA
FT                   LVIFSPLMGWLAHSFSWHTVFVIMGALGIAMSFIWLKTIYEPKKHPRINAAELAYIEEG
FT                   GALVSMDEGKNAEKKEKESQWPYIKQLLRSRMLLGVYIAQYCITTLTYFFLTWFPVYLV
FT                   QARGMSILEAGFVASLPAICGFLGGLLGGFVSDFLLKKGCSITVARKTPIILGMLMSCS
FT                   MIICNYADSSWLVVSIMSLAFFGKGFGALGWAVVSDTSPKECAGLSGGIFNTFGNIASI
FT                   TTPIIIGYIVNATGSFNGALVFVGANAIAAVLSYLFLVGPIKRIELQKEKDPADTTLSM
FT                   "
FT   gene            262140..263507
FT                   /gene="gudD"
FT                   /locus_tag="BLi00287"
FT   CDS_pept        262140..263507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gudD"
FT                   /locus_tag="BLi00287"
FT                   /product="D-glucarate dehydratase GudD"
FT                   /EC_number="4.2.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00287"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39246"
FT                   /protein_id="AAU39246.1"
FT                   /translation="MNTNIHQHVKEEKASQTPSIADMRVIPVAGRDSMLLNLSGAHGPF
FT                   FTRNIVILKDSSGALGVGEVPGGERIRQTLEQAKPLVIDQPLGAVQSILQSVRRRFKDR
FT                   DAGGRGVQTFDQRTTIHAVTALEAALLDLLGKFLGVPVAALLGEGQQRDKVKMLGYLFY
FT                   IGDRKRTTLPYISEQEANDDWFHLRREEALTPEAIVRLAEAARERYGFHDFKLKGGVLS
FT                   GEEEIEAASALAKRFPKARITLDPNGAWSLEEAIALCKGKRDVLAYAEDPCGAEAGYSG
FT                   REIMAEFRRATGIPTATNMIATDWRQMGHAIQLHAVDIPLADPHFWTMQGSVRVAQMCH
FT                   EWGLIWGSHSNNHFDVSLAMFTHVAAAAPGDITAIDTHWIWQDGQRLTKQPFSIADGYV
FT                   QVPDQPGLGIEIDMERVEKANELYEKMTAGERNDAAAMQFLIENWRFDPKRPCLVR"
FT   gene            263602..264315
FT                   /gene="ycbG"
FT                   /locus_tag="BLi00288"
FT   CDS_pept        263602..264315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbG"
FT                   /locus_tag="BLi00288"
FT                   /product="HTH-type transcriptional regulator YcbG"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00288"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39247"
FT                   /protein_id="AAU39247.1"
FT                   /translation="MEEDMETLQVESVNRKTLAKQVVERIVHLLSSGQLKPGDKLPTEI
FT                   ELMEKLNVSRPVLREALISLETLGIIKRKTRDGTYFNDKIGIQPFSVMLALAVDNLPAI
FT                   IEARMALELGLVTIAAEKINDSQLERLQETIDIIANSTDNHYGEADKEFHRIIALSANN
FT                   PVLEGMIQSLLITHAKIDSQIPYRERDRTVEYHTNILKALQQRDPYQAYHHMYEHLKFV
FT                   RDKILNGLRDEKNNH"
FT   gene            264404..265930
FT                   /gene="garD"
FT                   /locus_tag="BLi00289"
FT   CDS_pept        264404..265930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="garD"
FT                   /locus_tag="BLi00289"
FT                   /product="D-galactarate dehydratase GarD"
FT                   /EC_number="4.2.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00289"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39248"
FT                   /protein_id="AAU39248.1"
FT                   /translation="MLVNQTETPLYIKVNEKDNAAIIANAGGLPQGTVFPCGLKLQERI
FT                   PQGHKVALTDITQGGAVIRYGEIIGYAVKPIEKGGWISESHIMLPEAPPLDELPIANKV
FT                   PKPAPLLEGYTFEGYRNEDGSVGTRNVLGIMTSVQCVAGVLDYAVKRIKEELLPKYPNV
FT                   DGVAALNHQYGCGVAINAPEAKIPIRTIQNIARHPNFGGEAMVIGLGCEKLLPTKIEPE
FT                   GDAENILSLQERQGFQQMIQSIMEMAEERLKRLNERKRMTCPASDLVIGLQCGGSDAFS
FT                   GVTANPASGYAADLLVRAGATVLFSEVTEVRDAVHLLTPRAVNEEVGRALIREMAWYDR
FT                   YLERGESDRSANPSPGNKKGGLANVVEKSLGSIAKSGSSPISAVLAPGERAVQKGLIFA
FT                   ATPASDFVCGTLQLASGMHLQVFTTGRGTPYGLEMAPVLKVATRQSLSEDWHDLIDVNA
FT                   GRIATGEASIEEVGWEIFRTILDVASGRKTWAEHWGLSNDLCLFNPAPVT"
FT   gene            266093..266786
FT                   /pseudo
FT                   /gene="ycbL"
FT                   /locus_tag="BLi00291"
FT                   /note="two-component response regulator YcbL"
FT   gene            266794..267723
FT                   /gene="ycbM"
FT                   /locus_tag="BLi00292"
FT   CDS_pept        266794..267723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbM"
FT                   /locus_tag="BLi00292"
FT                   /product="two-component sensor histidine kinase YcbM"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00292"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39251"
FT                   /protein_id="AAU39251.1"
FT                   /translation="MLWIGILIILASLNIVQYKMKRQRDRNLKYITEKLSVMLNEHEAD
FT                   QILLGTADKVLRALLVQINLFVEEHQHITARFAKTEQSMKRMLTNMSHDLKTPLTVVLG
FT                   YIEAIQNDSDMAEEERERLLEKLYQKTGEIIQLMNSFFDLAKLESEDKQILLTKIHINE
FT                   ICRKNILQHYDAVQAKGFKAVIDIPDTPVYAHGNEEALDRILQNLLSNAIQYGADGKLI
FT                   GLSLTYDETWIVITVWDRGKGISEYDQQRVFERLYTLEESRNKAFQGSGLGLTITKRLI
FT                   EKMGGNISLQSKPHERTVFSITLKRMTY"
FT   gene            267818..268741
FT                   /gene="ycbN"
FT                   /locus_tag="BLi00293"
FT   CDS_pept        267818..268741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbN"
FT                   /locus_tag="BLi00293"
FT                   /product="putative antimicrobial peptide ABC exporter
FT                   ATP-binding protein YcbN"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00293"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39252"
FT                   /protein_id="AAU39252.1"
FT                   /translation="MTYIVQTSGLTKTFKGQEVVSNVSMHIRKGEIYGFLGPNGAGKTT
FT                   IMKMLTSLVKPTSGEINILGHKLTNRSYEILGKIGSMIEYPIFYENLTAKENLNLHCEY
FT                   MGYHNKAKIQEVLDMVNLKNIDSKPVKTFSLGMKQRLGIARAILTKPYLLILDEPINGL
FT                   DPIGIKEIRNLFQVLSKEYGMTLLISSHILNEVEQIADTIGVIRDGRLVEEVSMESVRG
FT                   RNTEYIELVTPNQLHACFVLEHELQIANFKILNDKTIRIYDAEASQTAISKALILNDVE
FT                   IESMNKKHTSLEDYFLSLINGNAVNA"
FT   gene            268756..269439
FT                   /gene="ycbO1"
FT                   /locus_tag="BLi00294"
FT   CDS_pept        268756..269439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbO1"
FT                   /locus_tag="BLi00294"
FT                   /product="transmembrane protein YcbO"
FT                   /note="complete"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00294"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39253"
FT                   /protein_id="AAU39253.1"
FT                   /translation="MLNLMRIEMKKLKLGWYIRGAVFANFIIFGFLWMVTCTEGKETFQ
FT                   TIDETFLLIGTFVRAVFIVFGAVLISKLVISEFKNKTILVMFTYPINRKKLLAAKLLIA
FT                   GGLTFVTILISNACVAVGFFLLNSIYGIIPGELTASIASQQALKMIVFAFGAAGTSLVP
FT                   IFFGMRKYSTAATIISSVVIIMPISSTGPGFSISSIVYIPLSLAAVGLFFSFLAVRRIE
FT                   KIDVF"
FT   gene            269640..270152
FT                   /pseudo
FT                   /gene="ycbO2"
FT                   /locus_tag="BLi00295"
FT                   /note="transmembrane protein YcbO; fragment of YcbO"
FT   gene            270248..271327
FT                   /gene="yetN"
FT                   /locus_tag="BLi00296"
FT   CDS_pept        270248..271327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yetN"
FT                   /locus_tag="BLi00296"
FT                   /product="YetN"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00296"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39255"
FT                   /protein_id="AAU39255.1"
FT                   /translation="MEFEIRYISFYVIQVDGKDEQANKQYKHFQTLDTEEFENSELKDF
FT                   LDGELKKIVKRKAERHPKSEQVPTKIGRFITEPGHELDSNPNYNLFHKTKLAETKEEFN
FT                   ELSEQFVRTYLDTSAVRGGVFLVATAVPRKYFDDTFVFVMKCDFEPKVATIADESSLIR
FT                   KVEMAITTKNMKSIQYPHMPEEGMTEESEVKIHQASHARYFEDFLKFVEYGESMPEIMK
FT                   SQVMNMVQEHVYEAFEDKSEELQQFEHDLEIWEASEKREIQERLDTHQVIEASAQIVEH
FT                   MPEAELKMKLGETEIKGLLAEFGDSIHLAKVNGRYVALIEAETISFEKGSSPVEFYKPE
FT                   GLHEVIERIRNKIDREDEK"
FT   gene            271485..272669
FT                   /gene="ybdO"
FT                   /locus_tag="BLi00297"
FT   CDS_pept        271485..272669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdO"
FT                   /locus_tag="BLi00297"
FT                   /product="YbdO"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00297"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39256"
FT                   /protein_id="AAU39256.1"
FT                   /translation="MRLNSQYIRTQLMVQNILKRNAADTTLKNVSSDITAVAKKASSQA
FT                   GRASKESLSKLNYSKDSIVNHAGAFRRAYEAANDRTVTDTGKETKINAQNPYVSESDIR
FT                   KKILDEKYSKINAMNKTKPDPLGYIKDKYKNPNSPYFRNDLSAAERQAAYDNETEWLFK
FT                   GKAQSYNMQDAAFRNVTFNGEVETENEKVYQRSQVNKQLQALLDQYHIAIPADAALTFT
FT                   ITPIDYQVKVSGTDDEQLIHQIEQILQSGENSKQLFLHIMKSLSSDSAQYSKEAHQKYQ
FT                   TVREIYEVTGYHLKDLEVVDGRYVTPSGRDLLEVYKEELEKDPVLKKTAHLAIAHYGAE
FT                   LNRLAEAEYDSVPDFILSIDYSNGSLRDTGQKKSYGTGDTAWLRELKRRTGVND"
FT   gene            273080..273991
FT                   /gene="ycbJ"
FT                   /locus_tag="BLi00298"
FT   CDS_pept        273080..273991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbJ"
FT                   /locus_tag="BLi00298"
FT                   /product="YcbJ"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00298"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39257"
FT                   /protein_id="AAU39257.1"
FT                   /translation="MTTVNEQIEHTLKLAEKHGLRLKRKHAEINESGMDFQVVFAEDEA
FT                   GKSWVLRKPRRDDVIERAVYEGKVLKLLQNRLPAAVPDWRIHTPELIAYPELPGVPAAV
FT                   IDMDIKNYVWNMEHEPPAEAFTRSLAKTLALLHGIDHKDAEEAGMHVMNPDDVRQTKAE
FT                   HMERIKSELGVSAELWERWQKWLSDDSYWPEHTVFIHGDLHPPHILIDQHQSITGLLDW
FT                   TEAKIADPAKDFLLYQTILGEAETARLISYYEEEGGRVWPRMKEHIKEMQAAYGIEIGM
FT                   FALQTKQEEHLKMALDALGVTQ"
FT   gene            complement(274025..274444)
FT                   /gene="ywhA"
FT                   /locus_tag="BLi00299"
FT   CDS_pept        complement(274025..274444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ywhA"
FT                   /locus_tag="BLi00299"
FT                   /product="putative HTH-type transcriptional regulator YwhA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00299"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39258"
FT                   /protein_id="AAU39258.1"
FT                   /translation="MNHHRIEANLLDHAFTKYLRSSKKLDEETIPKSITSGKGFILRII
FT                   YRHGTCTIKEILQEVALSPSATTTALNHLEKEGLVIRSRNNDDRRTVWIELSQEGTRIA
FT                   AQMVENRQALIDKLFGKLSEEEKKAFFAVIEKVMM"
FT   gene            274662..276233
FT                   /gene="ydaB"
FT                   /locus_tag="BLi00300"
FT   CDS_pept        274662..276233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaB"
FT                   /locus_tag="BLi00300"
FT                   /product="putative acyl-CoA ligase YdaB"
FT                   /EC_number="6.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00300"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39259"
FT                   /protein_id="AAU39259.1"
FT                   /translation="MRHIISPGFVRNNENLEMKILSTLQQLINHHMETSDGLEALSGGD
FT                   RTFTFKAYHQRVNQLAHYLLEEGVQKGDHIAVLCKNNHHFPVILLASLKIGATVVPLSW
FT                   QLTSYELKGILNNCRPKVMFYDLEFADILTPLREQLQFCLMIEAGAGMNTTEQFESLFK
FT                   NRPLKVEAEQVTEHDLALMLFTSGTTGNPKGCMVNHGSLAAYLTEVNVKSKQLKGTRFL
FT                   ASHPLYHMSSLNHVFQAAFEGIALYFLWDPEPFEILQEIEKKRIHMMMAFPSVYTYMLE
FT                   EMKRHPFDLSSVKMLVSGGTKVPARLIKEYNDHGIMMVQGYGSTEAWTVSVWRPDMGWD
FT                   KVTSAGKPIPQVSIKIEDPDTHEELPTGEVGEVVVKSPYVFEGYYQNPSATQKVLKDGW
FT                   FYMGDSGKLDEDGFLYITGRYKDVIVYGGDNIYPDQVEEIIDQVPGVVESAVIGVPDEM
FT                   YGEVPRAYVVKNESAGLKKEDIIAYCKERLSDYKIPEIVFIDSLPKNRLGKIVKKDLRE
FT                   LAVKGQ"
FT   gene            276362..277576
FT                   /locus_tag="BLi00301"
FT   CDS_pept        276362..277576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00301"
FT                   /product="putative serine protease inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00301"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39260"
FT                   /protein_id="AAU39260.1"
FT                   /translation="MKSKWSAMVVIAGLLLLAGCGALKEADPPRGRSAQKTEASFSEAE
FT                   QRFALALFQDMIKEEGSRKNIFLSPYSIQQALLMTANGAAGDSRKELLSTLHLSQADMA
FT                   SINGISKSVNRSLETLPHGEFSSANSIWTKRELKESFQDAIKGLGDAYQLQIDPNRATE
FT                   EINSWVKKKTKDRIDQIVDKVSSNTIAYIINAVYFKESWKHPFDPHMTAEQPFYSADGS
FT                   AKKHPMMTQTNRFPYLENEHFQAVKLPFQDEGLSLAVFLPKKAANLEQLLTGMTHDQWR
FT                   ALQKGWTMKQVELKLPRFSFQTDYMLNEPLKRLGMKNVFSSANFSNMFTGHGAAQINKV
FT                   RHKTFIKVDEAGTEASAATAVEIIESAPVPEVTMTADHPFYFAIVDEASGMILFLGSVA
FT                   EPKDD"
FT   gene            277687..278514
FT                   /locus_tag="BLi00302"
FT   CDS_pept        277687..278514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00302"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39261"
FT                   /protein_id="AAU39261.1"
FT                   /translation="MKKSLFLFVFSLFLMAIPAFSASANVYEDEYEPNNSFAEAYDVGL
FT                   WKYKTISATIHSESDKDYYKFYATKGEQLAIHLKNIPANTDYDLYLFKDAYGYPAVGSS
FT                   ERMGNQNEIIRLDVPETGRYIAVVMSKDGSYDGWGFYRLEFIDRMKSGAYTANLSPSSI
FT                   SSPGQGVVSPVAAVNLANASAIPEGATVKSVSAEGTIYPSLGHTYREVLNKEEGVWHTS
FT                   VSGGTLFPDLKPELALPVKTTWNVRYYSLAWSSSTWRSPQLKINYQYDSTYGW"
FT   gene            278578..279405
FT                   /locus_tag="BLi00303"
FT   CDS_pept        278578..279405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00303"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39262"
FT                   /protein_id="AAU39262.1"
FT                   /translation="MNIRDRVKLSLYSEQLMKPAAANVPAKTKGSKRMPASQTDTLSIS
FT                   KQAESAQKNAPSLRSQMNGVQFEIYNLYVDRQRLNSQIEGALRESGISLSESEHLTLHV
FT                   DGHNRITVEGIEDEQKRTRIEAVLNDSDKRFGARLLGHAELIGEQNGTPLDKQAYEKWH
FT                   VNEFLKTVAGLSLADVSLDERGELEGGNEKLTRVIESAKDPKSDLEKSFQNILKKLKNV
FT                   LAKGPDTILDRSASFGYAGGTLIDLNVSKGFSAGQLNEWLDDPFLREVLLNNF"
FT   gene            279535..280287
FT                   /locus_tag="BLi00304"
FT   CDS_pept        279535..280287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00304"
FT                   /product="putative HTH-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00304"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39263"
FT                   /protein_id="AAU39263.1"
FT                   /translation="MKMKVKEVADLVGISVRTLHHYDEIGLLAPSETTEAGYRLYSDDD
FT                   LEKLQQILFFRELDFPLKKIKSILENPSFDKNEALQLHRKALLEKRSRLDQMIATIDKT
FT                   IQFAKGEINMTNEEKFAGFDFSQNPYEEEARERWGDEAVDRSKAYIESMSEGERKKMEQ
FT                   QYDAIYRKIAALREGAPDSEEAQAAIKEWYDFLNNNTGHSYSLEAFKGLGQMYVADKRF
FT                   TKNIDQYGAGLAKFMCDAMTVFADRNQE"
FT   gene            280500..280679
FT                   /locus_tag="BLi00305"
FT   CDS_pept        280500..280679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00305"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39264"
FT                   /protein_id="AAU39264.1"
FT                   /translation="MNTYLTGILFVLSGILLLNLAVLSGINGVLWGLVLGGSIIFNLIG
FT                   VVLLMRYINEKSHT"
FT   gene            280699..281043
FT                   /locus_tag="BLi00306"
FT   CDS_pept        280699..281043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00306"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39265"
FT                   /protein_id="AAU39265.1"
FT                   /translation="MKKTAENYLPLTQATYYILLSLTQPLHGYGIMQRVESMSEGEVKL
FT                   GPGTLYGALSKLEKQGLIKKEGETGDNRRKQYILTNEGWAVVELEFKRLSKLVAISQSI
FT                   FQKEGDTSNE"
FT   gene            281036..281551
FT                   /locus_tag="BLi00307"
FT   CDS_pept        281036..281551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00307"
FT                   /product="DUF2812 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00307"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39266"
FT                   /protein_id="AAU39266.1"
FT                   /translation="MSKKRKRKFRFFLAWQDRKEEDWLNEMAKQGWMLKSFFLFIYTFE
FT                   KTKPSNTVYRLDYKTTSNLDQEEYIHIYEDAGWKHVTQFLNWHYFAADPSQVQTNVIYT
FT                   DRESEAEKYNGLLKVLYAALASVFLSSGLPILIIGIPGYFYWIAAFNLFVLCLLIVCIL
FT                   KVRRKTRI"
FT   gene            281968..282129
FT                   /gene="rtpA"
FT                   /locus_tag="BLi00308"
FT   CDS_pept        281968..282129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rtpA"
FT                   /locus_tag="BLi00308"
FT                   /product="anti-TRAP regulator RtpA"
FT                   /note="anti-tryptophan operon RNA-binding attenuation
FT                   protein regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00308"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39267"
FT                   /protein_id="AAU39267.1"
FT                   /translation="MVIATDDLETTCPNCNGSGREEPEPCPKCSGKGVILTAQGSTLLH
FT                   FIKKHLNE"
FT   gene            282149..283093
FT                   /gene="ycbK"
FT                   /locus_tag="BLi00309"
FT   CDS_pept        282149..283093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbK"
FT                   /locus_tag="BLi00309"
FT                   /product="YcbK"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00309"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39268"
FT                   /protein_id="AAU39268.1"
FT                   /translation="MSRAEKSTAEQSGHIQHGVRKAAGVVFMVFGTMCFASKSIFVKWA
FT                   YEQGAQPEAVLLYRQLFAAPLFWLIFIVYRSKLPAKPEKAEIFKACAAGLLCFFLSPLL
FT                   DFIGLHGVSATVERMIVMSYPMFVLIITAFVNKKMVSGKTFAAILLVNAGLFLAVGGWD
FT                   VQALEANLSGAFLILLSAVAYAAYLVVAGGLVRQIGGIRMNAYGMSAASLAMAGYALLR
FT                   SLREQPGIVLSYPPAMYGFFMIIAAVTTVIPFLFMLEGMKRIGAERGAVISMIGPVLTI
FT                   FGGVLFLNERLTPVQWLGCLLVHLTVSLLEYRK"
FT   gene            complement(283145..283498)
FT                   /gene="yczC"
FT                   /locus_tag="BLi00310"
FT   CDS_pept        complement(283145..283498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczC"
FT                   /locus_tag="BLi00310"
FT                   /product="YczC"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00310"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39269"
FT                   /protein_id="AAU39269.1"
FT                   /translation="MIDCVLAVGLHFSSAWIFGDGSHEVAAAALLVYVLYPLLMPLTKL
FT                   QGTIGKAIFRIRIVSDDTGRRIKLWQAFVRYIVSWVHIFFGLLYLTVVFSGTKQAVHDF
FT                   AARTYVMKTSDTE"
FT   gene            283751..284818
FT                   /gene="yccF"
FT                   /locus_tag="BLi00311"
FT   CDS_pept        283751..284818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yccF"
FT                   /locus_tag="BLi00311"
FT                   /product="YccF"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00311"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39270"
FT                   /protein_id="AAU39270.1"
FT                   /translation="MGKVKRNMPCPCGSGLKYKKCCGKAEGAFPAVAVQELKQIQKDVM
FT                   EFAFTEHKDTIDQFLNQYSFLSDLDQSAQKICVFNLGVWGVFARPLADGGLTIFEDFLQ
FT                   KKGSSILRSQTKEAVQSWKDLSPALLRVKHITDGGIRFEDAVTNEELTVRMNVKREGPF
FT                   VGEYVLGFPIKIGSHTEFFLQFTIYPAKMADALKDRLSEALNRFTEEGGTKEQLMREDF
FT                   HHVLMHLCRQEESTPSEQVSEDIEWANEMEKETALVFEKGMLDEGHSEPFVSWAVGLWK
FT                   SYCAKKAPVIKKTEAFAAALEYFINTISKSEKSISQAKLAKKYGVSASTVSNRFKDIEA
FT                   VLQDELDHHLELMPS"
FT   gene            284941..285660
FT                   /locus_tag="BLi00312"
FT   CDS_pept        284941..285660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00312"
FT                   /product="antimicrobial peptide ABC exporter ATP-binding
FT                   protein"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00312"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39271"
FT                   /protein_id="AAU39271.1"
FT                   /translation="MMSTILLETRHLQKKFGRSQAVSDVSLSVEKNSIYGLLGPNGAGK
FT                   STTLKLLTGILNPTAGDILFEGRQWKRSVLKDIGSLIESPPLYDNLTAYENAKVHAALL
FT                   GLPDARITEVLKTVDMHHTGKKKAGQFSMGMRQRLGIAIALLNRPKLLILDEPTNGLDP
FT                   IGIQELRELIRSFPEQGMTVILSSHILSEVEQIADHIGIISGGYLGYQGKINKGDDLER
FT                   LFMDVVKSTREKEGGEK"
FT   gene            285657..286415
FT                   /locus_tag="BLi00313"
FT   CDS_pept        285657..286415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00313"
FT                   /product="antimicrobial peptide ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00313"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39272"
FT                   /protein_id="AAU39272.1"
FT                   /translation="MIGYYVKAENLKFKRTFSRKMIFIVPLINICFAFLMNPGFFVAGT
FT                   YNWWSVILMPVMIALLCAQSHQKEKKASNYNGIFSSPVDLHQIWYAKISVIALYSLASQ
FT                   AVFLGFMVGMQFVIPQFSSIHLTVIAANLLLWLTTLWEIPVCLWIARKYGFISAVLFNM
FT                   LGTIILGIMSASSPFWWLNPWSWPIRVMCPTIGIHPNGVPLENGDPLTSWAVVPPAVVL
FT                   SVLLFAILARLTRRSFSPAVDRKSIKREAV"
FT   gene            286417..287187
FT                   /locus_tag="BLi00314"
FT   CDS_pept        286417..287187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00314"
FT                   /product="antimicrobial peptide ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00314"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39273"
FT                   /protein_id="AAU39273.1"
FT                   /translation="MLLFFRCLAADFQKTKRTSFIWLHLSVPVICAGVFLLYFYNRQPD
FT                   PYQLYRTYFEAIAIALPLLIGIVCGMTASLEEQAGRFQVLLGGTAPKLTAYLSKVTLLL
FT                   IMNIFAVFLAIGLYLLGLRALFHVPNLPSSLFLEAGAWLAAGSVTLYFIYFLISCTFGM
FT                   GASILAGGAGLLMTALMNTGLGDVIWKYNPWAWGIRLTGYKGIDRFVQIDPSLRSVLDG
FT                   EIKQGAFIMVFAIIAVFALSIIWFIRWEGRKAFE"
FT   gene            287209..287871
FT                   /gene="spaR"
FT                   /locus_tag="BLi00315"
FT   CDS_pept        287209..287871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spaR"
FT                   /locus_tag="BLi00315"
FT                   /product="two-component response regulator SpaR"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00315"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39274"
FT                   /protein_id="AAU39274.1"
FT                   /translation="MAKILAVDDEKDILVLIQNILRRDQHQVHTLSQVNTESLDVFSGY
FT                   DLILLDVMMPGMDGFELCEKIRPLVDCPILFLTAKTEEEAIVKGLLTGGDDYISKPFGV
FT                   LELSARVNAHLRRERREKYETKRVISGFLFHFDSKEVFIHDQKLNLTKNEFKICELLAQ
FT                   HKGRTFTREEIYDHVYGLEGNALYSTITEFIRTIRKKCKEHNRDPIKTVWGVGYRWE"
FT   gene            287862..289232
FT                   /gene="spaK"
FT                   /locus_tag="BLi00316"
FT   CDS_pept        287862..289232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spaK"
FT                   /locus_tag="BLi00316"
FT                   /product="two-component sensor histidine kinase SpaK"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00316"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39275"
FT                   /protein_id="AAU39275.1"
FT                   /translation="MGIIRKKKTLRRELIKYMLTLSFSLIAITALYVLVNMIGMNAGLF
FT                   YPANYNEIEAEKLKPRLQSAEQITEDMIPDTMLYAILDKKSKQKTAGNMKETNLSIVRK
FT                   KIESRPYVSFSQKGYMIIERKDEYCVLEYPLRAEFRSPLLRRFLPNYELTSICIIVLLL
FT                   ITVVFTVTTRFANRLKEHFQTLNTIAEQIKKQNLNFTPEFSNIKEFDHVISSLMDMRNA
FT                   LQASLRAQWHLEKTKKEQIGALAHDIKIPVTIIKGNAELLSLSPQNQEQSEYIRYILDA
FT                   GQKIEQYIDQLIHLSKTEEALHTEYREGAVKTLVESVLHETEAYIGNKSIDIVLKEQNL
FT                   EGKKAVFDKQLLHRALMNIMTNAADHTPEGGRIDFEAVCTADQLIFTITDSGKGFSQDG
FT                   LQKAAELFYMEDKARTSNGHYGMGLTFALRVVKLHQGDLAIKNSEAGGGQVQVTIPL"
FT   gene            complement(289305..290189)
FT                   /gene="ytlI"
FT                   /locus_tag="BLi00317"
FT   CDS_pept        complement(289305..290189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ytlI"
FT                   /locus_tag="BLi00317"
FT                   /product="HTH-type transcriptional regulator YtlI"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00317"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39276"
FT                   /protein_id="AAU39276.1"
FT                   /translation="MDFKTLKTFHKIVACGSFNRAAEELNYAQSTVTMQIKKLEEDLGI
FT                   RLLERGKTFRLTEAGRLFFEESRHIVKDIDHLQHHMADLLLGEGGNIRLGAVEPIASCE
FT                   LPQILGRFLADYPKIRVSVDIANSSALGERLVQGSLDLAVCSTPAMGTDLYFEPLYAEE
FT                   LVVLLPEGHPAGNNERIHLKDIREHRLLITANNCTYRKKVEIAFQELPGSQMNTMEIGS
FT                   MTALKNYVAAGLGVALIPKSIVSPPPPGTIVRFIDDDPISVTFGILCKTAAFPLKQADA
FT                   KLYQYLKQELGEP"
FT   gene            290299..290694
FT                   /gene="yusQ"
FT                   /locus_tag="BLi00318"
FT   CDS_pept        290299..290694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yusQ"
FT                   /locus_tag="BLi00318"
FT                   /product="putative tautomerase YusQ"
FT                   /EC_number="5.3.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00318"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39277"
FT                   /protein_id="AAU39277.1"
FT                   /translation="MPFVRMDLLKGRSKEELRRISRSVHQAMTEAIDVPEDDYFQVITQ
FT                   HDEEEFFFDPSYMNIKRTKDLIYIHITMKERPIEKKLALYQRIAERLQKNAGIRQEDVM
FT                   IIAAENVKENWSFGNGTAQLASVERER"
FT   gene            290698..291438
FT                   /gene="yusR"
FT                   /locus_tag="BLi00319"
FT   CDS_pept        290698..291438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yusR"
FT                   /locus_tag="BLi00319"
FT                   /product="putative dehydrogenase/reductase YusR"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00319"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39278"
FT                   /protein_id="AAU39278.1"
FT                   /translation="MEMKNKTALVTGGGTGIGRAVSLSLANRGAAVVVNYSRSKAEAEE
FT                   TVGMIESQGGRALAVKADVSKISEVQDMFDRAVGEFGTVDLLVNNASITRHIELDDLEG
FT                   ASEEVWDELYAVNVKGMFNCARAAAPFMKRNKQGAIVNVGSIAGLTGSGSSLPYAVSKA
FT                   AVHGLTKSLAHALAPDIRVSCVAPGAVSTRWWEGNEEKMKRLSQKLPLERIAEPEDIAL
FT                   LICALLEQETVTGQILTADCGQTL"
FT   gene            291526..293610
FT                   /locus_tag="BLi00320"
FT   CDS_pept        291526..293610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00320"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00320"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39279"
FT                   /protein_id="AAU39279.1"
FT                   /translation="MRRLQSLEAIEKVKNGDYHVLRDAEWLKYLVLTEEQNINLERISS
FT                   LENMPQNPVFLYVEQTLSILEKADIPELEKEIIEEVLIWSEAAKCGQPHKRKEWREKGF
FT                   QLAIHNIGSAQIYADRRQAYMPERQDIEELIHILIVTHGLVGQYIRGETRYRQFTPLID
FT                   WIETSELQHIDIRRVLYVLNKCIIEAVSPALWDSIERDVNRVIGQICTGERNKDWPFAE
FT                   RIRKLRGQALDSGEDSSRYERFLREHSAEDTLRRFFQRIDLWYVESALSSFSFEEFVKI
FT                   FLLVLRSVNPLSVKHISFEPLMKDMYRDYQGVRHINVYKKRIIEACLKEMSISDLLYGE
FT                   VPVNEHVSLAVQPFDQASEIVGVTFSFSQAGLKLIEFCQEAEKSPLYERAIVLLYDFFE
FT                   FRKDSFDRLQNEAAYLSDMNGAEDYKKKIADYAVGERMLDIGAGGGVMLDLLTDQHPEA
FT                   EVIGIDLSVNVIEELQKRKVREHKPWHVKQADALDLPEYFEQESVDTIVFSSILHELFS
FT                   YIPYEGKKFNHLVIAQALKSSFDILKPGGRIIIRDGIMTENKEETRRIRFKDPDGMDFL
FT                   KRYVHDFKGRKVQMLEAEKDAAVLFVNDAMEFLYTYTWGEEAYPHEVQEQFGYFTPSEF
FT                   RRCIEKELGERANILVFEHYVQEGYEEHLYPKIELTDRLGRRVPLPDSTCFIVIEKKHL
FT                   "
FT   gene            complement(293621..294697)
FT                   /locus_tag="BLi00321"
FT   CDS_pept        complement(293621..294697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00321"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39280"
FT                   /protein_id="AAU39280.1"
FT                   /translation="MRSKKFFLMMLLMIVAVVSTACGGSKSASGEKEDTKKADNAEVKI
FT                   LSSEYTLPDDSSTNLHENELILKINVSVKNTGKEPLMVDKSQFSLYEGDSKMSDVSVYD
FT                   ERNKRLRSSTLNSDKEVDGNIYYIVEKGKKFQLEYTPDMYGENKADPVKFEIDGGSDEL
FT                   LKTAKKLEDPAKALLAYTDVTIFGKDNNNFDKLVDENKREVVTDYLEGAQKSIVRSLGY
FT                   YDEEDVDKKKLNKLISAIQNAYQEKSQVKAVTKSISGDEATVEATVTPIDNTDVQKKVK
FT                   KRLEDYVKDSGKDFMSRDELINPAIDIMSEEIKKAEATSSEKTVEVKLEKSKNDKWKID
FT                   ADNYKTEQYFSSFLKSNN"
FT   gene            complement(295313..296713)
FT                   /gene="ycgA"
FT                   /locus_tag="BLi00322"
FT   CDS_pept        complement(295313..296713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgA"
FT                   /locus_tag="BLi00322"
FT                   /product="C4-dicarboxylate anaerobic carrier YcgA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00322"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39281"
FT                   /protein_id="AAU39281.1"
FT                   /translation="MSNGTPQKTKLHFPHTYALIFFIIILAALASYFIPSGEFKRVEED
FT                   GQTVIVQGSYKQTDAGPVGFFEMFKAIPEGMIQSADIIFYIFLIGGAFGIIHQTGMIRA
FT                   GVHVLVQRLKKRGFLLIPVTMFVFSIGGATIGLSEETIIFIPIGIAVARALGYDSMTGL
FT                   AMISLGAAAGFTGGMLNPFTVGIAQTIAEVPVFSAFGYRLAVYAAMLGFSIFYVMRYAQ
FT                   QVKAHPNTGLMYGSETEINEETAAGHADLSFTGRHGLVLLITALGFGINMFGVFQWGWF
FT                   LSELSAGFLIIGFAAGLAGGRGINNTFHSFVDGMKQVVYGALIVGFARAIVIVLENGHI
FT                   IDTIINSLASAISSLPNEISAIGMFAVQIAINTFIPSGSGQAATTMPLMAPLADLLGFE
FT                   RQIAVFAYQYGDGITNSIIPTSGVLLASLSIAGVPYERWVKFVWKLIAGWIIIGAAAIV
FT                   IAMIIGIK"
FT   gene            296838..298013
FT                   /locus_tag="BLi00323"
FT   CDS_pept        296838..298013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00323"
FT                   /product="putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00323"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39282"
FT                   /protein_id="AAU39282.1"
FT                   /translation="MKKQIEKEIENIREELLHISQYIGNHPELGHEEFKASKILSEELK
FT                   KHGFQVELGTCGLATAFTAEFDSGRPGPSIGFMAEYDALPDLGHACGHNLIGTMAVGAA
FT                   IGVSKVIASCGGKVYVYGTPAEETKGGKVTMAEQGVFDHLDAAMMVHPYCRHEKSGTSL
FT                   AMDAIQFEFFGKASHAAGAPHEGINALDAVIQTFNGINALRQHILPDARIHGIIPEGGK
FT                   AANVVPDYAVAQFYVRGTERAYVNELLDKVKNCAKAAALATGARLESSFYELSYDDLKT
FT                   NETLSDAFTQNMIELGVDPDSIHEKADGGGSVDMGNVSQIAPSIHPYVQICDEPYACHT
FT                   PEFREAAMSSRGFEGLMLGAKSMAFTAYDVLINEELLKKIKEEFNLLKALA"
FT   gene            complement(298225..298677)
FT                   /gene="yvbK"
FT                   /locus_tag="BLi00324"
FT   CDS_pept        complement(298225..298677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yvbK"
FT                   /locus_tag="BLi00324"
FT                   /product="putative N-acetyltransferase YvbK"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00324"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39283"
FT                   /protein_id="AAU39283.1"
FT                   /translation="MNIRRLHPEHEPPLDLLLTADPSEKLVNDYLERGQCYTAEIDRRI
FT                   AGVYVLLPTRPETAELVNIAVKEDLQGKGIGRQLVMHAIETAKAQGFKTIEIGTGNSSI
FT                   GQLALYQKCGFRITGIDRNFFLRHYEKPIYENGMRCIDMIRLSLDL"
FT   gene            298777..300276
FT                   /locus_tag="BLi00325"
FT   CDS_pept        298777..300276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00325"
FT                   /product="putative amidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00325"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39284"
FT                   /protein_id="AAU39284.1"
FT                   /translation="MNISDYVKHDAVALSKLIKHGEVTVNELIDAAFSRLEEVNPELNA
FT                   VIRTRKEQVKIESKQLDIRHQPFAGVPILLKDISQALKGEPLTAGAKLLSSYKPKRDSN
FT                   FVAKLRGAGFLFLGQTNTPEYGLKNISEPELYGPSRNPWNTDYSPGGSSGGSAAAVAAG
FT                   IVPLAGASDGGGSIRIPASFTGLFGLKPTRGRTPVGPGAGRQWQGASIDFVLSRTVRDS
FT                   AALLDILQTIQPEAAFQTPLFPGQYEEDMKKGLERPLKIAFSVESPVGTPVSDEAKQAV
FT                   RRTVRWLEAQGHHVEEQTNGVDGIRLMENYYLMNSGEISAMILGMEKTLGRAITVQDVE
FT                   IVTWVLNEAGKKVSAAEFTASLASWDRAAAQMAAFHETYDLYVTPATAYPAPKVGELTH
FT                   TEKEAEALLKVSELEKIEQQSLIYQMFLKSLTYTPFTQLANLTGQPAMSVPVHLTNEGL
FT                   PLGVQVTAPKGKEHWLLRTAHLLEQSDLWIGMKGNPMLGSL"
FT   gene            complement(300299..302134)
FT                   /gene="yjbG"
FT                   /locus_tag="BLi00326"
FT   CDS_pept        complement(300299..302134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjbG"
FT                   /locus_tag="BLi00326"
FT                   /product="oligoendopeptidase YjbG"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00326"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39285"
FT                   /protein_id="AAU39285.1"
FT                   /translation="MEKVAEKRPKRCEVPEELTWNLTDLFSSYETWEDALVKIEEDLAS
FT                   IGSFKGRLHEGAGVLLDCLSLREILLKRLVRAAAYTHLRKSEDLTNPVNQADASRMAAL
FT                   QAKINAGLSFIQSEILEFPENQVETYIKNEKGLEPFSKMLTEIMELKPYKLAPETEEAL
FT                   AVLGEIHDAPYKIFGMAKLADMQFSPIQDRNGNTLANSFALYEGKYMFSPDTHIRRTAF
FT                   DSFTNTLQTYKNTIAAIYETEVKKQVSMSRLRGYESVTHMLLQPQSVTLEMYRNQLDVI
FT                   KNELAPHMRKYAALKKRVLDLDEMRFCDLQAPLDHDFSPKTTYEQAGRMILDALQVMGP
FT                   EYTEVMETALTERWVDLADNIGKSTGAFCSSPYGAHPFILMTWTDTMRDAFTLAHELGH
FT                   AGHFYFANREQRIMNVRPSLYFIEAPSTMNEMLLAQHLFSKTNDPKMKRWVINQLMGTY
FT                   YHNFVTHLLEGEYQRRVYELAEQGHALTASVLSEQTSAVLSEFWGSGVKVDEGASLTWM
FT                   RQPHYYMGLYPYTYSAGLTASTIVSQQIKEEGRPAVDRWLNVLKAGGTMKPLDLLKHAG
FT                   VDMSTDQPIRRAVTYVGTLVDELEKLYDKKEDRPD"
FT   gene            complement(302247..302516)
FT                   /locus_tag="BLi00327"
FT   CDS_pept        complement(302247..302516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00327"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00327"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39286"
FT                   /protein_id="AAU39286.1"
FT                   /translation="MFGFIWSLIIGGILGWLAGLIIRRDVPGGIIGNIIAGFIGSWLGS
FT                   MILGRWGPVVGGFNIIPALIGAIILIFIVSLVMRSMGGRNRNAQ"
FT   gene            302687..304402
FT                   /locus_tag="BLi00328"
FT   CDS_pept        302687..304402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00328"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39287"
FT                   /protein_id="AAU39287.1"
FT                   /translation="MKQSLKALKGFRAFAEEKMKEWNVPGAAVAVIKEDEIIMAEGFGF
FT                   RDKERKLKVNPETVFAIGSASKAFTTAAMAVLADEGKMEWDKPVREYLPEFKMHDPVAT
FT                   ERMTPRDLACHRSGLPRHEMMWYNSSFSREELFRRIRYLEPNQDFRSKWQYQNLMYMTA
FT                   GYLAGRIAGTTWEDLVHERLFKPLHMTSSSFSVEDMQKLSDFAFPYQENNGTVEKIPFR
FT                   NIDAIGPAGSINSNAVDMANWLLLQLGSEKFNGVLSDGSLHELHTPCISCDSIIKAKEL
FT                   PVCSYGLGWFVEPYRGRHMIHHGGNIDGFSSLVAFMPYEKIGIVILTNMNGSFLPNVLA
FT                   YNIFDRLLGLEEIDWSGRLKGEAEKIMKAALGVDRTADLTKIEGTNPSHALKDYTGVYE
FT                   HPGYGEIKIELKDGVLQALFNSFVMPLKHYHYNIFEMKMPLTEMAMLASFDTDIHGHIS
FT                   RLSIPFEMAEGAREIEFVRKPDQQLYDPEFLASLTGKYALGDGTDVVVSLRNNRTLWVS
FT                   LPGQPDYELEPYRELTFQIKNLPGFSVRFEAGDSGQVTGLRFIQPNGEFPAVRK"
FT   gene            complement(304462..305784)
FT                   /locus_tag="BLi00329"
FT   CDS_pept        complement(304462..305784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00329"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39288"
FT                   /protein_id="AAU39288.1"
FT                   /translation="MTTADERKVIEQQFKQRMDEEELLNCMRCGFCLPSCPTYIESGFQ
FT                   ESHSPRGRIALMKAVVDGTIEPDEDVERSLELCLGCRACEPVCPSGVNYGRLLEEARDI
FT                   IQQNKKHAFPVKVLRRAVFKGLFPHPNRIRALTGMLGLYQRSGMQNVIRKSGLLRLLPD
FT                   HLAKMEAVLPKVPNMKQLKKRPHLLPAIGERKKRAAFFSGCLMDTLFLDTNMATIELLR
FT                   LAGCEIIIPEQQTCCGALHGHSSEKSEAILLAKRNIQAFEDSNADFIITNAGGCGAFLK
FT                   EYDHLLKDDSEWRERAASFTGKLKDFSSVLLELNFDQQSLELPEQIVTYQDSCHLRNVM
FT                   KTSAEPRRLIRSIKGIEFKEMKNAESCCGSAGIYNIVESEMSMKILDTKMEAAAATRAA
FT                   TIVTANPGCLLQMKLGIERAGLTDRVRAVHLADLLLEAVQK"
FT   gene            complement(305781..307193)
FT                   /gene="glcD"
FT                   /locus_tag="BLi00330"
FT   CDS_pept        complement(305781..307193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcD"
FT                   /locus_tag="BLi00330"
FT                   /product="glycolate oxidase subunit GlcD"
FT                   /EC_number="1.1.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00330"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39289"
FT                   /protein_id="AAU39289.1"
FT                   /translation="MISSQVRSKLIEIVGSANYDDSNAGRLVYSYDATPQFQSMPDAVI
FT                   APRSKEEVSRIVKICNTHRIPIVPRGSGTNLCAGTCPTEGGIVLLFKHMNQILEIDEEN
FT                   LTITVQPGVITLDLIHAAEEKGLFYPPDPSSMKISTIGGNINENSGGLRGLKYGVTRDY
FT                   VMALEIVLANGDIIRTGGKLAKDVAGYDLTRLFVGSEGTLGVITEATLKLIPAPETKKT
FT                   VLALYQDIDSAAQTVSNIIAHKIIPTTLEFLDQPTIQVIEDFAKIGLPVHAKAVLLIEQ
FT                   DGTEDAVRRDIAVIEEICKKGNAVSVQTAQTEAEAENLREARRTALSALARLKPTTILE
FT                   DATVPRSEIAEMVKAINSIAEKHQISICTFGHAGDGNLHPTCTTDVRNSEEMKRVEQAF
FT                   EDIFKKAVELGGTITGEHGVGEMKAPYLELKLGNAGIAAMKAVKQALDPNNIMNPGKIF
FT                   AKDSRKRVVVTR"
FT   gene            complement(307317..307619)
FT                   /locus_tag="BLi00332"
FT   CDS_pept        complement(307317..307619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00332"
FT                   /product="lactose/cellobiose-specific phosphotransferase
FT                   system EIIB component"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00332"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39290"
FT                   /protein_id="AAU39290.1"
FT                   /translation="MKIALVCSAGMSTSILVKKMREEAENRSLKAEINAYAEADLPSDL
FT                   DEIDVILIGPQVRYLKGQMTERAKPYHTPVAVIDQMAYGMMDGAKVLNQAISLAT"
FT   gene            complement(307616..307948)
FT                   /gene="licA1"
FT                   /locus_tag="BLi00333"
FT   CDS_pept        complement(307616..307948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="licA1"
FT                   /locus_tag="BLi00333"
FT                   /product="lactose/cellobiose-specific phosphotransferase
FT                   system EIIA component"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00333"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39291"
FT                   /protein_id="AAU39291.1"
FT                   /translation="MADTLQLEQVSFEIILHAGNARSSAMEALQLVKHHECETGYQKIQ
FT                   EAESELNQAHQAQTRLLQKEAQGAGLSPNLLLIHAQDHLMTAITVKDLAKEMIDLYQEL
FT                   GKGREK"
FT   gene            complement(307965..309251)
FT                   /gene="licC1"
FT                   /locus_tag="BLi00334"
FT   CDS_pept        complement(307965..309251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="licC1"
FT                   /locus_tag="BLi00334"
FT                   /product="lactose/cellobiose-specific phosphotransferase
FT                   system EIIC component"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00334"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39292"
FT                   /protein_id="AAU39292.1"
FT                   /translation="MKQNKMMAFIESNIMPIAGRIGSQRHLIAIRDGFIAIMPLIIIGS
FT                   LAILVNNFPIPAFQNFMTGLFGEGWTAVGGAIWNGSFALLSLLAVAAVSFKLAESYHTD
FT                   GLSAALIGVGAFAVLTPTTEDFGFSMTWLGAQGLFVGLIVALLSTEVFRLFSKNEKLKI
FT                   KMPEGVPDGVTKSLNALLPAAVILSTAGLCNALIVHFSGQSIHELVFSTIQEPLQGLSN
FT                   TVGSALIFTFLNHLLWFFGLHGTNILGPIMESVYLPLIQENQHLFSQGMSAFEVPYIVT
FT                   KPFFDSYVFMGGSGTTLALLAAILIAVKSKHYKTIGKVSLAPGLFNINEPVLFGLPIVL
FT                   NPIMFIPFILIPLILTITSYIALASGLVPKTVAILPWTTPPIVSGYLVTGGSVRGVFLQ
FT                   IFNLVLATLLYLPFIKAAQRSALHQTENE"
FT   gene            complement(309238..310572)
FT                   /gene="licH1"
FT                   /locus_tag="BLi00335"
FT   CDS_pept        complement(309238..310572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="licH1"
FT                   /locus_tag="BLi00335"
FT                   /product="6-phospho-beta-glucosidase LicH"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00335"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39293"
FT                   /protein_id="AAU39293.1"
FT                   /translation="MALKVVVIGGGSSYTPEIIEGIIKRHHQFPVNEIVLVDIEEGKEK
FT                   LRIVSELAKRMIRHAGVPIELSHTIDRAKALKGADFVTVQIRVGGLKARALDEKIPLSH
FT                   GLIGQETNGAGGMFKALRTIPFMLDIARDIHEICPEAWLINFTNPAGIVTEALLKHGPH
FT                   QKVVGVCNIPYNMKNSIAEIFGVDVNLVMIEFAGINHFVFGKRVWIDGIDRTEETIELL
FT                   LNDHFGYSPSNIAALPWNRQFLRSLRMLPSPYHQYYYQHEDALAKDIEAYNNKGTRAET
FT                   VMEVERQLFERYKDAKIHEKPKELESRGGAYYSESACSLMNSLYHHSMDIQTVNTLNKG
FT                   SIPDLPDDAVIEVNSVITKSGPIPLTVGKLPDAISGPIILMKKFEQLVIEAAVTGDYDT
FT                   AYLAMITNPLVSSDHKAQKVLDEMLEAHKRYLPQFFEEVRAHETK"
FT   gene            310734..311462
FT                   /gene="ybgA"
FT                   /locus_tag="BLi00336"
FT   CDS_pept        310734..311462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgA"
FT                   /locus_tag="BLi00336"
FT                   /product="putative HTH-type transcriptional regulator YbgA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00336"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39294"
FT                   /protein_id="AAU39294.1"
FT                   /translation="MAKQPQLHSQIKQDIVDKIESGYYPPGSLLPTESEFCKIYDVSRT
FT                   TLRTALNHLLMEGAIYRKQGKGTFVAKGKVKQILSSSSLRYAEQLKAQGFKPKIKVVDL
FT                   QKIKPSEKLQTRLGIDAEQMVYQVKRIRYADDEEIQFETAYIRTDLVPEVTEEMANISL
FT                   YQCISRQGNNIKRTEEQIKIVISDEEIAHHLNITQGTPCFQISTQTFLASEEVVEYSMA
FT                   YFRGDRVEFFIERDYGQRGK"
FT   gene            311419..312201
FT                   /locus_tag="BLi00337"
FT   CDS_pept        311419..312201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00337"
FT                   /product="putative polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00337"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39295"
FT                   /protein_id="AAU39295.1"
FT                   /translation="MSSSLNAIMDKGGNESVKSLIINADDFGFSRGVNLGIIEAFQHGV
FT                   LTSTTLMVNMQEADHAVELARQNPELGVGIHLTLTAGRPILGGLHTITDEEGNFRKLLY
FT                   YQGFFDIDLEEVYREWKAQIEKALSCGLNPTHIDSHHHIHTYGNLPEVFVEVAKEYDLP
FT                   CRKVNHDHPSLWKGVRSNDAFELKVDRLKDLSSFFNDYQDAAVIEVMCHPAYVDKCLLE
FT                   KSSFHYPRAYELSLLTEPSLKAALQHCPDIRLTSYAGL"
FT   gene            312613..314400
FT                   /locus_tag="BLi00338"
FT   CDS_pept        312613..314400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00338"
FT                   /product="putative glycoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00338"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39296"
FT                   /protein_id="AAU39296.1"
FT                   /translation="MLINKSKKFFVFSFIFVMMLSLSFVNGEVAKADSGKNYKIIGYYP
FT                   SWGAYGRDFQVWDMDVSKVSHINYAFADICWEGRHGNPDPTGPNPQTWSCQDENGVIDA
FT                   PNGTIVMGDPWIDAQKSNPGDVWDEPIRGNFKQLLKLKKSHPHLKTFISVGGWTWSNRF
FT                   SDVAADPAARENFAASAVEFLRKYGFDGVDLDWEYPVSGGLPGNSTRPEDKRNYTLLLQ
FT                   EVRKKLDAAEAKDGKEYLLTIASGASPDYVSNTELDKIAQTVDWINIMTYDFNGGWQSI
FT                   SAHNAPLFYDPKAKEAGVPNAETYNIENTVKRYKEAGVKGDKLVLGTPFYGRGWSGCEP
FT                   GGHGEYQKCGPAKEGTWEKGVFDFSDLERNYVNQNGYKRYWNDQAKVPFLYNAENGNFI
FT                   TYDDEQSFGHKTDFIKANGLSGAMFWDFSGDSNRTLLNKLAADLDFAPDGGNPEPPSSA
FT                   PVNVRVTGKTATSVSLAWDAPSSGANIAEYVVSFENRSISVKETSAEIGGLKPGTAYSF
FT                   TVSAKDADGKLHAGPTVEVTTNSDQACSYDEWKETSAYTGGERVAFNGKVYEAKWWTKG
FT                   DRPDQSGEWGVWRLIGGCE"
FT   gene            314491..316572
FT                   /locus_tag="BLi00339"
FT   CDS_pept        314491..316572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00339"
FT                   /product="putative glycoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00339"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39297"
FT                   /protein_id="AAU39297.1"
FT                   /translation="MKKAASSFLSCMLLLALFIPNRQISAETSSERPDCRPEGLWDSGV
FT                   EHVPYCDVYDKDGREKLANQLDRRIIGYFTSWRTGKGNQDRYLVSDIPWKYLSHINYAF
FT                   AHIGEDHRISVGEEADENNPSIGMTWPEHPDVKMDQTLPYKGHFNLIHQYKDRYPDVKV
FT                   LAAVGGWAETGGYVDKDGKRIPSGGFYSMTTNGDGSVNHKGIHTFAESVVAFLRKYEID
FT                   GIDIDYEYPTSMQDAGNPADWNIANPRRNGLNKSFEALMKTLREKLDQASAEDGKYYML
FT                   TIAAPSSAYLLRGMETFKPLRYVDYVNIMSYDLHGAWNEFVGPNASLFDNGEDAELKQS
FT                   NIYTTPEYEGIGYLNTDWAYHYFRGAVESGRINIGVPYYTRGWKNVTGGANGLWGRAKS
FT                   ADCPQGLRQCGDGATGIDNIWHDKDEQGNEIGAGANPMWHAKNLEKGIAGSYLERYGLS
FT                   KADLTGVYKRHYDAGLAAPWLWNPEKKVFLSTEDEESIKTKADYVIDKGIGGVMFWDLS
FT                   GDYDWYPERNGSKGEYGIGNTLTRTMYHKFSDTTPYDNRLSTSPLPDESLDAEVELTNF
FT                   PLGDQNYPIHPVMKLINNSDVTITGGSFIEFDAPTSTSPRFRSWSGDHVEVISKGHTGP
FT                   NIGGLTVDFHRIRVTLSIWKTIKPGEEAEFQLVYYLPISGPSNFTISIDGKKYRLKGN"
FT   gene            complement(316631..317581)
FT                   /gene="mpr"
FT                   /locus_tag="BLi00340"
FT   CDS_pept        complement(316631..317581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpr"
FT                   /locus_tag="BLi00340"
FT                   /product="glutamyl endopeptidase Mpr"
FT                   /EC_number="3.4.21.19"
FT                   /note="blaSE"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00340"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39298"
FT                   /db_xref="GOA:P80057"
FT                   /db_xref="InterPro:IPR000126"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR008256"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR028301"
FT                   /db_xref="UniProtKB/Swiss-Prot:P80057"
FT                   /protein_id="AAU39298.1"
FT                   /translation="MVSKKSVKRGLITGLIGISIYSLGMHPAQAAPSPHTPVSSDPSYK
FT                   AETSVTYDPNIKSDQYGLYSKAFTGTGKVNETKEKAEKKSPAKAPYSIKSVIGSDDRTR
FT                   VTNTTAYPYRAIVHISSSIGSCTGWMIGPKTVATAGHCIYDTSSGSFAGTATVSPGRNG
FT                   TSYPYGSVKSTRYFIPSGWRSGNTNYDYGAIELSEPIGNTVGYFGYSYTTSSLVGTTVT
FT                   ISGYPGDKTAGTQWQHSGPIAISETYKLQYAMDTYGGQSGSPVFEQSSSRTNCSGPCSL
FT                   AVHTNGVYGGSSYNRGTRITKEVFDNLTNWKNSAQ"
FT   gene            317755..318528
FT                   /gene="ycdF"
FT                   /locus_tag="BLi00341"
FT   CDS_pept        317755..318528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdF"
FT                   /locus_tag="BLi00341"
FT                   /product="putative glucose 1-dehydrogenase YcdF"
FT                   /EC_number="1.1.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00341"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39299"
FT                   /protein_id="AAU39299.1"
FT                   /translation="MYSDLKGKTAIVTGSSKGIGKAVAERFGKEKMNVVVNYHSDPGGA
FT                   REAVDNIQAAGGNALAIEADVSSEEDVKKLINSAVEHFGSLDVMVNNSGFNGAGAFPHE
FT                   LELDEWQKVIDVNLTGAFLCAREALKYMADRRMKGSILNISSVHQQIPRPKNVHYSASK
FT                   GGMKLLTETLALDYADKGIRVNAIAPGTIATESNEDLEGSRKSEQLKKIPMNEFGEPEQ
FT                   VASAAAWLVSQEAAYVTGATLFVDGGMTLYPSQLE"
FT   gene            318695..319513
FT                   /locus_tag="BLi00342"
FT   CDS_pept        318695..319513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00342"
FT                   /product="DUF1835/DUF3658 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00342"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39300"
FT                   /protein_id="AAU39300.1"
FT                   /translation="MQNNIVHIAFGESAGGSINMMLKQSGGTHEKSLIVLPELFSIGPL
FT                   QKLEAKEGRVNRYEWLKTYLNDRFHESGKRYSRFEVAVSALSGIPEQASVFIWTGDHAH
FT                   EQTGLRFVHHILRQMNLAVFHLNTTKFFPHTRSSGELNDENLRFIYEQGDQAAVTAAEG
FT                   RRLAEEWTALSQQTSVLRVWEDGRIKSVKEDFFDSFIIEKLAQLQKNRSANTFINCLSL
FT                   IGEVIGHLEENIGDEFIEYRILELIRKGIFEMKGTTKGMRYFNVRLKNVM"
FT   gene            319613..321010
FT                   /locus_tag="BLi00343"
FT   CDS_pept        319613..321010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00343"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39301"
FT                   /protein_id="AAU39301.1"
FT                   /translation="MVREQLKQKAQSISKVPPHYQLMIEDYGEKYEKERRVFFAWQDIE
FT                   EPERDISVELDHQGRLISLTKEYEPVVEEALPDERLLQIALQFTEQHYPNAPYEFVFHE
FT                   KKVTEQFVRFTYVQTVLDLPLPQTGFYVRVAKNGEVIEFRYNGGTSSFSIPKQIADKQS
FT                   VTADYLEHVQFELAVEKIRSELYEGGDDLPHLIYEADLPFFSYPADITEKRQMKPAADD
FT                   EEEEDTLPLPVLPEADRHADIDDMIGFTPSMRKIRETDLGESIGTVWRLGDDPEPRDRS
FT                   IAGYFETWNQNTLKIVKDKNSGKLKGIASFIKSEGPPVLSGEDCLKRALQFLYRLYPDA
FT                   DRLFRMHPAENDGDRSNAFFQFDLQYKGVPLRLGSANISINRTTGRVVGYHGPEIEPET
FT                   LIDLSPSPSISEEEAKAVFAAAFDVKLQWERDYSREKDDFYRLVYRPVYPYFIDAHDGK
FT                   AFMSKNI"
FT   gene            complement(321064..322017)
FT                   /locus_tag="BLi00344"
FT   CDS_pept        complement(321064..322017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00344"
FT                   /product="3-mercaptopyruvate sulfurtransferase"
FT                   /EC_number="2.8.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00344"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39302"
FT                   /protein_id="AAU39302.1"
FT                   /translation="MTISGFIFDIAHERKLFFYYQNPRKNKGERRDRELSVLKSPEWVY
FT                   KRLMEKTDQTVIVDVRFHLTKPDEGRKAYTKGHVPGAVFIDLKEDLSRNPEEHGGRHPL
FT                   QDPDLLAAKLGKIGIDRQTDVVVYDDSGGMFAARFWWQLHYLGHDSVYIMDGGLSNWIK
FT                   AGYEVNAEDPRPSEREFKPALRENELLDAKEVLKRIGREGSILIDARDPSRYTGETEPL
FT                   DHRAGHIPGAKNFFWKGNLTEGGLWKSKEQLRQHYAALDPGSEIVVYCGSGVSACPNVL
FT                   GLKEAGFENVKLYAGSWSDWISYPDHPISTGAEDDI"
FT   gene            322073..322501
FT                   /gene="cwlJ"
FT                   /locus_tag="BLi00345"
FT   CDS_pept        322073..322501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cwlJ"
FT                   /locus_tag="BLi00345"
FT                   /product="cell wall hydrolase CwlJ"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00345"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39303"
FT                   /protein_id="AAU39303.1"
FT                   /translation="MAVVQASSKDISLLARLLRAEAEGEGVQGMLMVGNVGINRIRANC
FT                   SDFVGLRTIPQMIHQPHAFEAVTHGYFYQRARESERRLARRAVNGERLWPAKFSLWYFR
FT                   PAGACPAQWYNQPHVGRFKSHCFYEPTAEECENVYNTF"
FT   gene            complement(322548..323537)
FT                   /gene="yceB"
FT                   /locus_tag="BLi00346"
FT   CDS_pept        complement(322548..323537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceB"
FT                   /locus_tag="BLi00346"
FT                   /product="luciferase-like protein YceB"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00346"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39304"
FT                   /protein_id="AAU39304.1"
FT                   /translation="MQLSILDQVPISKGSDAHSALKHSAELAELADQWGYKRYWFAEHH
FT                   STRGLASTAPEIMIAHIAAKTANIRVGSGGVLLPQYSPFKVAENFRQLEALYPGRIDLG
FT                   IGRSPGGTTKTRLALTDGVHKSLHEFPRQLQDLVSFLTDSVPSGHDYFGIKASPLTDSP
FT                   PEVWLLGLGENSAKLAGSMGAGYVFGHFISPARGKNAFQSYRESFRPSPFFKRPQSLAA
FT                   VFVVCAESDEKAEELCLSQDLWLLRVEKGLDSLVPSIEEAKSAAYTAADKKKLAQNRSR
FT                   MVIGSPQTVKRKLLELSERYQTDEFMILTNVYRFEDKKQSYERLAELF"
FT   gene            323849..325207
FT                   /gene="cwlO"
FT                   /locus_tag="BLi00347"
FT   CDS_pept        323849..325207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cwlO"
FT                   /locus_tag="BLi00347"
FT                   /product="peptidoglycan DL-endopeptidase CwlO"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00347"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39305"
FT                   /db_xref="GOA:Q65NQ9"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65NQ9"
FT                   /protein_id="AAU39305.1"
FT                   /translation="MKKKVYTFGLASILGTASLFTPFMNNTASAETSQQKQEIQQKRSE
FT                   VNSGIESKRKEIAKLQDEQKKLEGKIQELDKKALETSNKIEDKEKENKKTKKEVEALKK
FT                   EIKETEKRIEERSKVIKNRVRSLQENGGSQNYLNVLLGAQSFGDFITRATAVSTIVDAD
FT                   KDLLDEQEKDKNKLEKAMSDLNTKLDEIQKTLADLKTLKSDLDKQLKEQANLSKQLQTK
FT                   QAAAESELSDLKKEAGSLTKEEAALEQKLKEERAAAAAAAKAKEESATAEKSDSGSSSS
FT                   SNSGSVSKSDGSSNSGSSSSKKSSSPSRNYSSGSVVSSNGNAIEAAISTGSSIVGRSPY
FT                   KWGGGRSQADIDNRRFDCSSFVRWAYASAGVELGFGATTSTLVGKGRAVSASEMKRGDL
FT                   VFFDTYKTNGHVGIYLGNGTFLNDNSSRGVSVDSMSNPYWKKAFNGVVRRVVE"
FT   gene            complement(325259..326071)
FT                   /locus_tag="BLi00348"
FT   CDS_pept        complement(325259..326071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00348"
FT                   /product="putative antimicrobial peptide ABC exporter
FT                   permease YclI"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00348"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39306"
FT                   /protein_id="AAU39306.1"
FT                   /translation="MNLSLYKQMLRTNMKGIMSYGVGSAFYILLILGIYPSIAGNAEDI
FT                   EKMIKSMPEGFLNAFGFENGLGNLEDFISGEYYGLIFIVILSIFSVMLSTKLLAKRVDQ
FT                   GSMAYILSAPTTRGKVAFTQAAVLTTGLLIIMAVTTAAGLAGYHLMLGGDYDFNVSRFL
FT                   VLNLLGFLLFFAVGGISFLFSAISNDEKRALGLSGGITFLFFSFDLLGKLSEKTEWLRS
FT                   LSVFSLFRPGDIVNGSTDIAQVSLVLAAVGFAAFALSILIFKKRDLPL"
FT   gene            complement(326068..326955)
FT                   /locus_tag="BLi00349"
FT   CDS_pept        complement(326068..326955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00349"
FT                   /product="putative antimicrobial peptide ABC exporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00349"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39307"
FT                   /protein_id="AAU39307.1"
FT                   /translation="MLTVERLTKKFSNGKGIFDLSFHVQKGEVFGFLGPNGAGKSTTIR
FT                   HIMGFMKPDQGDIKVNGMDVLKQQGDIQRHIGYLPGEIAFIEGMTGKQFLDFMADMHGL
FT                   KDTAKRNDLIERLQFDVHTPIRKMSKGMKQKVGIVAAFMHSPEVIILDEPTSGLDPLMQ
FT                   KVFIEIVLEEKAKGTTFLMSSHSFPEIERTCDRAAIIKDGIIIAVKDIHELQSMQRKVF
FT                   EVTFENTGDIPAFMNSSLQIESRTDNRVKVAVLGNHDQFIKETAKYHIRHIDASSQSLE
FT                   EIFMNYYNRKGTAQ"
FT   gene            327105..327692
FT                   /locus_tag="BLi00350"
FT   CDS_pept        327105..327692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00350"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39308"
FT                   /protein_id="AAU39308.1"
FT                   /translation="MNGFEKRALLIKEKIKKTALDMLKTWEPKRIRITDIAKEANVSQV
FT                   TIYNYFGSKEALLKEVFKDYIDQSISEFEEYMNKDISVKEKIELMILQKRAANNQKFAL
FT                   TVIKEVMIEDSEIMDYVKQQYDEKIIPLMLQMIEEGHRTGEISSKITAESFLIFMNMII
FT                   EHSKTLGKAFEKNRKFTEEMLHIFFYGLCGRP"
FT   gene            327795..329690
FT                   /locus_tag="BLi00351"
FT   CDS_pept        327795..329690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00351"
FT                   /product="DUF2207 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00351"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39309"
FT                   /protein_id="AAU39309.1"
FT                   /translation="MKHSFFFFMFIAFFLVTGFSEAGKSFSIERADIRATVKENGDLSV
FT                   EEVYRYDFKGSFEGATRSFSEETASRLKNFKAYLLPDHRRKGGQAIPLKTKKEDGTYFA
FT                   YSASKDETKNVMFRYVIEDAAQKFEDTSILIHSFYQKANTDFGRVKIEVRLPDSVKARD
FT                   IHAFLREKGNGKITKVNDSSVTYETGLYRAGTGSELRIYFPQSALKEAVRHPSYQTKDE
FT                   LLKEERDEAKRYAERDERIAGAERMILIFSGIVGFMVIMAVMLSFLKKRRRAMLSFEEL
FT                   ESFDPVLVAFLYKKGRFTDRDLLAGLLSLYQRGLVTMQKVQAEERFLDDPKAPDDTYEF
FT                   EFSGSKADLPKPDQLLIEKLFEQTGSDTYMFRLDSLSGPTEEECKHKEQLGKYERKRII
FT                   LQNVVQKWTESVRQAPEFRELFQENRWLRMLSLSLLSVHTGLLLFILYADVVHQAGFMA
FT                   ACVIFGFALSAGIVLAKSKLYTILFLAGLFLASVFTDSVHTILYYGICVGLSILLIAFI
FT                   PAVKESRYASICRRSILSWRNHLRKEDLFSGRSLSQNEKTMIFAIVLEVEDESAVWLNQ
FT                   SANRLDYASPVLGMAAAGCLHYPFYSWQLPDSQQHAGAYDAGGSGAGGGDGAGAF"
FT   gene            complement(329722..330204)
FT                   /locus_tag="BLi00352"
FT   CDS_pept        complement(329722..330204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00352"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39310"
FT                   /protein_id="AAU39310.1"
FT                   /translation="MGKTIINKPFTAAPEDEVVVFVIGMRVNKWHAVHKWWPVFTAMPP
FT                   MIKELYQNKNLGFLAMESFINFRTICLIQYWRSFEDLTAYAKGDKHMAAWRRFYQKTAA
FT                   SGAVGIYHETYSVPKGRYEAFYHNMPVFGLAKAYGHQPVTRGTKTAEQRMRGTEII"
FT   gene            complement(330197..330760)
FT                   /locus_tag="BLi00353"
FT   CDS_pept        complement(330197..330760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00353"
FT                   /product="putative transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00353"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39311"
FT                   /protein_id="AAU39311.1"
FT                   /translation="MTKRNHTTYALLGLITAGYRTGYEMKRMIDQSLNHFWKISYGQIY
FT                   PALRQLTEAGWAAASPALSDKKQDRKEYMITAEGQKALQSWLEEPINDIASEKNEFLLK
FT                   LFFSKEESREKTALKVKEYQQKLEERLEAYKAIEQSILSCSSHSKDREYWLFTLDYGKR
FT                   TTSAGIEWCEATINRLNGKEGTNG"
FT   gene            331077..331679
FT                   /gene="yceC"
FT                   /locus_tag="BLi00354"
FT   CDS_pept        331077..331679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceC"
FT                   /locus_tag="BLi00354"
FT                   /product="putative stress protein YceC"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00354"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39312"
FT                   /protein_id="AAU39312.1"
FT                   /translation="MAISLEKGQRIDLTKGKAGLSKILVGLGWDPVASGSGGFFGKLFG
FT                   GGTPNIDCDASVLMLENGRVTENKNVIYFGNLRSRCGSIEHTGDNLTGEGSGDDEQIIV
FT                   DLQKVPSHIHKLVFVVNIYDCVKRSQHFGMIENAFIRIVNMNDRSEMVKYNLRDDYSGR
FT                   TSLIAGEIYRDGAEWKFTAVGEGTNDTSITEIVKRYA"
FT   gene            331708..332289
FT                   /gene="yceD"
FT                   /locus_tag="BLi00355"
FT   CDS_pept        331708..332289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceD"
FT                   /locus_tag="BLi00355"
FT                   /product="putative stress protein YceD"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00355"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39313"
FT                   /protein_id="AAU39313.1"
FT                   /translation="MAISLAKGQKIDLTKTNPGLSKVVVGLGWDVNQYDGGADFDLDAS
FT                   VFLLNAEGKCSSEKDFIFYNQTEGAGGAVIHTGDNRTGEGEGDDEQVKINLNAVPADIQ
FT                   KISFVITIHEAEARRQNFGQVSNAYVRVINEDSNEELIRYDLGEDFSIETALITGELYR
FT                   HGGEWKFSAIGSGYQGGLARIATDFGLQVG"
FT   gene            332365..332943
FT                   /gene="yceE"
FT                   /locus_tag="BLi00356"
FT   CDS_pept        332365..332943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceE"
FT                   /locus_tag="BLi00356"
FT                   /product="putative stress protein YceE"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00356"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39314"
FT                   /protein_id="AAU39314.1"
FT                   /translation="MAIQLSKGQRIDLTKTNPGLTKALIGLGWDTNKYTGGADFDLDAS
FT                   AFLVDQNDRCINDHDFVFYNNLEHPSGAVIHTGDNRTGEGEGDDEQIIVDFSKIPAHVE
FT                   KIGITVTIHEAESRSQNFGQVSNAFVRLVDESTNEELLRFDLGEDFSIETAVVVCELYR
FT                   HGGDWKFNAIGSGFSGGLASLCRNYGLQV"
FT   gene            333009..333782
FT                   /gene="yceF"
FT                   /locus_tag="BLi00357"
FT   CDS_pept        333009..333782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceF"
FT                   /locus_tag="BLi00357"
FT                   /product="putative stress protein YceF"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00357"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39315"
FT                   /protein_id="AAU39315.1"
FT                   /translation="MDLFHHIMSIYASFFDWEMWVEVLTDPVSWGLIGSLVVLEGLLSA
FT                   DNALVLAVMVKHLPEKQRKKALTYGLIGAYFFRFLFIGLGMILIKFWWIKLLGAAYLAW
FT                   LVIKHFFIGEGDDEANAIKKDSWMVRVFGVFWATVISVELMDLAFSVDSILAAFAVSEK
FT                   VWVLLIGGMLGILMMRTVAKFFLTLIDKVPELETTAFVLIGIIALKMAASVWHIEMPHS
FT                   VFFIILIIAFAATFIIHYMNKQKAVKEQTAASKEE"
FT   gene            333876..335057
FT                   /locus_tag="BLi00358"
FT   CDS_pept        333876..335057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00358"
FT                   /product="putative ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00358"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39316"
FT                   /protein_id="AAU39316.1"
FT                   /translation="MQYFDFLSASQKEDVFFKLPGTVTKDSPKRILEYALGAALYVPGN
FT                   RKDIADVIINNKYPELCSVVFCLEDSIGDCEVLQAENNLVSQADMIYQAQKLQNINSDV
FT                   LPLMFIRVREPEQMLELGNKLGRALHLFAGFVFPKFSMLNAEHYLDTLTKLSQESGIVL
FT                   YGMPIFETPDLLAMETRAKALQELKSTLGFYQDIILNIRIGATDLCGLYGLRRKPETPI
FT                   YDILVISDFIKDIVNYFGLQFVISGPVWEYFGDASRTVPPFAPNWAEAGESSLVINRYM
FT                   DGLINETLLDLANGIHGKSVIHPSQIKAVQSLHVISMEDYLDALSIVESADGTRGVVKS
FT                   SFSNKMIEIKPYLSWAKKILLKAEIYGVYHENRSYTDILRASKPFSNLGSFGS"
FT   gene            335202..335423
FT                   /locus_tag="BLi00359"
FT   CDS_pept        335202..335423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00359"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39317"
FT                   /protein_id="AAU39317.1"
FT                   /translation="MMKIVDLTSSEILSSQQACEEWGIDSSTLRKRAHDFPAGTIRKFG
FT                   TTYAVTRAGMCAVFGRKSDTDSEERGDG"
FT   gene            335429..337033
FT                   /gene="yceG"
FT                   /locus_tag="BLi00360"
FT   CDS_pept        335429..337033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceG"
FT                   /locus_tag="BLi00360"
FT                   /product="YceG"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00360"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39318"
FT                   /protein_id="AAU39318.1"
FT                   /translation="MNQEINIQNALVNDDEWKQIIKKPLPERTPYEKNSHLTISRLAGR
FT                   ILGTPHDETDYYIYLHELYASGDVHVLSETLDKTISPERFQAIQRIHMVNQKEKGLSVN
FT                   RFAAFLDGEQLIPKHPDPAMHRHLRKALIEVLQLFQSFHEKGLNDPDFRRVLLDLVKWM
FT                   GNHLEKWLKGADCETAMPKVVWYGDTTKSQRYFLYYLMLVGCDVLLFHPEGKDEFRQLD
FT                   PEQKLSFVFTYPDTSALEPFPTEKPQRKATVAYRSAKELDTVLHNEDSLMYKPWQFREH
FT                   TPASVTLKTTYDELFLIAKERAFIRPNFQASKSTVNIPNLFAMVMGVSSNEKEYWDRLQ
FT                   TLTEYKESHTIRRFPFTKEETSNYQFHYSDALDQTGMIDPGRLMESNIWRYKHLPEGVQ
FT                   RGIAQAVSRMCKSPKMLALNNEKTADVQLYLFTQAVQLPAALLNMIQTFDYSQTVPKLI
FT                   LYHTEQTGTLTRSDAAALLLLNEIGIDIIIYNPPGHKCIDHYIDRQHFDTHWLDEMSFN
FT                   QEFKEPSIVRKFINKIF"
FT   gene            337050..338144
FT                   /gene="yceH"
FT                   /locus_tag="BLi00361"
FT   CDS_pept        337050..338144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceH"
FT                   /locus_tag="BLi00361"
FT                   /product="putative TelA-like protein YceH"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00361"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39319"
FT                   /protein_id="AAU39319.1"
FT                   /translation="MANPNETSIVNISKEEEITVEKAEDIRAKLRQEPDVQALARQIDV
FT                   KNQVELLEFGKEPALEISKFSDRILSMMRTNSVTDSGAMLTQLGKIMDRFDKNDFEEQK
FT                   GLLSKLFKRGNSMIEKIFKKYQTLGGEIEKINVEISKYKDEMTKSTVTLDEMYESNLKY
FT                   YVELEKYVVAGQMKIEELQRLIPEYEAKAASGNQMAQMELDTLRNGIQALEERVYDLDM
FT                   ARMVAIQTAPQIRLLQRGNTKLIGKINSAFIITIPIFKNGIIQAVTAKRQKLVADSMSE
FT                   LDRRTNEMLKRNAENISSQSVEIARMSGRPSIDIETIEQSWNTIVKGMQETKQIEDENK
FT                   RLREEGAKRILELQDNMKKAALNG"
FT   gene            338283..338996
FT                   /gene="ccdA1"
FT                   /locus_tag="BLi00362"
FT   CDS_pept        338283..338996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccdA1"
FT                   /locus_tag="BLi00362"
FT                   /product="thiol-disulfide oxidoreductase CcdA"
FT                   /note="'cytochrome c-family biogenesis protein,
FT                   membrane-associated'"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00362"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39320"
FT                   /protein_id="AAU39320.1"
FT                   /translation="MWKYMAALWLAFGGGFLSFISPCCLPLYPSFISYITGISVGDLKN
FT                   RHAKHIKQSVMIHAAAFLAGFSVIFYILGFSASSVGLLFLQYHNLIRMLGGIFFVVMGL
FT                   FLLGVFRPAFMMKERRFSIRKGKIGLLNSMLVGMIFAAGWTPCIGPIFGTIAYANFQNP
FT                   DFGSAFMMITAYSLGFAIPFLLMAFFIGNIRPLMKYSNMLMKIGGALMIVIGILLYTDN
FT                   MIWINIWYSNLTNLF"
FT   gene            complement(339016..339702)
FT                   /locus_tag="BLi00363"
FT   CDS_pept        complement(339016..339702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00363"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00363"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39321"
FT                   /protein_id="AAU39321.1"
FT                   /translation="MEWKNPWNKKQLVCLFLIAFAAVPIFIEYLLKNALDLLLGEGMLS
FT                   AMLMSIAMAAVFILSLYYIALKPDRLSWREIGISRFAPAYLIQIAGWTVFLIVMTFAVM
FT                   EILIWFGAGYENTKTKTITADPSWLSIAMSFASACIVSPIYEELFYRGFLYRWFRAEFG
FT                   VVWALVASSALFMIAHIPTYNTLAVNFGTGLVFAWTYEKTRSIIPAMIIHSLFNAILLF
FT                   FTILLT"
FT   gene            339786..340526
FT                   /locus_tag="BLi00364"
FT   CDS_pept        339786..340526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00364"
FT                   /product="putative HTH-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00364"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39322"
FT                   /protein_id="AAU39322.1"
FT                   /translation="MVKEELTTGRVAKMMGISVRTLRYYDQIGLLKPGSTLPNGRRQYS
FT                   KEDLLELEKIMILKSAQFSLEHIKTLMNQLDTISIIEMHKRRLNSEIEQLTKSLEHTNT
FT                   LLNMYQIEGSLSWEDLLKLVRQPRHKPWKESFSEEEAEILAERLPKAESDDFITKQWLS
FT                   IIKRIKLCLKQEVPPESEWGKQIAEDIICLSDHSFKGHEDLADRFWEVRKSEEPNGLYP
FT                   LDSGIMEFAERAIESAFHDSGGSG"
FT   gene            complement(340626..341831)
FT                   /gene="nasA"
FT                   /locus_tag="BLi00365"
FT   CDS_pept        complement(340626..341831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasA"
FT                   /locus_tag="BLi00365"
FT                   /product="nitrate transporter NasA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00365"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39323"
FT                   /protein_id="AAU39323.1"
FT                   /translation="MKLADLRKSGHAPSLLSSFLYFDVSFMIWVLLGALGVYVTADFDL
FT                   SPSQVGLIVAIPTLAGSFFRIALGILTDRFGPKKTAVGGMLVTMIPLLWGWQFGSSVAE
FT                   LYIIGILLGVAGASFSASLPMASRWYPPHLQGLAMGIAGAGNSGTLLATLFGPRLAEQV
FT                   GWNGVMGLALIPLTLVLFSYFLMAKEPPNQPAPKPLKDYFAVFKERDTWYFCLLYSVTF
FT                   GGFVGLSNFLSYFFASQYAVPAVRAGEFVTLVVASGSCLRPVGGLIADKIGGVRLLQFL
FT                   FIGVALCMFSVSMLPSLGVVTAALFIGMGCLGMGNGAIFQFVPQRFQQEIGMVTGIVGA
FT                   AGGIGGFFLPNILGTLKQITGTYSSGFLTFTVIAFLALGLLLFAQAGWKKQWKAEEKSI
FT                   RI"
FT   gene            342270..343229
FT                   /gene="ldh"
FT                   /locus_tag="BLi00366"
FT   CDS_pept        342270..343229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ldh"
FT                   /locus_tag="BLi00366"
FT                   /product="L-lactate dehydrogenase Ldh"
FT                   /EC_number="1.1.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00366"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39324"
FT                   /db_xref="GOA:Q65NP0"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65NP0"
FT                   /protein_id="AAU39324.1"
FT                   /translation="MRNQKVNRTVLIGAGFVGSSYAFTLINQGITDELVIIDLNKDKAM
FT                   GDVMDLNHGKAFAPHPVKTWYGTYDDCKEADIVCVCAGANQKPGETRLDLVEKNLKIFK
FT                   GIIGEVMASGFDGIFLVATNPVDILTYATWKFSGLPKERVIGSGTTLDTARFRYLLSEY
FT                   FGVAAHNAHGYIIGEHGDTELPVWSHANIGGVPVSDLLKRNEKYKAEDLDELFDNVKNA
FT                   AYHIIEKKGATYYGVAMSLARITKAIYRNEEAILTVSAHLDGEFGENDVYIGVPAVVGR
FT                   CGAREIVELDLNEKEKQQFKHSAGVLKAILKPHFELQA"
FT   gene            343270..344901
FT                   /gene="lctP"
FT                   /locus_tag="BLi00367"
FT   CDS_pept        343270..344901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lctP"
FT                   /locus_tag="BLi00367"
FT                   /product="L-lactate permease LctP"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00367"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39325"
FT                   /protein_id="AAU39325.1"
FT                   /translation="MMKMWQQIYDPFGNLFISAFAAILPILFFLLALTVLKMKGIIASF
FT                   LTLAVSFIVAVFFFHMPAAKAVSAVLLGIANGLWPIGYIVLMAVWLYKISVKTGKFKVI
FT                   RASIAGISSDQRLQLLLIGFSFNAFLEGAAGFGVPIAISAVLLVELGFKPLKAASLCLI
FT                   ANAASGAFGAIGIPVITGAQMGGLTPVELSRTLALMLPVIAFFVPFLLVFILDGFKGIR
FT                   ETLPALLVLSGSYTAVQTLTMISLGPELADILAALISMGALALFLKKWQPRHIYRETGN
FT                   EHVPAEKYRAADIMNAWSPFYILTAVIAVWSLPGFKGLFQEGGFLKQTTILFNMPFLHR
FT                   EVLKTPPISPEQAPLDAVMKLDFISATGTAILIAVIITIVMSRNISFRGGLSSLKETVK
FT                   ELWLPVLTICFVMGFANLANYAGLSSTIGLALAKAGDIFPFVSPVLGWIGVFITGSVVS
FT                   NNALFGHLQAVTGAQIGTSSALLLAANTAGGVMAKLISPQSIAIATAAVKETGQESKLF
FT                   SQTVKYSLVLLFIICIWTFALSKLGI"
FT   gene            345008..345649
FT                   /gene="ycgF"
FT                   /locus_tag="BLi00368"
FT   CDS_pept        345008..345649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgF"
FT                   /locus_tag="BLi00368"
FT                   /product="putative amino acid efflux protein YcgF"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00368"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39326"
FT                   /protein_id="AAU39326.1"
FT                   /translation="MLNIFLSYVFLGLSLAAPVGPVNAAQIDRGMKGGFFHAWLFGLGA
FT                   VTADVLYMALIYFGVAQFLTAPFLKTFLWLFGFFVLTYTGIESLVKAKEVSLMRGAGEK
FT                   GSYRKSFLSGLVISLSNPLSIMFWLGIYGSILAKTVEAYESYQLLICSSGILIGLFLWD
FT                   LAMSFLAGTFRTFLSPRMIQGTTWLAGISLIVFGCYFGYQGILELLQAGR"
FT   gene            complement(345650..346984)
FT                   /gene="ycgH"
FT                   /locus_tag="BLi00369"
FT   CDS_pept        complement(345650..346984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgH"
FT                   /locus_tag="BLi00369"
FT                   /product="putative amino acid transporter YcgH"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00369"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39327"
FT                   /protein_id="AAU39327.1"
FT                   /translation="MKRQAKKGDLKWWQLSMIGVGCTIGTGFFLGSSIAIKKSGFSVLA
FT                   AFLLAALGTFLVFQQLAKLTADHPVEGSFCSYAREAFGNWAGFSNGWVYWSSEMLIIGS
FT                   QLTAISLFTRHWFNEIPLWVFASIYAILGLIVIFTGRSSFEKTENILAVLKTAAILMFI
FT                   IIAVLALCGLLPGKTPEVQFPDRVHELFPFGFMGLWTGLIYTFYAYGGIEVMGLMAIHL
FT                   KDPKDSSKSGSLMLITLAVVYVVSIGLAMLLVPRGTFTEQNSPFITSLKDFHLDLIMDI
FT                   FNGIFIIAGFSTLTASLFAVTTLMGTMAKNGDAPACFAKKEKAKVSWPALGLTVLVLAA
FT                   SIVLSLILPKQLYEHMTTAASLMLLYNWMFILLSSKKLTKPKMKGNVQIVTALVLILFA
FT                   VSGTLFEKNSRPGFFVSLLFLAVIAAVTMLMKKKWADQEEKNGQT"
FT   gene            347150..347968
FT                   /gene="nadE"
FT                   /locus_tag="BLi00370"
FT   CDS_pept        347150..347968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE"
FT                   /locus_tag="BLi00370"
FT                   /product="NH(3)-dependent NAD(+)synthase NadE"
FT                   /EC_number="6.3.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00370"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39328"
FT                   /db_xref="GOA:Q65NN6"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65NN6"
FT                   /protein_id="AAU39328.1"
FT                   /translation="MTLQEKIMQELNVKPSIEPKQEIEKRVGFLKSYLKKTGAKGFVLG
FT                   ISGGQDSTLAGRLAQLAVEELREEGIQAEFIAVRLPYGVQQDEDDAQLALKFIQPDKSF
FT                   AFDIASTVGSFAAQYQSVTGEALADFHKGNVKARVRMITQYAIGGQNQLLVIGTDHAAE
FT                   AVTGFFTKYGDGGADLLPLTGLTKRQGRSLLEELGAPERLYTKSPTADLLDEKPQQSDE
FT                   TELGLTYDNIDDYLEGKAVSSEVAEAIEKRYKASEHKRQVPASMFDDWWK"
FT   gene            348091..348624
FT                   /gene="aroK"
FT                   /locus_tag="BLi00371"
FT   CDS_pept        348091..348624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="BLi00371"
FT                   /product="shikimate kinase AroK"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00371"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39329"
FT                   /db_xref="GOA:Q65NN5"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65NN5"
FT                   /protein_id="AAU39329.1"
FT                   /translation="MNAAIRDKNIVLIGFMGVGKTTIGQLVSKKLGRDFIDIDHEIEKD
FT                   FQMTIPEMFQQKGEAFFRQTEKEYIFQMCEHTMGNIVSLGGGAFQQEEIRKKCLEHCFV
FT                   IFLDLRWENWKQRMDLLIENRPVLHNRTIEEMKQLFNERKSIYAFHHLKVETDNRSAEE
FT                   TADYIVEMLKLGQS"
FT   gene            348916..349686
FT                   /gene="ycgL"
FT                   /locus_tag="BLi00372"
FT   CDS_pept        348916..349686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgL"
FT                   /locus_tag="BLi00372"
FT                   /product="YcgL"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00372"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39330"
FT                   /protein_id="AAU39330.1"
FT                   /translation="MKQRIEEELKNIEATYGVKILYAVESGSRAWGLPSQDSDYDVRFI
FT                   YVHQKDWYLSIDAKRDVIELPIDDSLDISGWELTKALRLFRKSNPPLLEWLSSGTVYYE
FT                   AYSLAEKMRRLKSRAFSPVSCMYHYLNMASGNFRDYLTREEVKIKKYFYVLRPILACQW
FT                   IESRRTVPPIEFQVLLDELTEDGPLKTEIHQLLERKKKGEEFNLEPQNPILHEFIEREL
FT                   ERLQTVAKAYKTDHEDLTQELDRLFRETLDEVWA"
FT   gene            350036..350953
FT                   /gene="putB"
FT                   /locus_tag="BLi00373"
FT   CDS_pept        350036..350953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="putB"
FT                   /locus_tag="BLi00373"
FT                   /product="proline dehydrogenase PutB"
FT                   /EC_number="1.5.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00373"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39331"
FT                   /protein_id="AAU39331.1"
FT                   /translation="MEVITRDFFLFLSKSSILNRLARNWGSSVATGKIIGGKDFEASIP
FT                   IIKGLNEQGLTVTVDHLGEFVNSREVARERTQECIRAIQLIAQEQLNSHVSLKMTSLGL
FT                   DIDLDLVRDNMNSILECAEQHQVMVTIDMEDEVRCQKTLDLFKEFRQKYEYVSTVLQAY
FT                   LYRTEQDLEELNSLNPFFRLVKGAYKESPKVAFPDKKDVDENYKKLIKKQLLSGHYTAI
FT                   ATHDDKMIDFAKEIANEHQIGKDRFEFQMLYGMRSKTQLELVKEGYNMRVYLPYGDDWY
FT                   GYFMRRLAERPANIAFAFKGMTKK"
FT   gene            350977..352527
FT                   /gene="rocA"
FT                   /locus_tag="BLi00374"
FT   CDS_pept        350977..352527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocA"
FT                   /locus_tag="BLi00374"
FT                   /product="1-pyrroline-5-carboxylate dehydrogenase RocA"
FT                   /EC_number="1.2.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00374"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39332"
FT                   /db_xref="GOA:Q65NN2"
FT                   /db_xref="InterPro:IPR005932"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="PDB:3RJL"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65NN2"
FT                   /protein_id="AAU39332.1"
FT                   /translation="MTTPYKHEPFTNFGIEENRKAFEKALETVNNEWLGQSYPLVIDGE
FT                   RYETENKIVSINPANKEEVVGTVSKATQDHAEKAIQAAAKAFETWRYTDPEERAAVLFR
FT                   AVAKVRRKKHEFSALLVKEAGKPWNEADADTAEAIDFMEYYARQMIELAKGKPVNSREG
FT                   ERNQYVYTPTGVTVVIPPWNFLFAIMAGTTVAPIVTGNTVVLKPASAAPVIAAKFVEVL
FT                   EESGLPKGVVNFVPGSGAEVGDYLVDHPKTSIITFTGSREVGTRIFERAAKVQPGQTHL
FT                   KQVIAEMGGKDTVVVDEDCDIELAAQSIFTSAFGFAGQKCSAGSRAVVHEKVYDEVLKR
FT                   VIEITESKKVGEPDSADVYMGPVIDQASFNKIMDYIEIGKEEGRLVSGGKGDDSKGYFI
FT                   EPTIFADLDPKARLMQEEIFGPVVAFSKVSSFDEALEVANNTEYGLTGAVITKNRDHIN
FT                   RAKQEFHVGNLYFNRNCTGAIVGYHPFGGFKMSGTDSKAGGPDYLALHMQAKTISEMF"
FT   gene            352682..354106
FT                   /gene="ycgO1"
FT                   /locus_tag="BLi00375"
FT   CDS_pept        352682..354106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgO1"
FT                   /locus_tag="BLi00375"
FT                   /product="sodium/proline symporter YcgO"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00375"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39333"
FT                   /protein_id="AAU39333.1"
FT                   /translation="MVGMLYIGYYAYKRTANLSDYMLGGRTLGPAVTALSAGASDMSGW
FT                   LLMGLPGAMFATGLSGSWIVIGLVLGAWANWIFVAPRLRSYTEVAGNSITIPAFLENRF
FT                   HDKSKILRIFSGVVIITFFTFYVSSGMVSGGVLFNSIFNLDYHAGLWIISGVVVAYTLF
FT                   GGFLAVSWTDFVQGIIMFVALILVPIVTVIQTGGPGEAFSEIQSIDPNLLNIFKGTSVL
FT                   GIISLFSWGLGYFGQPHIIVRFMAISSIKETKKARRIGMGWMIFSSAGALLTGLLGIAY
FT                   YSKNGLHLDDPETIFIQLGNILFHPLITGFLISAILAAVMSTISSQLLVTSSSLTEDLY
FT                   KTLFKRSASDKELVFFGRLSVLAVSIVGLCLAWTKNNTILGLVSYAWAGFGASFGPVVI
FT                   LSLFWKRMTKWGALAGMVAGALTVIIWAEAGLSDVLYEMIPGFAASLLFVFVVSLLTSK
FT                   PEQQVLDEFEQYKQTL"
FT   gene            354234..355511
FT                   /gene="ycgP"
FT                   /locus_tag="BLi00376"
FT   CDS_pept        354234..355511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgP"
FT                   /locus_tag="BLi00376"
FT                   /product="YcgP"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00376"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39334"
FT                   /protein_id="AAU39334.1"
FT                   /translation="MIKLKTSRRKDMEELLEQVVSLSNINEIIDFISGELKKPVILESA
FT                   DFFLLAYNSYYINHFDAANQQTIFSKKCPLPIFEKFVEEGIIDQLKTIPTPFRVKQIEE
FT                   IGLNQRVVVSAKHKDEIMGYIWVQEIEDNLSDEELDFLYQASFHVGKIIYKKKRLKQEK
FT                   EEQAEELYKKAINDQFQTEKELKAAADKANVVLPAVFTVMVLQVVDGEDELLEDLKETI
FT                   RSYLNLKDNISHVLEDHSNIAIIVGSVSRKRSALAAASELINRLLTHLRSQMLPLILIG
FT                   VGNEYSSLLSLGKSYREALQVTKAAEITGSQEHIPYEYQKLGLFKYLDQIAAKNDHLQY
FT                   VNPDLQLLKEKDKESHTEFLRTLEIYLVNNCKVKPSAEQLFIHQNTLNYRIKQILEMTS
FT                   IDLNDFNTRCQLFIDLMLMKKAGYKS"
FT   gene            complement(355549..356394)
FT                   /gene="ycgQ1"
FT                   /locus_tag="BLi00377"
FT   CDS_pept        complement(355549..356394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgQ1"
FT                   /locus_tag="BLi00377"
FT                   /product="UPF0703 family protein YcgQ"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00377"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39335"
FT                   /protein_id="AAU39335.1"
FT                   /translation="MFRTFILMLFTFFFFHLHASGNLTKYINMKYAYLSYIAIILLAIL
FT                   TAVQFYIYMKSSDEKGCNHECGCGHDHDHEKDKPFLQRMFIYFVFFFPLCTGLFLPAAT
FT                   LDSNIVKSKGFSFKAIEQPEHYAQTQYLRPDTSIYYGQDGYDELMNKALKKYKEKQHIT
FT                   LKDDDFLKGMETIYHYPGEFLDRTLEFDGFAFKGEAISDKQLFVLRFGIIHCIADSGVY
FT                   GMLVEFPENMDIKDDQWLHVKGTLSSEYYQPFKSTIPVLKVKDWSAIKEPKDPYVYRTY
FT                   "
FT   gene            complement(356399..357286)
FT                   /gene="ycgR1"
FT                   /locus_tag="BLi00378"
FT   CDS_pept        complement(356399..357286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgR1"
FT                   /locus_tag="BLi00378"
FT                   /product="UPF0718 family protein YcgR"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00378"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39336"
FT                   /protein_id="AAU39336.1"
FT                   /translation="MASQSFLQLNSIFISILIEAIPFVLIGVFISGLIQMFVTEEMMAK
FT                   IIPKNRFLAVLSGTFAGVLFPACECGIVPIARRLLLKGVPLHAAVAFMLTAPIINPIVL
FT                   FSTFIAFGNKWDVVFYRGGLAIAVSLIAGLIISYQFKGNQLIENGTHGHHHHVHESQSF
FT                   LQKLGGTLRHAVDEFFSVGKYLIIGAFVAAAMQTYIKTSTLLAIGQNDVSSSLVMMGLS
FT                   FVLSLCSEVDAFIASSFSSTFSLGSLIAFLVFGAMVDIKNLLMMLGIFKKRFVFVLIPY
FT                   IAVIVLAGSLLVKG"
FT   gene            357477..358433
FT                   /gene="cah"
FT                   /locus_tag="BLi00379"
FT   CDS_pept        357477..358433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cah"
FT                   /locus_tag="BLi00379"
FT                   /product="cephalosporin C deacetylase Cah"
FT                   /EC_number="3.1.1.41"
FT                   /EC_number="3.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00379"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39337"
FT                   /protein_id="AAU39337.1"
FT                   /translation="MQQPYDMPLEQLYQYKPERTAPADFKEFWKGSLEELANEKAGPQL
FT                   EPHEYPADGVKVYWLTYRSIGGARIKGWYAVPDRQGPHPAIVKYHGYNASYDGDIHDIV
FT                   NWALHGYAAFGMLVRGQNSSEDTEISHHGHVPGWMTKGILDPKTYYYRGVYLDAVRAVE
FT                   VVSGFAEVDEKRIGVIGASQGGGLAVAVSALSDIPKAAVSEYPYLSNFQRAIDTAIDQP
FT                   YLEINSFFRRNTSPDIEQAAMHTLSYFDVMNLAQLVKATVLMSIGLVDTITPPSTVFAA
FT                   YNHLETDKEIKVYRYFGHEYIPPFQTEKLAFLRKHLK"
FT   gene            358526..358948
FT                   /locus_tag="BLi00380"
FT   CDS_pept        358526..358948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00380"
FT                   /product="putative HTH-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00380"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39338"
FT                   /protein_id="AAU39338.1"
FT                   /translation="MNTEQTIEVMNQNWTDIYYHLHMKHDDQLSHQAVRMLQHIEKNRF
FT                   VTIGHLARLLDVSHNTASEHVKRLIQKGLVQKNRDSSDERKVYVTLTPEGEEAVKRHTR
FT                   LNPKKLQKVLEQLNEEEVEMVKTAFSLLSREAKSCF"
FT   gene            358939..359280
FT                   /locus_tag="BLi00381"
FT   CDS_pept        358939..359280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00381"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00381"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39339"
FT                   /protein_id="AAU39339.1"
FT                   /translation="MFLIVKIGVSAILIAIITEIARKSPEMGGMIAALPLVSLLSLFWL
FT                   SVQGESLKHLSQFAKGVLWGFPATAVLLLIVVLSLKASFPVIISVVFGICGWGGCLMLQ
FT                   KALIHAIFG"
FT   gene            complement(359384..359899)
FT                   /locus_tag="BLi00382"
FT   CDS_pept        complement(359384..359899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00382"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39340"
FT                   /protein_id="AAU39340.1"
FT                   /translation="MFDPKAECDCKWNRDADYVAPYYFELISHAPHPDRLPAHPAYIEP
FT                   VNCQIYSGSASQTGLIYLSDKAGNPVEKSGREGLYISLVNQEAHRLKGYLYYFQNGEYQ
FT                   EFMISQTKAQAFSYELAPETVQTYPINLKILGSNYFRFLSTSIPPDGAYRDAPFPARMI
FT                   YYSRLYTW"
FT   gene            complement(360247..360930)
FT                   /gene="yckA"
FT                   /locus_tag="BLi00383"
FT   CDS_pept        complement(360247..360930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckA"
FT                   /locus_tag="BLi00383"
FT                   /product="putative amino acid ABC transporter permease
FT                   protein YckA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00383"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39341"
FT                   /protein_id="AAU39341.1"
FT                   /translation="MGSIQWEYIFNAELAAKSFPYVMQGIWNTLFISFASMFAGLILGF
FT                   FIALGRMSGLALLRWPARIYISFMRGVPILVILFILYFGFPYIGIQFTALAAALIGFSI
FT                   NSAAYIAEIIRSALSSVDRGQWDAAKSVGFSYWQTMRHVIVPQSVRIALPPLANVMLDL
FT                   VKASSLAAMITVPELFQQAKIVGGREFDYMTMYILVALIYWAICSGIALLQDFLEKRTE
FT                   VYIKK"
FT   gene            complement(360942..361817)
FT                   /gene="yckB"
FT                   /locus_tag="BLi00384"
FT   CDS_pept        complement(360942..361817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckB"
FT                   /locus_tag="BLi00384"
FT                   /product="putative amino acid ABC transporter
FT                   substrate-binding protein YckB"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00384"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39342"
FT                   /protein_id="AAU39342.1"
FT                   /translation="MNKLHTYKRITLLITVLALALITAACSTAQNKAENKKTAWDEIKE
FT                   KGKIVVATSGTLYPTSYHDTDSGKDKLTGYEVEVIREAAERLDLDVEFKEMGFDGMLTA
FT                   VGSGQVDAAANDITMTDDRKEKFLFSTPYKYSFGTAIVRKKDLSGIHTLEDLKGKKAAG
FT                   AATTVYMDIARKYGAEEVIYDNATNDQFLKDVANGRTDVILNDYYLQKLALAAMPDLDL
FT                   TIHPDLKYYPHQQGMIMKKGNTELKKQFDKTIDEMLKDGTIKKISKKFFGGADVSKKQD
FT                   IDYIDVDVNK"
FT   gene            362001..362552
FT                   /gene="mdaB"
FT                   /locus_tag="BLi00385"
FT   CDS_pept        362001..362552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdaB"
FT                   /locus_tag="BLi00385"
FT                   /product="putative NAD(P)H oxidoreductase MdaB"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00385"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39343"
FT                   /protein_id="AAU39343.1"
FT                   /translation="MKNILIINGHEAYPHARGQLNHTIFTAMADKLSEKYEVKKTVVAD
FT                   GYQIPEEHEKFKWADAVIYQTPVYWFSVPALFKKYIDEIYEYGLFYQGSEDYGRGGLFT
FT                   DKKYMFSTTWNAPKDVFSKAGTFFEGKSLDEALFHLHKMQEFIGMKPLKTFSVHDVISN
FT                   PQVDQYLADLDAHLKEVFSI"
FT   gene            362649..363374
FT                   /locus_tag="BLi00386"
FT   CDS_pept        362649..363374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00386"
FT                   /product="putative ATPase"
FT                   /note="AAA+ family"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00386"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39344"
FT                   /protein_id="AAU39344.1"
FT                   /translation="MFLKKLTLLREGVPSYAKYPFSIPAIQHLKELTFQKNVTFFVGEN
FT                   GSGKSTLLEAIADKCEFNTAGGGRNNTYEVYGSGSALGDYIRLSWLPKVTNGFFLRAES
FT                   FYHFATHIDEVDITGFRSYGGRSLHEQSHGESFLSLFKHRFKEKGIYLLDEPEAALSPA
FT                   RQLAFLKIIHDLTKSSQAQFIIASHSPILLGYPEAEIFSFDGEQIAEVNYEDTDHYTLT
FT                   KYFLQHREKLLAELFLDDV"
FT   gene            363444..364880
FT                   /gene="bglC1"
FT                   /locus_tag="BLi00387"
FT   CDS_pept        363444..364880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglC1"
FT                   /locus_tag="BLi00387"
FT                   /product="cellulase BglC"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00387"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39345"
FT                   /protein_id="AAU39345.1"
FT                   /translation="MIHQRLRPFPDHFLWGSASAAYQIEGAWNEDGKGLSVWDVFTKIP
FT                   GKTFKGSNGDIAVDHYHRFKEDVALMAEMGLKAYRFSVSWPRIFPQGRGEANESGLRFY
FT                   DDLINELLAHDIEPVLTLYHWDLPQALMDEYGGFESRRIIEDFNAYCVTLYKRYGGRVK
FT                   YWVSLNEQNYNFNHGFITAMHPPGVKDRKRFYEANHIAFLANAKAIDSFRRYVPDGKIG
FT                   PSFAYSPAYPLSSRPDDILAFENAEEFTNYWWLDMYCRGTYPDIPLKYLKEKGWAPTIE
FT                   DGDMELLAKGKPDFVGVNYYQTITYEMNPLDGVSEGKMNTTGQKGSNQETGMPGLYKTK
FT                   RNPHLETSNWDWAIDPIGLRIGLRRISSRYGLPLFITENGLGEFDKVENDGTIHDDYRI
FT                   AYLRAHLEQCRQALNDGVDLIGYCSWSFTDLLSWLNGYQKRYGFVYINRDEENVKDLKR
FT                   IKKDSFYWYQNVIQTNGEEL"
FT   gene            complement(364919..365290)
FT                   /gene="nin"
FT                   /locus_tag="BLi00388"
FT   CDS_pept        complement(364919..365290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nin"
FT                   /locus_tag="BLi00388"
FT                   /product="DNA-entry nuclease inhibitor Nin"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00388"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39346"
FT                   /protein_id="AAU39346.1"
FT                   /translation="MTMSYHQFTVYQKGGKPPVMDWTDEDIKRGYTTGEHAVSFEALEN
FT                   TASSVEVRLNAQKQVPSFNRRVTVPFEVLYDGVEIASVLSKKLTCDIPQGAYQLTCYTI
FT                   MPDHSGTAQITYLLDFKQA"
FT   gene            complement(365335..365781)
FT                   /gene="nucA"
FT                   /locus_tag="BLi00389"
FT   CDS_pept        complement(365335..365781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nucA"
FT                   /locus_tag="BLi00389"
FT                   /product="nuclease NucA"
FT                   /EC_number="3.1.30.-"
FT                   /note="membrane-associated"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00389"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39347"
FT                   /protein_id="AAU39347.1"
FT                   /translation="MDKIKSLLITLLAVAVVIIGIVSGDFFTSEHQPSGRQNGSNYDEV
FT                   LIFPSDRYPETGAHIRKAIKKGHSEICTIDRDGAAERRKDSLKDVPSKSGYDRDEWPMA
FT                   MCEEGGTGASVEYISPSDNRGAGSWVGNQVSDYPDGTKVLFKIN"
FT   gene            366080..366250
FT                   /locus_tag="BLi00390"
FT   CDS_pept        366080..366250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00390"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39348"
FT                   /protein_id="AAU39348.1"
FT                   /translation="MLRKLLKALQNGKNRRYSSSDYGRKSYKKYSSSDYKRKGYGHRHY
FT                   KRKHKKFFGSS"
FT   gene            366310..367059
FT                   /gene="ybdM"
FT                   /locus_tag="BLi00391"
FT   CDS_pept        366310..367059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdM"
FT                   /locus_tag="BLi00391"
FT                   /product="putative serine/threonine-protein kinase YbdM"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00391"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39349"
FT                   /protein_id="AAU39349.1"
FT                   /translation="MEGRYRINRVLGMGNYGITYLAEELGRSGFRVIKQQRKTKAWTSA
FT                   GRRSFNREAEILRELDLPAAPRLYEVLRAAGERFIVMEYIEGKTFEDLLFYDGRVFDEQ
FT                   QTISILKEVLHSVSLLHSRGIIHRDLRIPNLIVNRGTIRIIDFGLACRLTERERVDNRH
FT                   PEKKLMRAVSVKSDFYALGHFALFLLYSGFTPSDEEEKCWEEELSISSGLKSVLRKMLQ
FT                   IDLPYERAEDIIGDLISCTAEKKKLPF"
FT   gene            complement(367079..368757)
FT                   /pseudo
FT                   /gene="tlpC"
FT                   /locus_tag="BLi00392"
FT                   /note="methyl-accepting chemotaxis protein TlpC"
FT   gene            complement(368879..369619)
FT                   /locus_tag="BLi00394"
FT   CDS_pept        complement(368879..369619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00394"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00394"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39352"
FT                   /protein_id="AAU39352.1"
FT                   /translation="MKVYEAETLISAMKQRSDEYKNLREQLVSLKKALNSVAELDEFQG
FT                   KGADAIKAFYRDLSGVVDGWLDLTDMQIQFLNGVSSAAENAGLSEDTFVDVQFLEQELA
FT                   NVHIHSQNMVSAQQQELSNILGQIDDLISLQPFSSDEIKQQLDAANQNRKDTIKAVEDL
FT                   DGLLKREYSASEHIQQMIQTDYSALIDATGKGKNASPLNYNSHIYQNSEVYKMKHRMHQ
FT                   EARSYIANKQKQYETGKAEKAEEL"
FT   gene            370023..372077
FT                   /gene="hyuA1"
FT                   /locus_tag="BLi00395"
FT   CDS_pept        370023..372077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hyuA1"
FT                   /locus_tag="BLi00395"
FT                   /product="hydantoinase A"
FT                   /EC_number="3.5.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00395"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39353"
FT                   /protein_id="AAU39353.1"
FT                   /translation="MNEEGYRLGIDIGGTFTDLTLLNPADGSMTAVKTPTVPEDPARGI
FT                   INGLALLKTRGVQPSEIHHFVHGMTIGLNTLLQRKGADIALFVTEGFRDILSLQRLRLP
FT                   VPYDFRSRMPEPLIPRKNVFPIQERMLYDGSEKLPLHMEDIDEAVGQALRKGLKGIVVS
FT                   FLHSYRNPLHERQAAERIRQIAPELEVATSAELWPQMREYERTVMSVANLYIKPNIHHY
FT                   FGTLKERLVQEGISAQPFITQSNGGLMDIESAAEAPVKTLFSGPAAGVIGSIRTAEAAG
FT                   EANIITFDVGGTSADISIVEKGEPTFTQSNQISGFPIAIPSVAMYSIGAGGGSVAWIDS
FT                   GGLLKVGPESVGSDPGPACYGKGTKAALTDAFLICHYLNPNRFAAGNMKLYRERAEKAL
FT                   LPVAEYLGTDVEQAADKMIQVALANMYTELSNVMEQHGFDPREFSLMAFGGAGPVTANF
FT                   LAEEIQAKNVLIPPHPGTLSALGALTADFIYDAVCSRQVLLEQIKTAELKVEFMRLQEQ
FT                   AETWLRKQRADMVTEASLLYLLDARYKGQAYEIELPVSPEWLEGESTSEIADSFHLLHG
FT                   KQYGHSDGKASIELMNMRVRIIGKTPKPPGGKGCQSNLPEAEPVSQRKIIMKGGTYQAS
FT                   VYRRPDLRSGQRIDGPAIVEQDDTTTLILPNWSGKTDHAGNLIIERKES"
FT   gene            372080..374074
FT                   /gene="hyuB1"
FT                   /locus_tag="BLi00396"
FT   CDS_pept        372080..374074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hyuB1"
FT                   /locus_tag="BLi00396"
FT                   /product="hydantoinase B"
FT                   /EC_number="3.5.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00396"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39354"
FT                   /protein_id="AAU39354.1"
FT                   /translation="MRTDPARLEMMRSYFNAIAAGMGHVIERTSFTTFVKESADFATAL
FT                   ATPEGEFFVYPKTVGVTIFLGLSLKRVIEESGPFEPGDIILTNDPYTTDGLATHLPDIH
FT                   VVKPIFLEGEIISYAWCFVHCSDVGGLVPASISPTATDIHQEGLRIPPARIYKKGRENR
FT                   DILKVLRANSRVPDLNEGDIHAMVAAVNTAENRLTEMVGKFGKEAVQQGMDDLLEQAAM
FT                   RAGRVISRIPEGSYSFSDYLDDDMVSDVPIRLAVTANVSGGEITLDFSDCDPQVKTAFN
FT                   LVTNGSKHSFLYQGLINYIISEDPYIPINGGLTRPIQVIAPKGTLVHPEYPAAVGIRHS
FT                   ITMRLYNAVLGALAKALPKAVPAAGAGQSAIVVLSVPDESTGSRKMSVVEPMGGGGGGQ
FT                   HDMDGADGIDHASGFLKNTPIESLEQHIDIHVRRYELIKNTAGAGFHRGGHAIGLEFEA
FT                   AAPESIVTARGMERMRFHPWGLAGGTAGALGRVRLYPDQPQEKTMSKIDVLKLNKGDVI
FT                   SIHSPGGGGWGNPFRREAESILGEVEAGLLSPEAAYHQYGVAVKENGAGSFIIDLEETA
FT                   EIRKKKAGEHRKQWDFGIAREEYERCWTEEASSTLARLLRQLPAHQRSHVKHLVHRYFS
FT                   KEHNGPISKSEVAAAVEKLAGKNNTGMVR"
FT   gene            374077..375159
FT                   /locus_tag="BLi00397"
FT   CDS_pept        374077..375159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00397"
FT                   /product="putative spermidine/putrescine ABC transporter
FT                   solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00397"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39355"
FT                   /protein_id="AAU39355.1"
FT                   /translation="MKSKISALFILSLAAVLLLSGCGGNGSQESKQSDTVVIGVYGGDW
FT                   EKHIKPSLESFEKETGLKVKVVAGTDSEWFTKLKASNGRNAPYDLLILQPDTIHRAQSA
FT                   GLLAPIDQEKVPNVRDLYHSVQKRFTDDGKQYAAGFSMGQLGIVYRKDLVPQEPKRWTD
FT                   LWNSSYKGHVAISSPAYSAGLQFFVGLINAQGGLESNGKDVDKAFNSLADLKNNITAYP
FT                   DNPGSIQTLLERGDAWVVPFWDGRAFSLQDAGLDLGFAYPEEGAVAAVASWALMKGSPN
FT                   QDNAYKLLNHLLSPEVQGDFADRTFYGMANKKVKYSDKLKGKIKVGEDYYRNLKWVDYE
FT                   VAAKDLGDWTNRWNQVLGGK"
FT   gene            375169..376287
FT                   /locus_tag="BLi00398"
FT   CDS_pept        375169..376287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00398"
FT                   /product="putative spermidine/putrescine ABC transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00398"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39356"
FT                   /protein_id="AAU39356.1"
FT                   /translation="MSAIQIRHVSRHFGNTIALEDVQLEVKEGEFFSLLGPSGCGKSTL
FT                   LNIIAGFLEPTSGFVYIGGRDVTDLPPYDRHIGMVFQDYALFPHLSVFDNVAYGLKVRK
FT                   WPRRKIEERVMECLALVRLEAFANRMPHQLSGGQQQRVAIARALAVQPSVLLLDEPLSN
FT                   LDAKLRKEMQTELRSIQKRVGITTILVTHDQEEALSLSDRIGILGCGRLQQLGTPLDVY
FT                   RTPANQFVAEFIGQVNLLKARASKIQPSSGGYGYETVDFEVYEGVPLTFEINQELSKKT
FT                   SVLFMVRPERISVSFEKQKNRLIEMPATITEVSYAGHDLRLKAAVFKGEWIIQAPDPQF
FT                   PRLPKAGDQVYLSLEPGDFVPLDVKEDADEGC"
FT   gene            376274..377140
FT                   /locus_tag="BLi00399"
FT   CDS_pept        376274..377140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00399"
FT                   /product="putative spermidine/putrescine ABC transporter
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00399"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39357"
FT                   /protein_id="AAU39357.1"
FT                   /translation="MRAVEQKRFYWFLLVPVLLFLGVFLVLPLVLLLLLSFRDVDAMMN
FT                   TLDTYSFSQYVEVFSSDVYLKTIGITIWTALKTTVLCLVMAYPAAYLLVKAPTGRLRAL
FT                   FYILLVSPLLTSVVIRTFSWIVLLSQNGIVNEALISMKMIEKPLPLLWNMNAVIIAYVQ
FT                   VMLPFAVLPLASSLSEVKPDLKFASMSLGAGRLRTFFFVTLPMTVPGLLTGAMIVFSLS
FT                   AGSYITPLLVGGRMQPLLPLSIYQQVMQVFHLPLAAAMSITLLAVVSVVIGILGIFQKR
FT                   WEARING"
FT   gene            377133..377945
FT                   /locus_tag="BLi00400"
FT   CDS_pept        377133..377945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00400"
FT                   /product="putative spermidine/putrescine ABC transporter
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00400"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39358"
FT                   /protein_id="AAU39358.1"
FT                   /translation="MGRRLRRMRRGKWIDACVWTAGLLVYFFLALPVFVIILSAFSPDE
FT                   YPKFPPSGISLRWFAGVFSSSGWMESIWVSFMLLLVVTHLAVILGTVAAYALARLNFPG
FT                   KQAIQAFVLSPLMIPQIALGVSFLYLLTMIGVNGTFAGLAAGHMLISLPYVVRTVGVSM
FT                   ANVDQKLELASMNLGAGPWHTFFHVILPLIKPGIIAGAVFASVTSFGEISISLFVSSPA
FT                   VTPVPVRTFSYIDQTFDPSVHAISVIFITVSVIALIIIERTIGLSKTM"
FT   gene            378683..389425
FT                   /gene="lchAA"
FT                   /locus_tag="BLi00401"
FT   CDS_pept        378683..389425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lchAA"
FT                   /locus_tag="BLi00401"
FT                   /product="lichenysin synthase LchAA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00401"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39359"
FT                   /protein_id="AAU39359.1"
FT                   /translation="MGNTFYPLTHAQRRIWYTEKFYPGTSVSNLSGFGKLKSASGIDSG
FT                   LLTEAIRKFVRTNDTMRFRLMFEGEDEPKQYIAEDEPFQIEYFDASESGGADGVLKWGQ
FT                   AEARRPLPLYDSPLFKFAVVRISEEESWFFAKVHHIISDGISMTILGNRITDIYLKLAK
FT                   GETDLEPVQSSFTEHIQSELEYENSKRFQKDKAYWNAQYEAIPEPVSLKASDTYQIQLD
FT                   AARFSKEISPDLYKKIQTYCNEHNISVLSLFLSILHIYMHRVTGQKDVVLGTFMGNRTN
FT                   AKEKQMLGMFVSTIPMKASIEVHQDFSAFVQERMKDQLKIIRHQKYPYNLLINDLRERQ
FT                   PHVSKLFAVSLEYQVMQWQQKETVSFLTEPIFSGSEVNDISIHVKERWDTGTLAIDFDY
FT                   REELFTSEEMAVLYERLMTLLEDALLSPQKTIAELEIVPAFEKERLLKRASSQTIAYDK
FT                   NMTLHGLFEQKAADHPEKTAVVYEGQKLSYRELNEQSSRLAMALRRRGIGPDAPAAIVM
FT                   ERSERVITAMMGVLKAGGAYVPIDPGFPEERIRFMLEDSKAKAVITDSGLTFETAETVQ
FT                   FSEALSESRENGYPSSAAGAGHLAYIIYTSGTTGRPKGVMIEHRQVHHLVRGLQQAVGT
FT                   YDQDDLKLALLAPFHFDASVQQIFTSLLLGQTLYIVPKKTVSDGRALSDYYRRHQIDVT
FT                   DGTPAHLQLLAAADDLSGVKLRHMLVGGEALSRVATERLLQLFAETAESVPAVTNVYGP
FT                   TETCVDASSFTITNRTDLQYDTAYVPIGRPIGNNRFYILDENGALLPDGVEGELYIAGD
FT                   GVGRGYLNLPDMTRDRFLKDPFVSGGLMYRTGDTARWLPDGTVDFIGRRDDQVKIRGFR
FT                   IELGEIESVLQGAPAVEKAVVLARHETGGSLEVCAYVVPKQGGKIHIQGLREHLSKHLP
FT                   DYMIPSCFVELNEIPLTASGKVDRKALLRHEVSVSGTAEYAAPRNECEEKMVGIWQEVL
FT                   GAEQVGIHDQFFDLGGHSLKAMTMLAKIHKAFGVEVPLQVLFEKPTVAALSGFVSEAEK
FT                   DGFAVIEPAPESDDYPLSLAQQRIYIVSQLEGVGYNMPAAAMLEGTLDSGRLEAAFQKL
FT                   IDRHEALRTSFTVVDGEPRQTVHQRVQFKIEKVKAEGKPIEQIAKSFVRRFDLAKAPLM
FT                   RAGLVSLADGRHLLLFDMHHLVSDGVSISIILNELAALYNGEELPELRLHYKDYAFWQR
FT                   AQAQEGFQKEEAYWESMFAGELPVLQLMTDEPRPPVQSFEGDRVSAVLPKDLKEKLAVL
FT                   AEQNGATLYMVMLSAYNMLLAKYSGQEDVIVGTPAAGRRHSDLEGIIGMFVNTLAIRSK
FT                   VDPGRTFADFLNDVKKTVIDAFEHQDYPFERLAEKFGASRDLSRHPIFDTMFILQNAWE
FT                   DIPLLGDLHLSIYETNFNIAKFDLTLQAKEEQGELILDLDYSTKLFKKDTAERMLKAYL
FT                   NLLEDMAADPMLRIGEYSLLTEEETNRQLVAFNPATSDYPREKTIVQLFEEQAAERGGY
FT                   PALQFEDKVWSYDELNRKANQLARRLRESGVQAGTTAAILTARSAEMVIGILAVLKAGG
FT                   AYVPIDPDHPEKRVQHFFKDSGAAVLLTQKAMKPLAEAAEFGGDILFVEDENLYMGDAS
FT                   DLRLPISPEAMANLTYTSGTTGTPKGNMVSHRNILRTVKNANYLEVMESDIVLSISNYV
FT                   FDAFMFDVFGSLLNGAKLVIAPKDTILDMSRLAHVLEKEKITILMITTALFNLLTDMRP
FT                   DSLKGLRRVLFGGERASVDHVRRALKTVGRGRLLHMYGPSESTVFTTYHPVNEVPDDAQ
FT                   AIPIGKPVSNTEVLILDSFGNVQPAGVAGELCVGGDGLVRGYFNRPELTAEKFTAHPFK
FT                   TGEKIYRTGDMARWLADGCLEFIGRIDHQVKIRGQRIELGEIEHHLLTHDMVQEAAVLA
FT                   VDTGAGDQMICAYFTADQELSSQELRRHAAEGLPGYMIPSVFMQLDELPLTGNGKIDRR
FT                   ALPEPDIAQAAQKEYTAPRSGTEAQLADLWQEVLNVPKIGVHDNFFELGGHSLLGMTLI
FT                   ARIQQEMNVDLQLKDLFQAPTIESLAQAAAKSEKKSAVYIEAAPDRETYPVSSAQKRLY
FT                   VLQQIEGAEKSYNMPAVLQLEGKLDLKRLESAAQMLIKRHEAFRTTFEIRNGEPVQRIW
FT                   EAAELTIDVIDADEQEAEKLIKEFIRPFDLTKAPLFRMSIIRVTEEKHLLLVDMHHIIS
FT                   DGASVSVLIDEMTRLYAGEALEPLRIQYKDYAVWQQHLLTERHKMQEEYWLKELDGELP
FT                   VLTLPTDYPRPSVQTFEGSRISFSLKPELVQQLRRLAKETESTLYMVLAASYSTFLSKL
FT                   SGQSEVIFGSPAAGRPHADLSRIIGMFVNTLAIRTRPEGDKPFSAFLEEVKETTLGAFE
FT                   HQDYPFEELIEKLNIQRDMSRNPLFDAVFSMQNADLKDLSMEGVTLKPYDFAHQTAKFD
FT                   LTLTAAEEDGLLVFEMEYNTDLFKRESIKRWSGYWVNLLEAVAETPDASLSDLSLLDEA
FT                   EKRRIVQKWNETKLAVPQDKTVHELFEAQVLRTPDRGAAVYNGVKWTYKELNARANRLA
FT                   RLLIEKGAGPEQRVGIMVKPSLEMAAGVLAILKAGAAYVPIDPGYPAERIGYVLKDSGA
FT                   ELLLTQTNLAVPEEFSGETLLLDSMLSEEITNDDEVNPQAGTQPNNLAYLIYTSGTTGQ
FT                   PKGVMVEHQSLVNLCYWHNDAFAVTEQDKSAKYAGFGFDASVWEMFPYWIAGAELHIID
FT                   EAIRMDITRLNEYFEENGITITFLPTQLCEQFMELDNQSLRVLLTGGDKLKRIEKRNYT
FT                   LVNNYGPTENTVVATSTAIDPDEGMLSIGKPIANTRAYVLGQNNEVQPVGVAGELCIAG
FT                   RGLARGYLNKPEETAKRFTEDPFVPGERMYRTGDAVKWLEDGRLEYIGRIDQQVKIRGF
FT                   RIELSEIEVQLARLSEVQEAVVTDIEDAYGNKALCGYVVADEQLDTESLARKLGQTLPD
FT                   YMVPAYWVQLDELPVTANGKVDRRALPQPDVEAQTAEYKAPRTETEQLLADIWQDVLGI
FT                   DRIGVTDNFFALGGDSIKGIQMASRLQQHGWKLEMKDLFQHPTIGELSAYVQAADDQPI
FT                   DQNPVEGEVTLTPIQRWFFERKFTNEHHWNQSVMLHAPSGFDPEAAGKALTKMIEHHDA
FT                   LRMVYQRNGDGIVQYNRGLEETAVRPEVIRFNESGAELEAAVLKESNRIQSSINLTEGP
FT                   LLKAAIFETDQGDHLLIVIHHLVVDGISWRILLEDFAAGYAQAEKGEPIILQEKTHSFA
FT                   EYAARLKEYARSKAFAKEIGYWQEVEKAETASLPKDDEAEDKRMHHTKTAEFSLSKEET
FT                   EQLMTKVHEAYNTEMNDILLTALGLALKEWTGQEDFIICLEGHGREDIMEGLNISRTVG
FT                   WFTSQFPALIQLRHSEDIGYQIKQIKEELRHIPNKGIGYGIYRYLTEEGKKAQPIKHDI
FT                   SFNYLGQFAEMADSGLFTRSALPSGDPLSPETEKPNALDIVGYIENGILTMSIAYHSLE
FT                   YKESTVAAVAASFKTYLLQLIDHCLELDGGELTPSDLGDDELTLEELDKLMEIF"
FT   gene            389445..400211
FT                   /gene="lchAB"
FT                   /locus_tag="BLi00402"
FT   CDS_pept        389445..400211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lchAB"
FT                   /locus_tag="BLi00402"
FT                   /product="lichenysin synthase LchAB"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00402"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39360"
FT                   /protein_id="AAU39360.1"
FT                   /translation="MGKQKIQKVYPLTPMQEGMLYHAMLDPESSSYFTQLELVIDGEFD
FT                   LGIFEKSVNQLVRSYDILRTVFVHQQLQKPRQVVLAERQAIVEFEDLADLDEERQKTRI
FT                   DRYKQEVQAAGFNLAKDMLFKTAVFRLDRKKYHLVWSNHHIVMDGWSMGILMKRLFQNY
FT                   EAFRANRTVPLDQGKPYADYIKWLGRQDKDEAASYWEHRLSGLESPSVIPGGKTRPDSG
FT                   SYRNEEFTFVWDKDMVDALQKAANRYHVTAPNLFQAIWGTVLAKYNRSEDVVFGTVVSG
FT                   RPSEIDGIEHMAGLFINTIPVRLRVDQNASFAELFKQAQQHAIDAERYDYLPLYEIQKQ
FT                   SALDGRLISHLVAFENYPLDKELESGTIHERLGFSIKAAGAFEQTNYDFNLIVYPGAEW
FT                   TIKLKYNGEAFDAAFIEQAAGHLTRLAEEAIANPESKAGSADMLSKQEQQTLLAFNQTK
FT                   TGYPREKTIPELFEEQVEASPDKTAVAADGRSLTYRRLNEKANQLARRLKARGLMHGNA
FT                   AAIMMERSLEAAVSMLAVLKAGGVYVPIDPGYPEERIRFLLEDSGAKIVLTKDSPQISL
FT                   EGYEVLAANAVDAEKEDAANLVHANKPGDLAYYIYTSGSTGKPKGVMVEHRNIVRLVKN
FT                   AGYIPLKSDVKMAQTGAVSFDASTFEVFGALLNGGTLYPVPKETLLDGKRFRVFLEETG
FT                   ITTMWLTSPLFNQLAQQDPGMFATLNDLIIGGDALVPGIVNRVKRESPELSLWNGYGPT
FT                   ENTTFSTCFFIDQAYERTIPIGKPIGNSTAYIVDEHGALQPIGVPGELCVGGDGVARGY
FT                   LNQPELTDEKFVGDPFAEGKRMYRTGDLAKWLPDGNIEFLGRIDHQVKVRGFRIELGEV
FT                   EAALARLEGISEAAAVIRENNTGETEICAYYTAVGARPAAQLRTELSRSLPEYMIPAHL
FT                   IELDSMPLTANGKVDKRQLPAPIAEETDRFEAPKNETEKILAAIWEEILGIKQPGIDDN
FT                   FFSIGGHSLKAMMLTAKIQEQLQKEVPIKVLFEKPTIRELAEFLQGETKEKTAPIAPAP
FT                   SRANYPVSSAQRRMYILNQLEEASTSYNVPAVLLLEGELDKERLEDAFRALISRHETLR
FT                   TSFELIDGEIVQTIHQDAVFHLTESVADEAEAEAAIRGFIRPFQLNKAPLVRAELVKLE
FT                   EKRHLLMIDMHHIITDGSSTGILIRDLASFYHGEEAPAPKLHYKDFAVWQNGPEHQEKL
FT                   KEQEQYWLDIFKGELPVLDLPYDFPRPSKRSFEGDRVVFGINRKLTADVQKLLSEADAT
FT                   LYMFLLAAFNILLSKYASQEDLIVGSPVAGRTHPDLHNIPGMFVNTLALRNRPEGEKTF
FT                   KEFLQEVKETSLQGFAKQDYPLEELIEKLPLPRDTSRNPLFSVFFNMQNMEIPTLKLGD
FT                   LQISSYSVRHRTAKFDLSLEAVEHDGEIGLSFDYAVSLFKEETIRRWSGHFLNVIKTIC
FT                   ENPGIKLRDIELLSDKERGLLLEEVRRSRAERLEERPFHVRFEEKAAEMPDQPAVVCGE
FT                   TILTYRGLDERANQIANVLRSEGIGKDDVVGIMLDRSAEVAAAILGVMKSGGAFLPIDP
FT                   EMPTSRIQYMLEDSKARWLLTEHSHQAALADWYNGRLIDVRNDTLMASKKRPHLIHDGA
FT                   SLAYIIYTSGTTGQPKGVQLEHRNLANYVSWFISEARLSASDKTMLLSSYAFDLGYTSL
FT                   FPVLLAGGELHIVRKETYTEPETFIHYIGEQGITYIKLTPSLFHTVVQPQSFALAKGLQ
FT                   SLRLIVLGGEKINPKDVERFHSRYPDTRFINHYGPTETTIGAIAKPVEPGMIRQFAERP
FT                   TIGRPISGAGALVLDASRRLVPAGAAGELYITGSGLARGYVNNRELTAAKFIENPYTPG
FT                   TFMYRTGDLVRRLPNGEIEFLGRTDDQVKIRGYRIELKEIEEAFIGLEHIERAVVLSFT
FT                   ADSGLDELCAYIQAKRQLPVSEMRERLSERLPSYMIPSYFVTVDKMPLAANGKVDRSAL
FT                   PEPQGLSGQSDSYRAPSTEFEKALCGIWEEVLGVRPVGLDDNFFDLGGHSLKGMMLTAE
FT                   IQSKLGKKVPLKTLFDCPTAGLLARSIEADGQAEQSGIQPAEKRDWYPVSSAQQRMYAL
FT                   HHIEKNGTGYNMPSVLMLEGVLDTDRLRRAFADLVNRHESLRTAFVEIDGRTVQIVHEK
FT                   ADIDLKVIHIHEEDAEAQINRFIRPFDLSTAPLIRAELLSISSARHLLLIDTHHIIADG
FT                   VSRSLFVKEIAQLYKGASLPEPKLHYKDYAVWQQQPDQQENIRKQEDFWLRQFKETVPE
FT                   LSLPLDFPRPPVQSFAGDRVHFKVSKGTALKIRRLMAKTNTTLNIVMLAVFNLFLSRLA
FT                   GQKDIVVGSAAAGRTNADLKDVPGMFVNSLALKNHVPDQASFSGFLEEVKNNSLAALDH
FT                   QDYPFEELIAKLDLPRDMSRNPLFNVMLTTEDPDKETLDLDGLIIKPYETSHAAAKFDL
FT                   TLGAFEKDDEIGLQFEYATDLFKKQTIERWSGYLLNLLEAIAENPDASLSDLSLLDEAD
FT                   KRRILYEWNETVLDVPQNKTVHELFEAQVLRTPDRGAAVYNGVQWTYKELNARANRLAR
FT                   LLIEKGAGPEQRVGIMVKPSLEMAAGVLAILKAGAAYVPIDPGYPAERIGYVLKDSGAE
FT                   LLLTQSGLTMPDAFTGEVIDLNREASILAGELYPEDDINPSAEAQSDNLAYLIYTSGTT
FT                   GQPKGVMVEHQSLVNLCYWHNDAFTVTEQDKSAKYAGFGFDASVWEMFPYWIAGAELHI
FT                   IDEAIRMDITRLNEYFEENGITITFLPTQLCEQFMELDNQSLRVLLTGGDKLKRIEKRN
FT                   YTLVNNYGPTENTVVATSTAIDPDEGMLSIGKPIANTRAYVLGQNNEVQPVGVAGELCI
FT                   AGRGLARGYLNKPEETAKRFTEDPFVPGERMYRTGDAVKWLEDGRLEYIGRIDQQVKIR
FT                   GFRIELSEIEVQLARLSEVQEAVVTDIEDAYGNKALCGYVVADEQLDTESLARKLGQTL
FT                   PDYMVPAYWVQLDELPVTANGKVDRRALPQPDVEAQTAEYKAPRTETEQLLADIWQDVL
FT                   GIDRIGVTDNFFALGGDSIKGIQMASRLQQHGWKLEMKDLFQHPTIGELSSYVQAADAK
FT                   PIDQGPVEGEVTLTPIQRWFFERKFTNEHHWNQSVMLHAPSGFDPELVEQTLAALTEHH
FT                   DALRMVYQKNNGRLIQYNRGPDDRSFAFRVVDLRYVTDIETEIAAQANRLQASLDLENG
FT                   PLVKAEQYQTAEGDHLLIVIHHLVIDGVSWRILLEDFASGYSQAAQQHDVVFPDKTNSF
FT                   KDWAEALEAYAQTERFLKTADYWRRLEQERICELPKDRAAAERKAENTSAVKFELSEAE
FT                   TRLLLTKVHEPYGTDINDILLSALSLTIREWTNGSNICINMEGHGREEIIPGMNISRTT
FT                   GWFTAQYPVVLKSQAAAGLPETIKNVKETLRRIPDKGIGYGILRYLTDRKKAGAIFSIK
FT                   PDISFNYLGQIDREVQTGFFGPSPYDMGRQVSERSEALYALSFSGIISKEKFILSCSFN
FT                   TEEYDRQTIQELMDRFKAFLTALIDHCTAKEEREFTPSDFSAGDLEMEEMGDLFDVLEE
FT                   NLK"
FT   gene            400269..404117
FT                   /gene="lchAC"
FT                   /locus_tag="BLi00403"
FT   CDS_pept        400269..404117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lchAC"
FT                   /locus_tag="BLi00403"
FT                   /product="lichenysin synthase LchAC"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00403"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39361"
FT                   /protein_id="AAU39361.1"
FT                   /translation="MSQFKKEHVQDIYYLSPMQEGMLFHTLLHPGQGFYIEQISMQVKG
FT                   SFQKDVLEKSMNVIIGRYDIFRTVFVHEKMKRPVQVVLKERSFQAEEIDLSGLSEAEQN
FT                   ERIEDYKRKDKEKGFNLSKDIPMRTAVFKKGQDRYEWVWSYHHILLDGWCFGIVVQELF
FT                   EVYNALRENRPYSLGPVRPYKEYIKWLESQDKQKSLVYWEHHLAGFEGQTTFSEQRKNP
FT                   EQAGNQPEELLFTLPKEDTEAFTQLAKAHHTTLSTALQAVWSVLLSRYQRSRDLIFGTV
FT                   VSGRPADIQGVEHMVGLFINVVPKRATFGPQTTFTELVADLQKQALEAEPHQYVPLYEI
FT                   QSHIAAPNLIDHIIVFENYPLQEANKQQKEKNLGFTMDEISVFEKSNYDLNLLASPGEE
FT                   MMLKLAYNRNIFEPSFILRLKEQLLTAIREVIRDPEQPLDDICVVSKKEKERLLHEFNG
FT                   QVQRKQIGLTIPQWFEQYAEALPEKPAVSAAGRTLTYRELNEKANKVAHLLRKKNVGRG
FT                   EPVALLFRRSPEMVIAILAVLKAGGAYLPIDPEYPEARIQYMLEDSGAVCMLTQEELAG
FT                   RAASLSFHKHTILIDDPAVSAESGRNLEIAAEPDDLAYIMYTSGTTGKPKGNLTTHANI
FT                   TRVVKETNYISLSEKDTLLSLSNYAFDGFTFDLYGALLNGAKLVVADQATILHIGKLTE
FT                   AIQKENITVMFVTTALFNLLVDAGTGWMKGIRKVLFGGERSSVSHVKKAFAAMGPDRII
FT                   HVYGPTETTVFATFYPVNRMEDSAVSIPIGKPINETNAYILTENNRLQPIGAVGELCLS
FT                   GTGVSRGYLNRPELTAEKFAPHPFNSGETMYRTGDLARWLPDGNIDFIGRIDDQVKIRG
FT                   HRIELGEIEEQLMRCQGVKEAVVTARKSGNGDAALTAYVVPVQGTEVANEEVRRQLARR
FT                   LPAYMVPAAYIMLEELPLTANGKVNRRLLPEADGRPNSTERRAPRNATEEKLAVIWSEV
FT                   LGRQQIGIDENFFEIGGHSLKAMAVASRMLKDLAIDVPVNVLFEMPTIEGLAAYIDQGG
FT                   HVDEVKKTVFNQASTRHLFAFPPVLGYGIMYGKLAEQMPEYRIHAFDFIESDDRAVRYA
FT                   EAISDLQPEGPLTLIGYSAGCGLAFEVAQALEKNGRKVEKLLMIDSYMKNDVSDLEGRS
FT                   IEADTAALMEANKDNEYMKIKTVADGIAKKMTAYYSYFVNLVHQGTVSSEIHLIKSEHA
FT                   KPLPAWLSLWKEGTESSYDEYQGAGRHDEMLADGFVKSNADLIRQILGERAAVIGGA"
FT   gene            404121..404861
FT                   /gene="lchAD"
FT                   /locus_tag="BLi00404"
FT   CDS_pept        404121..404861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lchAD"
FT                   /locus_tag="BLi00404"
FT                   /product="lichenysin synthase LchAD"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00404"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39362"
FT                   /protein_id="AAU39362.1"
FT                   /translation="MNEIIKQFGAPASGMQLICFPFAGGYSASFRPLHEHLKTDFDMLA
FT                   IEPPGHGTNRMALVDNLEKLADLYIAALKPRLSSQFVLFGHSMGGMVVYRLAQKLEQEG
FT                   IFPAAAVISAIQPPHIQRQKVSHQKDDAFLDHLIQLGGIPKELAEHREMMNFFLPSFRA
FT                   DYRALETFCHTDHTPLRSPVHILNGDRDEKCMRDALGWKKWANTIDFHYFKGGHMYLLS
FT                   ETEQVAAKLKTIAAASRSTAVPTM"
FT   gene            complement(404908..405819)
FT                   /gene="ycxC"
FT                   /locus_tag="BLi00405"
FT   CDS_pept        complement(404908..405819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycxC"
FT                   /locus_tag="BLi00405"
FT                   /product="putative transporter YcxC"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00405"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39363"
FT                   /protein_id="AAU39363.1"
FT                   /translation="MNKSAYAAALLYAFIIGFSFFFVKLALTAASPVDILAHRFTVAFL
FT                   AALIPLLLGWVKIAISIKDALKVLPLALFYPVMFFAFQVFGLVYTSSSEAGIIQAAIPI
FT                   FTMIFAAYFLNERFTKRQFFFTVLSAAGVACIFMMKSAGTGSSDLRGAALILLSALSSA
FT                   GYSVLARKMTRTFSSLELTYVTTGAGFLFFNGIAGISHMSDGTLSGFFAPFTDPVFVLS
FT                   VLYLGVLSSFATSFLSNYALSKIEAAKISMFNHLATLVTILAGIIWLGESLEWFHFAGT
FT                   GMIIAGIIGATMVRRENRLKKS"
FT   gene            405955..407304
FT                   /gene="ycxD"
FT                   /locus_tag="BLi00406"
FT   CDS_pept        405955..407304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycxD"
FT                   /locus_tag="BLi00406"
FT                   /product="putative PLP-dependent transcriptional regulator
FT                   YcxD"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00406"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39364"
FT                   /protein_id="AAU39364.1"
FT                   /translation="MHKYVALMNELEDMIEDKSFQEGDRLPSIRALAIRFKVSKSTVIR
FT                   ALNELERRHLIYSVPKSGYYVVKKTNQRPNSGKAVIDFAASAPDPDVFPYIDFQHCINK
FT                   AIDTYKNDLFIYGTPKGLPSLIQAVQKELANSQVFAKEEHIFITSGVQQALALLASMPF
FT                   PNRKRKVLIEQPSYHLLIKYLEVHGIPAVGIERTAEGIDMDELERIFQTEDIKFFYTMP
FT                   RFHNPLGTSYTEREKTAIVKLAEKYDVYIAEDDFLGDLENDKKADPLHYYDISSHVIYL
FT                   KSFSKIIFPGLRVGAAVLPDSLTIVFNRYKQLLDIDSSMLSQAALEIYLKSGMFEKHKQ
FT                   KIRSSYQKRSCLLHDLLKECSASLGDVFEFHPPAQPAIHTHIELDRTIPASRLIKSLQK
FT                   RDVLLEPVNAHYMPAFPKRNLLKINTSNVKEEDIRSGIERLRQAVETAYF"
FT   gene            complement(407316..407996)
FT                   /gene="sfp"
FT                   /locus_tag="BLi00407"
FT   CDS_pept        complement(407316..407996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfp"
FT                   /locus_tag="BLi00407"
FT                   /product="4'-phosphopantetheinyl transferase Sfp"
FT                   /EC_number="2.7.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00407"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39365"
FT                   /protein_id="AAU39365.1"
FT                   /translation="MKIYAVYMDQLPEAGQFNRMMAMVSEEKRKKVGRYRYPEDASRTL
FT                   IGEVLARHIISETFHLPNEQIRFTEGRYGKPAAEGLNDFHFNISHSGKWIVCGAGAQPI
FT                   GVDVEKIKPINFDIAKRFFSPSEHDDLMEKDESERLSYFYHLWTMKESFIKQAGKGLSL
FT                   PLDSFSVKLNEQGRASVETPPGYPPCYIQAYEIDPGYKMAVCSAAPEFPGRIVMKSCAE
FT                   LSML"
FT   gene            408066..408881
FT                   /locus_tag="BLi00408"
FT   CDS_pept        408066..408881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00408"
FT                   /product="putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00408"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39366"
FT                   /protein_id="AAU39366.1"
FT                   /translation="MILVQNGVMNMIDGTLIKDTCFGRELLIYLPPSYGSGENRYPVLY
FT                   VHDLGDLFDPAYSNSLRSIEKLFSSQEVPELLLVGVAPKDRESEYTPFPKRHLLPNKRE
FT                   YGGKGNEYAAFLANRLKPHIDRHYRTNPSREQTGIIGKSFGGLISVYTAFLASETFGKI
FT                   GSLSGSFWFEGITEFMKNNRFENKHLRIYMDVGSTEGTDRDNLQKEMIPRTKEAFSLLT
FT                   ESAASEKELKFVIDEGGSHRLERFAKRFPEAVKWLFGSCHNSARNGRSF"
FT   gene            409127..409510
FT                   /locus_tag="BLi00409"
FT   CDS_pept        409127..409510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00409"
FT                   /product="putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00409"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39367"
FT                   /protein_id="AAU39367.1"
FT                   /translation="MVDAAFKYGYSTPESLSGGLQPPSRHQPFTGPRKRRTLRAFPRLS
FT                   FHIQIKGVEDMDYKIVEKEPFQVIGKALEVTVKDGQNKKDIPAFWNELNHNGFTDSLKP
FT                   HIGPLGFLGVCMDFNDQPDTFNF"
FT   gene            complement(409794..410456)
FT                   /locus_tag="BLi00410"
FT   CDS_pept        complement(409794..410456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00410"
FT                   /product="transmembrane protein"
FT                   /note="YczE-like"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00410"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39368"
FT                   /protein_id="AAU39368.1"
FT                   /translation="MKRELVLRWLFYFVGLIVLSFGVSLTIEGKVLGIGPWDAFHYGLY
FT                   MLLGLTVGQWAIIVGAVIVGLTSLFTKAWPKIGAVLNMLLIGIFIDFFTYILPDPETYI
FT                   SSTVVFVIGVIFIGYGVGIYVSADLGAGPRDSLMLLISEKTGWNVQWVRNGMELTILLI
FT                   GWLLGGPIGIGTVLTAILTGLILRFSLPQSKQLLKAAMAGRRIRAAKPVHMSLKKNG"
FT   gene            410712..411242
FT                   /locus_tag="BLi00411"
FT   CDS_pept        410712..411242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00411"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39369"
FT                   /protein_id="AAU39369.1"
FT                   /translation="MKKLYISAVLGLLFVFVGGTKIHAQEPQNNNGVLDENKFIDETVY
FT                   SYTQPISIQDGEVTTQAKKYIKTVSVNRSYKSLLNIVVARHYSDTTFTYGSGKLYKSPR
FT                   ALSNDWWTLPPNFKSGSSKSWDWYNTGKGATGRSNLQVRYTWGVPTPWGPVGSNYSSRI
FT                   KVSFKSNGSWYTN"
FT   gene            411269..412198
FT                   /locus_tag="BLi00412"
FT   CDS_pept        411269..412198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00412"
FT                   /product="putative antimicrobial peptide ABC exporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00412"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39370"
FT                   /protein_id="AAU39370.1"
FT                   /translation="MGTIGINFKNIQHQYRTKDVLRGVSFHADPSSITFLAGENGAGKT
FT                   TLIKVALGLISPKAGNALFDGQSVGEIREKISCVFDEPPVYPNESGLDNLKFLSGIHSL
FT                   DRKWSQEVCAMLKLDEGLLKQKAKALSLGQRHRLAVAAALLRKPKYLFLDEPSIGLDPP
FT                   SWQLVQIALKQMTARGCAILITGQNYDAIENLADNIAILQSGKIIFSGPIVKLVQAFPV
FT                   YVRIVTDDHREIAVQFPEAEPDSSGIYRIVCESGEQARAVIDQVRRSTLNFQELSTEKA
FT                   SMGKMVTDIYKDGFQSEKRGLTYESVQN"
FT   gene            412179..413078
FT                   /locus_tag="BLi00413"
FT   CDS_pept        412179..413078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00413"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00413"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39371"
FT                   /protein_id="AAU39371.1"
FT                   /translation="MNPFKIETNQLKNSMLVRVCIALLFCCFIWGLLTLYQSAEGEERR
FT                   QEKIHQSVIDEVKKNGAEEELENGGLEIEKNDDIARSMYIGLHPSVTPNLFLLILANIG
FT                   PIVFIIIGSHLVGSEYHQGTVKMKAAHIGWRKAVSGKLCALLSLVIVMVIAALLLGLAG
FT                   GWLAWTFATAHSDLAASLEVNAAVSYPILILFLMIGLTFYSVLGMTVTLLTKSRLAGVL
FT                   ISLAIPYAEQMMSLPFLPLTAYQSLMVHHFIYVDGSIIGQPYLTEPMGEPGAWAVLVCW
FT                   LFVVIAVQQFAAKKQQIL"
FT   gene            413775..415436
FT                   /locus_tag="BLi00416"
FT   CDS_pept        413775..415436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00416"
FT                   /product="putative pyridoxal phosphate-dependent
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00416"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39372"
FT                   /protein_id="AAU39372.1"
FT                   /translation="MQQRNTPDVQRWFPSEDGNEAKRNEFLSLIEQLIEGVDNLKNPDQ
FT                   VNLGGEKNREGFFYEKLVAESRIPHEGAPMKEVNEELLKLLHGHPYHTKYFFTNILPMA
FT                   SIPGILGMLTAFMVNGNNLWDVYGPAGAEAEVKVTAMMSKLAGYDAETSGGYTTWGGQG
FT                   AVYSGLRIAIAKMAPSSLKEGVPGNFYAFCSEAAHYSLYKSMEAAGLGSDHLIKVKTNL
FT                   DHSMDTEDLREKLRQVCEAGGIPVYIVATTGTTDAIGIDDVSAVRRAAEETAKSFGLPV
FT                   PHIHADSALGGFFAFFNEYDLNENALSFSPGVLSMIKPIQEKMRHLHAADSLCFDFQKL
FT                   GQTPYVTSLFLVKDRNDLKRIDLDPDETPYVGHRGYGDYHTGYTLECSRMASSISMYSA
FT                   LMAFGYEGYQKLLAQFLEVNLHFREQLSRQIPEADIVNPDNCGMSTLFRIYPEGAPRFE
FT                   DEISGACTIEELERNNALTEKLFEKLGTKRDKMFFGDTKKHLLVKSCEGVELPLCVSKF
FT                   FVISPYTMPEHVPGIIDYLKETIEEVFREHGSLMTN"
FT   gene            415451..417175
FT                   /locus_tag="BLi00417"
FT   CDS_pept        415451..417175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00417"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00417"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39373"
FT                   /protein_id="AAU39373.1"
FT                   /translation="MKTLKKKLTEHISVKIMIGVALVLLITIASFSAVFTFISKDLSEQ
FT                   LKQQFQNRLYTDIHLAENQIKRLDGNPLEIDSADGPLYKQTKMAVDSLKKKNKLENIYI
FT                   LSNEGGKERILVLSDTPDDFGTDYSFSPEMKEALTTNKETVSDVYEDEYGIHQSIFLPL
FT                   ENGSGEKVGILGIDLDASVIPETAAKAKWYTIAISAFVLLLGMVMAYFLGSYIAKPIRQ
FT                   LMKASEKIADGDLSADISVKSRDEAGKLAESFKRMSENLQQLIGHISASSEEVSKTSLQ
FT                   LKNVSAESSESAAQVAESMNSMSEGINEVVSSVSDCHTSAAEIDQQLTHVTEKVNEMKN
FT                   VAEGVSKDSKTGQELVEETLRQTQTIKNVMEESKQAASEMQNHTEEIEKVIGMISSIAE
FT                   QTNLLALNASIEAARVGEEGQGFAVVAGEVRKLSERSADAALSVSQLVAGTQESSRLVM
FT                   ERIQEGNEAVDKGQILINGTYENFSGIFKGISQFAERTDQLLQSLLKVEKSYQTISSAM
FT                   EQISAVTEEQAAGSEEVAAAAEQQSAGMQEIASAIQQLSALSEELNQAASKFKLAAE"
FT   gene            complement(417214..417957)
FT                   /gene="tcyC"
FT                   /locus_tag="BLi00418"
FT   CDS_pept        complement(417214..417957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tcyC"
FT                   /locus_tag="BLi00418"
FT                   /product="L-cystine ABC transporter ATP-binding protein
FT                   TcyC"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00418"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39374"
FT                   /protein_id="AAU39374.1"
FT                   /translation="MLAIKGLNKSFGENEILKKIDLNIEKGKVIAILGPSGSGKTTLLR
FT                   CLNALEIPNRGILSFDDFTIDFSKKNKPADLLRLRRKSGMVFQAYHLFPHRTVLENVME
FT                   GPVKVQKRNKEEVKKEAVQLLQKVGLEDKMDLYPFQLSGGQQQRVGIARALAIKPELML
FT                   FDEPTSALDPELVGEVLKVMKDLANEGWTMVVVTHEIKFAQDVADEVVFIDGGVIVEQG
FT                   PPEQIFSAPKEERTKQFLNRILNPV"
FT   gene            complement(417973..418677)
FT                   /gene="tcyB"
FT                   /locus_tag="BLi00419"
FT   CDS_pept        complement(417973..418677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tcyB"
FT                   /locus_tag="BLi00419"
FT                   /product="L-cystine ABC transporter permease TcyB"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00419"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39375"
FT                   /protein_id="AAU39375.1"
FT                   /translation="MFLSNIQAAAIGQAIPWDLVRESFWPIFLRGIYYSIPLAILSFIF
FT                   GMIIALITALARMSKSRILRAVFGIYVSAIRGTPLLVQLFIIFYLFPAFQVTIDPFPSA
FT                   IIAFSLNVGAYASEIIRASILSVPKGQWEAAYSIGMTQKTALTRVILPQAVRVSIPPLS
FT                   NTFISLVKDTSLASQILVAELFRKAQEIGAGNLDQILIIYMEAAFIYWIICFVLALVQQ
FT                   QIERRLDRYVAK"
FT   gene            complement(418664..419470)
FT                   /gene="tcyA"
FT                   /locus_tag="BLi00420"
FT   CDS_pept        complement(418664..419470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tcyA"
FT                   /locus_tag="BLi00420"
FT                   /product="L-cystine ABC transporter substrate-binding
FT                   protein TcyA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00420"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39376"
FT                   /protein_id="AAU39376.1"
FT                   /translation="MKKAIFAVLLTLLITVMAACGASGDNSKDKNAAGDSLWSSIKDKG
FT                   VLTVGTEGTYEPFTFHDKKTDKLTGYDVEVMQEVAKRLNLKAEFKETQWDSMFAGLNSK
FT                   RFDVVANQVGKKDREDQYDFSDSYTTSQAVVVTKADNNDVKSEGDVKGKKAAQSLTSNY
FT                   NDLAKNAGAEIEGVEGMAQAFQLIQQGRVDLTYNDKLAVLNYLKTSGNKNLKIAFETGE
FT                   PQTTHFAFRKGSGELVDKVNSALKDMKEDGTLAKIAKKWFGEDVSK"
FT   gene            complement(419599..421011)
FT                   /gene="rocR"
FT                   /locus_tag="BLi00421"
FT   CDS_pept        complement(419599..421011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocR"
FT                   /locus_tag="BLi00421"
FT                   /product="arginine utilization regulatory protein RocR"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00421"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39377"
FT                   /protein_id="AAU39377.2"
FT                   /translation="MLKDYDFLKLIFQGIIDEIDIGLHVVDENGTSVVYNKKMSQIEGM
FT                   DVGDVLGKNVLDVFTFASQHDSTLLQALHHGKTNKNVKQTYFNNKGQEITTVNHTFPIM
FT                   ENGNTKGAVEIAKDVTKLERLIRENMNKTESTKYTFDSLIGVSPAFKEVIEHAKRATRT
FT                   SSSILIVGDTGTGKELFAQSIHNGSQRSTGPFISQNCAALPESLVEGLLFGTVKGAFTG
FT                   AVDRPGLFEQADGGTLLLDEINSLDFRLQAKLLRAIQEKTIRRIGASKDTPIDVRIIAT
FT                   MNEDPVDAVSGQRLRKDLYYRLSVVTLFIPPLKDRKEDIMPLTQHFIDKYNALFQMEVK
FT                   GFEEEVRRFLLSYDWPGNVRELEHLIEGAMNLMSYEDKIELTHLPLQYRTKPAAKEQLP
FT                   QQGYDLFAPLPSASAAPLKEQIENAEKYYIQKTVKKCNYNVSQAARVLGISRQSLQYRL
FT                   KKWKIRFDQESE"
FT   gene            421253..422455
FT                   /gene="rocD"
FT                   /locus_tag="BLi00422"
FT   CDS_pept        421253..422455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocD"
FT                   /locus_tag="BLi00422"
FT                   /product="ornithine aminotransferase RocD"
FT                   /EC_number="2.6.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00422"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39378"
FT                   /protein_id="AAU39378.1"
FT                   /translation="MTVLSKSEKIMKQTAHFGANNYHPLPIVISEAEGAWVKDPEGNRY
FT                   MDMLSAYSAVNQGHRHPKIIQALKDQADKITLTSRAFHNDQLGPFYEKVASLTGKDMVL
FT                   PMNTGAEAVESAVKAARRWAYDVKGVPDNQAEIIACEGNFHGRTMLAVSLSSEEEYKRG
FT                   FGPMLPGIKLIPYGDLEALKQAITPNTAAFLIEPIQGEAGIVIPPEGFLKQAAEVCKER
FT                   NVLFIADEIQSGLARTGKMFASDWEDVTPDMYILGKALGGGVFPISCIAANRDVLGVFN
FT                   PGSHGSTFGGNPLACAVSIAALEVLEDERLAERSLELGEYFKEKLSQIDNPKIKEVRGR
FT                   GLFIGVELTEAARPYCERLKEEGLLCKETHETVIRFAPPLVISHEDLDWAIEKITRVLS
FT                   K"
FT   gene            422627..424072
FT                   /gene="rocE"
FT                   /locus_tag="BLi00423"
FT   CDS_pept        422627..424072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocE"
FT                   /locus_tag="BLi00423"
FT                   /product="amino acid permease RocE"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00423"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39379"
FT                   /protein_id="AAU39379.1"
FT                   /translation="MNHENREQYTLKRTMKSRHLFMISLGGVIGTGFFLGTGYTINEAG
FT                   PIGAILSYLAGGMIMYFTMLCLGELAVAMPVSGSFQTYATKFIGPATGFAVGWIYWLGW
FT                   SVTVALEFLSAGQLMKRWFPDVGVWIWCLIFGLLLFSLNALSAKAFGESEFWLSGIKII
FT                   VILLFIILGGGAMFGLIDLKDGQAAPFFSNLIGDGIFPNGFGAIFITMITVNFAFQGTE
FT                   LIGIAAGESENPEKTVPRSIKQTVWRTLVFFGLSVFVLAGLIPWEKAGVVESPFVVVFE
FT                   QIGIPYAADLMNFVILIALLSVANSGLYASTRMLYSLAKEGMAAQALSRVNKRGIPMNA
FT                   LWITLGFAGLSLISSVVAAETLYIWLLSLAGLSAQVGWITITVSQLLFRRRYVKEGGKV
FT                   EDLKFKTPLYPYLPLTGFILNSAVLVSLAFDSEQRMALYCGILFMSACYFVYHVFVKKR
FT                   QALDRQEAMIYQNKTNDEVVIDE"
FT   gene            424065..424958
FT                   /gene="rocF2"
FT                   /locus_tag="BLi00424"
FT   CDS_pept        424065..424958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocF2"
FT                   /locus_tag="BLi00424"
FT                   /product="arginase RocF"
FT                   /EC_number="3.5.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00424"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39380"
FT                   /protein_id="AAU39380.1"
FT                   /translation="MNKQVSLIGMPMDLGQARRGVDMGPSAIRYAHIVERLNELGYDID
FT                   DLGDVPINRDQPKGDEGLKNLVSVLEGNRKLADIVDNVVEQRRFPLVLGGDHSIAIGTL
FT                   AGVAKHYQQLGVIWYDAHGDLNTLETSPSGNIHGMPLAVSLGVGHEKLVNLHGYAPKIK
FT                   PEHVVIIGARSLDEGERKYIRETGMKVYTMHEIDRLGMTKVMEETIEYLSANCDGIHLS
FT                   LDLDGLDPSDAPGVGTPVVGGISYRESHLAMEMLYDADIITSAEFVEVNPILDHKNKTG
FT                   EAAVELIESLLGKKLL"
FT   gene            complement(425027..425899)
FT                   /gene="bsdA"
FT                   /locus_tag="BLi00425"
FT   CDS_pept        complement(425027..425899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsdA"
FT                   /locus_tag="BLi00425"
FT                   /product="HTH-type transcriptional regulator BsdA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00425"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39381"
FT                   /protein_id="AAU39381.1"
FT                   /translation="MDIRQLKYFVTIAREGKITTAAKRLHIAQPPLSRQLKQMEEELGV
FT                   VLFDRNKKKNLTLTYEGEVFLKRAKEILHKLEDSILEVRELREEVNGTLAVGSTIYCAA
FT                   LLLSKVSKIRDMYPNLMFNIWEGEPSRLSELLESRQIDAAVTTTPIHSKNTESKSLPEV
FT                   PCKLVLPGNQSYGLKGEAGMKEIAGLPLILLRPSHGKGIYDEVVHHFQSSGLEPRVVCE
FT                   CHDSTTLLSLVTSGFGATILPLSMLPAHFARHVQTLEIQNNPFILQPSVVWRAGSFLPK
FT                   PVREFLALF"
FT   gene            426021..426590
FT                   /gene="bsdB"
FT                   /locus_tag="BLi00426"
FT   CDS_pept        426021..426590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsdB"
FT                   /locus_tag="BLi00426"
FT                   /product="phenolic acid decarboxylase beta subunit BsdB"
FT                   /EC_number="4.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00426"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39382"
FT                   /protein_id="AAU39382.1"
FT                   /translation="MNIIVGITGATGAVFGVRMLEWLKKTDAETHLVISPWAAATILHE
FT                   TGYTMKDVEKLASFTYSHKDQAARISSGSFQTDGMIVAPCSMKTLAGIRTGMADNLLTR
FT                   SADVMLKERKKLVLLTRETPLNQIHLENMLELTKMGAVILPPMPAFYNHPQNLTEMVDH
FT                   IVFRTLDQFGIHLSEAKRWEGMKQEK"
FT   gene            426604..428025
FT                   /gene="bsdC"
FT                   /locus_tag="BLi00427"
FT   CDS_pept        426604..428025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsdC"
FT                   /locus_tag="BLi00427"
FT                   /product="phenolic acid decarboxylase gamma subunit BsdC"
FT                   /EC_number="4.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00427"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39383"
FT                   /protein_id="AAU39383.1"
FT                   /translation="MAYQDFRDFLNTLKKEGQLLEVQEEVKPEPDLGAAARAANNLGDK
FT                   SPALLFNNIYGYNNAQIALNVIGSWPNHALMLGLPKDTPVKEQFFEFARRYNQFPVKVQ
FT                   REETAPFHENEITEDINLFDILPLFRINQGDGGFYLDKACVISRDVEDPDHFGKQNVGM
FT                   YRLQVKGKDRLGIQPVPQHDIAIHLRQAEERGENLPVTIALGCEPVIATAASTPLLYDQ
FT                   SEYEMAGALQGEPYKIVKSKLSNLDIPWGAEVVLEGEILAGEREYEGPFGEFTGHYSGG
FT                   RSMPIIKIKRVCHRNNPIFEHLYLGMPWTEVDYMVGINTCVPLYQQLKEAYPNEIVAVN
FT                   AMYTHGLIAIVSTKSRYGGFAKAVGMRALTTPHGLGYCKMVILVDEDVDPFNLPQVMWA
FT                   ISTKMHPKHDAVIIPDLSVLALDPGSEPAGITHKMILDATTPAAPETRGHYSQPLDSPI
FT                   GTKEWEAKLMNLLNQ"
FT   gene            428045..428272
FT                   /gene="bsdD"
FT                   /locus_tag="BLi00428"
FT   CDS_pept        428045..428272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsdD"
FT                   /locus_tag="BLi00428"
FT                   /product="phenolic acid decarboxylase delta subunit BsdD"
FT                   /EC_number="4.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00428"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39384"
FT                   /protein_id="AAU39384.1"
FT                   /translation="MHTCPRCDLKKAETVSKSPVEGAWEVYQCQHCFFTWRSSEPETIT
FT                   NPEKYNPAFKIDPAEVETAVQVPAIPDRKI"
FT   gene            428288..428743
FT                   /gene="yclD"
FT                   /locus_tag="BLi00429"
FT   CDS_pept        428288..428743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclD"
FT                   /locus_tag="BLi00429"
FT                   /product="YclD"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00429"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39385"
FT                   /protein_id="AAU39385.1"
FT                   /translation="MAQLSNELFQLLNGEKLAGKRHEAMMLQTVTEDGWPHTAMISAGE
FT                   ILALNKTDIRLALWQGTTTTANIARTGRALFVACWKGKAHYVRLSLKKLPELRDAKHPR
FT                   ARFAGTVEAAREDIAKYADIISGVQIKLKDEAAVLRRWEETLGELRK"
FT   gene            complement(428778..429224)
FT                   /locus_tag="BLi00430"
FT   CDS_pept        complement(428778..429224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00430"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00430"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39386"
FT                   /protein_id="AAU39386.1"
FT                   /translation="MSNFLQKPRNKAILSVYLFFVCGSVLSAVLNPKMSIGEKLFILCF
FT                   NIFSATLFAFLIYLLLNKLMKDEDRKHPADPEKNGINQVIWKKYKKPLILFVYFGSLFA
FT                   VCAAILPMPIYTVAEKLVILSIAIIFITICCILAYKVTNKMLQK"
FT   gene            complement(429250..429591)
FT                   /locus_tag="BLi00431"
FT   CDS_pept        complement(429250..429591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00431"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00431"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39387"
FT                   /protein_id="AAU39387.1"
FT                   /translation="MSPETFVEYTEYLIAGMLAAHFAYSLCFLIIASHMIIEYEKMIFL
FT                   KPEKRSHKITNTFVFLLVGTGYFVYKRLLRYNWFLRKLYFALYLVGRGILSIIIFYIFS
FT                   FLVHLIFSV"
FT   gene            complement(429649..430095)
FT                   /locus_tag="BLi00432"
FT   CDS_pept        complement(429649..430095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00432"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00432"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39388"
FT                   /protein_id="AAU39388.1"
FT                   /translation="MKGRNKIIFLVYSLYATIIILAALVKPAINWKERLAVIGFMFVSI
FT                   SLFTFIIYVFINKPKKDQSAPRCNIVAKIFWKKHRKPFTLSFYFVGILIVGISVFSMSE
FT                   LSLAWKSGMFAILFAVISGNFFAVYQTANQMLNRSCLERMPDEE"
FT   gene            complement(430116..430796)
FT                   /locus_tag="BLi00433"
FT   CDS_pept        complement(430116..430796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00433"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00433"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39389"
FT                   /protein_id="AAU39389.1"
FT                   /translation="MLRLKETVVYKDLPYNIQSHLKAPVSRETKWGMACFIVLVLDILC
FT                   ILPVLASKVEFFTFAVLPVAILINVWMILINTRNMTEYLHHLQYVRFMGVSFSGMSYCQ
FT                   LITAQKMMFSAIGFHLPLISLSLFIYAASIFLVIRYYLAVFPDPKRGKRETAAPTGMLL
FT                   AAVPAAGYMISHAVLRVSESAVYLLMSIVYLLMACLFSIMGVKFIHKYFFIKANQDIIR
FT                   QHRI"
FT   gene            complement(430814..431071)
FT                   /locus_tag="BLi00434"
FT   CDS_pept        complement(430814..431071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00434"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00434"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39390"
FT                   /protein_id="AAU39390.1"
FT                   /translation="MKNEKNFLYKKINEAMIIFTILFPVVGIFFVIMTIWGLLEQAPSE
FT                   IPLFVSVISLFFFVLPLLLHIFRKKVWLKKHMENYKNSEG"
FT   gene            complement(431237..432040)
FT                   /locus_tag="BLi00435"
FT   CDS_pept        complement(431237..432040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00435"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39391"
FT                   /protein_id="AAU39391.1"
FT                   /translation="MKHLITCTSEELALLVGLCDYPGVAKGILESSLGKKSKKEWDAIL
FT                   EATVNQLILKQYWDEEKSSKDENPLSEEMQKFIVSYVNSEQMIRCSNLDNKNTLMLHHF
FT                   ENETWLFHMIDRDIIHEFAYVDEQEIAQLMKDYYHFSTDEEHIPLKFRLSDKCFDWLSN
FT                   KDMTEKVRKKSSFSPEEEHSFNQLIADLEANQWSLNNISHFYIPSLNDGPFLQNIVFFI
FT                   PSARGVWVAQYDEHNEKPVHISLRTLEQWNELLKGLEYTVSFQNT"
FT   gene            complement(432420..434045)
FT                   /gene="yxiD"
FT                   /locus_tag="BLi00436"
FT   CDS_pept        complement(432420..434045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yxiD"
FT                   /locus_tag="BLi00436"
FT                   /product="putative integrase YxiD"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00436"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39392"
FT                   /protein_id="AAU39392.1"
FT                   /translation="MKTLDVQAFQTGLDKTLTELKNQTDEISKVKQSIKGLTSLDDALK
FT                   GAGGEAIRSFYEECHTTFLLFYESFISDYKGLLEKTKSALHSLEPNQNGFISQSFLENE
FT                   LHDGVSQAESLTGRLTSKANQTMATVSHIVDLPDLDDSAVNENAKKAQRQISETLEKLH
FT                   TFDREQTNALKAAREDLDTMKQYIQQLEKMYTGPKIEISEYKSGSILKPQNDSTISQAP
FT                   GGLQNDLQNPGETPMEKMLGRLEEKAAETLTNPDTQDKEKTNIAHEILSYFETFGEPLD
FT                   VGDKALLGYHAANATASIAWTRKLKIYYQGGKPTKWQRFKGEYKFQVMSHRSWTSQGDH
FT                   SSKVARTIKNISDSNPSNPLLKKAQKFVASYDSPSMMFKHAVGFPKNQHSFIDGKEFRK
FT                   RAALRTKAGAVDIMESTAKAKGFTALERGVPIVGTAVTFASNLTEYTDPENSDKSFAEK
FT                   TGRFAAGVGTDIFAVSTGVEIGATIGSVGGPVGVIVGGAIGGVAGAIASSSYGDAIKDA
FT                   GEKVAGSIEKGIKNSFESVKSWFK"
FT   gene            complement(434063..434341)
FT                   /gene="yxiC1"
FT                   /locus_tag="BLi00437"
FT   CDS_pept        complement(434063..434341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yxiC1"
FT                   /locus_tag="BLi00437"
FT                   /product="YxiC"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00437"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39393"
FT                   /protein_id="AAU39393.1"
FT                   /translation="MGQEIKVKTGEVKQALSKLKHSAQAVKPNVQTDISGKNNLDVVKK
FT                   IESMNKDLKSLTKAYASALAKQIAQTEQAVNAIKDADKKLSSSIKAK"
FT   gene            complement(434355..434738)
FT                   /locus_tag="BLi00438"
FT   CDS_pept        complement(434355..434738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00438"
FT                   /product="putative phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00438"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39394"
FT                   /protein_id="AAU39394.1"
FT                   /translation="MIWEKTVLYGLQGTLLIKKQQLEQLKNCQTELEADKKEFDDSKDS
FT                   IKKPELSPTTWQGSLADSFKNVRSDMKTAYNDICGKQLNEVFKQLKEKISSLNDDIDSL
FT                   GKDISSLKTKIEKLEKEEREARR"
FT   gene            435240..436232
FT                   /locus_tag="BLi00439"
FT   CDS_pept        435240..436232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00439"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00439"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39395"
FT                   /protein_id="AAU39395.1"
FT                   /translation="MKKLLVVYAVMLCLFFLYVYDYSRGDKAGSAEESRRPAAAGSLSE
FT                   KYVMVTFQSGIEYWKSGLKGFEDAAQLFNVSVEYRGAAHYDVHEQTTVLEQVIAKKPAG
FT                   IAVSAINPKALNPVIDKAHEQGIPIVLFDSDAPLSKASTYIGTNNMEAGAVAARRMAEF
FT                   LNGKGETAVITQPQQYNHQERTKGFEQTIKQKYPNMKVAAVLDGKGDELTSKKEAAKIL
FT                   EENPSIKGIFTTEANGASGVARAVKEAGLEGEVCIIGFDKDKKTLDGIKNGSISATMSQ
FT                   DTWQMGYWSLHMLFFSNHHLKHERPLPAAIDTGITIITKENVAAYYAND"
FT   gene            436204..437988
FT                   /locus_tag="BLi00440"
FT   CDS_pept        436204..437988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00440"
FT                   /product="two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00440"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39396"
FT                   /protein_id="AAU39396.1"
FT                   /translation="MWQPIMRMIKRLINNAPIRHKLISLLLLISMLPTIGLGILSGWAV
FT                   ENIIEKQVIDQTLQLIGEVNKTAEVYVSHMQNLTYLISMNEEMEAFFSHKKEDGEADYK
FT                   RRTFLQGLTSLYSEAAGILVVNDKGEMISNEMYERTPTDLTKEPWYQAALDNEGIFKMI
FT                   GKPVNRNIRSHVHYREDEVVSAVRAVIDPETQHVKGVVLIDLKLRVLAEATKNIRLGKT
FT                   GYLMIMDENGGNIYSPETSNLFLPKKWFRQERSGYFSKRIKGEEYQFIYETSSFTNWTT
FT                   VGVFKAGEPVFEVKEIHLYVLLFLLTAAFLGMSASYYLSHSMSRPILKLNAVMKTAESG
FT                   NFSTLYQEEREDEIGLLGKSFNRLMFRIRELMSVTERQERQKREAELRALQAQINPHFL
FT                   YNTLDTINWMARKKGAEEVSDLVQALSKLFRISLSKGKDIIPLSDEFEHVENYLKIQKA
FT                   RYRDKLNYSIEMTGLCDDRLILKLVLQPIVENAIYHGIKEKKGPGHIAIKGMEEDGSLI
FT                   IKIEDDGAGMDEETLKQITDQFKHRDDTAGYGMINVHERIALTFGEPYGITVESRKGAG
FT                   TAVTIRLPILAKGGTSLE"
FT   gene            437981..439183
FT                   /locus_tag="BLi00441"
FT   CDS_pept        437981..439183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00441"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00441"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39397"
FT                   /protein_id="AAU39397.1"
FT                   /translation="MSECWRVLIADDEPWIREGIRDAVSWERYQMSVSAEAENGEEAFE
FT                   LALKHGIDLLIVDLNMPIVNGIALMKKLRGALPQCRFVIVTGYDQFAYAQEAIRLNVDD
FT                   YLLKPVDPAHLEQVLKKISVSLAAEKKKLSEQKLAEQHIQQNLGLLKEHVFRSWIENRA
FT                   DEEDVYRQLECLRLPARNPETLGVIAAGHVWNKPSEADNLKEKVERFFINERDKAVFFD
FT                   GDRLIAACLWRSVTEAEQRALAEMIKAELQASAAVCFAKLAENGRSAPQCYQHCRQQVS
FT                   KAFNISPVVIRAKEYMQKHFTEREFSLKQMADALQVSSVYLSRMMKKELGVTFVQLLTE
FT                   MRMDQAVHLLETTPLSIHDIAEQTGYDTQHYFSTVFKKTMGVSPNQYRRMSGIERTGGK
FT                   L"
FT   gene            439311..440390
FT                   /locus_tag="BLi00442"
FT   CDS_pept        439311..440390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00442"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00442"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39398"
FT                   /protein_id="AAU39398.1"
FT                   /translation="MKKCWLLITAMLFCLIVTACSGNQASGGGDKGYVGISMPTKSSER
FT                   WVYDGKYMVKEFEKLGYKTDLQYAEDVVENQVSQIENMITKGVNVLVIASIDGEALTDV
FT                   LEKANKQDIKVISYDRLLMNSKHVDYYATFDNHKVGELQGKYIEEKLGLKDKKGPFNIE
FT                   LFAGSPDDNNAHFFFDGAMSVLKPYIDSGKLKVLSGQTSFEQGATLRWDGATAQSRMDN
FT                   LLSAHYTKAKLDAVLSPYDGISIGIISSLKGAGYGSDKKPLPVITGQDAELASVNSIIK
FT                   GEQTSTIFKDTRELAKKAVEMASSVLKGEKAEVNDTKTYDNGEKVVPSYLLEPVVVDKE
FT                   NYKKVLVDGGYYKESELGK"
FT   gene            440395..441963
FT                   /locus_tag="BLi00443"
FT   CDS_pept        440395..441963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00443"
FT                   /product="multiple monosaccharide ABC transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00443"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39399"
FT                   /protein_id="AAU39399.1"
FT                   /translation="MSDCILEMRGITKEFPGVKALDNVHLRVKAGEIHALCGENGAGKS
FT                   TLMKVLSGVYPYGAYTGDILYKGEVCQFKNIKQSEEAGIVIIHQELALVPQLSIAENLF
FT                   LGNEQASRGVINWRKTKLETLELMKKVGLQESPDTLVSQIGVGKQQLVEIAKALAKKVQ
FT                   LLILDEPTAALNEADSENLLQLLLELKKQGISSIMISHKLNEVTKVADSITVLRDGQTI
FT                   ETLDVQSGQLTENRIIRGMVGRELQNRYPDRSAEIGDVIFEVKDWTVHHPLQQDRKVVN
FT                   MAAFSVKRGEIAGIAGLMGSGRTELAMSIFGRSYGKNISGTIEKDGRELYINHPEDAIK
FT                   NGIVYVTEDRKGNGLILKDSIKENITLSKLDKVSSRLVMDERREQHEAEDFRRKLNIKT
FT                   PDISQRTGNLSGGNQQKVMLSKWIFAEPDVLILDEPTRGIDVGAKYEIYGVINQLAEAG
FT                   KAVIMISSELPELLGMCDRIYTMCEGEITAEFSKEEADQEKLMKYMTIRMKRGGEAYAD
FT                   TGANG"
FT   gene            441938..443149
FT                   /locus_tag="BLi00444"
FT   CDS_pept        441938..443149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00444"
FT                   /product="multiple monosaccharide ABC transporter membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00444"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39400"
FT                   /protein_id="AAU39400.1"
FT                   /translation="MQTPVQTDKDRAQPGYFQLFRDMYKQNIRKYSMVIALVFIMLLFQ
FT                   ILTDGILLRPLNITNLILQNSYILILAIGMMLVIITGHIDLSVGSVAAFVGAVSAMMII
FT                   ENDMPLFAAVVLSLLLGAAIGAWQGFWIAYVKIPAFIVTLAGMLLFRGLTMIVLEGKSI
FT                   APFPVSFQKMASGFIPDWLNGGTFHLTTIVAGAGVSILYLVYQLQQRNMQKKFQFDLQG
FT                   KGLFTVKVFFIIAIINLFTYILATYEGIPLILITLFVLIAGYTFVMKKTVIGRRIYAIG
FT                   GNEKAAELSGIKTKRLTFMVFVNMGVLAALSGLIFAARLNAATPKAGNLFELDAIAACF
FT                   IGGASAYGGIGTIGGAIIGGLVMGVMNNGMSLLGLGIDWQQAIKGLVLLIAVAFDIYNK
FT                   NKTS"
FT   gene            complement(443196..444464)
FT                   /gene="ybfB"
FT                   /locus_tag="BLi00445"
FT   CDS_pept        complement(443196..444464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfB"
FT                   /locus_tag="BLi00445"
FT                   /product="putative major facilitator superfamily protein
FT                   YbfB"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00445"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39401"
FT                   /protein_id="AAU39401.1"
FT                   /translation="MKRKIHYAWIIVFVTFLTLLAVQGVRLSFGAFIQPWEEEFSMDRG
FT                   TISLISMLSFIVYGVSQPVIGRLVDRFGPRIILSLSTLLVGLSIFFTYLVTSPWQLFIL
FT                   YGIIVSLGVGGASNVASTVIVTNWFNEKRGLAFGIMEAGFGAGQMLLVPGSLMMIHWFN
FT                   WKVTVIVLGLFLAVIVFPIVILLLRNHPSEKNVQPIGGAQGGEIKEEPDAQPKKIPYKA
FT                   VFLKRTFWFLVLPFFICGFTTTGLMDTHLIPFSHDHGFSTEVTSAAVSLLAGFNIIGIL
FT                   ISGVVADRWSSRKILCFLYAVRALSLVILLSSHNSMLLLCFAVLFGLVDFATVAPTQML
FT                   ATQYFRQYSVGFILGWLFLSHQIGSALGAYLPGVWYSQTGNYNLSFYLSIVILAVASIL
FT                   NILLPEPKKINPTLNQEGRSVQQ"
FT   gene            complement(444480..445397)
FT                   /gene="ybfA"
FT                   /locus_tag="BLi00446"
FT   CDS_pept        complement(444480..445397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfA"
FT                   /locus_tag="BLi00446"
FT                   /product="putative DNA-binding domain acetyltransferase
FT                   YbfA"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00446"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39402"
FT                   /protein_id="AAU39402.1"
FT                   /translation="MAEINHSTTLKFRKFNRFYTNVLGFLNEHIYDSPFSLTETRILFE
FT                   IHNTADCTAKLIQDTLGLDRGYVSRILKRFEKENMVYKKRSEEDSRNHYIYLTSFGESI
FT                   YKKLEAKANQQIENMLKHIDGRHQEKLTEAMNTIECILSEHLPPEKSAVSIRDYYISDD
FT                   IKLMIEKQRAFYAETHGWDDSFLDYLHETFDAEIEKIWIAESAGRFAGCVGLVKHPGRT
FT                   VQLRWFLVDAAFRHQGVGTRLLEHLIDYCKENQYERIFLWTVSTMAEARPLYEKFGFRL
FT                   TEVKDETLLWGQRLREERWDAELG"
FT   gene            445678..447750
FT                   /gene="ganA1"
FT                   /locus_tag="BLi00447"
FT   CDS_pept        445678..447750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ganA1"
FT                   /locus_tag="BLi00447"
FT                   /product="beta-galactosidase GanA"
FT                   /EC_number="3.2.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00447"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39403"
FT                   /protein_id="AAU39403.1"
FT                   /translation="MVKPYPPISRKVPRLLHGADYNPDQWLKYPDVLKEDIRLMKLSRC
FT                   NVMSVGIFSWVSLEPEEGRFTFDWFDQVLDTFKENGIYAFLATPSGARPAWMSKKYPEV
FT                   LRTERNRVRNLHGKRHNHCYTSPVYRRKTAIINGKLAERYAHHPAVIGWHISNEYGGEC
FT                   HCELCQDKFREWLLAKFKTLDRLNDAWWTSFWSHTYTDWDEIESPAPHGEDAVHGLNLD
FT                   WKRFVTDQTVDFCRHEIAHVRSFNPDLPVTTNFMGTYAGLNYWKFADLLDVISWDSYPA
FT                   WHNSRQEDSRLGADIAFVHDINRSLKGGRPFMLMESTPSMTNWQDVSKLKRPGMHELSS
FT                   LQAVAHGSDTVQYFQWRKSRGSSEKFHGAVVDHEGSEHTRVFQEVKKLGEKLEKLEDVA
FT                   GTTVEPEAAIIFDWENRWALEDAQGPRNIGKHYERTAKSFYEPFWREGVPVDVIHMEAD
FT                   FSRYKLLVAPMLYMLREGTAERIEQFVQNGGTFVATYWSGIVDENELTFLGGFPGGLRK
FT                   TLGIWSEEIDALHDGQKNTIVMDEENRLGLSGSYEASELCDLIHLEGAEALAAYEDDFY
FT                   AGRPALTVNLFGDGKAYYIASRNEAAFQEAFISRLIEECGIAKVLDTELPKGVTAQLRT
FT                   DGRHDYIFVMNFTAENRSVSLPEETNTDVLKGTRKKGALKLPPYGTSILRRSHKA"
FT   gene            complement(447992..449137)
FT                   /gene="phy"
FT                   /locus_tag="BLi00448"
FT   CDS_pept        complement(447992..449137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phy"
FT                   /locus_tag="BLi00448"
FT                   /product="3-phytase Phy"
FT                   /EC_number="3.1.3.8"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00448"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39404"
FT                   /protein_id="AAU39404.1"
FT                   /translation="MNFYKTLALSTLAASLLSPSWSILPRAEASAYKDFSVTADAETEP
FT                   VDTPDDAADDPAIWVHPKQPEKSRLITTNKKSGLIVYDLNGKQLAAYPFGKLNNVDLRY
FT                   NFPLDGKKIDIAGASNRSDGKNTVEIYAFDGEKNKLKNIVNPQKPIQTDIEEVYGFSLY
FT                   HSQKTGKFYAMVTGKNGEFEQYELFDNGKGQVEGKKVRSFKMSSQTEGLAADDEYGKMY
FT                   IAEEDAAIWSFSAEPNGGDKGKIVDRAGGPHLTADIEGLTIYYGEDGEGYLIASSQGDN
FT                   RYAIYDRRGKNDYVADFSIDDGKEIDGTSDTDGIDVIGFGLGKKYPYGIFVAQDGENTE
FT                   NGQPANQNFKIVSWEKIADALDDKPDIDDQVNPRKLKKRAK"
FT   gene            complement(449388..450878)
FT                   /gene="yclF"
FT                   /locus_tag="BLi00449"
FT   CDS_pept        complement(449388..450878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclF"
FT                   /locus_tag="BLi00449"
FT                   /product="putative oligopeptide transporter YclF"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00449"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39405"
FT                   /protein_id="AAU39405.1"
FT                   /translation="MSNHQKETFQNIPQKGFFGHPRGLFTLFFTEFWERFSYYGMRAIL
FT                   IYYLYTEVTKGGLGFDQTTANSIMAVYGSLVYMSGIIGGWIADRLLGTANTVFYGGVLI
FT                   MFGHILLSFPGSVPAFFISMFLIIIGTGLLKPNVSSVVGDLYSPEDTRRDSGFSIFYMG
FT                   INLGGFLAPIIVGTVGQTYNYHLGFSLAAIGMLFGLLTYLATRKKNLGSAGRTVPNPLT
FT                   PAERKMVFGRIGIGVLVIAAIFGYSIFMGWMTIKLFTMIVSCLGILIPLIYFIVMFKSS
FT                   KTTSDERSRLTAYIPLFVASMMFWAIQEQGANILATYADKRTHLEFLGVQLHSSWFQSL
FT                   NPLFIVVLAPVFAWIWMRLGNRQPSTPTKFSLGLILAGLSFVVMIFPAYINGTESLANP
FT                   MWLVLSFLIVVLGELCLSPVGLSATSKLAPAAFSAQTMSLWFLSNASAQAINAQIVRFY
FT                   SVDTEIAYFGIIGGVSILLGIILMLLSPKIQKFMKGVN"
FT   gene            451041..451139
FT                   /locus_tag="BLi00450"
FT   CDS_pept        451041..451139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00450"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39406"
FT                   /protein_id="AAU39406.1"
FT                   /translation="MKDFLIKFYLFMYKRILLDWHIYNANRFTKGG"
FT   gene            451147..452904
FT                   /gene="yclG"
FT                   /locus_tag="BLi00451"
FT   CDS_pept        451147..452904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclG"
FT                   /locus_tag="BLi00451"
FT                   /product="YclG"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00451"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39407"
FT                   /protein_id="AAU39407.1"
FT                   /translation="MQQQPDEMRMTVVDATKFGAVGDGKTDSTNAINECLAWTKSMGYN
FT                   TVWIPNGTYMIDGTKNGDPRAPFRGAGINVPGNIEILMDAEAVIKVKPNSSWGYAAFYI
FT                   GGTSDIKISGGSIIGERDEHTYTPAPRPTHEWGFGICIEGASNVVIEHVRIADFTGDGI
FT                   IISNGGEGYRPSERIQVTNCDIRRSRRNNLSITGCDNVLVEGCEIADAGTGNGTAPCFG
FT                   IDIEGYSEGSIVYEEPVNVIIRNNVLKGNVNHAVSNFNGTSVIIEGNVADGTISYGYGT
FT                   GTTIANNIIKKNPEFTGQSTGINGLGVGALEERSDAVIKGNLISGFTTGIDIRGKSVFA
FT                   TGNKIRDFVNAGILAYQASQVFIEGNYIENDVPEQRSGTAFSITQSDNVTCSGNHIANV
FT                   VLAVRSTGNDVQIKHNVIKQFSRGIWISQGNAVIEGNFISPNGFQTVPESYAVSVTNTA
FT                   SAVIQQNTITRFRNFPIYCSTNQHTKIIGNYIEDSPLIVTVFLTRGTHEVIGNTITLSR
FT                   PSLPAVLIYLDQSSDSAILNNTLRSNTEARVTAIQTNTSRQTLIIGNTIVKGMIHSHQT
FT                   DTVNGNIEV"
FT   gene            complement(452928..453146)
FT                   /gene="yczF"
FT                   /locus_tag="BLi00452"
FT   CDS_pept        complement(452928..453146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczF"
FT                   /locus_tag="BLi00452"
FT                   /product="putative transmembrane protein YczF"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00452"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39408"
FT                   /protein_id="AAU39408.1"
FT                   /translation="MKLIGIGLLLLASLEAFAVMLDVFQGMTLQRAIVNSLTFAILEVG
FT                   EWIIILLFLFIIFLEASESFRKKRKRT"
FT   gene            453241..454914
FT                   /gene="gerKA"
FT                   /locus_tag="BLi00453"
FT   CDS_pept        453241..454914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKA"
FT                   /locus_tag="BLi00453"
FT                   /product="spore germination protein KA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00453"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39409"
FT                   /protein_id="AAU39409.1"
FT                   /translation="MKNEKGILTAMPFFFKGRHQKDNKQESLMSGDKNPETVKLSGFVR
FT                   PLLAENLSLIKEMTGNSSDIVIRKLKTGAGEKIEIAVVYVGGITDEKAIHDFLLESIMN
FT                   SEELAEKEYGREVLETIAGDAVALGGVEKEKRLDKVLESLMAGNTIILAEETAEAVITT
FT                   TKGGEKRSIKEPENQQAFRGSREGFIEALDTNISLVRRIIKNPNLWVEKTTMGSVTKTD
FT                   VAIMYINGICDPKAVKEVKKRMESIEIDSILESGYIEQFIEDTVFTTFPTVYHTERPDM
FT                   VAGNLLEGRIAIFVDGTPFVLLVPAVFIQFFQSVEDYYSRFDIATFIRFLRVLIFFISL
FT                   IAPAVYVGATTFHKEMIPTELLVVIAAQREIVPFPAVVEAMIMEISFEILREAGIRLPK
FT                   AIGSAVSIVGAIVIGQAAVQAGIVSPAMVIIVAITAISSFATPSFSMAISARLVRFFFI
FT                   LAAATTGFYGIILGLIIMFVHLCSLRSFGVPYMTPFAPFILKNWGDAIVRLPWWTHEKR
FT                   PELIGNDNKVRQGEYQKPEPPDSGDMKTKQEDGDPNETNR"
FT   gene            454898..456121
FT                   /gene="gerKC"
FT                   /locus_tag="BLi00454"
FT   CDS_pept        454898..456121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKC"
FT                   /locus_tag="BLi00454"
FT                   /product="spore germination protein KC"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00454"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39410"
FT                   /protein_id="AAU39410.1"
FT                   /translation="MKRIVKIVLLLAAIVLLQGCWDKRELTDLLLITAIGIDKGKDTDY
FT                   ELSYQIVNPINVTGGLQGGQGGDRPPISSYSVTGNNLTEMSRHASAKMSREIYYSHTNL
FT                   VVVDEKLAKEEGLIKILDVLDRDTDFRTTATIIISRGQKAKTFIRTLTPIDKIPSNKVN
FT                   KTLQFTEEHLGEHMKTSVQDVIKCLTSKAKHPIISSFKVTGNKEKGEKMENVQSTSPEA
FT                   IVEADGLAVIKEGKLVNWLEGKTARGVLWLRNKISRTYLTIPMNHERDAVTFDVIRQKT
FT                   KIGSHLKNGKPAISVDVAMEGDIGETTVPIHLDDPKVLSDIERKVAKELKNELQNTIDI
FT                   VKRNKTDVLQFGDVVYRTHPEVWKKMEGEWSNRYFPDTDVDITVNAYVRRTGLRNNPNI
FT                   LNHHEGRS"
FT   gene            456146..457252
FT                   /gene="gerKB"
FT                   /locus_tag="BLi00455"
FT   CDS_pept        456146..457252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKB"
FT                   /locus_tag="BLi00455"
FT                   /product="spore germination protein KB"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00455"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39411"
FT                   /protein_id="AAU39411.1"
FT                   /translation="MEKAKISAAQLFVLIVLFELSSSLLIFPGQSAEQDAWIAILFGTV
FT                   GGLALFMMHHFFYQVNPDASPYETLMNIFGKPVGWSMTFIYIVYYCYIAARVLRDFGEM
FT                   LLTSAYPNTPIIFANGLLIAVCIFTVRKGIEVLARSGELLFGIMFWLAVTGLILIVSSG
FT                   LIKPKELLPILGNGPGPMFHAVFTQTLYFPFGEIIAFTLILPYLKEKKLAKKAGLLGIA
FT                   ISGLILAFNVALNISVLGVDLNMRSRFPLLSTIQTIQVAEFLDRLDVFFMLVLVIGGFF
FT                   KMSIFMYAVTEGVTVLFKLKNPSKVVHVIGIIILILSVSIASNISEHVKEGIEFVPLYV
FT                   HLPMQVILPAFICIVTYVKMKKNKKKAM"
FT   gene            457308..458036
FT                   /locus_tag="BLi00456"
FT   CDS_pept        457308..458036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00456"
FT                   /product="putative HTH-type transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00456"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39412"
FT                   /protein_id="AAU39412.1"
FT                   /translation="MLYTVKEVARLANITIKTLYHYHKIGLLCPAEVTDAGYRLYGVKE
FT                   LERLQHILFYRELEFPLKAIKQILDGKADRLTILSEQKRLFTARLDRIKQLISTIDLSI
FT                   QQAGKGEAMDQSSMFKGFSSSREWEDALAEQNRYLKEAYDVDLLKGEPVIAEEMNEKAE
FT                   EAARFMNGMAEALRDGVKHDHEQVKTAIKRHLKFLGITPDDFQSQTRFFIEDDFHRGML
FT                   ENQQTGLSYYLAAAAEAFAS"
FT   gene            complement(458069..458752)
FT                   /gene="yclH"
FT                   /locus_tag="BLi00457"
FT   CDS_pept        complement(458069..458752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclH"
FT                   /locus_tag="BLi00457"
FT                   /product="antimicrobial peptide ABC exporter ATP-binding
FT                   protein YclH"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00457"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39413"
FT                   /protein_id="AAU39413.1"
FT                   /translation="MGSILEFQNVGYWYKNQDQPLFEDISIQFSQGLLYTIVGTSGSGK
FT                   TTFLSLAGGLDAPKEGNILYKGENISKIGLTSFRNQYVSIVFQSYNLLPYMTALQNITS
FT                   AMEITGSQVKNKEQYALEMLEKVGIGEKQARQKVLTLSGGQQQRVSIIRAFCCDTDLIV
FT                   ADEPTGNLDEDTSKDIVRLFQNLAHQENKCVIMVTHDEQIAKVSDVNITLSRGGFTVKK
FT                   RISAG"
FT   gene            complement(458768..460207)
FT                   /gene="yclI"
FT                   /locus_tag="BLi00458"
FT   CDS_pept        complement(458768..460207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclI"
FT                   /locus_tag="BLi00458"
FT                   /product="antimicrobial peptide ABC exporter permease YclI"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00458"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39414"
FT                   /protein_id="AAU39414.1"
FT                   /translation="MNFFKRAFWSMKAKKGKTLLQLFVFTMICVLVLTGITIQSAAVKS
FT                   SELAREQLGGSVTLKVDREKMMKEQQDSGDRKRFESTPVSLKSAEKLASLYHVKSYNFI
FT                   SSTSALADNFDPIESGDEDSTDSNSDQPAGSGGNEQGGRQMMQADVSIEGVTSTALVDE
FT                   FADGTSKITEGRALTKDDVNEKVAVIEETLAEENELKVGDTIKVKASSDEDATINLKIV
FT                   GIYKTTSSGDNQAQNFAFLNPYNKIYTPYTAASALKGDDYQNAIDEAVYNMDDASNIDA
FT                   FIAAAKKTGIDLDTFTLDANDQLYQQMVGPIENVASFSKNVVYLVTVAGAVILGLIVMM
FT                   SIRERKYEMGVLMAIGEKRRKLIGQFLTEILMIAVLAIGISALTGSLIAKQIGNQLLSQ
FT                   QIEQTSASQSAGGMMGPGGGGFFGQSTAQVSAIDQLDIQVSFGNLMALGGIGLLIAMFA
FT                   TLLPSISVLRLHPKTILTKQE"
FT   gene            460425..461111
FT                   /gene="yclJ"
FT                   /locus_tag="BLi00459"
FT   CDS_pept        460425..461111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclJ"
FT                   /locus_tag="BLi00459"
FT                   /product="two-component response regulator YclJ"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00459"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39415"
FT                   /protein_id="AAU39415.1"
FT                   /translation="MKILMIEDNLSVCTMTEMFFAKEGFETEFVHDGLEGYNRFKSGDW
FT                   DLLIIDIMLPSMDGVTICKKVREESTVPIIMLTAKDTESDQVLGFELGADDYVTKPFSP
FT                   LALVARIKAVSRRYQNAGRQDSADSDTLETEHFKINKKTREVFLDGVQIQNLTPKEFDL
FT                   LYYLVQSPKQVFSREQLLEQVWGYQFYGDERTVDVHIKRLRKKLGSDSRPFLYTVWGVG
FT                   YKFDED"
FT   gene            461101..462528
FT                   /gene="yclK"
FT                   /locus_tag="BLi00460"
FT   CDS_pept        461101..462528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclK"
FT                   /locus_tag="BLi00460"
FT                   /product="two-component sensor histidine kinase YclK"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00460"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39416"
FT                   /protein_id="AAU39416.1"
FT                   /translation="MKIKYLYQLLASHISILVLAFLITGALFSHFAKDFAYESKVDELS
FT                   SYGYRIMGEMEMRPKGAPAIMKPFEEILRSRKISFFLFNEKKEILMTPADLRPRKLLLS
FT                   DEEWKELKDGKAVVVKTDFNRFNEEVSVVALPNIVNNEFQGGILLTAPISGTEEMISDM
FT                   NRFMLFTAAGVILVAILLSWLTSKFHVARIQKLRDATKKVAAGDYDIHIENRNKDEIGD
FT                   LGDDFNIMARKLKSSSEEIDRLEKRRRQFITDVSHELKTPLTTISGLVEGMNSQTIPED
FT                   QQDKCMKLITEETKRLIRLVNENLDYEKIRSNQITLQKLHYPLIEVFEIIKEQLALQAE
FT                   ERQNQLILDVEDHVMVNADYDRLIQILVNITKNSIQFTTNGTVWLRGREDYKETVIEVE
FT                   DTGIGIDENDIENIWDRFYKADLSRTNTPYGEYGLGLSIVRQLVSLHNGTVEIESEKNK
FT                   GTKFIIRLPLTARDDDE"
FT   gene            complement(462561..464279)
FT                   /gene="tlpA1"
FT                   /locus_tag="BLi00461"
FT   CDS_pept        complement(462561..464279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlpA1"
FT                   /locus_tag="BLi00461"
FT                   /product="methyl-accepting chemotaxis protein TlpA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00461"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39417"
FT                   /protein_id="AAU39417.1"
FT                   /translation="MNLLRNIKIRSKLFVIIIISALALSIVGIQGVGGLSKLSKGSEMI
FT                   YQDQLIPNQLFARLKANNLDLDTYKFELMVTKDSDRNETLQKNIKEKNEENNTLMEKID
FT                   QLKLMDNVSEKYESFKSEYKKLQDISSQMLSLAVKNENDKAYDVYLKEMEPQRETVNQL
FT                   IEDIQTLNADNAKTIYQRDSKEAGSIITLLIIVIAASLVLSISIGLLMTRLITKPIKDI
FT                   QALFAETEQGDFTVKGTYQSKDELGLLTASFNKMVAGVRSIIETVGETSHQVASSSQEL
FT                   SASADESTKASEYISTTIQELAVGSDQQVESVENSRTVIKGMTEFAGRISSSAEKAAAT
FT                   ADQTAKMSLEGTKAIDKVSAQMQSINETVVSLSEAFKHLTERSNEIGNITEVITSIAEQ
FT                   TNLLALNAAIEAARAGEQGKGFAVVADEVRKLAEQSAQSAEQITRLITIIQNDTKQTMN
FT                   SVISATGEVKEGLVVVHEAGGAFQKIENSITEVVTQINDVTNLVKNLTAGTSEIETAIS
FT                   GVKEVAETAAGSTQTVSAATQEQLASMEEIAAASQILAQNAEELQHLIQKFKIKD"
FT   gene            complement(464415..465776)
FT                   /gene="yclM"
FT                   /locus_tag="BLi00462"
FT   CDS_pept        complement(464415..465776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclM"
FT                   /locus_tag="BLi00462"
FT                   /product="aspartate kinase YclM"
FT                   /EC_number="2.7.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00462"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39418"
FT                   /protein_id="AAU39418.1"
FT                   /translation="MKVVKFGGSSLASGAQLEKVFQIVTSDPERRAVVVSAPGKRHPED
FT                   TKVTDLLIECAQQYLLSKEATGLVEAIVGRYADIALELGLADDVINRIRADLLQLLEGD
FT                   KTNPERFIDAIKASGEDNNAKLVAAYFRHRGVEAHYVSPKDAGLFVTSEPGNAQVLPES
FT                   YDNLFQLRQQKGIIIFPGFFGFSQEGEVMTFSRSGSDITGSILANGLKAELYENFTDVD
FT                   AVYSVNPAIVSNPKEIRELTYREMRELSYAGFSVFHDEALIPAFRARIPVQIKNTNNPD
FT                   AEGTRVVATRDNTNGPVVGIAGDSGFCSIYISKYLMNREIGFGRRVLQILEDEGLTYEH
FT                   IPSGIDDITIILRQNQMDQAAEKRMIKRIKEELDADEVAIEHNIALIMVVGEAMRHNVG
FT                   TTARASKALSEAGVNIEMINQGSSEVSMMFGVKEAQEKQAVRALYQEFFAKVLV"
FT   gene            466032..467006
FT                   /gene="yclN"
FT                   /locus_tag="BLi00463"
FT   CDS_pept        466032..467006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclN"
FT                   /locus_tag="BLi00463"
FT                   /product="petrobactin peptide ABC transporter permease
FT                   protein YclN"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00463"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39419"
FT                   /protein_id="AAU39419.1"
FT                   /translation="MQGGYCSMKLRYLLLMLIILSFSSIFIGVKELSPLDLFRFNEDEI
FT                   QTLYISRIPRLISIVLAGMSLSICGLIMQQLTRNKFVSPTTAGTMDWARLGVIIAIVLF
FT                   SSAGIVVKILFAFVFALFGSFLFVKILDRIKFKDAIFIPLVGMMLGSVVSAISTFMAYQ
FT                   YNIIQNVNAWFEGNFSLVMKGRYELLFLSIPLVIIAYLFANKFTLAGMGESFSINLGLK
FT                   YKRVVNIGLIIVSIISSVVILTIGTLPFLGLIIPNIVSIYRGDHLKNSLPHTAVLGAVF
FT                   VLFCDIAGRLVIYPYEISVGLMVGIIGSGVFLYLLLRRKAYAS"
FT   gene            466996..467940
FT                   /gene="yclO"
FT                   /locus_tag="BLi00464"
FT   CDS_pept        466996..467940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclO"
FT                   /locus_tag="BLi00464"
FT                   /product="petrobactin peptide ABC transporter permease
FT                   protein YclO"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00464"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39420"
FT                   /protein_id="AAU39420.1"
FT                   /translation="MRHKQKMLVLIVIAAVCIGLFLFYGLPSVWEYALPRRFAKVFAII
FT                   IVGTAIAYSSMIFQTITNNRILTPSILGLDSLYVLLQTGIIFFFGAAKLADLGKNGNFL
FT                   LSTGLMVCFSFVLFFLMFRRGGRHIFLLLLVGIVFGTLFRSLSSFMQMLIDPNEFQVVQ
FT                   NKMFASFNNLNTDILVLASLVILAILVYAWRFNPYFDVISLGRDQAVNLGIDYDRTVKK
FT                   MLIVVAVLVSVSTALVGPITFLGLLVVNVAREVFKTYKHSVLIPGAVLFSIIALVGGQF
FT                   IVEKLFGLTVTLVVIIDFIGGIYFIYLLLKERK"
FT   gene            467940..468698
FT                   /gene="yclP"
FT                   /locus_tag="BLi00465"
FT   CDS_pept        467940..468698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclP"
FT                   /locus_tag="BLi00465"
FT                   /product="petrobactin peptide ABC transporter ATP-binding
FT                   protein YclP"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00465"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39421"
FT                   /protein_id="AAU39421.1"
FT                   /translation="MIEVRDIMKQFGEQTVVHPTTLTIQKGMITSFIGPNGAGKSTLLS
FT                   IISRLIGMDAGKVLIDGKEIGAYKSNDLAKKISILKQSNQINIRLTVRELVSFGRFPYS
FT                   QGRLSKEDWAYVDEAIDYMKLRDIEHKHLDQLSGGQCQRAFIAMVIAQDTDYILLDEPL
FT                   NNLDMKHSVEIMKLLKDLVENRGKTIVIVIHDINFASVYSDRIAALKNGRIVKEGPAED
FT                   IIQTPVLKDIYDMDIPIQQIGDQKICVYFK"
FT   gene            468713..469660
FT                   /gene="yclQ"
FT                   /locus_tag="BLi00466"
FT   CDS_pept        468713..469660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclQ"
FT                   /locus_tag="BLi00466"
FT                   /product="petrobactin peptide ABC transporter
FT                   solute-binding protein YclQ"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00466"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39422"
FT                   /protein_id="AAU39422.1"
FT                   /translation="MKKLSLLIMALITVLVVAACGNKAADTDAKSSSKKETVTIKHNSD
FT                   TTDVPKNPKKVVVFNFGMLDTLDELGLSDRVVGLPKQTLPSYLKKYKDSKFESVGGLKE
FT                   PDFEKIAELEPDLIIIEGRQSEQYDEFKKIAPTIDIELDQKNYMNSFKENTENIGKIFG
FT                   KEDAVKEALAKIDEKVEKANKLAKEKGGKGLVVLTSDKQISAYGSGSRFGLIHDVLGVE
FT                   PVDKNIEVSLHGQSVSSEYISEKNPDYLFVIDRSAAIGEKGTAKEVIENEIVKSTKAYK
FT                   NGHITYLDPGYWYLSGGGLESVSEMVKEVENGLK"
FT   gene            complement(469829..471250)
FT                   /gene="ycnB1"
FT                   /locus_tag="BLi00467"
FT   CDS_pept        complement(469829..471250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnB1"
FT                   /locus_tag="BLi00467"
FT                   /product="major facilitator superfamily protein YcnB"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00467"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39423"
FT                   /protein_id="AAU39423.1"
FT                   /translation="MSTGTEQQTYNRNIIVGLLIAGAFIAILNQTLLVTALPHIMADLN
FT                   IDATKAQWLTTAFMLTNGILIPITAFLIEKFSSRALVIAAMSIFAAGTVVGAVAPNFPV
FT                   LLAARIIQAAGAGIMMPLMQTIFLTIFPVEKRGAAMGMVGLVIAFAPAIGPTLSGWIVD
FT                   SFTWRYLFYIILPIALIDLVLVILLMKNVTKLRETSVDIISIILSSLGFGGLLYGFSNA
FT                   GSEGWGSNTVLISFAVGAVALFFFISRQLKIKRPILEFRVFQSWTFTITTLLGMIVFAL
FT                   MIGTETILPLYTQNVRDVTAFDSGLMLLPGAIAMGIMSPIIGRIFDKIGGKGLAIIGFA
FT                   VLLLTSIPFADLQMDTSLTFIIVIYTLRMMGTSMIMMPLTTAGINALPAHLIPHGTAMN
FT                   NTMRQIGGSIGTAVLISVMSNSAKNAATSHPLNALIHGMNSAFIVAAVLALIGFILSFT
FT                   LKKKPQADKQGQPAR"
FT   gene            complement(471262..472182)
FT                   /gene="ycnC"
FT                   /locus_tag="BLi00468"
FT   CDS_pept        complement(471262..472182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnC"
FT                   /locus_tag="BLi00468"
FT                   /product="putative HTH-type transcriptional regulator YcnC"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00468"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39424"
FT                   /protein_id="AAU39424.1"
FT                   /translation="MSFIIAKEGAGMNEKKAAVLRAAKKLFAQKGYHNVAMQAIAEECK
FT                   MSKASIYKLFQSKEDLLLALIKFRKHEMLNKSAVINTETSLTPKERFAKKIALEITEFR
FT                   ENRQFINFISNEGSSPDTAVFKKHLKETKSMIISWHKDSIIQAYGEEVEPFIWDIVIIF
FT                   HGLMREFLFLVGTGKAQPDVKTIPPFIMSVLDLFIEKKLNEDQKSSLNEDIIASYSNFS
FT                   SCWAPPKKEELLEDLLQKLKTKISSLPQDDVSVTELLSAADLLSEELFANEPRTYLIKA
FT                   LLDYLGKIEAIQYDVSQIQTISIKE"
FT   gene            complement(472244..473086)
FT                   /locus_tag="BLi00469"
FT   CDS_pept        complement(472244..473086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00469"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39425"
FT                   /protein_id="AAU39425.1"
FT                   /translation="MKSFAKYQTFLDLHHQSDPFVLPNAWDAASAKAFQNCGFKAVGTT
FT                   SAGIAMSLGYPDGEHLPFETLLSVLKTITDAVDIPVSADLEAGYGQTPETVAENAKKAA
FT                   AAGVVGMNIEDGTKDPCRPLSDATLMEEKITAVKKLNLPVLINARTDVYWLNADAPGSR
FT                   LQAAVRRANRYSQAGADCIFIPGADDAGTIAGLRKGISGPINVLAGSHTPSLQILSELG
FT                   IERISCGSAPFRAALSLVKKIGEDIIRRGAFNRMTDGVLSYGEAADWISLHRDPKQNR"
FT   gene            complement(473197..473934)
FT                   /gene="nfrA1"
FT                   /locus_tag="BLi00470"
FT   CDS_pept        complement(473197..473934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfrA1"
FT                   /locus_tag="BLi00470"
FT                   /product="NAD(P)H-dependent nitro/flavin reductase NfrA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00470"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39426"
FT                   /protein_id="AAU39426.1"
FT                   /translation="MNEVLKTLKDHRSIRSYTDEPVSPEQLDDIIQAVQAAPNSINGQQ
FT                   VTVITVQDEERKKKIAELAGGQVWIEQAPVFLLFCADFNRAKIALEKNGETLAITDGME
FT                   SVLVGAVDAGIALGTATAAAESMGLGTVPIGAVRGRAEELIKLLNIPEYVFPVAGLVVG
FT                   HPADRSAKKPRLPEQAVRHSETYQPDLKPLIDAYDEEISEYMTKRTNGQETRNWSQGIS
FT                   AYYNKVYYPHIREMLEKQGFKLE"
FT   gene            complement(473953..474240)
FT                   /gene="ycnE"
FT                   /locus_tag="BLi00471"
FT   CDS_pept        complement(473953..474240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnE"
FT                   /locus_tag="BLi00471"
FT                   /product="putative monooxygenase YcnE"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00471"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39427"
FT                   /protein_id="AAU39427.1"
FT                   /translation="MIVLQAYMKVKPEKRDAFLESVQPLLKHSRAEAGNAQYQLFEDTE
FT                   HANTFVMLEQWKDQDALDAHNQTEHFQAFVQAAGDLLSEPLNVVKTHTTD"
FT   gene            474418..474714
FT                   /gene="yczG"
FT                   /locus_tag="BLi00472"
FT   CDS_pept        474418..474714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczG"
FT                   /locus_tag="BLi00472"
FT                   /product="putative HTH-type transcriptional regulator YczG"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00472"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39428"
FT                   /protein_id="AAU39428.1"
FT                   /translation="MKTNEMKLTAVLQALSDPYRLEIVKALADTAEKTCGTCTNLNIAK
FT                   STLSHHFKVLREAGLLKVRIEGKHHYYSLCKRELEEQFPGLIEAVLKVEKERW"
FT   gene            complement(474779..476209)
FT                   /gene="gabR"
FT                   /locus_tag="BLi00473"
FT   CDS_pept        complement(474779..476209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabR"
FT                   /locus_tag="BLi00473"
FT                   /product="HTH-type transcriptional regulator GabR"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00473"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39429"
FT                   /protein_id="AAU39429.1"
FT                   /translation="MITIPIDRSKGAEYIYHQIYQRIKEEIFSRNLLPGKKLPSKRELA
FT                   ETLNVSINSVNAAYQQLLAEGYLYSRERKGFFVEQIETFHASRHPGPLQLEKELVEEPE
FT                   SKDGWISFSHMSVDTAHFPFKTWLRCEQKAVSSHVDELGEMTHPQGVYEVRQTIARFIA
FT                   LTRGVKCLPEQIVISAGTQSLIHTLQDLLPASAVYAMEEPGYSRIYRLLKNEGKEVATI
FT                   QLDHKGMRISEIHRLNPDVLFVTPSHQFPTGIIMPVSRRIQLLNWVSDGANRYIVEDDY
FT                   DSEFKYGSDTIPALQSLDRSEKVIYIGTFSKSLLPGLRISYMVLPQKLLKRYRKRHHFS
FT                   IQSSSVLTQLALQELIESGEYQKHIKKMNQIYEKKRTRLIGSLVKHFNGRVKIKGESAG
FT                   LHFVADFETDRSEEEVLLRAKERRVEVYGMSRFTLKKEQTKHEGTVSLVLGFAKIAADQ
FT                   IDEGTAKLYEAVCGDEKL"
FT   gene            476312..477625
FT                   /gene="gabT"
FT                   /locus_tag="BLi00474"
FT   CDS_pept        476312..477625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabT"
FT                   /locus_tag="BLi00474"
FT                   /product="bifunctional 4-aminobutyrate
FT                   aminotransferase/(S)-3-amino-2-methylpropionate
FT                   transaminase GabT"
FT                   /EC_number="2.6.1.19"
FT                   /EC_number="2.6.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00474"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39430"
FT                   /protein_id="AAU39430.1"
FT                   /translation="MSRNTKAFTTEDWQAKRDQFVARGVSNGNRHLAAKGEGAVLYDID
FT                   GRRFIDFAGAIGTLNVGHSHPKVVEAVKRQAEQLIHPGFNVMMYPAYLELAEKLCRLAP
FT                   GAHEKKAIFLNSGAEAVENAVKIARKYTKRQAVVSFTRGFHGRTNMTMSMTSKVKPYKF
FT                   GFGPFAPEVYQAPFPYYYRKPEGMTDESYDDMVIQAFDDFFVSSVAPETVACVVMEPVQ
FT                   GEGGFIIPSKRFVQHVAAFCQKHGIVFVADEIQTGFARTGKYFAIEHFDVVPDLVTVSK
FT                   SLAAGVPLSGVIGRAEMLDAADPGELGGTYAGSPLGCVAALAVLDIIESEQLNKRSEEI
FT                   GKAIEERALEWKMKYPQIGEVRRLGAMAAIEIVRDEKTREPDKAAAAKIAKYANEHGLL
FT                   LLTAGINGNIIRFLSPLVITDELLEEGFGIIEEALEQL"
FT   gene            477659..479050
FT                   /gene="yhdG"
FT                   /locus_tag="BLi00475"
FT   CDS_pept        477659..479050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhdG"
FT                   /locus_tag="BLi00475"
FT                   /product="putative amino acid permease YhdG"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00475"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39431"
FT                   /protein_id="AAU39431.1"
FT                   /translation="MGKQQMKKTMSQTDVLFLAIGAMLGWGWVVLSGDWISTAGFLGST
FT                   IAFIIGGILVILIGLTYAELSSAIPETGGGLIFVYRAFGRKTAFVAAWGVLFGYVSVIT
FT                   FEAVALPTVIDYVLPVEHQGFLWSLSGWDVYVTWVLIGSGGAVVLTALNYFGVKPAAIF
FT                   QSVFTIAIIATGFLLLGGALVNGDFEHVQPLFKDGFSGMMSVLVMIPFLFVGFDVIPQV
FT                   AAEINAPKKIIGKILIISIISAVVFYLLIVFGVTMGLSESELATTSLATADAMVNLLGN
FT                   QLFGTVLVLGGVAGIITSWNAFIIGASRILFAMSEKGMVPKWFGFIHPKYKTPTNAILF
FT                   LGALAFFAPLLGRPALVWIVNAGGTGIIVGYLIVSIAFMKLRKTEPDLHRPYKINKWKT
FT                   TGISAILLSVIFLAFYLPGMPAALTWPYEWLILAGWTLIGFLLYNSSSKRKGEEIQHDQ
FT                   HARSI"
FT   gene            479025..480419
FT                   /gene="gabD"
FT                   /locus_tag="BLi00476"
FT   CDS_pept        479025..480419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="BLi00476"
FT                   /product="succinate-semialdehyde dehydrogenase GabD"
FT                   /EC_number="1.2.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00476"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39432"
FT                   /protein_id="AAU39432.1"
FT                   /translation="MTSMLEVYNPATGEKIKSVPQQSAKEVEEAVVRSHEAFQKWSKTS
FT                   AAERAGLLKKWFDLIVEQKDELAKLITLENGKPYAEAQGEVLYSAGYIEWYAEEAKRIY
FT                   GRTVPASVTNKRIIVTRQGVGPVAAITPWNFPAAMITRKAGPALAAGCTFIIKPAPDTP
FT                   LTALELVRLGHEAGIPKDVLQCVIGDGQEIGSIFTSHPLIRKITFTGSTPVGKHLMKNS
FT                   AETVKHVSMELGGHAPLIVDEDANIDLAVKQTMLSKYRNAGQTCVCANRLIVHESVKDE
FT                   FAEKLRAEVAKLKVGNGLEEGVSIGPIINKNGFQKIVDQINDAVNKGAKVLIGAEYESD
FT                   DEKSCYFVHPTVLTDVDPSMTIMHEETFGPVAPITSFKTLDEAVKLANDTPYGLAAYFF
FT                   TENYRRGIYLSENLDYGILGWNDGGPSTVQAPFGGMKESGIGREGGLEGIEPYLETKYL
FT                   SIGLDE"
FT   gene            complement(480466..481350)
FT                   /gene="ywfM"
FT                   /locus_tag="BLi00477"
FT   CDS_pept        complement(480466..481350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ywfM"
FT                   /locus_tag="BLi00477"
FT                   /product="putative transporter YwfM"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00477"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39433"
FT                   /protein_id="AAU39433.1"
FT                   /translation="MKVSVLFVLLAAILWGTTGTTQAFAPKEAAPLVFGAVRMAVGGIT
FT                   LLLFAAFRGQLKRSGWPVKTLIIAALSMAFYQPFFFSAVSLSGIAVGTVVAIGSAPIIA
FT                   GCLEWLVFKKVPQTKWWIATAAAIAGVALLFIPSASSGGSFLGILLALGAGLSFAVYTL
FT                   TSKKLLQKQKPEAVTGTVFFLSAVLLAPLLFLYDLGWISSVQGMAVSLYIGVIATGAAY
FT                   LLFTTGLAKVPASTAVTLSLAEPLTASLLGTVLVRESLPLVSWAGIALLLLGIFYISYQ
FT                   PKKDKINAEQMKA"
FT   gene            481515..482006
FT                   /locus_tag="BLi00478"
FT   CDS_pept        481515..482006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00478"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39434"
FT                   /protein_id="AAU39434.1"
FT                   /translation="MKKRTVLFFLLIWLAGCASAQEAEEQTKWVNSEQKAIENGIRYES
FT                   ITKDDIIDKIDLNGEQVVVFRFGDSEGEGIGLAHIKRENGNYQWYRDLNYAIVKSDHPK
FT                   TENAEASAPFTTPKGRKYTLYTGDADRLNGTFETDDGLHLEPVVDQKTGMYYQIVQDSD
FT                   "
FT   gene            complement(482054..482698)
FT                   /gene="ycnI"
FT                   /locus_tag="BLi00479"
FT   CDS_pept        complement(482054..482698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnI"
FT                   /locus_tag="BLi00479"
FT                   /product="YcnI"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00479"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39435"
FT                   /protein_id="AAU39435.1"
FT                   /translation="MLKKTLWMGAILASFLLFSVPVSAHVTVKPTESAAGSWETYTVKV
FT                   PVEKDNATIKVVLSMPDGVEFQQYEPVPGWKTSTETGKNEKVTRVTWEAENGGIQPGEF
FT                   QQFTFTAKNPDKEQKAAWNAYQYYKDGTIVEWTGDDDADTPHAITSIVDAAKLGHETVD
FT                   AHGASTKQNAAAENEDSQGGQGIQTASLILSILAVLLGGAALLLTVRKKKS"
FT   gene            complement(482701..484347)
FT                   /gene="ycnJ"
FT                   /locus_tag="BLi00480"
FT   CDS_pept        complement(482701..484347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnJ"
FT                   /locus_tag="BLi00480"
FT                   /product="copper transport protein YcnJ"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00480"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39436"
FT                   /protein_id="AAU39436.1"
FT                   /translation="MNVMKRATLWAVLAVLCTILLPKAAFAHAYIVQSTPAENQELKKA
FT                   PEEIKIEFNEAIQNGFHSITVRNSSGERVDSGKTEIDPQNAKIMTVKLKPKLKDDIYSA
FT                   EWRAVSADGHPVSGTIPFSIGNIQGGLPKDQQNQASGLPAADIVIERVLLYTGFSLFMG
FT                   AALFQLVWHRPENGWPGDKKRRLKRITNVALLLTGAAIIIQLPLQTKTNAGVSWIGAFQ
FT                   PSLLKETLLNTTGGTLWLINIAIIALLVFSSNRKGLKSAILSLFLFAGLLFVKSLDGHA
FT                   ASTSAGYMTIAMNFIHLNAASIWTGGLAMFVLFFGKDWLKPDKSLIWETIRRFSPWALA
FT                   SAGLLIFSGLFNSFFIVHTLDNLFGTAYGKALLVKSALVLLMIGLGAFHYFRFRKAPKQ
FT                   QGGRSMKAEWAVGLLILLTTAVFTNIPSPPAPLPQPFSETKQLTEGNTLSLRISPNMPG
FT                   SNTFEVTVRNRKGDVVKDIQKIELTVEKTGLFGDDKESTFSLSKNKDGVFQTKNLNLSE
FT                   DGIWKIRVHGLTASFEEIRTVFNAKINKKEF"
FT   gene            complement(484367..484939)
FT                   /gene="ycnK"
FT                   /locus_tag="BLi00481"
FT   CDS_pept        complement(484367..484939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnK"
FT                   /locus_tag="BLi00481"
FT                   /product="HTH-type transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00481"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39437"
FT                   /protein_id="AAU39437.1"
FT                   /translation="MLPIKRREQILAWIKEEESLRISEISKRLNVSEMTVYRDIKPLVE
FT                   NGQVIKTAGGITLNKPKQQLGQLCVVCGKGAGSRLAVQIVKNDSQIEQFCCVHCAMLRY
FT                   EKVKDDVSQIICRDFLLDTTISAKAAVFLLDTDLHLNCCEPHALPFASEAEARKFKKGF
FT                   GGQLLSFDDAALLVQKTMKNSCCSLKT"
FT   gene            485200..487494
FT                   /gene="nasB"
FT                   /locus_tag="BLi00482"
FT   CDS_pept        485200..487494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasB"
FT                   /locus_tag="BLi00482"
FT                   /product="assimilatory nitrate reductase electron transfer
FT                   subunit NasB"
FT                   /EC_number="1.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00482"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39438"
FT                   /protein_id="AAU39438.1"
FT                   /translation="MGKQRLVLIGNGMAGVRTAEEISLHGGSRFEIVIIGSEPHPGYNR
FT                   ILLSSVLQGETDWNDVMTKSRSWYEENGITLYTGETAVAIDTVNQTVATDQNREIAYDK
FT                   LIIATGSSPFILPVHGADKEGVYGFRTIDDCRAFINASKRFKKAAVIGGGILGLEAARG
FT                   LANLGMKVDVVHHSSSIMQTQLDPPASAMLQKELERQGIHFLLEKDTEAILGTSRAEGV
FT                   RFKDGTKISADLVVMAAGVRPNIELAKASGISTNRAIIVSDYMETNVPNVYAVGECAEH
FT                   NGTVYGLVKPLYEQGKVLAKHICGLECSGYQGSVQSAALKMSGIDVFSAGKITEDDSTT
FT                   AIKLLDEAAGVYKKAVFQGDKMAGVILYGDTSGSQRLLESIIKQRDITVVKKELFQSEE
FT                   DSSVASMAVRETICQCNAVSKGMIMEAIQTHGLKTAEEVKRCTKASGSCGGCRPLVEEL
FT                   LLHTAEHDGHISAAEQPMCACTSFTEDEVVNEIQMRNLSSVHEVISALGWKNSSGCRIC
FT                   VPALHYYLKMIRPDIAYEEHEEETDAIIPQMYGGRTNAEELKRIAGVIEKYQIQEVYMT
FT                   HHQRLKLAGIKPEHIERVKEELGMPYCLPQQQRIAAVKTCPCGSPQIQTLAADLEKAAE
FT                   SLLIPAKVSIGVSGCLDDCVYASVHDIGLLKVNGGWEIYAGGQGGQHASPGELLSVADS
FT                   AEEAGELMKGLLQYYRETANYLEKIGHWIERAGIIHIREVLFDNGLRGQLFERLEKEKR
FT                   LAQQEMIKGLM"
FT   gene            487496..489655
FT                   /gene="nasC"
FT                   /locus_tag="BLi00483"
FT   CDS_pept        487496..489655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasC"
FT                   /locus_tag="BLi00483"
FT                   /product="assimilatory nitrate reductase catalytic subunit
FT                   NasC"
FT                   /EC_number="1.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00483"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39439"
FT                   /protein_id="AAU39439.1"
FT                   /translation="MTERLLKYFRTKQKEVQSEKTYDTQCPFCSMQCKMQLIEQTIVTR
FT                   KKYTAVGKDNPTTKGRLCMKGMNAHQHAFHSERITHPLIKKNGEFVRVSWEEALQYIKE
FT                   QVTAIQHEDGRDALSVYGSASITNEEAYLLGKFARVALKTKHIDYNGRLCMSAAATAAN
FT                   QTFGMDRGLTNALSEIPHARVIILAGTNIAECQPTIMPYFEEAKQNRAYIIVIDPRETA
FT                   TAKIADLHLKIKPGTDAALANGMLKIIIEEQLTDGAFIRDRAEGFEEVKRHVASLSLED
FT                   ISAKTGIQIEQIKKAAVKFAREETGMLFTARGVEQQTDGTAAVRNLLNILISTGKIGKY
FT                   ACGYGAVTGQGNGQGAREHGQKADQLPGYRSIENEADRAYIADVWGIKAEDLPGKGVSA
FT                   YEMMKKVHEGEITGMFLMCSNPVVSSPTAGFVKSALGKLKFFAAVDLFLSETAILADVV
FT                   LPASSYLEDEGTMTNLEGRVTLREASKPCPGEARHDWQIICDIAKALGKGRYFSYRSAE
FT                   DVFNELRKASRGGIADYSGITYERLRKEGGILWPCPEEGHPGTQRLFESSFSHPDKKAR
FT                   MCVVPNEPKVKKDVPTEEYPLILTTGRVMSHYLTGVQTRRSAALKARHFESFMEIHPKT
FT                   AEKYNIGDRVLVRVESKRGSIIVRSKWSEAIRPDTVFVPIHWADSQNVNDLIAETLDPS
FT                   CSMPGFKVCSVKIRPSVDNFVNKLS"
FT   gene            489769..492189
FT                   /gene="nasD"
FT                   /locus_tag="BLi00484"
FT   CDS_pept        489769..492189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasD"
FT                   /locus_tag="BLi00484"
FT                   /product="assimilatory nitrite reductase NasD"
FT                   /EC_number="1.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00484"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39440"
FT                   /protein_id="AAU39440.1"
FT                   /translation="MKKKQLVLVGNGMAGVRAIEEILKISNEEFQITIFGSEPHPNYNR
FT                   ILLSKVLQGDTDVKDITLNDWDWYEENGIQLYTGEEVVKVDPESKTVITDTGRVQPYDE
FT                   LILATGSLPFILPLPGADKEGVTAFRDIKDTDIMLEASKTYKKAAVIGGGLLGLEAARG
FT                   LLNLGMDVTVVHLAPYLMERQLDAAAGRLLQKELEKQGMKFLLEKQTEEIYGETRVEGL
FT                   KFKDGSTLEADLVVMAVGIKPNVQLGKDCGLPVNRGIVVNDYMETEVPNIYAVGECAEH
FT                   RGIAYGLVAPLYEQAKVLAKKICGVETAPYEGSVLSTQLKVSGVEVFSAGDFNEDDGED
FT                   KKALKVFDEQDGIYKKIVLRGNQVIGAVLFGDSSEGNRLFSMIQKGADISDTSKISILQ
FT                   PLNQEEGMSLTAAMSDDEIVCGCNGVSKGMIIQAIKEQGCTSTDEIKACTGASRSCGGC
FT                   KPLVAEILQHTLGSEFDASAQKEAICGCTDLSRDELVAEIREKGLTHTKEVMNVLGWKT
FT                   AEGCSKCRPALNYYLGMINPKEYEDERESRFVNERMHANIQKDGTYSVVPRMYGGVTNS
FT                   NDLRRIADVVDKYEIPLVKMTGGQRIDLIGVKKEDLPKVWADLDMPSGFAYGKTLRTVK
FT                   TCVGEQFCRFGTQDSMALGIDLEKKFEGLYTPHKIKMAVSACPRNCAESGIKDIGVVGI
FT                   DGGWEIYVGGNGGTHLRAGDLLMKVKTAEEVIEITGAYLQYYRETANYLERTSAWIERV
FT                   GLSHVQSVLNDKEKRKELNDRINQALSVHKDPWKDFLEDGKTTRQLFENVVTS"
FT   gene            492220..492540
FT                   /gene="nasE"
FT                   /locus_tag="BLi00485"
FT   CDS_pept        492220..492540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasE"
FT                   /locus_tag="BLi00485"
FT                   /product="assimilatory nitrite reductase small subunit
FT                   NasE"
FT                   /EC_number="1.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00485"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39441"
FT                   /protein_id="AAU39441.1"
FT                   /translation="MVNKNLTKVFVSKIGDLPNQLGKTVFIKDKEIAVFKLSNGSVRAI
FT                   ENRCPHKGGVLAEGMVSGEFVFCPMHDWKISLEDGKVQEPDTGCVQTYETVVEGEDLYI
FT                   VY"
FT   gene            492658..494118
FT                   /gene="nasF"
FT                   /locus_tag="BLi00486"
FT   CDS_pept        492658..494118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasF"
FT                   /locus_tag="BLi00486"
FT                   /product="uroporphyrinogen-III C-methyltransferase NasF"
FT                   /EC_number="2.1.1.107"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00486"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39442"
FT                   /protein_id="AAU39442.1"
FT                   /translation="MGNGKVYFVGAGPGDSGLITLKGRTLIEAADVILYDRLVNSRLLE
FT                   HAKASCEFVYCGKLPDRHYMRQSEINALLIEKGLKGLKVVRLKGGDPSVFGRVGEEAAA
FT                   VSEHGIPYEMVPGITSGIAAPLYAGLPVTHRDFASSFAVVTAHDKSGKPEMNWEGLAKG
FT                   VQTLVFYMGIKNLGYICEQLMKHGKSPLVPAMAIQWGTWGRQRSVKGTLQNIREKITEH
FT                   QIKNPAIIVIGDIVSFRQNSWFEEKPLIGLNIMAVKSCEEEQIPVEALREQGAEVVEWP
FT                   KWKSAETVPDDALLGRIACFDSLLFTSSASLRRFFSRLAALKIDVREMRGRLYASDQHV
FT                   KAALEERGFEAFLQTEMPVSGSCLLIGSREAVQNYPHSGCEVLITHDRVIDSRFTSIIK
FT                   REIDEFPIDIVLFSNRTCVELFVNEAETVGLHPEKTAARLQAFCLTEEAGERAAAVGFQ
FT                   RVHAVNDRDRLPDVIKEINRTAEFVCQS"
FT   gene            complement(494144..494824)
FT                   /gene="ydhC"
FT                   /locus_tag="BLi00487"
FT   CDS_pept        complement(494144..494824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydhC"
FT                   /locus_tag="BLi00487"
FT                   /product="putative HTH-type transcriptional regulator YdhC"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00487"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39443"
FT                   /protein_id="AAU39443.1"
FT                   /translation="MKFSIQRAVSYHDQVHHYLKDMIIKGGYQPGERIYESKIAKELQV
FT                   SRSPVREAIRTLEQEGLLLIDDKSKITVYEPTIKDLEEIYQCRQALESLAVSLATRLAS
FT                   NETLELISETLSEAHKHQKSQGPESANALLRLNTQFHDAIIEASENERLQKQLLDLRSL
FT                   TFFYRSKNLEKPERTLEIINQHEEILRHMQDRNDAKAAESMRKHIEADLCYLKEVLFRS
FT                   SAAR"
FT   gene            495054..496694
FT                   /gene="sdcS"
FT                   /locus_tag="BLi00488"
FT   CDS_pept        495054..496694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdcS"
FT                   /locus_tag="BLi00488"
FT                   /product="sodium-dependent dicarboxylate transporter SdcS"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00488"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39444"
FT                   /protein_id="AAU39444.1"
FT                   /translation="MKSSVVSAWDMLWRSHREAKRLLLFAMPVRAGKDAGLKINSEQTM
FT                   KEEKPPSYKTPQKIGLLLGPALFFAVLLFFFPEGLSYEGRMVLATTLWVAVWWITEAVP
FT                   IPAASLLPIVLLPLTGALEGAAVTSSYGDPIVFLFLGGFLIALAMERWNLHKRIALNII
FT                   SVVGTSTSRIVLGFMAATGFLSMWVSNTAAVMMMLPIGTAIIHQVSAVIKSERKDLAAE
FT                   EAKFSKALIFSIGYAGTIGGLGTLIGTPPNIILAANIKKLYGVEVSFGGWMAFAVPVVV
FT                   ILLVAVWLYLTKVAHPIKMKELPGGKELILEEKRKLGKMSFEETMVLLVFGFAAFMWVT
FT                   RTFLWDDKIPGIDDTMIAIFAASLLFLIPSLNKGGRVLDWSVSKDLPWGILLLFGGGLA
FT                   LATGFKETGLAEWIGGRLTVLDGFNFVVIVIISTALVLFLTEITSNTATATMILPVLAS
FT                   LALALNVHPYALMVPAAMAANCAFMLPVGTPPNAIIFASGKLKISEMVRTGFVINIFTL
FT                   ILIVGAVFYILPHLWGVDLTVFPDNLKSN"
FT   gene            496783..496968
FT                   /locus_tag="BLi00489"
FT   CDS_pept        496783..496968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00489"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39445"
FT                   /protein_id="AAU39445.1"
FT                   /translation="MKLLKKKMISMNNPVLPHRYPFLFIDCVVESEPGKWVKGYKFITE
FT                   NDWFITENQKEMPFSS"
FT   gene            497004..497225
FT                   /locus_tag="BLi00490"
FT   CDS_pept        497004..497225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00490"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39446"
FT                   /protein_id="AAU39446.1"
FT                   /translation="MKEPAEIGFLSSVKKAECTGKAVVGDKLDLYFEVSRYKRGFLFGK
FT                   GTASVNGKPAVKAEIGIFMEQSESGGED"
FT   gene            497222..497689
FT                   /locus_tag="BLi00491"
FT   CDS_pept        497222..497689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00491"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39447"
FT                   /protein_id="AAU39447.1"
FT                   /translation="MIEIKPVAFVENLRTFPKDDHWGDVISEIKLAEGIHPDALKGIEE
FT                   FSHLDIIFYFHQVKEEHIQYKARRPRNNKNYPETGIFAQRGKNRPNRLGATVVTLLEKS
FT                   GSKLVVKGLDAIDGTPVIDIKPVMKEFLPKGQIIQPKWSEDLMKVYWHAAD"
FT   gene            497855..499906
FT                   /locus_tag="BLi00492"
FT   CDS_pept        497855..499906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00492"
FT                   /product="putative HTH-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00492"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39448"
FT                   /protein_id="AAU39448.1"
FT                   /translation="MINEKRPAQLLQYLLRVREATMHQLIDHFQLSKRQICYDLDKINH
FT                   WLTGKQLPEIEYKRKNRLAVPETLLELRFSEACSDIGRSFIFTQEERIKALYMFLFVRR
FT                   EPISSAHLTQLLQVSKNTVMNDVKKANEALTPFLVAIKYTRQRGYHLIGSEFDKRVPVM
FT                   HHLSSFLQKPYGKEILHYILKISGSRDHKQQEFKRAVELVSKEYGLQLVEERLNEFIYF
FT                   LMMYSIRVAEGKIVRFHQEEGELLKQSPLKNAAVRLVNELRIPVHETELCYILIQLLGL
FT                   SFGQQPAHDPLYQLCEKLVFEFESRACITFPRRREVAESLYRHLKPAYFRMKYRIPIHN
FT                   PLLSKIKKEHKELFTIVQKLMRHLEALLNKPVPEEEIGFITIHFGALLEQPVQSGSSKK
FT                   TAVVVCPSGVSSSLMVRRQLESLFSEIVVEKAMSLQEFTPDVFDHYDAVFSTVELKTKK
FT                   RYYMVRPLMTPAEKSRLVNEVYQEMFGVKQRELLTDEFLHILKKHASIIDEKGLRESLK
FT                   NIAFVQKVTETRGKRPVLKDLLTDETIQMADQIKGWEEAIQTAAKPLLDKEVILKEYTD
FT                   AMIDNVKTMGPYMIIGPEIAIPHARPEKGVQKVGMSLLKLKEPVYFLDDEQYPVRLLFC
FT                   IAAVDHTTHLKALSQLTRLLSNKENQDSLKETESLEHIKRLIEAYSSN"
FT   gene            499923..500204
FT                   /locus_tag="BLi00493"
FT   CDS_pept        499923..500204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00493"
FT                   /product="putative ascorbate-specific phosphotransferase
FT                   system EIIB component"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00493"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39449"
FT                   /protein_id="AAU39449.1"
FT                   /translation="MKILAVCGSGLGSSFMLEMNIKDILQEMGLMEIEVDHSDLSSASP
FT                   DQADLFIVAKDIAEGAAHLRDIVVLESIIDMDELKTKLVKTLQEKGVL"
FT   gene            500228..501601
FT                   /gene="ulaA"
FT                   /locus_tag="BLi00494"
FT   CDS_pept        500228..501601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ulaA"
FT                   /locus_tag="BLi00494"
FT                   /product="ascorbate-specific phosphotransferase system EIIC
FT                   component UlaA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00494"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39450"
FT                   /protein_id="AAU39450.1"
FT                   /translation="MGERALKLMMDVLSQPAVLIAAISLIGLLLQKKPANEIVKGTTKS
FT                   FLGFIVISAGAGILVGSLEPFGKMFQAAFHVNGVVPNNEAIVAMALNEYGTATALIMFF
FT                   GMLSNILIARFTRLKYIFLTGHHTLYMACLIAVILAVAGLKGPFLIGVGAVSLGLTMSL
FT                   FPAMVQPFMKKITGNDKVAFGHFSSIGYAVSGLIGKAAGKGSRSTEKIRFPNGLGFLRD
FT                   SSVSIALTMTILYVLIALFAGAGYVERELSGGTHYLVFSVIQAVTFAAGVFIILSGVRL
FT                   VLAEIVPAFKGISDKLVPDSKPALDCPIIFPYAPNAVLIGFFCSFIGGITGMLILGAAG
FT                   AVIVLPGVVPHFFTGASAGVFGNAAGGIRGAVLGSFVNGLIITFFPVFLLPVMGDLGFA
FT                   NTTFSDTDFAATGIVLGHAVKLLGSGGVVIGIAAVVVGAVLFGFKRGKAEKPDQKVEA"
FT   gene            501613..502458
FT                   /locus_tag="BLi00495"
FT   CDS_pept        501613..502458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00495"
FT                   /product="transketolase subunit A"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00495"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39451"
FT                   /protein_id="AAU39451.1"
FT                   /translation="MMSVREIDMERFRDQIRLLTLKQLHHLGFGHYGGSLSIADVLAVL
FT                   YGKVMKIDPANPSWEDRDFFILSKGHGGPALYAALHLSGYFEEDVLYTLNQNGTALPSH
FT                   PDRNLTPGVDMTTGSLGQGISAAAGVALSHKLSGRANRTFVIVGDGELNEGQCWEAIQF
FT                   AAHHKLRNLYVFVDDNKQQLDGPTKEIIDPLDFVSKFRAFGFYSERVNGHEPEAIYRAV
FT                   KRGEAQRERPVAVILDTVKGKGIPYFEKMENSHHIRANEEQNRMIERIILTLEEKEVRA
FT                   "
FT   gene            502455..503405
FT                   /locus_tag="BLi00496"
FT   CDS_pept        502455..503405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00496"
FT                   /product="transketolase subunit B"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00496"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39452"
FT                   /protein_id="AAU39452.1"
FT                   /translation="MNEAANVELDAVEMRQAYSSAVYELAQENTDIVALEADLMSSISM
FT                   DKVKRRIPEQVINCGVMEANMIGIAAGLSLTGRIPFVHTFAQFATRRCFDQLFVSGAYA
FT                   KTNIKILGSDSGITAEHNGGTHMAFEDLGLARLIPNAFVYEASDAAMLKFLIKKAAAEY
FT                   GIHYIRTIRKKAVRLYDEHETFADGKAKVLKDGSDAALFASGIMVAEALQAAELLKEKG
FT                   IDAAVIDMYCIKPIDQETVVRYAQKTNAIVTAENHNVIGGLGSAVAEVLSEHYPAPLKR
FT                   IGVHEAFGQVGTIDYLKKSYRLTAEHIALAAEQLV"
FT   gene            503480..504235
FT                   /gene="ycsE"
FT                   /locus_tag="BLi00497"
FT   CDS_pept        503480..504235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycsE"
FT                   /locus_tag="BLi00497"
FT                   /product="HAD superfamily hydrolase YcsE"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00497"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39453"
FT                   /protein_id="AAU39453.1"
FT                   /translation="MSVSQRNRIDVKLVALDMDGTLLNDEQTISDENRKAIKEAEEKGV
FT                   YVVLSTGRTLMTCRELAESLELSSFLITANGSEIWDSSFNLVERQLLHPDHVQMMWDLR
FT                   NLHNTDFWAASVDKVWRGEFPEDIQAYEWLKFGFDIPDDDVRNRVLEELKKNKELEVTN
FT                   SSPTNIEVNAIGINKAAALAKVCERLGFTMEHVMAVGDSLNDIAMIKEAGLGVAMGNAQ
FT                   EIVKETADWITDSNIEHGVAKAIRHWVLS"
FT   gene            504522..505283
FT                   /gene="ycsF"
FT                   /locus_tag="BLi00498"
FT   CDS_pept        504522..505283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycsF"
FT                   /locus_tag="BLi00498"
FT                   /product="putative glycoside hydrolase/deacetylase YcsF"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00498"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39454"
FT                   /db_xref="GOA:Q65NB0"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65NB0"
FT                   /protein_id="AAU39454.1"
FT                   /translation="MNQVDLNCDLGESFGAYKIGLDEEILEFVTSANIACGFHAGDPGV
FT                   MRKTVKMAAEKGVKIGAHPGLPDLAGFGRRNMAITPEEAYDLVVYQIGALSGFLKAEGV
FT                   TMQHVKPHGALYNMAAQSRELSDAIARAVYQTDPELILFGLAGSELVLAGERAGLKTAH
FT                   EVFADRTYQEDGTLTSRRQNDALIQDDDEAVGQVIRMVKEGKVRSLQGTDVSLKADTVC
FT                   IHGDGAHALHFAKKIRRELRAADIKVQAFST"
FT   gene            505308..506519
FT                   /gene="ycsG"
FT                   /locus_tag="BLi00499"
FT   CDS_pept        505308..506519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycsG"
FT                   /locus_tag="BLi00499"
FT                   /product="putative membrane protein YcsG"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00499"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39455"
FT                   /protein_id="AAU39455.1"
FT                   /translation="MKQNKKTKAPAGNWTLLLGAAFLMATSAIGPGFLTQTTVFTQSLA
FT                   ASFGFVILVSIILDIFAQTNVWRIIAVSEKRGQEIANLVLPGLGYFIAFLVVLGGLAFN
FT                   IGNIGGAGLGMQVLFGISPQMGAIISAVIAILIFVIKEAGKAMDRFTLIAGFVMILLTV
FT                   YVAVTTGPPVGEAITKTVMPDNIDYLAIITLVGGTVGGYITFAGGHRLLDAGVKGKDAI
FT                   PEVTKSSVSGILITSVMRIALFLAVLGVVSKGMQINPDNPPASVFQHAAGNVGYKIFGL
FT                   VMWSAAITSVIGAAYTSVSFFKTFSPKIEKNSRGIIIVFIIVSTLCFVTIGKPVNLLVL
FT                   AGALNGLILPIALGSLLIGAHKKNVIGDYRHPIWLTIPGILVVIVMAIMGGYTLINEIP
FT                   KLWG"
FT   gene            506525..507313
FT                   /gene="ycsI"
FT                   /locus_tag="BLi00500"
FT   CDS_pept        506525..507313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycsI"
FT                   /locus_tag="BLi00500"
FT                   /product="UPF0317 family protein YcsI"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00500"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39456"
FT                   /db_xref="GOA:Q65NA8"
FT                   /db_xref="InterPro:IPR009906"
FT                   /db_xref="InterPro:IPR016938"
FT                   /db_xref="InterPro:IPR038021"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65NA8"
FT                   /protein_id="AAU39456.1"
FT                   /translation="MHVNEMRPDEVRALIRKGEITGPTAGMAGGFTQANLVILKKELAF
FT                   EFLLFCQRNQKPCPILDVTDPGSPVPSITAPDADIRTDFPKYRVYKRGELADEVTDISS
FT                   LWEDDMVGFLIGCSFTFEQALMNNGIPVRHIEEKRNVPMYQTNIPCVPAGRFQGPMVVS
FT                   MRPVPEEQAVRAVQVTSRLPAVHGGPVHIGSPEAIGITDIAKPDFGDAVTIKKGEVPVF
FT                   WACGVTPQAVAMHARPELMITHSPGHMLVTDVRDEQFGVL"
FT   gene            507391..508125
FT                   /gene="kipI"
FT                   /locus_tag="BLi00501"
FT   CDS_pept        507391..508125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kipI"
FT                   /locus_tag="BLi00501"
FT                   /product="KinA inhibitor KipI"
FT                   /note="control of the phosphorelay"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00501"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39457"
FT                   /protein_id="AAU39457.1"
FT                   /translation="MKNLSNATMSPLGDSAVIIQLGEGISEQTHRVVSALTKRIENDPF
FT                   PGFIECVPAFTSVTVFYQPFEVYRKMESGKAVDSPYEKVKALLDHHLQELTMEEETDQR
FT                   TVEIPVCYGGRFGPDLEEVADINGLTAQEVIDIHTSGEYLVYMIGFAPGFPYLGGMSEK
FT                   IAAPRRSSPRTSIPAGSVGIAGMQTGVYPLSTPGGWQLIGNTPLELFKPYEQPPSLLRA
FT                   GDIVKFVSVTEEEYHALKEGKS"
FT   gene            508122..509135
FT                   /gene="kipA"
FT                   /locus_tag="BLi00502"
FT   CDS_pept        508122..509135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kipA"
FT                   /locus_tag="BLi00502"
FT                   /product="KipI antagonist KipA"
FT                   /note="control of the phosphorelay"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00502"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39458"
FT                   /protein_id="AAU39458.1"
FT                   /translation="MSIEVLKPGLMTTVQDLGRTGFQKYGVLVSGAMDADSLRIANLLA
FT                   GNSQNEAALEVTLMGPGPSLRFQKPALIAVTGADFSLMVNDEEVPLWRPVFIKEGSVLT
FT                   FGMCKRGSRAYMAVAGGIDVPPVMESKSTYVRAGLGGFQGRALQKGDVLSLGSPTPLSE
FT                   ALHRKLADEGKERGFAAPKWAVDRKYFLPLKKNPVIRVIKGDQFACFTSSSQERFFAGP
FT                   FRVTAKSDRMGYRLQGEALELTQPLEMISEAVSFGTIQVPPDGNPIVLLADRQTAGGYP
FT                   RIAHIASADFSQVTQMMPGEQVQFQLVSLQEAERVYIERETKISELSARLKLEYML"
FT   gene            509146..509916
FT                   /gene="kipR"
FT                   /locus_tag="BLi00503"
FT   CDS_pept        509146..509916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kipR"
FT                   /locus_tag="BLi00503"
FT                   /product="transcriptional repressor"
FT                   /note="of the kip operon"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00503"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39459"
FT                   /protein_id="AAU39459.1"
FT                   /translation="MYQEGEGMEHKNKTVVKAMTLLNLFLTRERLSLGDMIELTGMPKT
FT                   SVYRMVCSLEEMGFLDRDENGMYSLGLLFLQYGHLVSERLDIRKIALPIMEELRDDVDE
FT                   AVHLIVRQGNEAMYIEKIEGTQTVRLYTAIGRRSPLYAGACARSILTFLPEEERDAYIE
FT                   QTELVPIASGTIRDKAELIRIVDESYRSGCTVSHSELEDYTSAIAAPIFNHKREVAAGI
FT                   SIAGFEARFQKDRLPYLTERVKKAALDISRKLGF"
FT   gene            510005..510643
FT                   /gene="lipC"
FT                   /locus_tag="BLi00504"
FT   CDS_pept        510005..510643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipC"
FT                   /locus_tag="BLi00504"
FT                   /product="spore germination lipase LipC"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00504"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39460"
FT                   /db_xref="GOA:Q65NA4"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65NA4"
FT                   /protein_id="AAU39460.1"
FT                   /translation="MTLQYTALGDSLTVGVGAGLFEPGFVQRYKRKMEEDLNEEVSLIV
FT                   FAKSGLETSEILAMLNEPFIMEQVKKADVITITGCGNDLLQSLEIYEKEKDEHVFLEAS
FT                   SHCQKNYSGMLEKIREIKGEKDTRYLVRLLNLYNPFPSIELADKWISGFNRHLKQLESA
FT                   PQIKVIDTYAVFKGREKEYLSIDRVHPSSRGYEAMSEKLRAAGYGRLEG"
FT   gene            510888..512312
FT                   /gene="mtlA"
FT                   /locus_tag="BLi00505"
FT   CDS_pept        510888..512312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlA"
FT                   /locus_tag="BLi00505"
FT                   /product="trigger enzyme mannitol-specific
FT                   phosphotransferase system EIICB component MtlA"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00505"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39461"
FT                   /protein_id="AAU39461.1"
FT                   /translation="MEDRQNQDFKVKIQRFGSYLSGMIMPNIGAFIAWGIITALFIPTG
FT                   WMPNEALASLVDPMIKFLLPLLIGYTGGKMVYDHRGGVVGATAAIGVIVGADIPMFLGA
FT                   MIMGPLGGYLMKLTDRLFKDKVRSGFEMLINNFTAGILGFILAVLGFLAIGPVVLGLNK
FT                   TLAAGVEVIVNANLLPLASIFVEPAKVLFLNNAINHGILSPIGIEQAAQTGKSILFLLE
FT                   ANPGPGLGILLAYMIFGRGTSKQTAPGAAVIHFLGGIHEIYFPYILMKPLLILAAIAGG
FT                   ASGVLTFSIFNAGLAAVPSPGSIIAVLAMTPKGNHIGVILGVLVAAVVSFIVASLILKT
FT                   SKAGEEDLTAAAEKMQQMKGKKSQAVSALTSADEAEESAAPYENVSKIIFACDAGMGSS
FT                   AMGASILKNKVKKAELDIDVSNTSINNLPEDADIVITHKDLTERAKAKLPSARHISVEN
FT                   FLNSPKYDELINQLKK"
FT   gene            512379..512819
FT                   /gene="mtlF"
FT                   /locus_tag="BLi00506"
FT   CDS_pept        512379..512819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlF"
FT                   /locus_tag="BLi00506"
FT                   /product="mannitol-specific phosphotransferase system EIIA
FT                   component MtlF"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00506"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39462"
FT                   /protein_id="AAU39462.1"
FT                   /translation="MKPVLAKENIHLNQSAATQEEAIRLAGKALVDAGYVTADYIEKML
FT                   EREGLTSTYMGNAIAIPHGTEDSKQDVLHSGISVIQLPEGVEYGDGNIAKVIFGIAGKN
FT                   DEHLEILSKIAIVCSEADNVERIINAKNEDELMAVFEEGDQV"
FT   gene            512816..513955
FT                   /gene="mtlD"
FT                   /locus_tag="BLi00507"
FT   CDS_pept        512816..513955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlD"
FT                   /locus_tag="BLi00507"
FT                   /product="mannitol-1-phosphate 5-dehydrogenase MtlD"
FT                   /EC_number="1.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00507"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39463"
FT                   /db_xref="GOA:Q65NA1"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65NA1"
FT                   /protein_id="AAU39463.1"
FT                   /translation="MIALHFGAGNIGRGFIGALLCKSGYDVVFADVNDAVINELNDKGR
FT                   YTVEMADAGRKQETIGPVRAINSATQLDELYDLIAKADLVTTAVGPAVLKLIAEPIAEG
FT                   LKRRMKINKQPLNIIACENMIGGSAHLREEIFARLTETERAAISDSVGFPNSAVDRIVP
FT                   IQHHDDPLKVTVEPFFEWAVDQTEFAGKVPDIEGVTYVADLAPFIERKLFTVNTGHAMA
FT                   AYAGYKKGLKTIKDAIHHPEVRQTVAGALEETGRYLVQTYDFTQEEHRAYMTKIIGRFE
FT                   NECLSDDVTRVARSPLRKLGRDDRLVGPARKLCDLGFEPVRLAEGIALALQFDCADDPE
FT                   AVQLQSMIAEKGYAGVLRDVCGLEEDHSLFKLVISHLKA"
FT   gene            514236..516314
FT                   /gene="mtlR"
FT                   /locus_tag="BLi00508"
FT   CDS_pept        514236..516314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlR"
FT                   /locus_tag="BLi00508"
FT                   /product="transcriptional activator MtlR"
FT                   /EC_number="2.7.1.-"
FT                   /note="of the mtlA-mtlF-mtlD operon"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00508"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39464"
FT                   /protein_id="AAU39464.1"
FT                   /translation="MYMTAREQKLMKYLLHQNRYVKVNEIAGYIEVSTRTVHRELKAVK
FT                   SVLDKYRLQLDKQPGKGLKLVGAYRDKQRLLEDLSRDSHVEYSADERKLLILCAMLETG
FT                   EPIKLYTIAHDLQVTAATISNDLDELEKWIAPFGLSLIRKRGYGIELRGPEDAKRKIVG
FT                   NLMADKLDVQQFLETIEMNIKGKNEAPEKIFGVVSRGKLLKAEKVLFQMKEKYGLSLSD
FT                   SAYIALVVHLTFAIERIQLGEMINMNEEELTDLKRTKEFELALALAKALEDAFHVKIPE
FT                   AEAGYITMHLRSANKSFKIDYRAEDIELDTALRTKKLIDFISQKTGMNLTGNHSLYEGL
FT                   IAHLEPAIIRIKEKMSVHNPLTEQVKKDYFLLYMAIEEGVEIFFPEIRFPDEEIAFIVL
FT                   HFGSALEMSKQKVDINALVICSSGIGSSKMLASRLKKELPEIASFEISSLMELKTKNTD
FT                   AFDIIVSTVPIPYENIDCVTVSPLLDTEDVKQIKHQLTRKIPLILRKKRMAPKKPEPFP
FT                   DMLQIARKIGHYAAGIQHILSHFTVETMEAESSLEHTVKRICGTLEDQGLVKDAGQMAD
FT                   GLMKREAQGGLGIPGTTFALFHLKSEAAAVPLFKAYDLSKPFEIKGMDGSAMKMMRMLI
FT                   MLAPADLSPEGSEILSFISSSMIESDESIKAYQTGDREQLYGMLNVLFHRFIQDKEW"
FT   gene            516427..517296
FT                   /gene="ydaD"
FT                   /locus_tag="BLi00509"
FT   CDS_pept        516427..517296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaD"
FT                   /locus_tag="BLi00509"
FT                   /product="putative dehydrogenase/reductase YdaD"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00509"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39465"
FT                   /protein_id="AAU39465.1"
FT                   /translation="MDLRNQQTNGQPAQTQDRQPGIESVMNPRPIYEDENYKGTDKLKG
FT                   KVALITGGDSGIGRAVAVAYAKEGADISIVYLNEHEDAQETKARVEKEGVKCLLLPGDV
FT                   RDEAFCNDAVEQTVKELGRLDILVNNAAEQHPKDSIKEISSEQLEKTFKTNFFSYFYFT
FT                   KKAIDYLEPGSAIINTTSINPYRGNPQLIDYTATKGAINAFTRSMSQALVKDGIRVNAV
FT                   APGPIWTPLIPSTFSGEEVAKFGTDTPMGRPGQPVDHVGCYVLLASDDSSYMTGQTLHV
FT                   NGGDFITT"
FT   gene            517312..517815
FT                   /gene="ydaE"
FT                   /locus_tag="BLi00510"
FT   CDS_pept        517312..517815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaE"
FT                   /locus_tag="BLi00510"
FT                   /product="lyxose isomerase YdaE"
FT                   /EC_number="5.3.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00510"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39466"
FT                   /protein_id="AAU39466.1"
FT                   /translation="MKVTKEDVIEYYEKAGIVLNDDDKENIQIMDYGLNKLDKLGLQLF
FT                   VYVNTDRYCAKELVLFPEQTCPEHRHPPVDKQKGKEETFRCRYGKVYLYVEGEKTEAPA
FT                   VMPPDEDIEHFTVWHEIQLTPGEQFTIPPDTKHWFKAGSEGAVVTEFSSTSTDDHDVFT
FT                   DPRI"
FT   gene            complement(517832..518215)
FT                   /locus_tag="BLi00511"
FT   CDS_pept        complement(517832..518215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00511"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39467"
FT                   /protein_id="AAU39467.1"
FT                   /translation="MNIFISFDAEADMGYIALTERRAGSVSATDDIGDTALSADFDRHQ
FT                   RIIGVEFPGDEAPEIARLGTLTGRKYKLEPAYLNGTHVRRFRPTAQEAVKTLCVNGVQF
FT                   YFADHDGRHFIGFDVMERAKKSE"
FT   gene            518301..518723
FT                   /gene="ydaG"
FT                   /locus_tag="BLi00512"
FT   CDS_pept        518301..518723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaG"
FT                   /locus_tag="BLi00512"
FT                   /product="putative general stress protein YdaG"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00512"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39468"
FT                   /protein_id="AAU39468.1"
FT                   /translation="MDQQQLKNKVLDILDHHKIGSLATVESGKPHSRYMTFFHDGLTLY
FT                   TPTSDETHKAEEIDNNPNVHVLLGYNGEGLGDAYLEITGTAKLNHSKDLKDKIWDERLE
FT                   QWFDGKDDPNLTVLEIEPSEIRLMNEGESTPVTLDM"
FT   gene            519176..519985
FT                   /gene="ydaH"
FT                   /locus_tag="BLi00513"
FT   CDS_pept        519176..519985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaH"
FT                   /locus_tag="BLi00513"
FT                   /product="putative transmembrane protein YdaH"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00513"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39469"
FT                   /protein_id="AAU39469.1"
FT                   /translation="MDFLTSKVLLIFCFLLLIHSIETLAYAARLSGARVGFIASALSLF
FT                   NVMVIVSRMSNMVQQPVTGKLVDVAGADALSLVGSQFRFLIFGSTVGTIFGMLLLPTFV
FT                   AVFSRAIVHLAGENGSVLQVFRKAFSKNSFKHAKHYAKRPSLEYVKDFRFRYIPKRLFV
FT                   LNMVITAIYTIGVLAALYAGVLVPERHTTAVMASGLVNGVATMLLALFVDPKVSVLADD
FT                   VAKGKRSYTYLKWASITMAASRVAGTIFAQVLFIPASYYIAWMTKWM"
FT   gene            520150..521091
FT                   /locus_tag="BLi00514"
FT   CDS_pept        520150..521091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00514"
FT                   /product="putative extracellular protein"
FT                   /note="membrane associated"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00514"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39470"
FT                   /protein_id="AAU39470.1"
FT                   /translation="MERVRVRVRKPKRKRRKIIKRLFTLTLLVIIAAAGYTYFEYKKGL
FT                   SESDGDFKEDGQFEFNGEGSDLDEVNILVLGIDSRGEDHSRSDSMMVIHYNKKQKQPKL
FT                   ISIMRDSYVDIPGYDKQKVNAAYAYGGPELVRKTLKESFDLDINYYAVIDFKGFAKIVD
FT                   AVAPDGIEVDVPKKMSYGIGMTLQPGKQVLHGERLLGYVRFRHDRESDFGRVRRQQEVF
FT                   SKLQKEAVSIGNIAQLPKLWGLVDPYIETNIPNGVILSVGKDFLLGSVKETKSFRLPVD
FT                   GSFTNKDDPKYGAVLDLDLEQNKEELKRFLNE"
FT   gene            complement(521123..521416)
FT                   /gene="ydzA"
FT                   /locus_tag="BLi00515"
FT   CDS_pept        complement(521123..521416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydzA"
FT                   /locus_tag="BLi00515"
FT                   /product="putative membrane protein YdzA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00515"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39471"
FT                   /protein_id="AAU39471.1"
FT                   /translation="MLQTPIGRLRLMGFIEGMSLLILLFIAMPLKYWADYPMAVTIVGS
FT                   VHGGLFILYLFVLLYATFVLRWSVKWPAAGLVAAFVPFGNFLYDRGLKKYDQ"
FT   gene            complement(521500..521910)
FT                   /locus_tag="BLi00516"
FT   CDS_pept        complement(521500..521910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00516"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39472"
FT                   /protein_id="AAU39472.1"
FT                   /translation="MTRINFSDRGETPFQRLLGHSESLMSSWTALAEELSGDGFLSKEL
FT                   KEQVRRVLAQGNGCEYCKAKGKPEIPNQQKTSFAMGFAEVFLAQRERVSDRQFDVLKEV
FT                   FSEEEITELTAFICFTTAQQYFGALMKLPADA"
FT   gene            522028..522456
FT                   /gene="lrpC"
FT                   /locus_tag="BLi00517"
FT   CDS_pept        522028..522456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrpC"
FT                   /locus_tag="BLi00517"
FT                   /product="DNA-binding protein LrpC"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00517"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39473"
FT                   /protein_id="AAU39473.1"
FT                   /translation="MKIDDLDFKIIAELKKDSRLSMRELGRKISLSAPSVTERVRRLES
FT                   FGVIKKYTLDIDYQKVGLPVSCIIEATVKNGEYERFKAYIERLPNIEFCYRIAGAACYM
FT                   LKINAESLAKIEAFINETSPYAQTVTHVIFSEIETKES"
FT   gene            522521..524713
FT                   /gene="topB"
FT                   /locus_tag="BLi00518"
FT   CDS_pept        522521..524713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topB"
FT                   /locus_tag="BLi00518"
FT                   /product="DNA topoisomerase III"
FT                   /EC_number="5.99.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00518"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39474"
FT                   /db_xref="GOA:Q65N90"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65N90"
FT                   /protein_id="AAU39474.1"
FT                   /translation="MMDVSKTVVLAEKPSVGRDLARVLKCHKKGNGYLEGDRYIVTWAL
FT                   GHLVTLADPEGYGKEYQSWRLEDLPIIPEPLKLVVIKKTGKQFQAVKSQLIRKDVKDIV
FT                   IATDAGREGELVARWIIEKAKVTKPLKRLWISSVTDKAIKDGFKNLKNGKDFENLYHSA
FT                   VARAEADWIVGINATRALTTKFNAQLSCGRVQTPTLAMIAKREEDIKNFKPVPYFGLRA
FT                   AVDGMTLTWQDKKTSQTRTFNASVTSQLAGALQGKPAVIVDLKKTAKKSFAPGLYDLTE
FT                   LQRDAHKRFGFSAKETLSVLQKLYEQHKLVTYPRTDSRFLSNDIVPTLKDRLEGMQVKP
FT                   YAQHVARILKRGVKANKSFVNDAKVSDHHAIIPTEEPLALGALSEKERKLYDLIAKRFL
FT                   AVLMPPFEYEETKVFAEIGGETFTAKGKTVQSQGWKAVYDFADEDDDEEEKDQTLPKLA
FT                   KGDTLSVRSLTETKGETKPPARFNEGTLLSAMENPAAFMQGEEKNLVKTLGETGGLGTV
FT                   ATRADIIEKLFNTFLIEKKGKDIYITSKGKQLLELVPSDLKSPALTAEWEQKLSGIAKG
FT                   KLKSSAFIKEMKEYAKQTIREIKSSNQKFKHDNITGTHCPDCGKLMLKVNGKRGTMLVC
FT                   QDRECGHRKTVAKQTNARCPVCHKRMELRGHGEGQTFACVCGHREKLSVFEKRRAKDKN
FT                   SKASKRDVHSYMKKQNKDEPINNALAEQLKKLKLDQ"
FT   gene            525398..527221
FT                   /gene="ydaO"
FT                   /locus_tag="BLi00519"
FT   CDS_pept        525398..527221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaO"
FT                   /locus_tag="BLi00519"
FT                   /product="putative amino acid permease YdaO"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00519"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39475"
FT                   /protein_id="AAU39475.1"
FT                   /translation="MMYSAIKRFLIGKPLKSKELREQKITKTKALALLSSDALSSVAYG
FT                   TEQILIVLAAVSSAALWYSLPIAAGVMILLTALILSYRQIIFSYPHGGGAYVVSRENLG
FT                   VNPGLVAGGSLLVDYILTVAVSVSAGTDAITSAVPMLHPYHLLIAIVLVLLIMVLNLRG
FT                   LTESASILAYPVYLFVAALLILIAAGSYKLLTGQIEPAEHAAVGTPVAGLSLFLLLKAF
FT                   SSGCSALTGVEAISNAIPAFKDPAPKNAANTLAMMGILLAVLFSGITMLAFGYGITPKS
FT                   EETVVSQIASETFGRSFLYFFIQGTTSMILVLAANTGFSAFPQLAFNLARDKYMPRMFT
FT                   VRGDRLGYSNGIIFLGIASIVLIVLFNGQTEHLIPLYAVGVFIPFTLSQTGMCLKWMRE
FT                   KPDGWIAKMIINAAGAAISAVVLLILFITKFALVWPIVIFMPIVIWAFYVVKKHYTAVS
FT                   EQLRITGKPLEPIKGNIVIVPVAGVTSVVEKSVQYAKTLSDQVIAVHVSFDKEEEKKIE
FT                   KKWEALQNGVRLVTLYSSYRSLIHPLEKFLETVEAKAASYNYSVMVLVPQFIPKKSWHN
FT                   ILHNQSALLLRLRLLWKKDIVVATLPYHFKK"
FT   gene            527329..529050
FT                   /gene="ydaP"
FT                   /locus_tag="BLi00520"
FT   CDS_pept        527329..529050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaP"
FT                   /locus_tag="BLi00520"
FT                   /product="putative thiamine pyrophosphate-containing
FT                   protein YdaP"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00520"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39476"
FT                   /protein_id="AAU39476.1"
FT                   /translation="MANKTAGKIAAELLKEWNIDHVYGMPGDSVNEFIDELRHEENSLR
FT                   FIQVRHEETAALAAAADAKLTGKIGVCLSIAGPGAVHLLNGLYDAKADGAPVLAITGQV
FT                   SSDEIGRDYFQEIGLERMFEDVALFNQQVHSAEALPDLLNQAIRTAYSQKGAAVLSVSD
FT                   DLFAEKIKRKPVYTSALYIEGDLEPKKSQLMQCAQLINQAKKPVILAGRGMKSARDELL
FT                   EFADKAAAPIIVTLPAKGVVPDRHPHMLGNLGHIGTKPAYEAMEESDLLIMLGTSFPYR
FT                   DYLPEDAPAIQLDNNPAKIGKRYPVTAGLVCDAKKGLFELTKTIERKSNRAFLESCIQH
FT                   MRKWRYEVEKDEQVATEPLKPQQVIARLEDAVADDAVLSVDVGNVTVWTARHFNMTNQD
FT                   FLISSWLGTMGCGLPGAISAKLSHPERQVVAVCGDGGFSMSMHDFPTAVKYELPIVVVI
FT                   LNNQNLGMIQYEQQEKGHVNYATALENVDYAKFAEACGGKGFSVTKHEELIPALKSAFH
FT                   SQKPSIIDVAIEDEPPLPGKISYTQAVNYSKYMIKKLVEKKELDLPPLKKSLKRIF"
FT   gene            529122..529802
FT                   /locus_tag="BLi00521"
FT   CDS_pept        529122..529802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00521"
FT                   /product="putative extracellular protein"
FT                   /note="membrane associated"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00521"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39477"
FT                   /protein_id="AAU39477.1"
FT                   /translation="MAAYVFFLHQNPSQHCEKRGDCNVYRLPKTTFSTVFILAAGLLWM
FT                   SIVPQQAFAHGFIEKPGSRAALCSEAFGFLNLNCGSVMYEPQSLEAKKGFPHSGPADGQ
FT                   IASAGGLFGGILDQQSENRWFKHIMTGGEHTFTWTYTAPHNTSQWHYYITKKGWDPDKP
FT                   LKRADFELIGAVPHDGSPASRNLSHHIYIPEDRLGYHVILAVWDVADTENAFYQVIDVD
FT                   LVNK"
FT   gene            complement(529942..530802)
FT                   /locus_tag="BLi00522"
FT   CDS_pept        complement(529942..530802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00522"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39478"
FT                   /protein_id="AAU39478.1"
FT                   /translation="MEPRVIVQVVEELSATFKIIDILGVLGIPKSTYYRWKKKYKKVEL
FT                   TSLEELVIKLCKKNFYHYGHRKIKSILNRKYGINVNRKTVQKIMQKFEIQCQVKKKRQK
FT                   YICGESNIIVPNTLNRNFKASRLNEKWVTDITYLPYGSTMLYLSTIMDLYNNEIVAYKI
FT                   GTSQDINLVLDTLREAVELRKPVGLLLHSDQGSVYTSHAYQNLAKEKGITTSMSRKGNC
FT                   HDNAVIESFHSSLKSEGFNAQSRASISNSKVVQIVNQYMYRYNHVRIQAKLNYLSPLEY
FT                   RGQAA"
FT   gene            complement(530772..531104)
FT                   /locus_tag="BLi00523"
FT   CDS_pept        complement(530772..531104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00523"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39479"
FT                   /protein_id="AAU39479.1"
FT                   /translation="MGTRVHYAEEVKWEVIKMKQAGMTNKEIMEQLGIKNKTQIKTWMR
FT                   WYKTGQTYRFSQQVGKQYSYGKESEEMSELEELKLKNKQLEAQLAIIKKYQEIERSWSH
FT                   ESLSKL"
FT   gene            complement(531217..531468)
FT                   /locus_tag="BLi00524"
FT   CDS_pept        complement(531217..531468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00524"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00524"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39480"
FT                   /protein_id="AAU39480.1"
FT                   /translation="MKVFILFYLWIVPLVIGLIFFRVTQRTSFKKRFYPGYIMIVLAAA
FT                   VFAVCYLIGQPYLGNFFGGTMLFGTLLPFMAAAMKKKK"
FT   gene            complement(531540..532091)
FT                   /gene="ydaF"
FT                   /locus_tag="BLi00525"
FT   CDS_pept        complement(531540..532091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaF"
FT                   /locus_tag="BLi00525"
FT                   /product="putative acetyltransferase YdaF"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00525"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39481"
FT                   /protein_id="AAU39481.1"
FT                   /translation="MFKLMVRDDLYLKMLEPKDARAVYMQIQQSKDVLRKWLFWVDGTK
FT                   QLEDTEAFIEESMKQAAANNGFQAGIWHQGQFAGIIGLHYINWINRTTSIGYWLGEPFQ
FT                   GKGMMTDACRALIDTLFSEYDLNRIEIRAAVQNVKSQAIPERLGFTKEGCLRQCEWLHD
FT                   HFADHFVYGLLKEEYEARSK"
FT   gene            complement(532146..533426)
FT                   /gene="mntH"
FT                   /locus_tag="BLi00526"
FT   CDS_pept        complement(532146..533426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mntH"
FT                   /locus_tag="BLi00526"
FT                   /product="manganese transport protein MntH"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00526"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39482"
FT                   /protein_id="AAU39482.1"
FT                   /translation="MVSHDLSKHSQISKEAQDALDGKSKGFKRLLPFLGPAFIAAIAYI
FT                   DPGNFATNIAAGSKYGYLLLWVILFSNIMALLIQSLSAKLGIATGKNLPEVAREEFPKP
FT                   VSIGLWIQGELVVIATDLAEFIGAALGLYLLFGIPMLEASIIAAAGSFAILELQRRGVR
FT                   PLEAAITGMLFIVVIAFAFQTFFAKPDIGSVLEGMFVPRFDGADSILLAAGILGATVMP
FT                   HAIYLHSALTQRRVVGKTEAEKKKIFRFEFIDILIAMLIAGAINASMLIVAAALFYKNG
FT                   IFVEDLDVAFSHFSSMVSPLSAVLFGVGLLTAGLSSSSVGTLSGDIIMQGFINFRIPLY
FT                   LRRFITILPPIAIIASGVNPTTALVLSQVVLSFGIAFALIPLILFTSNKRIMGSLKNAK
FT                   WITAVSWLIAALIVALNIFLIYDTFSG"
FT   gene            complement(533609..533857)
FT                   /gene="ydaS"
FT                   /locus_tag="BLi00527"
FT   CDS_pept        complement(533609..533857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaS"
FT                   /locus_tag="BLi00527"
FT                   /product="YdaS"
FT                   /note="transglycosylase associated"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00527"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39483"
FT                   /protein_id="AAU39483.1"
FT                   /translation="MLGFLVSLIVAIVIGLIGGAIGGHGAPGSMVIGFIGAWIGHGLFG
FT                   TWGPDIAGFAIFPAIIGAAILVFILNLIFRGRMGSQA"
FT   gene            complement(533953..535374)
FT                   /gene="ansB1"
FT                   /locus_tag="BLi00528"
FT   CDS_pept        complement(533953..535374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ansB1"
FT                   /locus_tag="BLi00528"
FT                   /product="aspartate ammonia-lyase AnsB"
FT                   /EC_number="4.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00528"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39484"
FT                   /protein_id="AAU39484.1"
FT                   /translation="MDTKATRIEKDFLGEKEVPVDAYYGVQTMRAVENFPITGYQIDEE
FT                   LIKALAMVKKAAALANMDIKRLYKELGEVIVKAAGEIAEGLWHEHFIVDPIQGGAGTSM
FT                   NMNTNEVIANRGLELLGKEKGDYFHLSPNTHVNMAQSTNDVFPTAIHLATLNHLKRLLS
FT                   TMEHMLDAFRKKAAEFDSVIKMGRTHLQDAVPIRLGQEFEAYSRVIERDIQRIRQSQHH
FT                   LYEVNMGATAVGTGLNADPRYIQNVVAHLSDISGYQLTGADHLVDATQNTDAYTEVSAA
FT                   LKVGMMNMSKIANDLRLMASGPRAGLAEIRLPPRQPGSSIMPGKVNPVMPELMNQIAFQ
FT                   VIGNDNTICLASEAGQLELNVMEPVLVFNLLQSIKIMNNGFRVFTDYCITGIEANEIRL
FT                   KEFVEKSVGTITAVNPHLGYEAAARIAKEAIATGRSVRELCLLHDVLTEEELDLILDPY
FT                   EMTHPGIAGASLLEE"
FT   gene            535680..536867
FT                   /gene="yojK"
FT                   /locus_tag="BLi00529"
FT   CDS_pept        535680..536867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yojK"
FT                   /locus_tag="BLi00529"
FT                   /product="putative UDP-glucosyltransferase YojK"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00529"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39485"
FT                   /protein_id="AAU39485.1"
FT                   /translation="MMGHVLMINFPGEGHINPSIGVTKELQRRGESIVYYAVEEYAEKI
FT                   KKTGAEVRLYPDFREVLSPGKKKEKMDFAEVVYNMSSKVNEIVQFIYREVKSESYDYVI
FT                   YDHHFLAGKIIAEMLELPSVSLCTTFAMDEQFAKTFTPQGDLESSPYFEKLKGSLGELS
FT                   ERYPVSLDKPFDVFSCPGDITIVFTSRAFQPHAERFGSDYLFVGPSIASRQDPGSFPFA
FT                   ELEGETVIVISMGTIFNQQKELYHMCIEALKDFDGKVVMSVGKSTDPRDLGSIPDHFIV
FT                   RPYIPQLEVLKQADVFVTHGGMNSTNEGLYFDTPLIVIPMGADQFFVADQVERTGAGIK
FT                   LDKNELSPAVLQKTIKDMLENRSYKDDAAKIGRSLRNAGGYQKAADAVLELAGRK"
FT   gene            complement(536893..537339)
FT                   /gene="ydaT"
FT                   /locus_tag="BLi00530"
FT   CDS_pept        complement(536893..537339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaT"
FT                   /locus_tag="BLi00530"
FT                   /product="DUF2188 family protein YdaT"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00530"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39486"
FT                   /protein_id="AAU39486.1"
FT                   /translation="MPWSMEDYPASLKHLDKPVKKKAIEIANAMVDEGYDESRAIPIAT
FT                   SQAKEWADNRSKSELKSYAEKADETKRGDSGSSSRPELAEKCEHVIKHEKGWAVKAEDA
FT                   KRASEVKDTKAEAVERAKEIAENKGTAVVVHKKDGSVERKIRMN"
FT   gene            537458..538282
FT                   /gene="ydbA"
FT                   /locus_tag="BLi00531"
FT   CDS_pept        537458..538282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbA"
FT                   /locus_tag="BLi00531"
FT                   /product="YdbA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00531"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39487"
FT                   /protein_id="AAU39487.1"
FT                   /translation="MRYDKTDLENELKKIEKWEKEQQKAWFWERIGRLPFKVLDKLTPA
FT                   FIQDKIGLLLDEIGGFIQNGGQYLTSEKHLIRQFQKKLPDETIETIEDIQWAPLEVMDQ
FT                   ICENLGKNRANTAAVQGATTGVGGLFTLAVDIPAILGLSLKTLQDIAVSYGYDPKEKTE
FT                   RMFIIKCLQLSAADIVGKRAIIQELSRYHQPSGSRENMISQIQGWREVVYTYRDSFGWK
FT                   KLFQMVPVAGILFGAISNRSMVNGVAETGMMMYKKRRIMERLAELDATETEG"
FT   gene            complement(538322..539611)
FT                   /locus_tag="BLi00532"
FT   CDS_pept        complement(538322..539611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00532"
FT                   /product="Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00532"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39488"
FT                   /protein_id="AAU39488.1"
FT                   /translation="MQNQNGKASGLLPLFLFVCLFVGSGLITGDFYSLPIVAAALAASV
FT                   VSLAMNRKEKLSQKTEWFAKGAGHPDIMIMVMIFILAGAFSSAAKAMGAVESTVNLALS
FT                   FVPGQFMVAGLFIIAAFISVSMGTSTGTIAALAPIAAGISAEIGVPAAYSVAAVVGGAM
FT                   FGDNLSFISDTTIAAVRTQKTKMSDKFKTNFLIVLPAAVATVILLMVFSAGGHPGAQAG
FT                   TYSWVKVLPYLGVLIFALLGFNVMAVIFGGIVLAGVIGISDGSLTLHTYLTAITEGIGG
FT                   MSELIILSLLIGGMAEMMKRNGGIAFLLQFVSRRIRSKKGAEAGIAGLVSAANLATANN
FT                   TIAIITAGPLAKDLSDRYGIDNRKSASILDIFSCAVQGLIPYGAQMLSAAQIAKISPIS
FT                   ILPYSFYPILIGVCGICAIIFRLPRFTEKA"
FT   gene            539740..540456
FT                   /gene="ydbB"
FT                   /locus_tag="BLi00533"
FT   CDS_pept        539740..540456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbB"
FT                   /locus_tag="BLi00533"
FT                   /product="YdbB"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00533"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39489"
FT                   /protein_id="AAU39489.1"
FT                   /translation="MDRKTNLLELTKEVAEKHANFLVSEVNDHCMRIAVLEGEYVWHIH
FT                   PGSDELFIVLEGELLIDFQDRPTEVLKANDSLLIPKGVIHRTRADVRSVNLCIEKTNAE
FT                   TVPFAEGNVLKLIRCKSAEQKLQAFSEAQAKWAPLQNVSGFIRQWGGWMETEDGPEAVV
FT                   LALWKSKHDYLNFMAEHHDEIYERTHQKGTFESINITLFEDPAEISETLQNNTPAPVPE
FT                   WTVMGSGRLRDPHSLS"
FT   gene            540531..540971
FT                   /gene="gsiB"
FT                   /locus_tag="BLi00534"
FT   CDS_pept        540531..540971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsiB"
FT                   /locus_tag="BLi00534"
FT                   /product="general stress protein GsiB"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00534"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39490"
FT                   /protein_id="AAU39490.1"
FT                   /translation="MANNNDDNKMSREEAGRKGGEKTSQNHDKEFYQEIGQKGGEATSQ
FT                   NHDKEFYQEIGEKGGEATSRNHDKEFYQEIGEKGGEATSRNHDKEFYQEIGEKGGEATS
FT                   KNHDKEFYQEIGKKGGEATSRNHDKEFYQENGEKGGRQRRSG"
FT   gene            541193..542233
FT                   /gene="ydbI"
FT                   /locus_tag="BLi00535"
FT   CDS_pept        541193..542233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbI"
FT                   /locus_tag="BLi00535"
FT                   /product="UPF0118 membrane protein YdbI"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00535"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39491"
FT                   /protein_id="AAU39491.1"
FT                   /translation="MAALIKFFQHPGVRRFSVFVVLAGVLYLFRSMMNLILLTFIFTFL
FT                   MNRLENVIRGFLNRFIKVSQRLIISCLYAALAIALSIGGVVYYPVIVTQIQQLIKQGKH
FT                   IASHPDSIPFLDMITGMFGDINLTSYLEKGLNFIYTYITDISTFGLQVVMSLVLSMFLL
FT                   IEKDKVMSLMDKFKTSKIAIFYEEIAYFGKKFTRTFGKVLEAQFIIATINCALTTIALA
FT                   IMGFPQLFGLAVMVFFLGLVPVAGVVLSLIPLSIIAYSIGGIAYIVSLVLVIMIVHAIE
FT                   AYFLNPKLMSAKTELPIFFTFIVLIFSEHFIGIWGLIIGIPIFVFLLDILDVTNQEKNR
FT                   TAGTRK"
FT   gene            542521..543765
FT                   /locus_tag="BLi00536"
FT   CDS_pept        542521..543765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00536"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00536"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39492"
FT                   /protein_id="AAU39492.1"
FT                   /translation="MKLATKIIIALLLGAVVGIILNVTSPDLFSKLNTFLFGPLGTIFL
FT                   NLIKMLVVPIVFFSLTLGVAGLGDPKKLGRIGAKTISFFLITTAIAIIIGLVLALVIKP
FT                   GTIGTYDTSAAEYSAQKAPSISDTLLNIIPTNPVQAMAEGNMLQIIAFSILVGLGITML
FT                   GKKADALLKVVEQGNDLMMYLVNLVMKFAPYGTFGLIAGAIGSQGWDAIKAMGLYMIVV
FT                   ILALFIHTIVTYGAAIALLAKRNPLTFFKDFSEVMLVAFSTSSSNATLPVSMDVAQRKL
FT                   KVPEPISSFVQPLGATINMDGTAIMQGVATVFIAQVYGNDLSLTQLLMVVLTAVLASIG
FT                   TAGVPGVGLIMLAMVLQTVGLPVEGIALILGIDRLLDMIRTAVNTTGDAACAVIVTETE
FT                   KKHGKIEAPHSEVSV"
FT   gene            543835..544761
FT                   /gene="ydbJ"
FT                   /locus_tag="BLi00537"
FT   CDS_pept        543835..544761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbJ"
FT                   /locus_tag="BLi00537"
FT                   /product="antimicrobial peptide ABC exporter ATP-binding
FT                   protein YdbJ"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00537"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39493"
FT                   /protein_id="AAU39493.1"
FT                   /translation="MTKQPVLHIENVDKIIDGKTILKDIRLTADEGEIIGLLGPNGSGK
FT                   TTLIKLITGLIKMKSGSIVINGFPIDRQFEKAIQSVGAIVENPEFYPYLTGYENLKHYA
FT                   NMHAGIGRERLEEVISRVGLEDAAEDKVKTYSLGMKQRLGIAQAILHRPKLLILDEPTN
FT                   GLDPAGMKDFREHLRELAEEEGTAILFATHLLKEVEDLCDRVVILQKGKIKSTVVLNQA
FT                   DEKQEKAMLEVQPHDKALQWLKDQGYEARTEKGLLAVKVEKAQIPALNQQLVANDIDVY
FT                   SIAPFKQSLEDEYMARTNGIEERNADV"
FT   gene            544754..545521
FT                   /locus_tag="BLi00538"
FT   CDS_pept        544754..545521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00538"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39494"
FT                   /protein_id="AAU39494.1"
FT                   /translation="MFKLIQNEHVKLLKRKVTFVSLALIVVFQFLLALITKRILMGAGA
FT                   EDHFIGYFSFTPNLNILLQGLSIVVAASIISFEYDKKTIKFLLIRPVRREKILVSKYVT
FT                   SVLASIWLFIIYYGFSILFGLLFFGVKLDEKAEPLFINTVKMIGTQWFEVWMMVSFAFL
FT                   CSALFKSSALSIMVSIVVLYGAKMLVTIMAYLEKPLGKFLLFANTDLTQYAGEAKPLFA
FT                   GMTPLFSLFIVFIHLVFFLGTAWWGFCKRDMKV"
FT   gene            545639..545977
FT                   /gene="ydbL"
FT                   /locus_tag="BLi00539"
FT   CDS_pept        545639..545977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbL"
FT                   /locus_tag="BLi00539"
FT                   /product="YdbL"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00539"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39495"
FT                   /protein_id="AAU39495.1"
FT                   /translation="MKKFITALPIVLLLSFSFVSFAFNFDHLVYFRLALGLFSLAGLFL
FT                   LYKLKNGVRLFMAYLYGSWIVLAGIAAYEEPLFSDFFFGGLTITMGYLTYMLIYLGMKV
FT                   DRRGGQAV"
FT   gene            546102..547250
FT                   /gene="ydbM"
FT                   /locus_tag="BLi00540"
FT   CDS_pept        546102..547250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbM"
FT                   /locus_tag="BLi00540"
FT                   /product="putative acyl-CoA dehydrogenase YdbM"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00540"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39496"
FT                   /protein_id="AAU39496.1"
FT                   /translation="MCSIFVKTERQQEWLDKIGKLADEFEKTAAYYDEHAQFPAEHIQK
FT                   LRDSGYTALTVGKDYGGEGISLYDMLLFQERLAKGDGPTALSIGWHLSVMGELAEGNSW
FT                   DRDVFSSLSHEALKGALINRAASEAQTGSPTRGGRPGTHAVKKNGGWIVNGRKTFTTMS
FT                   PVLDYFLVTAWIEEKQMIGVFLIHKDAEGLAIEETWDMAAMRGTGSHDLVLTDVRLDES
FT                   MLVELLAGKRTDKINGWLLHIPAVYLGIAQAARDYAVQFAKDYQPNSLKGPIKEVPAVQ
FT                   RHIGEIDLELMKARHFMYHVAELYDDPERRALLTGELGAVKHTVTNTAIDVVDKAMRVV
FT                   GAKSLARTNPLQRFYRDVRAGLHNPPMDDATIAKLAGIAFSE"
FT   gene            complement(547324..547479)
FT                   /gene="fbpB"
FT                   /locus_tag="BLi00541"
FT   CDS_pept        complement(547324..547479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbpB"
FT                   /locus_tag="BLi00541"
FT                   /product="RNA chaperone FbpB"
FT                   /note="'for fsrA, response to iron limitation'"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00541"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39497"
FT                   /protein_id="AAU39497.1"
FT                   /translation="MSKRKIKTFHQLVEEYKKEIAKNPKEMEVIYDKIDRRHENRLLAI
FT                   SKAKQT"
FT   gene            complement(548056..548376)
FT                   /gene="ydbP"
FT                   /locus_tag="BLi00542"
FT   CDS_pept        complement(548056..548376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbP"
FT                   /locus_tag="BLi00542"
FT                   /product="putative thioredoxin-like protein YdbP"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00542"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39498"
FT                   /protein_id="AAU39498.1"
FT                   /translation="MKKITTEAQFNELIQSDKEIIVKFYADWCPDCTRMNMFIGDILEA
FT                   YQENDWYELNKDDLPELADKYQVMGIPSLLIFKNGEKTGHLHSANAKTPEEVNEFLAEH
FT                   IS"
FT   gene            548537..549622
FT                   /gene="ddl"
FT                   /locus_tag="BLi00543"
FT   CDS_pept        548537..549622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddl"
FT                   /locus_tag="BLi00543"
FT                   /product="D-alanine--D-alanine ligase Ddl"
FT                   /EC_number="6.3.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00543"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39499"
FT                   /db_xref="GOA:Q65N65"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65N65"
FT                   /protein_id="AAU39499.1"
FT                   /translation="MKTRLGLVYGGKSAEHNVSLQTALAVTKALDTEKFDIHPIYITEK
FT                   GEWVRGPQLTEPVSNVKMLQFEQTGQTFSPAVLNRDMFPGEADAKEDSIDVVFPLLHGP
FT                   NGEDGTIQGMLELLNVPYVGNGVLASSAGMDKVVMKHLFAQAGLDQAKYVSFLKKTWSQ
FT                   SKEECYAQVEGELGYPCFVKPANLGSSVGISKCRSREELDQAFELAFQYDRKIVVEEGV
FT                   IGREIELGVLGNDEPVCSVAGEIAPKKDFYDYKAKYEDGDTDLIIPASLTEDEYETMRS
FT                   MAVKAFQAIDGSGLVRADFFLTNEGRVLINEVNTMPGFTPFSMFPLLWKQSGVEYAELI
FT                   EKLVALAIERHEEKQQIKHTF"
FT   gene            549655..551130
FT                   /gene="murF"
FT                   /locus_tag="BLi00544"
FT   CDS_pept        549655..551130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="BLi00544"
FT                   /product="UDP-N-acetylmuramoyl-L-alanyl-D-glutamyl-meso-2,
FT                   6-diaminopimeloyl-D-alanyl-D-alanine synthase MurF"
FT                   /EC_number="6.3.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00544"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39500"
FT                   /protein_id="AAU39500.1"
FT                   /translation="MEKGAEGGSPLDTAADTILICGSVSFPCRRKRGTYMITRTVKEIA
FT                   EMSEGVLTNEAFEGRLIKGVSTDSRKLAKGQLFIPLAGERFNGHVFAEQAFQEGVAAVL
FT                   WNRSEPNPPEGKPVILVDDTLEALQKLAKAYRNQLDVKVVGVTGSNGKTTTKDMIHAVL
FT                   GTEYKVHKTEGNYNNHIGLPLTILAMPEDTEVAILEMGMSAKGEIDFLTRLARPDIAVI
FT                   TNIGESHLLELGSREGIAEAKLEIVNGLSKEGTLIYVGDEPLLTERLNQPPYDTKTFGE
FT                   DPAFDYQLEDMTQTEEGTAFRVRGIENGFFIPVLGKHNVKNALAAIAAGDLLNVSRAHI
FT                   AEGLTKLKVTGMRLELVKTPDGVAIINDAYNASPTSMKAAIELVEQMKGYGKKILVLGD
FT                   MLELGEGEKAFHEEIGQAVNPDSIDFLFTYGELGAYIAKGALKHFPEHRVLHFNPEEKD
FT                   SLKKTLKEKANTGDLILVKASRGMRLEDVIKDL"
FT   gene            551196..551906
FT                   /locus_tag="BLi00545"
FT   CDS_pept        551196..551906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00545"
FT                   /product="putative esterase/lipase"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00545"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39501"
FT                   /protein_id="AAU39501.1"
FT                   /translation="MIGCLCIHGFTGAPYELEPLASHLKQTADWQVEMITLPGHGEMPV
FT                   LKGVCFQEWIACAEVELIRLLKTCDTVFLIGFSMGGMIAGYLAGKYPVSRLVLLSAAAQ
FT                   YISPGQLIQDLKNVIKDSLQGKLEDNLLYKRYKQKLTSTPVSSAFQFRKLVKMTKPALK
FT                   NLRIPVLIVQGECDAIVPVSSAYYLYETIPSEEKELCLLPESKHHVCLEENSSILFQTV
FT                   EAFLKKTPIESIKK"
FT   gene            552257..553720
FT                   /gene="cshA"
FT                   /locus_tag="BLi00546"
FT   CDS_pept        552257..553720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cshA"
FT                   /locus_tag="BLi00546"
FT                   /product="DEAD-box ATP-dependent RNA helicase CshA"
FT                   /EC_number="3.6.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00546"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39502"
FT                   /db_xref="GOA:Q65N62"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030880"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65N62"
FT                   /protein_id="AAU39502.1"
FT                   /translation="MTITFQDFQLSSDLTKAIKRMGFEEATPIQAQTIPLGLANKDVIG
FT                   QAQTGTGKTAAFGIPLVEKINPESPNIQAIVIAPTRELAIQVSEELYKIGQDKRARVLP
FT                   IYGGQDIGRQIRALKKNPHIIVGTPGRLLDHINRRTMRLQTVNTVVLDEADEMLNMGFI
FT                   EDIESILSNVPAEHQTLLFSATMPAPIKRIAERFMTNPEHVKVKAKEMTVSNIQQFYLE
FT                   VHERKKFDTLTRLLDIQSPELAIVFGRTKRRVDELTEALNLRGYTAEGIHGDLTQAKRM
FT                   VALRKFKQGAIEVLVATDVAARGLDISGVTHVYNFDVPQDPESYVHRIGRTGRAGKTGM
FT                   AMTFITPREKDMLRAIEQTTKRKMDRMKAPTLDEAIEGQQQVTVDRIRTIIEENNLNFY
FT                   MTAAAELLEDHDSVTVVAAAIKMMTKEPDNTPVRLTEEAPLRTKRNKNHHHRSSKRRDG
FT                   GGYRGKNNRSSYDKKRSSNDRRQKKSYNS"
FT   gene            553834..554313
FT                   /gene="ydbS"
FT                   /locus_tag="BLi00547"
FT   CDS_pept        553834..554313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbS"
FT                   /locus_tag="BLi00547"
FT                   /product="cytosolic protein YdbS"
FT                   /note="membrane associated"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00547"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39503"
FT                   /protein_id="AAU39503.1"
FT                   /translation="MRSEPKNQISRDGVKVWRITACITSFVLMLAAAGLIAAGVIFKWP
FT                   VWIGILSAAVWLGISFVIIIMIPNIRHRVWRYEVHENEIDIQHGIFVVTRVIVPMVRVQ
FT                   HVDTSQGPILRKYNLASVQISTAATTHSIPALDVEEADQLRDSISRLARVTEDDV"
FT   gene            554303..555784
FT                   /gene="ydbT"
FT                   /locus_tag="BLi00548"
FT   CDS_pept        554303..555784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbT"
FT                   /locus_tag="BLi00548"
FT                   /product="cytosolic protein YdbT"
FT                   /note="membrane associated"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00548"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39504"
FT                   /protein_id="AAU39504.1"
FT                   /translation="MMSEPRRMHPAAVILNFIKGLVETVKNFIIPFGVVIFLNQSQTVK
FT                   MIAIAAAVLFFIALVVTSIIKWSKFTYRIEEDELRIEEGLINKKKRYIPIERIQTINTS
FT                   AGLIQQMFKLVKLQVETASGGTEAEVSLVAITQAEAERIQQALFERKKAAEDTGTDVPV
FT                   PLEETAEEAEEAEEPVMMYKMTGQELLTAASTSSGIGVIISGVFAFFTQVDDFFDLDWL
FT                   YDRFAFLNSAGAAVIALAAFVALFIAWLLSIVGMLLKYANFTVVRKEKEIVISRGLIEK
FT                   QQITIPLQRIQAIKIKESLIRQPFGLAAVTIVSAGGNVLEEDKSAILFPIISKKIINQR
FT                   LGEFIPDYAPEDDLNRLPKRALRRYILRASWPVLAVVPLSILFPPWGYLSAVLIPFYWI
FT                   IGYFSYRDAGWKISGSKIIMSSRFIGRTTAVIQRRRMQVFEVSRSYFQRRKQLVSIHTS
FT                   TKSSVLMEKFSVADVEEKDSDDIIAWYSYEKRVNG"
FT   gene            complement(555781..556380)
FT                   /gene="ydcA"
FT                   /locus_tag="BLi00549"
FT   CDS_pept        complement(555781..556380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcA"
FT                   /locus_tag="BLi00549"
FT                   /product="putative transmembrane protein YdcA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00549"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39505"
FT                   /protein_id="AAU39505.1"
FT                   /translation="MFIRTENFQTFIRLYPVTSAILALQLAIWILFLFPFTAVQMWSDL
FT                   LIGFNWGIANGEWWRFVTPIFIHAGFGHLLFNSMSIFLFAPGLERMLGKLKFLIVYIGA
FT                   GVIGNIGTYFIEPLEYMHVGASGAIFGLFGVYLYIVLFRKELMGSANSQIIVTILAISV
FT                   LMTFVNQNINMMAHIFGLLGGLALAPPLLNKRVNGF"
FT   gene            556675..557682
FT                   /gene="ydcC"
FT                   /locus_tag="BLi00550"
FT   CDS_pept        556675..557682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcC"
FT                   /locus_tag="BLi00550"
FT                   /product="putative sporulation protein YdcC"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00550"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39506"
FT                   /protein_id="AAU39506.1"
FT                   /translation="MRKSFVLLLTGLLVILMLSACGQKSQEDVVTGLDKKAKEYTSYKA
FT                   KAKMTIETGNEPQEYNVEIWHKKPSLYRVYLENPKKDQSQVILRNENGVFVLTPSLNKS
FT                   FRFHSDWPNNSSQVYLFESLVKDVKNDGEASFSAKDSKYIFETKTNYQHNQMLPTQEIV
FT                   FHKKTMAPSSVKVMDTDRKPMVKVEFTSFEFDKPLDKDSFDEKKNMTLSQIDVATSADV
FT                   SDSFAVKTPLDVPQGVKKLEEKEMATEDGKRIVITYGGEKSFTLIQEKARVAKTSTSVS
FT                   MNGEPVDLGFTVGALTDKSLSWTYDGVDYFISSEDLSQDELLMVAKSMQGQSSK"
FT   gene            557904..559076
FT                   /gene="alr1"
FT                   /locus_tag="BLi00551"
FT   CDS_pept        557904..559076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alr1"
FT                   /locus_tag="BLi00551"
FT                   /product="alanine racemase Alr"
FT                   /EC_number="5.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00551"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39507"
FT                   /protein_id="AAU39507.1"
FT                   /translation="MMSLKPFYRKTWAEIDLTALKENVRNMKRHIGEHVRLMAVVKANA
FT                   YGHGDAQVAKAALAEGASILAVALLDEALSLRAQGIEEPILVLGAVPTEYASIAAEKRI
FT                   IVTGYSVGWLKDVLGFLNEAEAPLEYHLKIDTGMGRLGCKTEEEIKEMMEMTESNDKLN
FT                   CTGVFTHFATADEKDTDYFNMQLDRFKELISPLPLDRLMVHSSNSAAGLRFREQLFNAV
FT                   RFGIGMYGLAPSTEIKDELPFRLREVFSLHTELTHVKKIKKGESVSYGATYTAQRDEWI
FT                   GTVPVGYADGWLRRLAGTEVLIDGKRQKIAGRICMDQFMISLAEEYPVGTKVTLIGKQK
FT                   DEWISVDEIAQNLQTINYEITCMISSRVPRMFLENGSIMEIRNPILPDQS"
FT   gene            559182..559469
FT                   /gene="ndoAI"
FT                   /locus_tag="BLi00552"
FT   CDS_pept        559182..559469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndoAI"
FT                   /locus_tag="BLi00552"
FT                   /product="antitoxin NdoAI"
FT                   /note="inhibits EndoA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00552"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39508"
FT                   /protein_id="AAU39508.1"
FT                   /translation="MFLSESSATTEILIRLPEALVSELDGVVMQDNGSRNELIYQATKM
FT                   YLRERKNRQIRESMRRGYMEMAKINLNISSEAQFAEYEAENTVERLVSGG"
FT   gene            559474..559824
FT                   /gene="ndoA"
FT                   /locus_tag="BLi00553"
FT   CDS_pept        559474..559824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndoA"
FT                   /locus_tag="BLi00553"
FT                   /product="endoribonuclease EndoA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00553"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39509"
FT                   /protein_id="AAU39509.1"
FT                   /translation="MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNNIGNRFSPTAIVA
FT                   AITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQIRTIDKQRLTDKITHLDDEMMEKVN
FT                   EALQISLALIDF"
FT   gene            559942..560769
FT                   /gene="rsbR1"
FT                   /locus_tag="BLi00554"
FT   CDS_pept        559942..560769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbR1"
FT                   /locus_tag="BLi00554"
FT                   /product="RsbT activator RsbR"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00554"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39510"
FT                   /protein_id="AAU39510.1"
FT                   /translation="MSNQAVLKFISEHQNVLAGNLADILKDLNSNMTNVKLTEHMYETI
FT                   SNEYIHILMNESGDGNEKSIDTIYQFSSKAVQLGVPLKLLSSGLSAFWKHLYYEMNKDV
FT                   PEDQQCYDLIWEIDKFIEPINSEILNQYAISWEKTVALQKVALQELSAPLIPVFENITV
FT                   MPLVGTIDTERAKKIMENLLSGVVKHRSEVVLIDITGVPVVDTMVAHHIMQASEAVRLV
FT                   GAKCLLVGIRPEIAQTIVNLGIDLTQVITKNTLQKGIQTALEMTDRKIVSLEE"
FT   gene            560773..561138
FT                   /gene="rsbS"
FT                   /locus_tag="BLi00555"
FT   CDS_pept        560773..561138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbS"
FT                   /locus_tag="BLi00555"
FT                   /product="RsbT antagonist RsbS"
FT                   /note="part of the stressosome"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00555"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39511"
FT                   /protein_id="AAU39511.1"
FT                   /translation="MRVPNIPILKLYNCLLVSIQVELDDQTALKFQEDLLNKIYETGSN
FT                   GVVIDLTSVDIIDSFIAKVLGDVITMSKLMGAKVVLTGIQPAVAVTLIELGISLDEIET
FT                   ALDLEKGLETLQRELGE"
FT   gene            561141..561542
FT                   /gene="rsbT"
FT                   /locus_tag="BLi00556"
FT   CDS_pept        561141..561542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbT"
FT                   /locus_tag="BLi00556"
FT                   /product="serine/threonine-protein kinase RsbT"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00556"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39512"
FT                   /protein_id="AAU39512.1"
FT                   /translation="MADQSCVKILTEWDIVAARQLGRNVAKELGFGTVDQARITTAISE
FT                   LARNIYLYAGKGRICIEQVQEEGKKGLKIVAEDEGPGIADIKKVMEDGFSTSGGLGAGL
FT                   PGVKRLMDQFELHSDAENGTDIQAVKWLR"
FT   gene            561553..562560
FT                   /gene="rsbU"
FT                   /locus_tag="BLi00557"
FT   CDS_pept        561553..562560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbU"
FT                   /locus_tag="BLi00557"
FT                   /product="phosphoserine phosphatase RsbU"
FT                   /EC_number="3.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00557"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39513"
FT                   /protein_id="AAU39513.1"
FT                   /translation="MDFREVIEQRYRQLLSRYISELTETSLYQGQKFSRKTIEHQVPPE
FT                   EIISIHRKVLSELYPDLPDHVFHSLDFLIEVMIGYGLAYQEHQTLRGIQQEIKSEIEIA
FT                   ANVQQTLLETTVPKVEALEIGAVSIPAKQMSGDYYHFVRDKESINIAIADVIGKGIPAA
FT                   LCMSMIKYAMDSLPDSGTSPSQVLKNLNRVVEQNVDPSMFITMFYGNYHLQKHLFTFSS
FT                   AGHEPGFYYSCRENKFYDLNAKGLVLGISSNYDYEQYEQKLDIGDMIVLFSDGVTECRT
FT                   DSGFLERSDLQNLITVHMEKPAQQMVDNIYEHLLKLQDFQLHDDFTLIVLKRKV"
FT   gene            562619..562945
FT                   /gene="rsbV"
FT                   /locus_tag="BLi00558"
FT   CDS_pept        562619..562945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbV"
FT                   /locus_tag="BLi00558"
FT                   /product="anti-sigma-B factor antagonist RsbV"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00558"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39514"
FT                   /protein_id="AAU39514.1"
FT                   /translation="MNLAVDTNKNDHVIEVKVAGEIDVHTAPTLRDELMPLAEEGKDLK
FT                   VSLKDVSYMDSTGLGVFVGIYKAVNRTGGSLVLENLSERLIRLFDITGLKDIIDISGKS
FT                   EGGL"
FT   gene            562945..563430
FT                   /gene="rsbW"
FT                   /locus_tag="BLi00559"
FT   CDS_pept        562945..563430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbW"
FT                   /locus_tag="BLi00559"
FT                   /product="serine-protein kinase RsbW"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00559"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39515"
FT                   /db_xref="GOA:Q65N49"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010193"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65N49"
FT                   /protein_id="AAU39515.1"
FT                   /translation="MKRAADYIEMKSPAKPEYVGIIRLTLSGIASKMGYSYDDIEDLKI
FT                   AVSEACTNAVQHAYKADNNTGEVSVRFGVFEDRLEIVVADQGDSFDIQDKQKELGPYSP
FT                   EHTVDQLSEGGLGLYLMETLMDEVHVQIDSGVTVSMTKFLNRERVDDGTTVQNYETN"
FT   gene            563393..564187
FT                   /gene="sigB"
FT                   /locus_tag="BLi00560"
FT   CDS_pept        563393..564187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigB"
FT                   /locus_tag="BLi00560"
FT                   /product="RNA polymerase sigma factor SigB"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00560"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39516"
FT                   /protein_id="AAU39516.1"
FT                   /translation="MMAQPSKTTKLTKTEVDTLIKKYQENQDEDAQLTLVQTYKNLVET
FT                   LAKKYSKGKSFHEDLCQVGMLGLLGAIKRYDPDVGKSFEAFAIPTIIGEIKRFLRDKTW
FT                   SVHVPRRIKELGPRIKMAVDHLTTETQRSPRVDEIAEFLDVTEEEVLETMEMGKSYQAL
FT                   SVDHSIEADADGSTVTILDIVGSQEEGYEKVNQKLMLESVLHVLSDREKQIIELTYIQN
FT                   KSQKETGEMLGISQMHVSRLQRKAVKRLREALAEDPYMELKP"
FT   gene            564184..564783
FT                   /gene="rsbX"
FT                   /locus_tag="BLi00561"
FT   CDS_pept        564184..564783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbX"
FT                   /locus_tag="BLi00561"
FT                   /product="phosphoserine phosphatase RsbX"
FT                   /EC_number="3.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00561"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39517"
FT                   /protein_id="AAU39517.1"
FT                   /translation="MIWTESNEHMQALVYQLPKEGKAVCGDSFYFHATDETMVCALADG
FT                   LGSGALARESSSVISEVVEEHGHEDVESLMERCNQALKHKRGATVSILKVDFRTRTIAY
FT                   SSVGNIRFILYAPSDKYIHPLPVTGYMSGKPQTYKTFTYTYEKGSRFIIYSDGLEVPAL
FT                   RTYLKQHHTPGDISNQLESYTRMGKDDLTYIIGQLF"
FT   gene            564861..567023
FT                   /gene="ydcI"
FT                   /locus_tag="BLi00562"
FT   CDS_pept        564861..567023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcI"
FT                   /locus_tag="BLi00562"
FT                   /product="putative nucleic acid-binding protein YdcI"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00562"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39518"
FT                   /protein_id="AAU39518.1"
FT                   /translation="MDTLASIVKQIAKETGLAPKHVESVIQLLEDGNTVPFIARYRKEQ
FT                   TGSMDEVQIQTISERWGYIQHLNQRKDEVIRLIDEQGKLTGQLKLDIEKADKLQEVEDL
FT                   YRPFKQKRKTKATIAKSKGLEPLADFIISLPRNEDVAAEARKYINEEKEVMSAEEALEG
FT                   AKNILAERISDEPEYRKWIRQETFKRGTLKSAAKDAEADEKKIYEMYYEYEEPIQKIVP
FT                   HRVLAVNRGEKEEILRASVEPPADRIQAYLEKRILQQKQTSAQDVLKSAIEDGYKRLIQ
FT                   PSIEREIRKELTEKAEDQAIHIFAENLRKLLLQPPMKGKLVLGVDPAFRTGCKLAVVDE
FT                   TGKMLKIDVIYPHPPVNKKSAAIEKVKRIIEDFQIEVIAIGNGTASRETEQFIADLLKD
FT                   IDRKVYYLIVNEAGASVYSASELAREEFPDLQVEERSAVSIARRLQDPLAELVKIDPKS
FT                   VGVGQYQHDVSQKKLNDSLRFVVETVVNQVGVNVNTASAALLQYVAGLSKTVAANIVKK
FT                   RDEIGKFTSRKELKDIPRLGAKTYEQCIGFLRVPDGDEPLDRTGIHPESYKETRELLKK
FT                   LGLSTAQIGTKELQDKINELNISEAAEQLGIGEITLKDICAQLTRPERDPRDEVPKPLL
FT                   KTDVLQLEDLKEGMELQGTVRNVVDFGAFVDIGVKQDGLVHISKLSHSFVKHPLDVVSV
FT                   GDIVTVWVEDVDAAKGRVSLSMVKDR"
FT   gene            complement(567073..567630)
FT                   /locus_tag="BLi00563"
FT   CDS_pept        complement(567073..567630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00563"
FT                   /product="putative transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00563"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39519"
FT                   /protein_id="AAU39519.1"
FT                   /translation="MEDRRSIKTKRAIKEAFLKLLHEKEINKITVSDLSRRADLGRGTF
FT                   YLHYRDVFDLYEQIENELFDQLGKFYDDYFPSEDPHHLLTFIEKTTEYIYQNAAIFTLL
FT                   TKPKGNILTINKFKDFFKQKIFEELSMMQQSGNEMACDEMEITFLVSGAVGIFEEWING
FT                   GMVQTPAHIAGVVHRILLKIAM"
FT   gene            567987..571106
FT                   /gene="ydgH"
FT                   /locus_tag="BLi00564"
FT   CDS_pept        567987..571106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgH"
FT                   /locus_tag="BLi00564"
FT                   /product="putative membrane protein YdgH"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00564"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39520"
FT                   /protein_id="AAU39520.1"
FT                   /translation="MRTIIKARWIIAALWIAMAAVLFITAPDMGQLTKEKGQIAVPEGY
FT                   PSSYANKLLEQMSKDGDTNKSVVVVFQDKHLLPNREAALKKAITTLEKDSSLHVSDITS
FT                   YFNADEDIQKQLLSKDRTTLLVPVTFDANKISAAEFKAKVNEKLKTLKLDYEMTGQPLI
FT                   DDDVMTSSQEGLKKTEYITVGFILIVLILVFRSAVAPFVPLLAVALSYLVSQSVVAYLV
FT                   KYADFPLSTFTQIFMVAIMFGIGTDYCILLLSRFKEEIARGKDKIEAILTTYKTAGRTV
FT                   LFSGIAVLIGFTCIGFAEFQLYKSAVAVAVGVAVLILALLSIVPFFMAVLGKVLFWPVR
FT                   GNIGHPQSKLWETAGRFAFSKPLISLLIVAAVAVPPILMYKGTLSYNSLDEIGDQYESV
FT                   SAFNTISDKFGPGESLPVTVVLKTSDALDTNDGLIAIEKISRAIEQTNGVSKVRSATRP
FT                   VGKGLSDLYVKTQANELNKGLESGNKGLKKIKDGLAEASKSIADQKPQIEASGKGINQL
FT                   IKGTESIQAGISDVEANMRKLKEGTDQSKQGVAQAKKEIQTAKKQLTAQVDQLNGQIET
FT                   YKEISKILKAALSQAENAQGITADVQKMIEQTNQNFKNLESEIPEVKENPSYLAIKGSY
FT                   TELASAIKQGSQKAAVYTKQAANAKKQLEAADAFIAKAQEEQKVYTSKIDALINGLGQI
FT                   EKGLEETSKGQGQLADSLPKLESGAGEVAEGQKQMKEKVGEFAGQLDQLTKGLNSSVDG
FT                   LEKISSGLMGAGDYLDQLKNASDQEMSGWFVPKEVLKNKQFQQVFNSYMSDDRHITTID
FT                   VILEDNPYGNGAIAKVKDIEASVKRALPDTHLHDASFGVGGVSSINADLKQLSDQDFSN
FT                   TVIYMMIGIFLILVLLFRSIVMPVYLVGSLVLTYFASIGVTEFIFTAFFGYPGLNWAVP
FT                   FFGFVILMALGVDYSIFLMERFNEYRGTDIMTAMTESMKNMGSVIISAAVILAGTFAAM
FT                   LPSGVLSLLQIATLVLTGLLLYAFVMLPLFVPVMVRIFGSANWFPFKRKE"
FT   gene            571496..571957
FT                   /gene="ydcK"
FT                   /locus_tag="BLi00565"
FT   CDS_pept        571496..571957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcK"
FT                   /locus_tag="BLi00565"
FT                   /product="YdcK"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00565"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39521"
FT                   /db_xref="GOA:Q65N43"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023524"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65N43"
FT                   /protein_id="AAU39521.1"
FT                   /translation="MDEQQLQQLTEQLSLTYFKKPFRHRAYFNSRLKTTGGRYLLNSHN
FT                   IELNKKYLTEHGQKELEGIIKHELCHYHLHLEGKGYKHRDKDFRTLLKEVGAPRFCTPL
FT                   EKEKKPQRKVRTYKCEACGQTFLRKRKMDTSRYVCGKCGGKIKEIIKKG"
FT   gene            572074..572148
FT                   /gene="trnN2"
FT                   /locus_tag="BLi00566"
FT                   /note="tRNA-Asn-GTT"
FT   tRNA            572074..572148
FT                   /gene="trnN2"
FT                   /locus_tag="BLi00566"
FT                   /product="tRNA-Asn"
FT   gene            572151..572241
FT                   /gene="trnS2"
FT                   /locus_tag="BLi00567"
FT                   /note="tRNA-Ser-GCT"
FT   tRNA            572151..572241
FT                   /gene="trnS2"
FT                   /locus_tag="BLi00567"
FT                   /product="tRNA-Ser"
FT   gene            572270..572341
FT                   /gene="trnE3"
FT                   /locus_tag="BLi00568"
FT                   /note="tRNA-Glu-TTC"
FT   tRNA            572270..572341
FT                   /gene="trnE3"
FT                   /locus_tag="BLi00568"
FT                   /product="tRNA-Glu"
FT   gene            572354..572428
FT                   /gene="trnQ2"
FT                   /locus_tag="BLi00569"
FT                   /note="tRNA-Gln-TTG"
FT   tRNA            572354..572428
FT                   /gene="trnQ2"
FT                   /locus_tag="BLi00569"
FT                   /product="tRNA-Gln"
FT   gene            572437..572512
FT                   /gene="trnK1"
FT                   /locus_tag="BLi00570"
FT                   /note="tRNA-Lys-TTT"
FT   tRNA            572437..572512
FT                   /gene="trnK1"
FT                   /locus_tag="BLi00570"
FT                   /product="tRNA-Lys"
FT   gene            572525..572607
FT                   /gene="trnL1"
FT                   /locus_tag="BLi00571"
FT                   /note="tRNA-Leu-TAG"
FT   tRNA            572525..572607
FT                   /gene="trnL1"
FT                   /locus_tag="BLi00571"
FT                   /product="tRNA-Leu"
FT   gene            572628..572711
FT                   /gene="trnL2"
FT                   /locus_tag="BLi00572"
FT                   /note="tRNA-Leu-GAG"
FT   tRNA            572628..572711
FT                   /gene="trnL2"
FT                   /locus_tag="BLi00572"
FT                   /product="tRNA-Leu"
FT   gene            complement(573001..573885)
FT                   /locus_tag="BLi00573"
FT   CDS_pept        complement(573001..573885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00573"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00573"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39522"
FT                   /protein_id="AAU39522.1"
FT                   /translation="MKNTLLGSIYLALAASIWGGMYVVVKVVVAVIPPIELVWIRYVIA
FT                   ILTLLIVGLIKRQSWKIHKRDLLLIVVIGIVGNTISIVTQEYGTMLSSAQMGAIITSST
FT                   PAFMVIFARLLLKEPLNIKKGTSIILATIGVLFIVGNGHIDTSNQIGGISLLAAALTWA
FT                   LMSVLIKLVPNSYSSLLVTTYSTFVAIVALTPFVKPTAIFTSQLLDPKILGGLLYLGIV
FT                   STACAFLLWNRGLQLLNASSGGLFFFFQPLVGTLLGWLLLGEKIGGTFWIGSFLILIGV
FT                   LLVIKEKEKDVNS"
FT   gene            complement(574751..575101)
FT                   /locus_tag="BLi00574"
FT   CDS_pept        complement(574751..575101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00574"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00574"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39523"
FT                   /protein_id="AAU39523.1"
FT                   /translation="MISKFFSGIHNTIFSPLRSWAEQSPGNWNILIVVGFLLVYGSGIL
FT                   VYVFYKKLGKDDERTNKIYLKSSSYMLLVIILCDMIFPKDDMWTIFFLYKYALAFLAAG
FT                   IYLSVQYKKDFS"
FT   gene            complement(575091..575330)
FT                   /locus_tag="BLi00575"
FT   CDS_pept        complement(575091..575330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00575"
FT                   /product="putative phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00575"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39524"
FT                   /protein_id="AAU39524.3"
FT                   /translation="MKKDFGDSISNKVYEYRVLARMSQQELAEKVGVSKQTIFVMEKGN
FT                   YVPTLLLAFRIAEFFNVDVNEIFTYVKGNDQNDK"
FT   gene            complement(575968..576996)
FT                   /gene="des1"
FT                   /locus_tag="BLi00576"
FT   CDS_pept        complement(575968..576996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="des1"
FT                   /locus_tag="BLi00576"
FT                   /product="phospholipid desaturase Des"
FT                   /EC_number="1.14.19.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00576"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39525"
FT                   /protein_id="AAU39525.1"
FT                   /translation="MNDQNLKTLRKLVTPYEKSDLQKSIYQIINTLIPFFLLWCLAYKS
FT                   LSISYFLTLAISIVAAGFLVRTFIIFHDCCHYSFFKNKKANRILGTITGILTLHPFDHW
FT                   GRDHSIHHATSSNLDKRGTGDIWLLTVEEYKEASTKTKIMYRLYRNPFVMFMIGPIYVF
FT                   GITNRFNRKGAKRKERMNTYVTNLGIAALTALLCWAIGWQNFLLVQAPIFMISGSLGIW
FT                   MFYIQHTFEDSYFEEDEHWEYVKAAVEGSSFYKLPKVMQWLTGNIGFHHVHHLSPRVPN
FT                   YKLEEVHNNIEPLQNVPTITLATSLKSLKFRLWDEESKKFVGFSHLKKASKSQVSAQLR
FT                   TD"
FT   gene            577595..577798
FT                   /gene="cspC"
FT                   /locus_tag="BLi00578"
FT   CDS_pept        577595..577798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspC"
FT                   /locus_tag="BLi00578"
FT                   /product="cold shock protein CspC"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00578"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39527"
FT                   /protein_id="AAU39527.1"
FT                   /translation="MEQGTVKWFNAEKGFGFIERENGDDVFVHFSAIQSDGFKSLDEGQ
FT                   KVTFDVEQGPRGAQAANVQKTA"
FT   gene            complement(578054..578836)
FT                   /locus_tag="BLi00579"
FT   CDS_pept        complement(578054..578836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00579"
FT                   /product="putative zinc-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00579"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39528"
FT                   /protein_id="AAU39528.1"
FT                   /translation="MGIVIDQGKDVSPSLIGKRVLPVRGEGTWQQYVTTKADYAIELPP
FT                   SISDNDASQLYINPLTAWLICTESLRVQPNEIVLMNGGGTSIAGLFAQISKILGFRLIV
FT                   MTRNSRKIEKLQKLGAWRAIDASKGSIYEKISDGCDIGVDHAIDSVGGESGELLARALK
FT                   PEGTFVSYGLLSGIPNDWRKLHDVYHVSPQLFALRLWNERHSVSEYRNRFSEVIKLVES
FT                   GRMVINAPEKIYDFEDFYDALKHYEQPGLNGKILLNFA"
FT   gene            complement(579408..580013)
FT                   /gene="yyaS"
FT                   /locus_tag="BLi00580"
FT   CDS_pept        complement(579408..580013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yyaS"
FT                   /locus_tag="BLi00580"
FT                   /product="putative transmebran protein YyaS"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00580"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39529"
FT                   /protein_id="AAU39529.1"
FT                   /translation="MKYLFYVIGILILTLGIAFTIQSDLGASPFDALLVVLAVHAGLTV
FT                   GSWEVIIALLLIGCNSVLKRQRPEVSGLLTAFITGIGIDMWLFLLHFFVTPEQWYSKAV
FT                   CFGIGLVVTGLGTATYLYTNFASMPIDRLTFIIKELTGTNIFFSRTIIYLVFLTAAVML
FT                   KGPIGIGTLLTVCLGGLALHLFMPFAGKVLGRFTDART"
FT   gene            580124..580576
FT                   /gene="yybA"
FT                   /locus_tag="BLi00581"
FT   CDS_pept        580124..580576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yybA"
FT                   /locus_tag="BLi00581"
FT                   /product="putative HTH-type transcriptional regulator YybA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00581"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39530"
FT                   /protein_id="AAU39530.1"
FT                   /translation="MKDILREIGMIARALDSISNIEFKEHDLTKGQYLYLVRICENPGI
FT                   IQEKLAEMIKVDRTTAARAIKKLEMKGFIERRDDEHNKKIKKLFPTEKGNEVFPFIKRE
FT                   NDHSNRVALEGFSEGEAEIIFNLLQRVRKNVEKDWEFVKKGNKRNY"
FT   gene            580601..581119
FT                   /gene="paiA"
FT                   /locus_tag="BLi00582"
FT   CDS_pept        580601..581119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paiA"
FT                   /locus_tag="BLi00582"
FT                   /product="spermine/spermidine-N-acetyltransferase PaiA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00582"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39531"
FT                   /protein_id="AAU39531.1"
FT                   /translation="MTVNIKRCTLEDLHKLQEIGYETFNETFKHQNSPENMKAYLDKAF
FT                   NLKQLEKELSNSSSQFFFVYFNNEIAGYLKVNTDEAQSEKMGDESLEIERIYIKNNFQK
FT                   HGLGKYLFNKAVEIAKELNKKKIWLGVWEKNENAIAFYKKMGFVQTGAHSFYMGDEEQT
FT                   DFIMAKTIL"
FT   gene            581141..581758
FT                   /gene="paiB"
FT                   /locus_tag="BLi00583"
FT   CDS_pept        581141..581758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paiB"
FT                   /locus_tag="BLi00583"
FT                   /product="transcriptional repressor PaiB"
FT                   /note="of sporulation and degradative enzyme genes"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00583"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39532"
FT                   /protein_id="AAU39532.1"
FT                   /translation="MYIPKYFKVENADEILDFVQKNSFGTIVTTEQGKPIATHLPLGLN
FT                   KKGDDYYITGHIAYGNPQVGTLETCKDVLVMFQGPHAYISSSWYGHEDVPTWNYQAVHI
FT                   YGKASILERDELIEELTIMMEKYEKHRENPILWDNLSPQLLERQLKAIVGFKIKVEDIQ
FT                   AAYKLSQNRNDTDYMNIIDQLQNEGDPDSEQLAAAMKKRLEN"
FT   gene            complement(582153..583067)
FT                   /locus_tag="BLi00584"
FT   CDS_pept        complement(582153..583067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00584"
FT                   /product="putative ureohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00584"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39533"
FT                   /protein_id="AAU39533.1"
FT                   /translation="MAKKTIRLLMPQWQGGNNPNYSFGAELLAWLAPENDQPLIHVPVQ
FT                   PYDGTPLENENGINGRKQLLEQLEAAQHIIHAHKPDRIVMFGGDCLVEQAPFAYLNERY
FT                   GGDLGLIWIDAHSDLVRYAGYDNGHTLPLGNLLGEGDEEFAKHVKIPLKPENVFIAGLA
FT                   APTEEETKVISNELQRQGIAPTEPDTEVIQRLGIRTAGTKKLMTSTEPIKEWIKESNIK
FT                   YLAIHLDLDVLDPKAFRSLLFANPEAPVNFSPEGTMQMPYLLHLLKELSSETDVVGLGI
FT                   TEHLPWDSIHLKKLLSEIPILTQ"
FT   gene            583173..583508
FT                   /locus_tag="BLi00585"
FT   CDS_pept        583173..583508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00585"
FT                   /product="putative HTH-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00585"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39534"
FT                   /protein_id="AAU39534.1"
FT                   /translation="MSMAEYKGKVKNIQDTPFGYTLSVIGGKWKMVIIYLLAENQPIRF
FT                   NELKRQIGAITYKTLSSQLKELEADGLVKRKEYPQVPPKVEYSLTDKAESLLPVLEGLC
FT                   EWGLKNQ"
FT   gene            583847..584719
FT                   /gene="ydeO"
FT                   /locus_tag="BLi00586"
FT   CDS_pept        583847..584719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeO"
FT                   /locus_tag="BLi00586"
FT                   /product="putative membrane protein YdeO"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00586"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39535"
FT                   /protein_id="AAU39535.1"
FT                   /translation="MNKIEKHRKFRAKMIFKVIMVMIGGIIAAYGLETVLIPNSVSDGG
FT                   VTGLSIVGSQLFDLPLGILIAVLNIPFVWLGYKQIGKSFALLSIIGIASLAAGTSFMHH
FT                   TPAIIEGDTLLVTVVGGIILGFGMGLALRNGGALDGIDMLAVLLSRKLPFGTSDLILFF
FT                   NLFVFIFVSAVFGLQGALLSVIAYYIASKVIHVVEEGLSGSKTFQIITSEPELMVETIR
FT                   DQLGRSATYKEAYGGFSHEKFKEITCVINRLEDTKLKEIINEVDKNAFVTVYDVAEVKG
FT                   SNFRKPNIH"
FT   gene            complement(584818..585396)
FT                   /locus_tag="BLi00587"
FT   CDS_pept        complement(584818..585396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00587"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00587"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39536"
FT                   /protein_id="AAU39536.1"
FT                   /translation="MSIIAFLSYVIMTSITPGPSNILMMNEAQRFGFTGSWRFSSGILA
FT                   GFAVLGILSGAFTISLYNWIPVVEPYFKLAGACYLIYLALQVGFTKNKKQDSTEARSSF
FT                   ISGFIFQLINIKSILFFLTVMSAFVLPFNHSLKSTIYYLALAIVLGWLALLLWSGFGSV
FT                   FKRVFAKHDRVFRVLMCLLLMYSAVSIFR"
FT   gene            585528..586409
FT                   /gene="ywqM1"
FT                   /locus_tag="BLi00588"
FT   CDS_pept        585528..586409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ywqM1"
FT                   /locus_tag="BLi00588"
FT                   /product="putative HTH-type transcriptional regulator YwqM"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00588"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39537"
FT                   /protein_id="AAU39537.1"
FT                   /translation="MEIRHLITFQTIVEMGSYTGAASKLGYTQSTITTHIQALEHEIGG
FT                   ALFTYEKRNLKLTQLGRELMPLAEELLSTHNQIKNLQSAHEVKGVLKVAAPESLTISRL
FT                   GPIIREYSLKYPHVKLKLSNGTCGQNQVDLLSGNVDVALMVYPEIELDKCIRYTLAEEK
FT                   IVLVGSSEGPEDLEEYQKHFFITNEEDCSYRTMFEKYLLKNDIHYFPTMELWSIEAIKQ
FT                   TVMSGLGFSVLPYITVKDEVESGKLKILPHSQYLDPLYSQMLIKKKKWQLPAVDAFADL
FT                   VLHSFREPRLIG"
FT   gene            586491..586712
FT                   /locus_tag="BLi00589"
FT   CDS_pept        586491..586712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00589"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00589"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39538"
FT                   /protein_id="AAU39538.1"
FT                   /translation="MREFAPKVFQTTGIIGFILAFVQIPIGWFIGFFFSGLFFMMLKSN
FT                   NEKSGTFNMMAGIACLLYSFYCLFTQVL"
FT   gene            586893..588119
FT                   /locus_tag="BLi00590"
FT   CDS_pept        586893..588119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00590"
FT                   /product="putative major facilitator superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00590"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39539"
FT                   /protein_id="AAU39539.1"
FT                   /translation="MRKLKLLLAANLISTVGTGITSYLIVWLLIDQLKQSVLYGLLTMA
FT                   TMILVFFASPYLGSLVDRYSRKAIFLYMEITGIVVLGVFSVLCNVSAVLDITLVVMLIF
FT                   YHTAYDSIKYPALAALTQEMFKKEDYSKVNSSLEVQGQAALMISSGLAAMMIGKMDAAV
FT                   ILVMNISTFIAASILIYQLPYQRNAEAEEHSNTMKNESYWKNFRSSLQYLCYRKVLFVL
FT                   LLTSFIPSIVIIVANYLDPVFIYDYLNEGPSVIGIANIVYAIGAMGAGFVAYQISKKWS
FT                   DMQGVILFMAVFALATIAIFLVPNAVTFIVASLFWGHSNAAIRVFRKSYMFHHVDNAYM
FT                   GRVNSLFNAVKLLGQVALIGILTITVVPAGQTVYGYFVLFIIVIAALLTTTYLFNRTYN
FT                   KDKEKRVSL"
FT   gene            complement(588215..588997)
FT                   /locus_tag="BLi00591"
FT   CDS_pept        complement(588215..588997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00591"
FT                   /product="putative cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00591"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39540"
FT                   /protein_id="AAU39540.1"
FT                   /translation="MKINQIVDLSVSLRGDIPSDPPGFIPEIEYADHKQGAKQMVQSFP
FT                   GLSSQDLPGGEGWSLEKVKMSTHAGTHIDAPYHYRSVTDDGKRMMTIDEVPLDWFHGPG
FT                   VKLDFRHLKDGHIVTPEEIEQELHRINHKLAPGDIVLVNTSAGAKYGQSDYLDSGCGMG
FT                   REATLFLTERGVRLVGTDAWSWDAPFSMTAKRFEQEKDPSIIWEGHYSGSTIPYCQIEK
FT                   LANLDQLPSTGFYVMAFPVKVEKASAGWARPVAILSGE"
FT   gene            complement(589123..590505)
FT                   /gene="ydgF"
FT                   /locus_tag="BLi00592"
FT   CDS_pept        complement(589123..590505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgF"
FT                   /locus_tag="BLi00592"
FT                   /product="putative amino acid permease YdgF"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00592"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39541"
FT                   /protein_id="AAU39541.1"
FT                   /translation="MTEDVTDNDIHEQKLSRGLKNRHIQLIAIGGAIGTGLFLGSGKSI
FT                   HFAGPSILFAYLITGIICFFIMRSLGELLLSNLEYHSFVDFVRDYLGDMAAFITGWTYW
FT                   FCWISLAMADLTAVGLYTQYWLPDVPQWLPGLIALIILLIMNLATVKLFGELEFWFALI
FT                   KVIAILALIAIGLFMIFKGFSTHSGTAAFHNLWSHGGMFPNGLHGFLLSFQMVVFAFVG
FT                   IELVGLTAGETKDPEKVIPKAINNIPVRVLLFYIGALLVIMSIYPWNVINPNESPFVQV
FT                   FAAVGIIAAASIINFVVLTSAASASNSAVFSTSRMIYSLAKEHNAPGAMTKLTSRKVPG
FT                   NALFFSAVVILIGIMLNYIMPEQVFTLITSISTICFIFIWGITVICHLKYRRTRPDLAK
FT                   RNKFKMPLYPFSNYVVLGFLAFILIVLALAQDTRVSLFVTPVWFIMLIAIYKLRKPKSR
FT                   QV"
FT   gene            590907..591542
FT                   /locus_tag="BLi00593"
FT   CDS_pept        590907..591542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00593"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00593"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39542"
FT                   /protein_id="AAU39542.1"
FT                   /translation="MLILIAVYVLYTLFENLILDPQSTSFLSHKSHLRDSFHLPIWLKV
FT                   MYVHVIAACLAMVSGAVNFSSGLLAKSRKIHRLNGFIYVVSVMVVTLSSGYMAPHSTGG
FT                   RAVSIAFNMVNMYWPAATVISVIKARRNQFTKHRNWMIRSYLFCFTNLFIHFITFVCRS
FT                   GFGLPYDISYTIGVYGAIALNVAAAEFVIHFTRRKAVDILHTAGFDKV"
FT   gene            591735..592370
FT                   /locus_tag="BLi00594"
FT   CDS_pept        591735..592370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00594"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00594"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39543"
FT                   /protein_id="AAU39543.1"
FT                   /translation="MDDRIETKEPMPSLIGLITNPALQFERMKRRPAVALPMFIVFVLS
FT                   VLSAYLYISKDFPDTYTYFGMIIFLWEFLKTGIYLFVSALILWLIATIGGGKTNFVTMF
FT                   SLASFVGFAKIIGDVINNTVYRFANVPEGTSFTSLHDVFSAVEPYKSILGVFDIFMVWA
FT                   LVLAAEGLQKAGGASKRASWIAVAVLFILKFLFACFFGLFAALFEDIF"
FT   gene            592712..593209
FT                   /gene="sigV"
FT                   /locus_tag="BLi00595"
FT   CDS_pept        592712..593209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigV"
FT                   /locus_tag="BLi00595"
FT                   /product="RNA polymerase sigma factor SigV"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00595"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39544"
FT                   /protein_id="AAU39544.1"
FT                   /translation="MKKQAARASLVACITDRKEDFYRLAYSYVKNQEDALDIVQESIKK
FT                   ALDSVDSVRNPDTIKSWFYKILVRTAIDFLRKQKKLKVMDDQTIEFLSQGKEDTYRDTD
FT                   LHEALDELPQPYHTIIVLRFFEDLKLEEIAEITGENLNTIKTRLYRGLKLMRIQLTKED
FT                   LS"
FT   gene            593209..594069
FT                   /gene="rsiV"
FT                   /locus_tag="BLi00596"
FT   CDS_pept        593209..594069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsiV"
FT                   /locus_tag="BLi00596"
FT                   /product="anti-sigma-V factor RsiV"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00596"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39545"
FT                   /protein_id="AAU39545.1"
FT                   /translation="MDKKLEQLRKAYQNVPIPKELDQVVETALQHKPKKKRRIVVWPAS
FT                   TLVAAAVLLAAVVNINPGAAQAMSQIPVIGKVVKAITFTEIKQKDGESSIDVKTPALSG
FT                   LNNRELENGINEKYVKESHQLYREFMKETSRNKKGHLSIYSDYETVTDTKDLISIRRSV
FT                   ERTEASSYTERRYITIDKKNEVLLTLKSLFKDDRYITAISENIKEQMKQQMKDDPDKIY
FT                   WIGDEEVEPFKRIKADQNFYITENHKLVISFDDYEVAPGYMGAVEFEIPTKAISNLLIG
FT                   DRYIR"
FT   gene            594299..596179
FT                   /gene="yrhL"
FT                   /locus_tag="BLi00597"
FT   CDS_pept        594299..596179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrhL"
FT                   /locus_tag="BLi00597"
FT                   /product="putative peptidoglycan O-acetyltransferase YrhL"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00597"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39546"
FT                   /protein_id="AAU39546.1"
FT                   /translation="MRDQTQQHRYIPGLDGLRAFAVLAVIAYHLNMSWADGGFIGVDIF
FT                   FVLSGYLITSIILPAYGNDISLTFRDFWVRRIRRLLPAATLMIFATVIWVALFNRELMH
FT                   TVRGDAISSLLYVSNWWFIFHDLSYFDSFGSPSPLKNLWSLAIEEQFYFIWPIILLLGI
FT                   YIFKKRERFAAAVVLCALCSAIWMSILYVPGGDPSRVYYGTDTRAFELLIGCALALVWP
FT                   MKRLSGNRLPNSLKHALHGTELAAFALLMMCIYFVDEFSPFLYHGGMLIISIIAAILIA
FT                   CVSHPSSFLGFALSVKPLRWIGKRSYGIYLWHYPVIVLSTPVQEIGNPVYWHVAMKVAV
FT                   TFILAELSYRFIEKPIRKDGFKPFVSRVFLDKITEWKTASVPSKISIGLMFAALLVFAG
FT                   GLSGLADEKKQPQQAYSKSYEETSASADQPADKSEERQDDKKAQTESGNESKTGNGEES
FT                   SDTKDEQSAEKEPDRIEKEVLAVGDSVMLDIASSLRRKIPGITIDGQVGRQVREALQLT
FT                   STYASFNHPDKAVVIELGTNGYFTDGQLDALLDAFSKADVYLVNTRVPRQWESKVNESL
FT                   RKHADSRQNVTLVDWHAEALQHPEYFTADGVHLMPKGAEALASLIVKAMK"
FT   gene            596368..597573
FT                   /gene="ydgK1"
FT                   /locus_tag="BLi00598"
FT   CDS_pept        596368..597573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgK1"
FT                   /locus_tag="BLi00598"
FT                   /product="major facilitator superfamily protein YdgK"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00598"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39547"
FT                   /protein_id="AAU39547.1"
FT                   /translation="MLHNPVGKERLALAFLLGMLAILGPLNIDMYLPSFPEIADDLGAG
FT                   ASLVQLSLTACLIGLTIGQLVIGPVSDAKGRRKPLLISISLFALSSLFCALSPNIATLV
FT                   LARFLQGFTASAGIVLSRAIVRDVFTGRELSKFFSLLMVITAVAPMVAPMTGGAILLLP
FT                   FATWHTIFYTLALIGLLLVLVISMKLTETLPPEKRIPSSIGSSLKTMGSLLKDRSFIGY
FT                   ALTVGFIHGGSFAYVSGTPFVYQDIYGVSPQVFSVLFGINGLAIISGSFIIGRFGGIIH
FT                   ERKLLRIAVITAVIATSVLLTMTILKGPLAAIVISIFIYMITIGMTLTSTFTLAMENQG
FT                   HRAGSASAMLGMLPLLLGSIVSPLVGMNETTAVPMGAIMFITAVIGSFAFFALTRENQG
FT                   ER"
FT   gene            complement(597613..600708)
FT                   /locus_tag="BLi00599"
FT   CDS_pept        complement(597613..600708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00599"
FT                   /product="two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00599"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39548"
FT                   /protein_id="AAU39548.1"
FT                   /translation="MLKKLFVFISIILGYAGFFFIFLFINNQLSEQNYPEAKQGIINLE
FT                   TWDFQKDGNIALTGEWALYRNQLLSPKDIHAGKGKAPIYSDVPNNVKLTDSGKNVDYGT
FT                   YRLMIRSKQDNEMFGISTSFINSANRVYFNGKLIGQSGTPSNKANFTAQNRPYTSFFEV
FT                   RRGDNELIVQFSNFKKTPSWGIEKPIAFGMQQHILHQSKISFLNETSMITAFFITGLYF
FT                   LGFFLHRRKDKHLFFFSTMCLLFSVIVLLIGRERMIFLLFPSISFSALSVVRATTMVLV
FT                   SMAVFLYLYFAYKEIVSKKWIIAATAFSVLVLMIDFITWGYTDRLAYILHSVLAVTTLI
FT                   YITYVFAISAVRKMKGSLYLTIAAISMSAFVILTTVSAYSGKRGFSFNSLYAVPSIIAL
FT                   LAAVLMMAQQFAGAFRENEILSLKLLRMNRLKDEFIAKTSHEFKTPLNSMINICQTLLA
FT                   RKRKRTLEEEKENLQLVIRMGYRLSSLVNDILDLEKMKQGMLQIQAVPVDAHSAISTEM
FT                   DFYRLLSKNKNVRIVNRVPSGLPLVLADENRFRQIMTNLVDNAIKYTPEGQITLSAERL
FT                   DQEKVKITVADTGVGIPKAVRQLIFEAFQQAKNHKDDGAGLGLSIVRQLVQLQNGEIWV
FT                   ESEEGKGSAFHFTLPVAKNDPLPDAKKENMPQQQAVRDLPDVSISTPYYSKKMDASTVL
FT                   IVDDNIESLKILADMLEGVPYQVIAAKSGHEALEVVSRSKLDLVILDLMMPDMTGFEVC
FT                   MKIRERFTMVELPVLIITAAIIDHDKYKAFHAGANDILQKPYNYTEFAARVKNLIMMKD
FT                   TAAQATNMEMAFLQSQIKPHFLFNVLNTIIALSHLDIEKAREVTADFTNYLRMSFDFQN
FT                   TSGMSSFKHELSIVNSYLSIEKTRFGDRLDVIYDIEEDIDFTLPPLMIQPLVENAVHHG
FT                   ISKKRGGGWIKLTAKKESENRYYIKIEDNGIGMPPEKQQDIFSSHFTHSVGMKNINRRL
FT                   KHFCGSELNIESTPDSGTAVSMVISINESADVSDSAIQRAPL"
FT   gene            600883..601959
FT                   /locus_tag="BLi00600"
FT   CDS_pept        600883..601959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00600"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00600"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39549"
FT                   /protein_id="AAU39549.1"
FT                   /translation="MKALIVDDEELALLHFKNMLERTNCFRFIEMFQDPADVLEYPDIR
FT                   DIDTVFLDIEMPGINGIELAEAIQSMNENIQVVFITAYNDFAIKAFELNAVDYLLKPVD
FT                   YVRLVKTIERIRENSLLKASAVNAGGDYFIQCFGNLQFYKAEKGVKTYIPVKWRTSKAR
FT                   EIYAYLLHHHGHVISKDVLIDLFWQDHDVSKASTQLYSAIYQIRKLIDRLPFGQSIEKT
FT                   DTGYVLRISGVKVDADEWEKSLKEAPPIHMATINRHMELLLAYENHYFMEHGYLWAEPE
FT                   KTRLARIWLGKAYELVDFLIHEKDYRRGLDICLLVEKIEPCDHKIIQYKMQLFNKTGNV
FT                   EEAIKEYERYKLMKDKMN"
FT   gene            602257..608184
FT                   /locus_tag="BLi00601"
FT   CDS_pept        602257..608184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00601"
FT                   /product="putative cell wall anchor domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00601"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39550"
FT                   /protein_id="AAU39550.1"
FT                   /translation="MRSKKYSFSLSKKRGLKSFLVTCLALYLIFSQVVGFTLTAVAAGT
FT                   STGGSVFFDSVTIKNSEDQTVDGSKGDEPALKPGDKVTLTYEWSLKNDEEAGAENSFTV
FT                   EVPKSFEFAQDAEGEVKSADQQIIGSYQVKADSNIFTVTLKSPAEGSAGAKGAIALSAK
FT                   FAADMKSDTKTVTALFQLGAGKTQQVIIPVNTGSESETAKNDPPSSEDDQSDDQSKSSG
FT                   GQDQEETKKKAADAENSDSKPAASSRLAAAGSLASGGNQITQNILTGVTLTDEHGKPYD
FT                   KSNRADTNSPAKISITWDIPNELGKTINDGDRYEFDLPEAFIMYNDITNQPLSSDGITY
FT                   GYFSIDTKGHVVMTFNGEVKEDSNVKGTLFVNTQFNAQKIKGSTTQKIPFPVKSDTPEV
FT                   TVYFKPKVSKTIDKSGTFDKGINPGQVTWTVDLNKKLDQVKNAKLQNFPEGLTYRSVKV
FT                   YQLDVNIDGSVSRGDEVLSGYTVDADGNVTFDGEIDSAYRLIYVTDIDDSAKPNEGGNA
FT                   AFRNKATFGGDNLEPASAEASVTAKYGKMIEKSSTGYKSDSQTFSWTILYNYGEKKIDE
FT                   SKASITDSFGSADLHLVSDSLKVIPITFNQNGSEQAGTPLTEGKDYTLSDNGSGFEIKF
FT                   NQDVTGAYKITYQTEVNSGVIIDKSTTYTNTAVTGTGESKKASGTAVQQNLIKGYSNID
FT                   YKKKTVDWTIAINKNNYTMNNWKLDDNFESGGLTLLDGSFRLQDVTNNKTLEEGKDYTL
FT                   IIKPDHEGFLLELIGDYATTNSQLKITYTTNMNADFSNENVKNTAESTWTDHSSTERKN
FT                   KEASSFTPNRQTSHNGFKHGLYNAVSKEITWKIGINYNGEPSKNPYIKDSLADDQQFEK
FT                   GSVVVKSYSVNKDGSITEGDILPASQYDVEEPSAANKQTLTVHLKTDDSVPYLIEFKTS
FT                   LKGQVIKHDPYTNKATYHNAGYSERELTASVSVADGGSLVFKGGKQNGGYVDWSINVNA
FT                   SQSVLEDVKVTDTPDTNQILAEDSFKVYQAKYDEKGAVKDSSGNLVPDDVQLKKGEDYT
FT                   LDIKTDNATGEQSFVLKFTGDYKKIDRAYVIQYQSLINIAGTSGHVNNKVSISGTNVQE
FT                   QTQENNSSVFVAVSSGGGSGSGERGSLTILKTGEDGTPLSGADFQLRTKDNEQLLRTGT
FT                   TDDNGKLTFGNIRYGTYILKEIKAPDGYTISDAYADGVSVEINSSSSSAGALYKVVNEK
FT                   NKVTLIKQDEQKNPLEGAVFKLEKKSGDGAFTTIRTNIKSDKNGKVEINGLPPGDYRLL
FT                   ETKAPEGYLLNTKELGFSVKTNDKNQVPDVDLGTLINYKGRAHLTKEDAEGRQLEGAEF
FT                   KLIDHEGKTIHEKLTSDQDGKTAVSDLAPGRYAFVETKAPEGYVINSKAIEFTISESAK
FT                   EKPESVDAGKAVNYKGSVYLTKEDAEGRTLKGAEFKIVDHEGKTVHEKLTSDEDGKIAV
FT                   SGLAPGRYAFVETKAPEGFMLNNDQIEFTIPGSAEGKPEPVDAGAAVNYKGSVHLTKED
FT                   AKGHKLEGAVFKIADQIGNTVQEELVSDRNGTVTASGLAPGRYAFVETKAPDGFVLNSG
FT                   KIEFVIPDSAKGKPEHVDAGTFVNYKGSVYLEKKDEDGNGLEGAVFKIIDSEGKTVKDD
FT                   LISKEGGKIEAGDLAPGSYQFVEKHAPDGYLLSTDPIPFSITGKHEGEPKQVKLTALNK
FT                   KNSVVLTKVGQDDKSAGLQGAQFDLTDETGKVLKTGLATDADGRITVYGLKPGNYQFVE
FT                   TKAPKHYQLDKTPISFTVKNTDTKQIELTAENQLTPGDVKLTKVDSNNKKAVLKGAEFK
FT                   LLDADGKPVKAGGNSKKLPAVWTTDQNGQFTAEGLAPGRYQFVETKAPDGYKLDETPIP
FT                   FEIKKGQTKPVEVIASNEKLKTPAVDKGAPDPNSGDPKTDNKGTPDRNSKGDPKTNDNG
FT                   HLKDTLPKTGDTDSIIPIMIGILLILSGGAFAFFTRKKQRKA"
FT   gene            608251..608883
FT                   /locus_tag="BLi00602"
FT   CDS_pept        608251..608883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00602"
FT                   /product="putative extracellular protein"
FT                   /note="membrane associated"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00602"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39551"
FT                   /protein_id="AAU39551.1"
FT                   /translation="MYKKMIVAVLVISGILFVLSPFIKESIIINLNKNKNFDLTAEQAE
FT                   QNNAQKASFDFEAIQPPSILETIKASLDRESKAVIGRITISSVNLKLPILKGTTNQNLL
FT                   YGATTMRPDQKMGEGNYPLAGHHMKRESLLFGPLLNIEKGDTVKITDFKKDYIYAVTSK
FT                   QFISEMDTDVIQETKKKEITLITCDKAVRTEGRLAVKGKLIHVAVHR"
FT   gene            609459..610880
FT                   /locus_tag="BLi00603"
FT   CDS_pept        609459..610880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00603"
FT                   /product="putative sugar/inositol transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00603"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39552"
FT                   /protein_id="AAU39552.1"
FT                   /translation="MNEQGNQKSFLRTIILVSTFGGLLFGYDTGVINGALPYMSEGDQL
FT                   NLTAFTEGLVASSLLLGAALGAVFGGRLSDYIGRRKNIIFLAVLFFFSTLGCTLAPDVT
FT                   VMVISRFLLGVAVGGASVTVPTYLAEMSPSEKRGRMVTQNELMIVSGQLLAFTFNAILG
FT                   TTMGDSSHVWRYMLAIAAVPAVFLFFGMLRMPESPRWLVSKGKNEAALGVLKRIRKEKR
FT                   AHSEVAEIEAAVMKESEMKKANYKDLAVPWVRRIVFLGIGIAVVQQITGVNSIMYYGTE
FT                   ILKNAGFETKAALIGNIANGVISVLATFVGIWLLGKVGRRPMLLTGLIGTTSALLLIGI
FT                   FSNVLQGSAALPYVVLTLTVTFLAFQQGAISPVTWLMLSEIFPLRVRGLGMGVTVFCLW
FT                   IANFFVGFSFPILLESIGLSSTFYIFVGLGLLSIAFVKKFLPETKGLTLEQLEHNFRNY
FT                   KSETAQSGASAKISG"
FT   gene            611478..611554
FT                   /gene="trnR1"
FT                   /locus_tag="BLi00604"
FT                   /note="tRNA-Arg-ACG"
FT   tRNA            611478..611554
FT                   /gene="trnR1"
FT                   /locus_tag="BLi00604"
FT                   /product="tRNA-Arg"
FT   gene            611567..611640
FT                   /gene="trnG1"
FT                   /locus_tag="BLi00605"
FT                   /note="tRNA-Gly-TCC"
FT   tRNA            611567..611640
FT                   /gene="trnG1"
FT                   /locus_tag="BLi00605"
FT                   /product="tRNA-Gly"
FT   gene            611805..613342
FT                   /gene="rrsE"
FT                   /locus_tag="BLi00606"
FT   rRNA            611805..613342
FT                   /gene="rrsE"
FT                   /locus_tag="BLi00606"
FT                   /product="16S ribosomal RNA"
FT   gene            613524..616452
FT                   /gene="rrlE"
FT                   /locus_tag="BLi00607"
FT   rRNA            613524..616452
FT                   /gene="rrlE"
FT                   /locus_tag="BLi00607"
FT                   /product="23S ribosomal RNA"
FT   gene            616587..616701
FT                   /gene="rrfE"
FT                   /locus_tag="BLi00608"
FT   rRNA            616587..616701
FT                   /gene="rrfE"
FT                   /locus_tag="BLi00608"
FT                   /product="5S ribosomal RNA"
FT   gene            616713..616789
FT                   /gene="trnM2"
FT                   /locus_tag="BLi00609"
FT                   /note="tRNA-Met-CAT"
FT   tRNA            616713..616789
FT                   /gene="trnM2"
FT                   /locus_tag="BLi00609"
FT                   /product="tRNA-Met"
FT   gene            616831..616907
FT                   /gene="trnD1"
FT                   /locus_tag="BLi00610"
FT                   /note="tRNA-Asp-GTC"
FT   tRNA            616831..616907
FT                   /gene="trnD1"
FT                   /locus_tag="BLi00610"
FT                   /product="tRNA-Asp"
FT   gene            617102..618085
FT                   /gene="thiL"
FT                   /locus_tag="BLi00611"
FT   CDS_pept        617102..618085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="BLi00611"
FT                   /product="thiamine-monophosphate kinase ThiL"
FT                   /EC_number="2.7.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00611"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39553"
FT                   /protein_id="AAU39553.1"
FT                   /translation="MDEFELIQRITPRSLSHREIEIGIGDDAAVYHTKNNYQEIVAVDT
FT                   MVDGIHFLSSHSSPADIGYKALAVNISDIAAMGGRPKYYLVSIAVPSGWGATDIEAMYE
FT                   EMNKLATLYEMDLIGGDTVSANGPLVLTVTAIGEIEKGRSCLRSHAEPGDVVFVTGELG
FT                   SSAAGLSFILGQTSARDETQSQYFIERHKRPEPRVEAGLICSRYHHVALNDISDGLASE
FT                   LNEIAEASRVSIDIYKELIPVHSDLHILHTKWEEWVLFGGEDFELVGTISNDQWERFSQ
FT                   ECSEHDVRVHQIGRVTKQGQAEVFYHDGQDRVLLEKKGYNHFKQDR"
FT   gene            618094..618570
FT                   /gene="ydiB"
FT                   /locus_tag="BLi00612"
FT   CDS_pept        618094..618570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydiB"
FT                   /locus_tag="BLi00612"
FT                   /product="UPF0079 ATP-binding protein YdiB"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00612"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39554"
FT                   /protein_id="AAU39554.1"
FT                   /translation="MKTLEWKTTEPEETKNIARLAAKYVQPGDVITLEGDLGAGKTTFT
FT                   KGFAEGIGIKRVVSSPTFTIIKEYRDGSLPLFHMDVYRMEDETEDLGLDEYFEGDGVCL
FT                   VEWAHLIEEQLPKERLEVVIKRLGDDKRKLTFTPKGRRYENLCEEISKHDDTCD"
FT   gene            618551..619240
FT                   /gene="ydiC"
FT                   /locus_tag="BLi00613"
FT   CDS_pept        618551..619240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydiC"
FT                   /locus_tag="BLi00613"
FT                   /product="putative glycoprotein endopeptidase YdiC"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00613"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39555"
FT                   /protein_id="AAU39555.1"
FT                   /translation="MTILAIDTSNLTLGVALIKDGKVIAEHISHLKKNHSVRAMPAIDE
FT                   LLKECGLKPSDLTQIAVAKGPGSYTGVRIGVTIAKTLAWSLNIPVKTVSSLEVLAANGR
FT                   FFQGLICPLFDARRGQVYTGLYQYRDGKLHGLEEDQNILLEDWLKKLKAMDQQVLFIGS
FT                   DTGIHREMIERILDEQAVIADPALQLPRPSELALIGELKEDEPVHSIVPNYIRLAEAEA
FT                   VWLEKQK"
FT   gene            619253..619711
FT                   /gene="ydiD"
FT                   /locus_tag="BLi00614"
FT   CDS_pept        619253..619711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydiD"
FT                   /locus_tag="BLi00614"
FT                   /product="putative ribosomal-protein-alanine
FT                   acetyltransferase YdiD"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00614"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39556"
FT                   /protein_id="AAU39556.1"
FT                   /translation="MNTQMVIRDMNPKDLDQVFEIEKSSFSSPWKKESFHHELFHNMYA
FT                   HYLVLEVEEQVVGYCGIWIVMDDAQITNIAVSPAYRGRRFGEALLKAAMKLCRMKRAVQ
FT                   LSLEVRVSNHIAQSLYKKLGFEPGGIRKNYYTDNGEDALLMWVRLNES"
FT   gene            619701..620726
FT                   /gene="gcp"
FT                   /locus_tag="BLi00615"
FT   CDS_pept        619701..620726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /locus_tag="BLi00615"
FT                   /product="putative O-sialoglycoprotein endopeptidase Gcp"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00615"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39557"
FT                   /db_xref="GOA:Q65N07"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65N07"
FT                   /protein_id="AAU39557.1"
FT                   /translation="MNHKKDLYVLGIETSCDETAAAIVKNGTDIISNVVASQIESHKRF
FT                   GGVVPEIASRHHVEQITIVLEEAFAQADMTFDDIDAIAVTEGPGLVGALLIGVNAAKAL
FT                   SFARGIPLVGVHHIAGHIYANRLVQDIQFPAIALVVSGGHTELVYMKEHGSFEVIGETL
FT                   DDAAGEAYDKVARTMGLPYPGGPHIDKLAQKGEANVPLPRAWLEEGSYHFSFSGLKSAV
FT                   INTLHNASQKGETIAPEDLSASFQESVIDVLVTKTERAAEAYGVKQVLLAGGVAANKGL
FT                   RAALEKTFSSRPEIELLIPPLSLCTDNAAMIAAAGTVAFEKGIRGKYDMNGQPGLDLTS
FT                   Y"
FT   gene            complement(620966..622891)
FT                   /gene="ydiF1"
FT                   /locus_tag="BLi00616"
FT   CDS_pept        complement(620966..622891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydiF1"
FT                   /locus_tag="BLi00616"
FT                   /product="putative ABC transporter ATP-binding protein
FT                   YdiF"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00616"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39558"
FT                   /protein_id="AAU39558.1"
FT                   /translation="MMILQVNQLSKSFGADTILTNIKLEVRSRDRIAVVGRNGAGKSTL
FT                   LKIIAGKLSYEKGDIIKPKDLTMGYLDQHSGLDSKLTLKEELLSVFDFLKKMEKEMRAI
FT                   EEKMAQAGPDKLESLMKTYDRLQQEFKDKGGYQYEAEVRSVMHGLGFAGFDDSVRVQDL
FT                   SGGQKTRLALGKMLLTKPDLLILDEPTNHLDIDTLTWLEQYLQSYSGAILIVSHDRYFL
FT                   DKVVTQVYEITRSQSKKYIGNYSSYLQLKAEQLERETKLYEKQQDEIAKLQDFVDRNLA
FT                   RASTTKRAQSRRKQLERMEIMDKPLGDEKSASFRFEITRQSGNDVLRVEDLTVSYQDQP
FT                   PLLRSLDFRITRGESVALVGPNGIGKSTLLKALIQKLQPVSGTIATGSHVSIGYYDQEQ
FT                   AELTSSKRVLDELWDDYPEMNEKDIRTCLGNFLFSGEDVLKPVHALSGGEKARLALAKL
FT                   MLQKANFLILDEPTNHLDLDSKEVLENALIDYPGTILFVSHDRYFINRIATKVLELSRD
FT                   KAEEYLGDYDYYTEKKAQQLELKELEKQTEERQKAASEKPGAKKSYEEEKELKRKERQR
FT                   QRRIEDIETRITAIEEQIEKNEELLCNPDVFQDHEKVQEIHSENEQLNEELEQLLSEWE
FT                   TLSTNE"
FT   gene            623038..623544
FT                   /gene="moaC"
FT                   /locus_tag="BLi00617"
FT   CDS_pept        623038..623544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaC"
FT                   /locus_tag="BLi00617"
FT                   /product="cyclic pyranopterin monophosphate synthase MoaC"
FT                   /EC_number="4.1.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00617"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39559"
FT                   /db_xref="GOA:Q65N05"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65N05"
FT                   /protein_id="AAU39559.1"
FT                   /translation="MNEFTHFNEQGRAKMVDISEKEASVRTAAAVSSVSMNREVHEKIK
FT                   NREIGKGDVLAVAQVAGIMAAKQTSAIIPMCHPIALKGVDIAFCWEKKEQKSILHIQSN
FT                   VKTKGSTGVEMEALTSASVCALTVYDMCKAADKGMVIGPTFLLEKTGGKNGDYKREKAD
FT                   VDMED"
FT   gene            623548..624195
FT                   /gene="rex"
FT                   /locus_tag="BLi00618"
FT   CDS_pept        623548..624195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rex"
FT                   /locus_tag="BLi00618"
FT                   /product="redox-sensing transcriptional repressor Rex"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00618"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39560"
FT                   /db_xref="GOA:Q65N04"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65N04"
FT                   /protein_id="AAU39560.1"
FT                   /translation="MNMDHSKIPQATAKRLPLYYRFLKNLHASGKQRVSSAELSDAVKV
FT                   DSATIRRDFSYFGALGKKGYGYNVNYLLSFFRKTLDQDETTNVTLIGVGNLGTAFLHYN
FT                   FIKNNNTKIAMAFDINEEKIGTEVGGVPVYDLNKLEEHMTDDDIPVAILTVPAQAAQSI
FT                   TDRLVALGIKGILNFTPARLNVPEHIRIHHIDLAVELQSLVYFLKHYSMQEK"
FT   gene            624238..624417
FT                   /gene="tatAY"
FT                   /locus_tag="BLi00619"
FT   CDS_pept        624238..624417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatAY"
FT                   /locus_tag="BLi00619"
FT                   /product="twin-arginine translocase component TatAY"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00619"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39561"
FT                   /protein_id="AAU39561.1"
FT                   /translation="MPTIGPGSFILIVVVALLIFGPKKLPELGRAAGNTLREFKNATKG
FT                   LADDDSDNKKKEDQ"
FT   gene            624424..625200
FT                   /gene="tatCY"
FT                   /locus_tag="BLi00620"
FT   CDS_pept        624424..625200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatCY"
FT                   /locus_tag="BLi00620"
FT                   /product="twin-arginine translocase component TatCY"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00620"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39562"
FT                   /protein_id="AAU39562.1"
FT                   /translation="MTFMKGKEMSLLEHITELRRRLVITFFFFVLFVAAGFFLAKPLII
FT                   YLQQTDEAKLLTLNAFKLTDPLFVYVQFAFIIGAVLTSPLVLYQLWAFISPGLYEKERK
FT                   VTLSYIPISIILFLGGIAFSYFILFPFVVDFMTRVSDDLNVNQVIGIHEYFQFLLQLTL
FT                   PFGLLFQMPVVIMFITRLGLVTPMFLAKIRKYAYFVLFVIAALITPPELLSHLMVSVPL
FT                   LILYEISIVISRISYRQAQKTMIQEENQSFLNDHTK"
FT   gene            complement(625246..625440)
FT                   /gene="ydiK"
FT                   /locus_tag="BLi00621"
FT   CDS_pept        complement(625246..625440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydiK"
FT                   /locus_tag="BLi00621"
FT                   /product="putative mebrane protein YdiK"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00621"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39563"
FT                   /protein_id="AAU39563.1"
FT                   /translation="MMRSPKFWGVIYLLTGVLFTYLAATSPGSMWSFYTILLMLFAAYN
FT                   ISISFKMFALAGRMKRKDQ"
FT   gene            complement(625437..626171)
FT                   /gene="ydiL"
FT                   /locus_tag="BLi00622"
FT   CDS_pept        complement(625437..626171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydiL"
FT                   /locus_tag="BLi00622"
FT                   /product="putative mebrane protein YdiL"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00622"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39564"
FT                   /protein_id="AAU39564.1"
FT                   /translation="MRKQYWFIILAYVLMQLSAVVGLPLLYFLGVGRGQPKAEAQLTLT
FT                   GVWSVIAFTLCLVIVLLILRTVPKTTLRNRPKASVAASIGWAVAGVFLALFAQSIAASI
FT                   EMNLFGVNPESENTQRIMKIITALPLMVFVSSVFGPILEEIIFRKIIFGAIYEKTNFFV
FT                   AALFSSVLFSVVHLDFSHLLIYTAMGFTFAFLYVRTNRIIVPIFAHVAMNTLVVLLQTF
FT                   REPIEEYLKNVEKMQMIIGGFL"
FT   gene            626397..626681
FT                   /gene="groES"
FT                   /locus_tag="BLi00623"
FT   CDS_pept        626397..626681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="BLi00623"
FT                   /product="chaperonin GroES"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00623"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39565"
FT                   /db_xref="GOA:Q65MZ9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65MZ9"
FT                   /protein_id="AAU39565.1"
FT                   /translation="MLKPLGDRVVIELVESEEKTASGIVLPDSAKEKPQEGKVVAAGSG
FT                   RVLESGERVALEVKTGDRIIFSKYAGTEVKYEGTDYLILRESDILAVIG"
FT   gene            626726..628360
FT                   /gene="groEL"
FT                   /locus_tag="BLi00624"
FT   CDS_pept        626726..628360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="BLi00624"
FT                   /product="chaperonin GroEL"
FT                   /note="co-repressor for HrcA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00624"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39566"
FT                   /db_xref="GOA:Q65MZ8"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65MZ8"
FT                   /protein_id="AAU39566.1"
FT                   /translation="MAKDIKFSEEARRSMLRGVDALADAVKVTLGPKGRNVVLEKKFGS
FT                   PLITNDGVTIAKEIELEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLK
FT                   NVTAGANPVGVRKGIEQAVAVAVESLKEISKPIEGKESIAQVASISAADEEVGSLIAEA
FT                   MERVGNDGVITIEESKGFTTELEVVEGMQFDRGYASPYMVTDSDKMEAVLENPYILVTD
FT                   KKITNIQEILPVLEQVVQQGKPLLLIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGD
FT                   RRKAMLEDISILTGAEVITEDLGLDLKSTQINQLGRASKVVVTKENTTIVEGAGDTEQI
FT                   AARVNQIRAQVEETTSEFDKEKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALN
FT                   STRAAVEEGIVSGGGTALVNVYNKVAALEAEGDELTGINIVLRALEEPIRQIAHNAGLE
FT                   GSVIVERLKNEEIGVGYNAATGEWVNMIDKGIVDPTKVTRSALQNAASVAAMFLTTEAV
FT                   VADKPEENKGGAGMPDMGGMGGMGGMM"
FT   gene            complement(629461..629808)
FT                   /locus_tag="BLi05004"
FT   CDS_pept        complement(629461..629808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi05004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi05004"
FT                   /db_xref="EnsemblGenomes-Tr:AFR74786"
FT                   /protein_id="AFR74786.1"
FT                   /translation="MSMNDVKKLEAYLKLNADGTLTLDPSYTKLDISRSVTNEVQDWIK
FT                   YLNDLVKQKEAVINSDFSVKILDKDGSVLTLENGNNHKMKVAKKGCGRSGHDLYWWGYN
FT                   LYFDCNETRTI"
FT   gene            complement(630237..630548)
FT                   /locus_tag="BLi00626"
FT   CDS_pept        complement(630237..630548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00626"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00626"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39567"
FT                   /protein_id="AAU39567.1"
FT                   /translation="MLSEHLSLLRELESNRNKVKRPVLDMVQIEDMDKIICEAMEFNLT
FT                   VLFSVFKPLPFLNRAESGETINIEGKIHYINHIRKVFHIVEGDTNFIKFEDAVFREIK"
FT   gene            631610..632527
FT                   /gene="yoaR"
FT                   /locus_tag="BLi00628"
FT   CDS_pept        631610..632527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yoaR"
FT                   /locus_tag="BLi00628"
FT                   /product="YoaR"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00628"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39568"
FT                   /protein_id="AAU39568.1"
FT                   /translation="MLKIWMTGLLLLAQPAGHSDSLTITQQGKKVAVVNREDFTMPLPG
FT                   TPMIDDKKYNEFVDRLERKVHKDPVNAVINDQGRIVPGKVGYSLSRKGFKEQFYAYFYG
FT                   DGPSTIEVPELNVYPKVDSELLSHIRTQRIGQYVTYFNSGNKSRTHNISLAAKAIDNHV
FT                   VFPNETFSFNKVVGMRTPDKGYMKAPVIVRGELSEGVGGGICQVSSTLFNAVDRAGLEI
FT                   VQRYSHSRRVPYVPPGRDATVSWGGPDLRFQNKYNQPVLIRAKRHGGTMVVTLYSSDVV
FT                   NHQLRKVPKAPAQIPKEEHQSGDH"
FT   gene            632645..633094
FT                   /gene="yfmQ"
FT                   /locus_tag="BLi00629"
FT   CDS_pept        632645..633094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfmQ"
FT                   /locus_tag="BLi00629"
FT                   /product="YfmQ"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00629"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39569"
FT                   /protein_id="AAU39569.1"
FT                   /translation="MTWLFVTFLVIFSLFKILVTCLPSGVVEWLTGKFQVHVKLEESNV
FT                   QVTFGGKRLEGSDKSRFIQNFNEAVFMERYYIYPGDEPLYVNPKNAGTPFVIETTKGKN
FT                   AVKLFVYRYDDHIDVVKQYKKKTAAYCLRSDSLQTCGGMKTADLI"
FT   gene            633318..633779
FT                   /locus_tag="BLi00630"
FT   CDS_pept        633318..633779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00630"
FT                   /product="putative N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00630"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39570"
FT                   /protein_id="AAU39570.1"
FT                   /translation="MTIHIQQLEAPLNREFVDELINLWNDNTLETADCALDDQDREMIH
FT                   QQLEQYVQSAYGAVFAVVNEKQEAVGYGLASIKKDLVSDCLSGQIDEVYIAPDYRRNKL
FT                   GKLVADRMMDWFEQHQVSHVQVSVDIDNQSALHFWEGIGFSSDFYLLTN"
FT   gene            complement(633844..634518)
FT                   /gene="yoqW"
FT                   /locus_tag="BLi00631"
FT   CDS_pept        complement(633844..634518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yoqW"
FT                   /locus_tag="BLi00631"
FT                   /product="DUF159 family protein YoqW"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00631"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39571"
FT                   /protein_id="AAU39571.1"
FT                   /translation="MCGRFTLFSEFDEIIDRFEIDQMAIEDYSPSYNIAPSQYILAVIN
FT                   DGSHNRLGRLRWGLIPPWSKDEKIGYKMINARAETLAEKPSFRKPLIRQRCLIPADSFY
FT                   EWKRTDAKTKRPMRIKLKTNRLFSFAGLWEKWQPAGGKPVYTCTIITTTPNDLMKDIHD
FT                   RMPVILDRQAEKEWLNPKNQNLAYLESLLKPYASKEMEAYEVAPLVNSPHHNSPELIKK
FT                   AP"
FT   gene            634950..635564
FT                   /locus_tag="BLi00633"
FT   CDS_pept        634950..635564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00633"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00633"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39572"
FT                   /protein_id="AAU39572.1"
FT                   /translation="MPLQLYEKEQILDACLEVFARHGYAKTSTGMLAEAAGISKALIFH
FT                   HFKSKKDLYLTVLDYCIEKVKSRLSLDDLASYDDFFEAKEKISMAKLEFFADYSNVYKL
FT                   TKDAFYSPPSELKKEIAAKYGEQFAVRNRILKQLFAKVPLREGVDREEAFELIMVMMGH
FT                   FEQKFLAEVTAEDDFDPAWSRRLLEERKRFLDMIRFGIEGE"
FT   gene            635580..638201
FT                   /gene="pps1"
FT                   /locus_tag="BLi00634"
FT   CDS_pept        635580..638201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pps1"
FT                   /locus_tag="BLi00634"
FT                   /product="phosphoenolpyruvate synthase Pps"
FT                   /EC_number="2.7.9.2"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00634"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39573"
FT                   /protein_id="AAU39573.1"
FT                   /translation="MGHYVLGFHEIDRTDLPLIGGKGLNLGELSKMDGIQVPPGFCITT
FT                   KAYEKMIGENDKVSEQIDQLSLLKVKDRKQINDLALQIRNGIERAEIAEEIKEAVKSAH
FT                   SNAGGDAYAVRSSATAEDLPHASFAGQQDTYLNIKGIEAILKHISKCWASLFTERAVIY
FT                   RIQNGFDHRKVQLSVVVQQMVFPDASGILFTADPITSNRKVTSIDASFALGEALVSGTV
FT                   SADNYKVREGAIIQKTISEKKTAVYSLESGGTEAREVEAGCRKEQTLTDEQIIRLEKLG
FT                   RRIEAHFGFPQDIEWCLADGEFFFVQSRPITTLFPLPKQSDDKLRVYMSVGHQQMMTEP
FT                   INPLGISFFGLISDYELTCAGGRLFIDLSHDLASFAGRKVVLSTAGKNDPFMHSALVNF
FT                   LKRKELVKTLPKGKRMFRLGAEGLSWSLPGDALKIYRKNDTDVVKRLMSKAEASIQEAE
FT                   QRLKNASGETLFAQIEEDQKSLKKVLYDSESMAVIMVGLYAVYWLNRKMEKWLGEKNVA
FT                   DTLSQSVLYNVTSEMGLALLDVSDAARGYPEVQKYLAYANNETFFEDLKQLDGGPAFIG
FT                   ALRAFLEKYGMRCTGEIDITKTRWSERPSILAPIILSNIKNFEPGARTAKFEQGRLEAE
FT                   KKERDLLSRLQQLKGGRQKAKRTKKMISVLRNFIGYREYPKYALIKRYFIYKEALMKEA
FT                   AVLQQKKLIQAKEDIYYLSFDELKEAVCTNRLDVKKIEERKAEYRHYEKLTPPRIMTSE
FT                   GEVITGEALGDHIPAGALAGVPVSSGIIEGRARVILKLEEADIEEGDILVTPFTDPSWT
FT                   PLFVSIKGLVTEVGGLMTHGAVIAREYGLPAVVGVEHATKEIKDGQKIRINGSEGYVEI
FT                   LE"
FT   gene            complement(638229..638513)
FT                   /gene="yoaF"
FT                   /locus_tag="BLi00635"
FT   CDS_pept        complement(638229..638513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yoaF"
FT                   /locus_tag="BLi00635"
FT                   /product="YoaF"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00635"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39574"
FT                   /protein_id="AAU39574.1"
FT                   /translation="MEMNLFWIGLGLAALGYFIGDGLKNFKNPKGIYSGYPYLIKEDDL
FT                   HYYLGLSKVETKEMLRKYPDIPKIELNGTTYYPYQQLMDWMLSADLYKN"
FT   gene            complement(638579..638941)
FT                   /locus_tag="BLi00636"
FT   CDS_pept        complement(638579..638941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00636"
FT                   /product="DUF488 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00636"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39575"
FT                   /protein_id="AAU39575.1"
FT                   /translation="MPFILQRIYQENQQTEGRRILIDRVWPRGISKEKANPDCWMKEIA
FT                   PSPELRKWFGHDPKKFESFKEAYQNEIKQNAEKQKSFRELKKMAADETVILLYGAKDER
FT                   HNHAVVLYEMLNRQSL"
FT   gene            complement(639025..639789)
FT                   /gene="dltE"
FT                   /locus_tag="BLi00637"
FT   CDS_pept        complement(639025..639789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dltE"
FT                   /locus_tag="BLi00637"
FT                   /product="putative oxidoreductase DltE"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00637"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39576"
FT                   /protein_id="AAU39576.1"
FT                   /translation="MELSGNTVLITGGASGIGFAFAERFIKAGNTVIVCGRRESKLKEA
FT                   KEKHPELITCVCDVAVETERLALFEWIKEHHPGVNVLVNNAGIQQRYHILKADVIDNWA
FT                   DYNKEITVNMEAPIHLAMLFSRYFAEKAGKTAIINVSSGLAFTPMAVAPIYSSTKAALH
FT                   SFTMSLRHQLSEAGVEVIEVAPPAVNTDLGGVGLHDSGAPLDEFADAIFKGLEEGRLEI
FT                   GYAVSEKALRMSRDEIDESVSQLYSSLKHSIE"
FT   gene            639941..641413
FT                   /gene="pnbA"
FT                   /locus_tag="BLi00638"
FT   CDS_pept        639941..641413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnbA"
FT                   /locus_tag="BLi00638"
FT                   /product="para-nitrobenzyl esterase PnbA"
FT                   /EC_number="3.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00638"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39577"
FT                   /protein_id="AAU39577.1"
FT                   /translation="MYDTTVETRFGKLKGRAENGVRIFKGVPYAKPPVGDLRFREPQRM
FT                   EAWEGELDAFQFGPVCPQPDGVLPESAGVQKSEDCLYLNVYAPEEADGDLPVMVWIHGG
FT                   AFYRGAGSEPLYDGTQLAKQGKVIVVTINYRLGPFGFLHLSSIDDSYSSNLGLLDQIAA
FT                   LEWVKDNIAFFGGDRHHITVFGESAGSMSIASLLAMPKAKGLFQQAIMESGASATMSDK
FT                   LAKAAAERFLRILDIDHHHLERLHDVSDQELLEAADQLRTLMGENIFELIFLPALDEKT
FT                   LPLKPEVAVAKGAAKEINLLIGTNRDEGVLFFPSDSDLLPESKINEILEEYMGKEAAEA
FT                   ASSLYPRSLEGHVDMMTDLIFWHPSVVFASAQSRYASVFMYRFDWHADSEQPPFNKAAH
FT                   GLEIPFVFGNMDILEQLTGTKAGEEAQLLAEQIQAAWVSFARSGNPSTDDVSWPDYDED
FT                   SRKTLIFDQEVAVESDPYSDKRKMLTAPNPQI"
FT   gene            complement(641438..642715)
FT                   /gene="iolF1"
FT                   /locus_tag="BLi00639"
FT   CDS_pept        complement(641438..642715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iolF1"
FT                   /locus_tag="BLi00639"
FT                   /product="D-chiro-inositol transport protein IolF"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00639"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39578"
FT                   /protein_id="AAU39578.1"
FT                   /translation="MPGRKKGSLKSTITVAMSNYLEAGSIVAGAGGLSLWVEYLGLDDA
FT                   RVGLLGALSANGFGAAIGAFLGGFLVDRYGRKFIYKYDLLVYMLGVLLIAASFNFPMLL
FT                   TGYIVTGIAVGAAIPAAWTYIAEEAPDHERAGRVGWGQLAWSVGPALTLLLSVALAPLG
FT                   LMGSRLIFAQLFVVAVITWILQQQIHESSIWEEQKRKEAEDKAKGVEEKASIKELLTNK
FT                   ANLRAMILLIGIYAFWNLVAGTMGYFMPYIYETVGGLTAAQANLLQAFLWILTVASTYF
FT                   VFIRLGDKVNRKLLFGIGAAMATAAWVILTFGTMNITELLLFVCLWGISAGFGAQAFYG
FT                   LWAAELFHTKYRALAQGFMFFIVRIGVGLISLVVPAMITGLGFKTAGAVMIAFLVIHMI
FT                   IGLRMAPETRGKSLEAIQSERYHQSG"
FT   gene            643085..643765
FT                   /gene="ydjF"
FT                   /locus_tag="BLi00640"
FT   CDS_pept        643085..643765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydjF"
FT                   /locus_tag="BLi00640"
FT                   /product="phage shock protein A-like protein YdjF"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00640"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39579"
FT                   /protein_id="AAU39579.1"
FT                   /translation="MSILSRFKDIMASNINALLDKAENTEKMVDQYVRNLNSDLNKVKA
FT                   ETASVMAAEQRAKRELADCRAEIDKLERYAMKALEAGSEADARTFLEKKAVLETKASEL
FT                   ETAFQTASSNANQMKKMHDKLVSDIGELEARRAAIKAKWTAAKTQERMNKLGASAANAN
FT                   HSMSAFGRMEEKANRALDEANAMAELNAAPQDDIEDLKAKYDSPSNVDDALAALKAKMA
FT                   GQKS"
FT   gene            643800..644825
FT                   /gene="ydjG"
FT                   /locus_tag="BLi00641"
FT   CDS_pept        643800..644825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydjG"
FT                   /locus_tag="BLi00641"
FT                   /product="YdjG"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00641"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39580"
FT                   /protein_id="AAU39580.1"
FT                   /translation="MVISYKCPGCGDDMAFDAESGTLACRSCGRQDKIENIPEELKTAR
FT                   FTEDEATEYHCQNCGAILITEKETTATSCSFCGGAAVIADRLSGSLAPAKVIPFTISKE
FT                   EAADAFRKWCRKGLLTPKGFMSADRIKSITGMYVPFWMYDLNSKVQVSARCTKVHRYIQ
FT                   GDYIYTETEHYDAFRDINLDYIKVPVDASEKMNDQLMDKLEPYPYDQLKDFKTAYLAGY
FT                   IAEKYNYDDEELFPRAKSKISGYIESYIDSTLSGYSSVDVKTKHVDTQKVKSLYVLLPV
FT                   WMVNYNYKQKDYIFAMNGQTGKVVGKPPISSFKEKMWFSGLAVSIFALWKIIAAVMGGG
FT                   A"
FT   gene            644825..645592
FT                   /gene="ydjH"
FT                   /locus_tag="BLi00642"
FT   CDS_pept        644825..645592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydjH"
FT                   /locus_tag="BLi00642"
FT                   /product="YdjH"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00642"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39581"
FT                   /protein_id="AAU39581.1"
FT                   /translation="MRSLLRSAMILCMIFLVFIPIASGAAASEQKRFVYDEAGLLTKQE
FT                   IEKLETLAAKLGAERETDFIIVTTNDTNGRDVKKYAEDFYDEKAPGYQKKHGNAAVLTV
FT                   DMEHREVYLAGFKKAEEYLNDARLDKIREKITPDISDKHYEAAFEMFMKAAHDDMEKKP
FT                   WADSIFFKTWFQLLVSAVIAGIAVAIMKYNSGGKVTVSASTYMNGDTSGVIRNNDEYIR
FT                   TTVTKQRKPSNNKSSGGGTTSGGHSHSGSRGSF"
FT   gene            645614..646588
FT                   /gene="ydjI"
FT                   /locus_tag="BLi00643"
FT   CDS_pept        645614..646588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydjI"
FT                   /locus_tag="BLi00643"
FT                   /product="YdjI"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00643"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39582"
FT                   /protein_id="AAU39582.1"
FT                   /translation="MVFFRNQFANVVEWDEFRDDMIFYKWNNREIKKGSRLIIRPGQDA
FT                   VFLNNGKIEGIFQDEGDYDIESEIIPFLSTLKGFKFGFNSGMRAEVLFVNTKEFTVKWG
FT                   TKNAINIPAAGLPGGMPIRANGRFNFKVNDYVALIDKIAGVKDQYVVEDIKIRITSILD
FT                   QLLMKWITKEGKDMFNLQANAFDIAKGIKEDLDMEIVGDGMTITGFNIMSFNYPKEVQD
FT                   MITKNASHGMVGDLNRYQQISMTDGMASGKMTGGGAASDMAGMMMGMNVANQMMNQMNQ
FT                   NQQAQTQTPPSAPQPAAKPNFCPNCGTKTGEANFCPNCGQKLV"
FT   gene            646848..647903
FT                   /locus_tag="BLi00644"
FT   CDS_pept        646848..647903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00644"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00644"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39583"
FT                   /protein_id="AAU39583.1"
FT                   /translation="MELGISTFVETTPDIKTGKVISHAERLREVVEEIVLADQVGLDVF
FT                   GVGEHHRQDYAASSPAVVLAAAASQTKRIRLTSAVTVLSSADPVRVFQDFATLDGISNG
FT                   RAEIMAGRGSFIESFPLFGYDLDDYDELFEEKLDLLLELQKSERVTWSGKHRPAIHNTG
FT                   VYPRPVQKPLPVWIGSGGNQESVVRAGLLGLPLVLAIIGGSPQHFAPLVELYYKAAEHA
FT                   GHDASKLIVASHSHGFIAEDTETAADRFFPSTQQAMNTLARERGWGPYSRSSFDAARSF
FT                   EGALYVGDPETVAEKIIHLRKNVGITRFLLHVPVGSMPHEDVMKAIELFGTKTAPLVRE
FT                   EVSRWEASERS"
FT   gene            complement(647936..648763)
FT                   /gene="yrhO"
FT                   /locus_tag="BLi00645"
FT   CDS_pept        complement(647936..648763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrhO"
FT                   /locus_tag="BLi00645"
FT                   /product="putative transcriptional regulator YrhO"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00645"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39584"
FT                   /protein_id="AAU39584.1"
FT                   /translation="MKENILDVLKNLNFTEYESKAYLALLEESPLTGYAVAKKSGVPRS
FT                   KIYEVLESLVIRGDIFVSYGNTPQYIPVPAKDLIKNRRMKAEETFEQAEKYFEKFERTA
FT                   NDRENIWNITGRSEILDKVKACISSAGKRILLEIWKEDFPELEPELKRAAKKGVIVTII
FT                   AYGDIEADFANVYLHDNSRQITEEYDGRWLVFSVDDSEVVAGIVSHGKDSRAAWTMHVG
FT                   LVMPITEVMIHDLYLMEIMEKHREVLEESFGENLIHLRRKFSIHPDFKKHYMK"
FT   gene            648910..649542
FT                   /gene="yrhP"
FT                   /locus_tag="BLi00646"
FT   CDS_pept        648910..649542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrhP"
FT                   /locus_tag="BLi00646"
FT                   /product="putative efflux protein YrhP"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00646"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39585"
FT                   /protein_id="AAU39585.1"
FT                   /translation="MDSLLSYISIAAMMVVIPGADTMLVVKNTLRYGPNAGRCNVLGLA
FT                   TGLSFWTLIAVLGLAVVIAKSVILFNTIKYLGAAYLIYLGIKSFFAKKMFSLEEIQAEK
FT                   NKNENASSRHYKDSFMQGLFSNILNPKTVLVYITIMPQFINLRESVNQQLIILALILTF
FT                   LAVFWFLILVYLIDFAKKWLRSVKFQKIFQKAAGLVLVGFGVKTGLD"
FT   gene            649737..650381
FT                   /locus_tag="BLi00647"
FT   CDS_pept        649737..650381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00647"
FT                   /product="putative HTH-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00647"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39586"
FT                   /protein_id="AAU39586.1"
FT                   /translation="MDEQKKNQLGVLLKEQLRKRSLSLRELSERTQIDKATISRIINGK
FT                   RKANLNHLQRFSESFGVSFDELMTAAGYAMEKTQESERPDIHSSVAEIEDVLQTSNVYD
FT                   RPFTMEELKNKLNECEQYSQTEEGKRTILAEFESKIEKVAGIGPFLTRLHDMYSRFTSG
FT                   RGTPRELLLMGGALLYFIVSVDVIPDYIFPIGYIDDAAAVHFVFNQLSYKS"
FT   gene            650397..651554
FT                   /locus_tag="BLi00648"
FT   CDS_pept        650397..651554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00648"
FT                   /product="rod shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00648"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39587"
FT                   /protein_id="AAU39587.1"
FT                   /translation="MKRKHINIDISLLLILFCLFIISLLAVYSGSGQYETQDPFYFAKR
FT                   QVFWYLVGFGVMAGTAYIDYELLERLALRLFVGAVFLLILVHFFGTYKNGSQRWISFGV
FT                   IEIQPSEFMKIILILLLASILNQFQHKRFSFAESIIPTGKIMMYTVIPFFFILVQPDLG
FT                   SALVILSIAFTLMLVSGISGRMIVSLSLGFMALVAFLTYLHNHYFEIFSKIIKPHQLDR
FT                   IYGWLSPHEHASTYGYQLTQALLGIGSGQLSGSGFTQGIQVQGGKIPEAHTDFIFAVIG
FT                   EEFGFLGAVTLVCLYFLMIYRIIRIALSSNSLFGLYICAGVAGLIVFQVFQNIGMTIGL
FT                   MPITGLALPFISYGGSALLTNMIALGLVFSVNIRSKHYMFGNDWG"
FT   gene            651551..652699
FT                   /locus_tag="BLi00649"
FT   CDS_pept        651551..652699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00649"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00649"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39588"
FT                   /protein_id="AAU39588.1"
FT                   /translation="MKLLKMILSHLKKLDYVLIAAVLFLSAFGLLMVYSAGYPLGYMKY
FT                   HDGSYFFMKQLQWLLIGLAFFSAAAIFPYKAYSKLIRFLVKLSFLMLILVLLPGIGMEK
FT                   NNSQRWIQFGSLMIQPSEAVKLVMVIYFAYVYAKKQKYIADFGKGVMPPLLILAAVFFL
FT                   ILKQPDLGTAVSILLSCGAVLLCAGLRMRHLLLLGTMAGAGIAYFAITAPYRLKRLTSF
FT                   SDPFQNENGDGYQLINSYLAIDSGGLWGNGLGNSVQKLGFLPEAHTDFIMAVITEELGG
FT                   IGLAVIIWAYLLIMFRGVRIAVQIDDPFGKLLAVGLTFQIMIQALFNLGAVFGLLPITG
FT                   IPLPFVSYGGSSLLFMLTTAGILVNLSSHVKRGVKKDVAFLL"
FT   gene            complement(653388..653813)
FT                   /locus_tag="BLi00651"
FT   CDS_pept        complement(653388..653813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00651"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00651"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39589"
FT                   /protein_id="AAU39589.1"
FT                   /translation="MKTRFTPYILMNGRAKEAIDYYRDVLDAEVKFSQTIGEGPADEAA
FT                   NFKEDELDFIAHAVLTIGDAVLMIADIIPELPFQSGNQLSICVTAADVSSAKRLFGKLS
FT                   ERGEVKLELKETYFSPAYGIVTDPFGVAFQIFAARPA"
FT   gene            653908..654855
FT                   /locus_tag="BLi00652"
FT   CDS_pept        653908..654855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00652"
FT                   /product="putative HTH-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00652"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39590"
FT                   /protein_id="AAU39590.1"
FT                   /translation="MSKAKRLNEMIMMVNRKKRFTVGELAREFGVSKRTVLRDLQELSE
FT                   MGVPLYSETGPHGGYQVLNERILPPIAFSENEAISIFFAIDALKHYISLPFDAQYASIK
FT                   KKFYLNLSGDIRDAIDSMKDRVAFYTPYEQTDDIPVLKVLLEAAVQQKVLIIEYEANGA
FT                   SSKRSIQPIGIYANQGKWYCPAYCFLRKDYRIFRCDRIKRAELDEHKAPIDLSGLNLKN
FT                   RFSALSRPRETLELSAELTKKGVERHGSLKWPHLELHVREDGSGVLKGEIAPKDIDFFA
FT                   DYFISFGREAVIQKPSKLIERMKRTLSDMLKQYG"
FT   gene            655133..655810
FT                   /locus_tag="BLi00654"
FT   CDS_pept        655133..655810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00654"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00654"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39592"
FT                   /protein_id="AAU39592.1"
FT                   /translation="MKKAMAILGFLVLTASLLFIINKGTSQINASQNRKAAVHTEYYKD
FT                   ISSLSFPVFSDLKEEDAKLANDAVKLHLKNSYKEFQKIVNDAEKKDKDEENVYETSYKV
FT                   KYNEEGKLSFLIYDYQFSGGAHGMYTVTSYNFDFDKHKQVVLTDVLNNQAKIEKAKNYI
FT                   FSYINEHPEQFYSDLKKSDIRLDEHTAFYYTSSGISIVFQQYDIAPYAAGNQEIKLPST
FT                   LLY"
FT   gene            655915..657261
FT                   /gene="yjeA"
FT                   /locus_tag="BLi00655"
FT   CDS_pept        655915..657261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjeA"
FT                   /locus_tag="BLi00655"
FT                   /product="extracellular DNase YjeA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00655"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39593"
FT                   /protein_id="AAU39593.1"
FT                   /translation="MLIFLTILIGLAGYSYNKVSSNSQEPPQPKKDRGQSGLGVESMVN
FT                   DSKQERYAIHYPVFHIKEIDEQIKDYVNQELAGFKEDNAKAQAQDEDGPFELNIKYKVV
FT                   YYTKDTASVVLNQYIEAGGVSGTTSVKTFNADLKQKKLLSLQDLFEENSDFLNRISSIA
FT                   YQELKNRNPSADMALLKEGTSPQEEHFSRFALLENEVEFYFEKKQTGLEQSVKIKKEWV
FT                   KDILKDRYQDMKKNRLQAKPDQEPVPLPKQAKINPDEKVIALTFDDGPNPATTNKILNA
FT                   LQKHEGHATFFVLGSRAQYYPETIKRMLKEGNEVGNHSWDHPLLTRLSNEKAYQEINDT
FT                   QEMIEKISGHLPVHLRPPYGGINDSVRSLSNLKVSLWDVDPEDWKYKNKQKIVNHVMSH
FT                   AGDGKIVLMHDIYATSADAAEEIIKKLKAKGYQLVTVSQLEEVKKQRGY"
FT   gene            657390..658928
FT                   /gene="amyS"
FT                   /locus_tag="BLi00656"
FT   CDS_pept        657390..658928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amyS"
FT                   /locus_tag="BLi00656"
FT                   /product="alpha-amylase AmyS"
FT                   /EC_number="3.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00656"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39594"
FT                   /protein_id="AAU39594.1"
FT                   /translation="MKQQKRLYARLLPLLFALIFLLPHSAAAAANLKGTLMQYFEWYMP
FT                   NDGQHWKRLQNDSAYLAEHGITAVWIPPAYKGTSQADVGYGAYDLYDLGEFHQKGTVRT
FT                   KYGTKGELQSAIKSLHSRDINVYGDVVINHKGGADATEDVTAVEVDPADRNRVISGEHR
FT                   IKAWTHFHFPGRGSTYSDFKWHWYHFDGTDWDESRKLNRIYKFQGKAWDWEVSNENGNY
FT                   DYLMYADIDYDHPDVAAEIKRWGTWYANELQLDGFRLDAVKHIKFSFLRDWVNHVREKT
FT                   GKEMFTVAEYWQNDLGALENYLNKTNFNHSVFDVPLHYQFHAASTQGGGYDMRKLLNGT
FT                   VVSKHPLKAVTFVDNHDTQPGQSLESTVQTWFKPLAYAFILTRESGYPQVFYGDMYGTK
FT                   GDSQREIPALKHKIEPILKARKQYAYGAQHDYFDHHDIVGWTREGDSSVANSGLAALIT
FT                   DGPGGAKRMYVGRQNAGETWHDITGNRSEPVVINSEGWGEFHVNGGSVSIYVQR"
FT   gene            659091..660041
FT                   /gene="mdxR"
FT                   /locus_tag="BLi00657"
FT   CDS_pept        659091..660041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdxR"
FT                   /locus_tag="BLi00657"
FT                   /product="putative HTH-type transcriptional regulator MdxR"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00657"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39595"
FT                   /protein_id="AAU39595.1"
FT                   /translation="MATLSDVAKKANVSKMTVSRVINHPETVTDELKKLVHSAMKELNY
FT                   IPNYAARALVQNRTQVVKLLILEEMDTTEPYYMNLLTGISRELDRHHYALQLVTRKSLN
FT                   IGQCDGIIATGLRKADFEGLIKVFEKPVVVFGQNEMGYDFIDVNNEKGTYMATRHVIGL
FT                   GVRNVVFFGIDLDEPFERSREKGYLQAMEGSLKKAAIFRMENSSKKSEARAREVLASFD
FT                   APAAVVCASDRIALGVIRAVQSLGKRIPEDVAVTGYDGVFLDRIASPRLTTVRQPVVEM
FT                   GEACARILLKKINEDGAPQGNQFFEPELIVRESTL"
FT   gene            660157..661920
FT                   /gene="yvdF"
FT                   /locus_tag="BLi00658"
FT   CDS_pept        660157..661920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yvdF"
FT                   /locus_tag="BLi00658"
FT                   /product="neopullulanase YvdF"
FT                   /EC_number="3.2.1.135"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00658"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39596"
FT                   /protein_id="AAU39596.1"
FT                   /translation="MMEYAAIHHQPFSSDAYSYNGRTLHIKIRTKKDDAEHVRLVWGDP
FT                   YEYTGGTWKANELAMAKIAATSTHDYWFAEVAPPFRRLQYGFILTGADDRDTFYGSNGA
FT                   CPFAGKAADIGKHCFKFPFVHEADTFDAPDWVKSTVWYQIFPERFASGREDLSPENALP
FT                   WGSKDPEAHDFFGGDLQGIMDKLDYLEDLGVGGIYLTPIFAAPSNHKYDTLDYCSIDPH
FT                   FGDEELFRTLVSRIHERGMKIMLDAVFNHIGSASQEWQDVVKNGETSRYKDWFHIHSFP
FT                   VKEGSYDTFAFTPEMPKLNTANPEVQAYLLDIALYWIREFDIDGWRLDVANEVDHAFWK
FT                   KFRQAVTAEKPDIFILGEIWHQADPWLRGDEFHSVMNYPFTEPMIDYFADGSISASQMA
FT                   SRINSHLMSGMKQVNEVMFNLLDSHDTKRILTRCGGDDKKVRSLLAFMFAQTGSPCIYY
FT                   GTEVGLDGGDDPLCRKCMVWEEEKQNQEMLAFMKRLIALRKQENDVLTYGALEWKLVDD
FT                   QNDFVSFSRTHEGKELIYFFHQGSEVRRVRLRDLKIASDKRIYDAWTEEALQHDDVVDI
FT                   QPGGFFILGAV"
FT   gene            662015..663268
FT                   /gene="mdxE"
FT                   /locus_tag="BLi00659"
FT   CDS_pept        662015..663268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdxE"
FT                   /locus_tag="BLi00659"
FT                   /product="maltooligosaccharide ABC transporter
FT                   substrate-binding protein MdxE"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00659"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39597"
FT                   /protein_id="AAU39597.1"
FT                   /translation="MQHLKKGILVLLASVLLFGLAACSSSKETGGSGGKKVLTVSVEEV
FT                   YKPYVESIKEGFEKENDVTVKIVEKPMFDQLEALPLDGPAGNAPDVMLAAYDRIGGLGQ
FT                   QGHLLEVKPSDTKSFGDKEMQQVTVGGKVYGIPLVIETLVLYYNKDLLKTPPKTFNELE
FT                   DLTKDKRFAFSSEKGKSTAFLAKWTDFYMSYGLMAGYGGYVFGADGTDSGDIGLNNKGA
FT                   VEAVEYAEKWFSEYWPKGMQDNTSADDFIQQTFMDGKAAAVIGGPWSASNYKEAGLNYG
FT                   AAKIPTLPNGKEYAPFAGGKGWVASKYTKEPELAEKWLQYAANDENAYRFYEDTNEVPA
FT                   NLAARKKAGEQKSELTSAVITQYETATPTPNIPEMAEVWTGAESLIFDAAAGKKSAQQS
FT                   ADDAVRVIKENIKEKYVK"
FT   gene            663310..664617
FT                   /gene="mdxF"
FT                   /locus_tag="BLi00660"
FT   CDS_pept        663310..664617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdxF"
FT                   /locus_tag="BLi00660"
FT                   /product="maltooligosaccharide ABC transporter permease
FT                   MdxF"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00660"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39598"
FT                   /protein_id="AAU39598.1"
FT                   /translation="MNKDQTLANRSRKAALLSIIPGAGQIANRQFSKGILFLVITGLFI
FT                   CELAIFGYQALIGLVTLGTVPGEDHSLFLLIEGTLQLILTLVFLMFYIFNLYDARKTAA
FT                   MKAAGLKISETAGDMIRNAGDKGFPYLFTLPAYLMMVFVIIFPVLVTLFIAFTNYDFYH
FT                   IPPNSLIDWVGFKNFMNIFFLGSYRQTFADVLGWTIIWTICATTLQIVLGIVTALIVNQ
FT                   NFIKGKRMFRIIFLLPWAVPAFITIMSFANIFNDSAGAMNVQVIPLLNQLPFVDIPAVA
FT                   WKTDPFWTKTALIMIQTWLGFPYIYVMVTGVLQAIPGELYEAAKIDGATFIQRFKHITL
FT                   PMILFATAPVMITQYTFNFNNFSIIYLFNEGGPGSAGAGAGSTDILISWIYKLTTGTSP
FT                   QYSVAAAVTLLISFIVIGVSLIAFKKSNAFGNEEVM"
FT   gene            664618..665469
FT                   /gene="mdxG"
FT                   /locus_tag="BLi00661"
FT   CDS_pept        664618..665469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdxG"
FT                   /locus_tag="BLi00661"
FT                   /product="maltooligosaccharide ABC transporter permease
FT                   MdxG"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00661"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39599"
FT                   /protein_id="AAU39599.1"
FT                   /translation="MRGLFKNTRFTGMLNKVLTYIFLAFLSIVIIYPLLITASSAFRVG
FT                   NVAAFTLDFSGAWTLDHFKRLFEETLYLNWYGNTLVIALSVMVFQVTIVTLAGYTYSRY
FT                   RFAGRKKSLIFFLIIQMVPTMAALTAFYVLAMLIGALDQYWFLTAIYIGGGIPMNTWLM
FT                   KGYFDTVPREIDEAARIDGAGHLRIFASVVLPLVKPMLAVQALWAFMGPFGDYLLAKFL
FT                   LRSPESLTIAVGLQTFISNPQQQKVALFAAGAILAALPICILFFFLQKNFVSGLTSGGT
FT                   KG"
FT   gene            665474..666355
FT                   /gene="yvdJ"
FT                   /locus_tag="BLi00662"
FT   CDS_pept        665474..666355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yvdJ"
FT                   /locus_tag="BLi00662"
FT                   /product="putative maltodextrin utilization protein YvdJ"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00662"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39600"
FT                   /protein_id="AAU39600.1"
FT                   /translation="MNDMRNEKLIVRFLKAAASPAGVMRCKHAFSWLEISFLFMFLTAC
FT                   LMAPMTLAFMKMDRFNAGYLIPNVAQEADAAFIKQLKGYQLTNGRLKGEDELYRVEKGR
FT                   TLLAVDLKDELKTSGENGRIKAEGYQNALIFQSDHLIISDQSGAGFSVRYPAKAGLNDL
FT                   DAGHLGDFIGAMWFAQYKPLIIMLACSAVFIISLFLTAVLAGGIWISKKSNMTGIRSFK
FT                   EAAAAAVCGSALPAGAAMAFGMISFDFIAMLLIHSCGSALMVSFIFRHIFKNRHHNENL
FT                   QSGGNHGKSAAI"
FT   gene            666333..668615
FT                   /gene="yvdK"
FT                   /locus_tag="BLi00663"
FT   CDS_pept        666333..668615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yvdK"
FT                   /locus_tag="BLi00663"
FT                   /product="maltose phosphorylase YvdK"
FT                   /EC_number="2.4.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00663"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39601"
FT                   /protein_id="AAU39601.1"
FT                   /translation="MANQRLFEIDQWKIKTNKFEKEHKRLQESLTSLANGYMGIRGNFE
FT                   ESYSGESLKGTYIAGVWFPDKTRVGWWKNGYPEYFGKVINAMNFIGIDVYVDDEKVDLS
FT                   QNDIESFELELNMKEGILRRSAVVRVNQKAVKISSERFLSLDVPQLCAIHYEAECLSDE
FT                   AVITLVPYLDGNVANEDANFEERFWQEEAKGAESHRGHLVTKTIENPFGTPRFTVAASM
FT                   CNVTEGYVSEHFQTDAMYAENRYCYEVGPGTKASLKKLIIVTTSRDFEEAELLVQGRAL
FT                   LADVLRQGYEEAKRRHTEHWMERWAKADIEIKGDDELQQGIRYNLFQLFSTYYGADSRL
FT                   NIGPKGFTGEKYGGAAYWDTEAYAVPMYLATAEPEVTKNLLLYRYHHLEAAKRNAAKLG
FT                   LKGALYPMVTFTGDECHNEWEITFEEIHRNGAICYAIYNYVNYTGDRDYMKEYGIDVLV
FT                   EISRFWADRVHFSKRNNKYMIHGVTGPNEYENNVNNNWYTNLIASWTLEYTLENLAILP
FT                   EEKRRRLDVREAEIEKWKDIIERMYYPYSEELNVFIQHDTFLDKELQAADELEPGDRPL
FT                   YQNWSWDKILRSSFIKQADVLQGIYFFNHRFTMEEKRRNFEFYEPMTVHESSLSPSVHA
FT                   VLAAELKMEKKALELYKRTARLDLDNYNHDTEEGLHITSMTGSWLAIVQGFAGMRTQDE
FT                   KLSFAPFLPKEWDGYSFNINYRDRLINVQVEENSVVFSLLKGEPLSMTVYGEQIALNGR
FT                   YERRMAR"
FT   gene            668612..670318
FT                   /gene="malL"
FT                   /locus_tag="BLi00664"
FT   CDS_pept        668612..670318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malL"
FT                   /locus_tag="BLi00664"
FT                   /product="oligo-1,6-glucosidase MalL"
FT                   /EC_number="3.2.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00664"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39602"
FT                   /protein_id="AAU39602.1"
FT                   /translation="MSQWWKEAVVYQIYPRSFYDSNGDGFGDLQGVIQKLDYIKSLGAD
FT                   VIWLCPVFDSPQDDNGYDISDYRSIYEKFGTNDDMFQLIDEVHKRGMKIIMDLVVNHTS
FT                   DEHAWFAESRKSKDNPYRDYYFWKDPKADGSEPNNWGSIFSGPAWTLDERTGQYYLHYF
FT                   SKKQPDLNWENEAVRREVYDLMTFWMDRGVDGWRMDVIGSISKFVDFPDYETDDSRPYV
FT                   VGRYHSNGPRLHEFIQEMNREVLSRYDCMTVGEANGSDVEEAKKYTDPSRHELNMIFTF
FT                   EHMDIDTKQHSPNGKWQMKPFDPIALKKTMTRWQTALMNVGWNTLYFENHDQPRVISRW
FT                   GNDRELRKQCAKAFATVLHGMKGTPFIYQGEEIGMTNSEMPLEMYDDLEIKNAYRELVI
FT                   ENKTMTEEDFRKAVAKKGRDHARTPMQWDDGKYAGFTDGEPWLAVNPRYQEINVKESLA
FT                   DEDSIFYYYQKLIGLRKQNKVIVYGDYRLLLEEDPRIFAYIREYRGEKLLVAVNLSEEK
FT                   ALFHASPELLEDRWDVLLSNYARERLNISGSIDMEPYEAFMMISRAKDYTS"
FT   gene            670315..670995
FT                   /gene="pgcM"
FT                   /locus_tag="BLi00665"
FT   CDS_pept        670315..670995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgcM"
FT                   /locus_tag="BLi00665"
FT                   /product="bifunctional-phosphoglucomutase/
FT                   glucose-1-phosphate phosphodismutase PgcM"
FT                   /EC_number="3.2.1.28"
FT                   /EC_number="5.4.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00665"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39603"
FT                   /protein_id="AAU39603.1"
FT                   /translation="MKAVIFDLDGVITDTAEYHYLAWKHTAEQIGIEIDRSFNERLKGI
FT                   NREQSLDKILIHGGAAGKFQEAEKQEIMRRKNQYYQQLIQNLTPHDLLPGISVLFAELK
FT                   REHISIALASSSRNAPAILQRLGVMDEFQGVVDPAALAHGKPDPEIFLTAAALLGVPPS
FT                   ECAAIEDAEAGIAAIKSAGMFAVGVGDETSLRGADLIVHNTNELTFELLNEGWQRYCCI
FT                   REGK"
FT   gene            complement(671278..672531)
FT                   /gene="tyrZ"
FT                   /locus_tag="BLi00666"
FT   CDS_pept        complement(671278..672531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrZ"
FT                   /locus_tag="BLi00666"
FT                   /product="tyrosyl-tRNA ligase TyrZ"
FT                   /EC_number="6.1.1.1"
FT                   /note="minor"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00666"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39604"
FT                   /db_xref="GOA:Q65MW0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65MW0"
FT                   /protein_id="AAU39604.1"
FT                   /translation="MQQQQFDQLTTAEKREVERQLHLYMDGAEEVIPPEELRAKLAKSI
FT                   LTGEPLKIKLGLDPSAPDVHLGHTVVLNKLRQFQENGHIVQLLIGDFTGKIGDPTGKSA
FT                   ARKQLTDEEVRRNAETYFQQFGKVLDQNKVELHYNSKWLKRLTLEDVIELAGKITVARL
FT                   MERDDFEERIAMQKPISLHEFFYPLMQGYDSVVLDSDIELGGTDQHFNVLMGRHFQEKY
FT                   GKEKQVVILMPLLEGLDGIEKMSKSKNNYIGIDEDPHEMFGKTMSLPDSLMKKYIHLAT
FT                   DLEAEEKKRLVKDLETGAVHPRDAKMLLGKTIVNMYHGSKAAEAAEQQFKKVFQQNSAP
FT                   DNITAVHWQGGGTVPVTDLLVTLELLPSKSEARRMIQNGGVKINGAKAESIHADIALEH
FT                   GMIIQVGKRKFVKLQMHQ"
FT   gene            complement(672787..673293)
FT                   /gene="ywaE"
FT                   /locus_tag="BLi00667"
FT   CDS_pept        complement(672787..673293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ywaE"
FT                   /locus_tag="BLi00667"
FT                   /product="putative HTH-type transcriptional regulator YwaE"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00667"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39605"
FT                   /protein_id="AAU39605.1"
FT                   /translation="MNRSPHLRQEEHDTLSKLKRMPIESLNLEAISVATNLYRSAQKLR
FT                   VKMETEVLSSYQLSWTAFSILYDLWVWGRLETRKLAELSGISTATASNVIKTLEKKNFC
FT                   VKSADPRDRRHVYAEITPEGKAAIEELYPAFHKGETMLIKGMTKEEQNTLIELLRKVND
FT                   NLHKP"
FT   gene            complement(673430..673996)
FT                   /locus_tag="BLi00668"
FT   CDS_pept        complement(673430..673996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00668"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00668"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39606"
FT                   /protein_id="AAU39606.1"
FT                   /translation="MKKKSAPLILIMALSLLLPFAQAEAAGSKGASGVKASSSSANNSA
FT                   LKTRAGSVNQSMRSYMKQSASRRYLNKNSQFNTIQRTLPPDALYKGSIKRTLNQNPAGS
FT                   AFLNYYFPYWMIFHVGGYTAEQKNILRTAGIKEKALSERKEKRYWLLIEDQNGKKHAVL
FT                   VSKKQYDSIQKGDRIEVRRKQITKK"
FT   gene            complement(673993..674385)
FT                   /locus_tag="BLi00669"
FT   CDS_pept        complement(673993..674385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00669"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00669"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39607"
FT                   /protein_id="AAU39607.1"
FT                   /translation="MKKSKLISLSAAAMLLAVPLSGCSSSASDRSQEVADDQSIQKYDL
FT                   VWFDYVNDSESDKAPLLKAAYVKDGKEKTETFKKYVENVENVEQPYIKIRDQEAFIFRP
FT                   PYIKYDQEPLEGVVKDKVEQKSSDEQ"
FT   gene            674587..674967
FT                   /gene="ydjM"
FT                   /locus_tag="BLi00670"
FT   CDS_pept        674587..674967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydjM"
FT                   /locus_tag="BLi00670"
FT                   /product="YdjM"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00670"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39608"
FT                   /protein_id="AAU39608.1"
FT                   /translation="MKKILFSVFVLAGSLLLAFNFAGEASAKTKKVSGYITWYNGVGKI
FT                   GADGKRLGHWDCATKMGFDVPRKGTKIRAYSKAKPHKVITVYKYDVGRMPGAVLDVSPK
FT                   AFRALGFPTSKGKVAGHYTYKK"
FT   gene            675024..676043
FT                   /gene="ydjN"
FT                   /locus_tag="BLi00671"
FT   CDS_pept        675024..676043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydjN"
FT                   /locus_tag="BLi00671"
FT                   /product="YdjN"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00671"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39609"
FT                   /protein_id="AAU39609.1"
FT                   /translation="MKKVSVVLLAAVILAAGAFAAVRYFVPEKAEPAKSGGSDLLVSIT
FT                   DQKLMTAYYENQNKLYEEKMTDYPAMALDRKKRILYYTNTDNSNVKHLIRLDLQSGKKT
FT                   TLYSGDEYVDGLSLSADGSKLFMRYNLAEERNFHLASFDLKQKAFHVIYPSLKNKDETV
FT                   SYYQYNKADNQFVMLHYSLKEDYQKTDDANNKGVPPEPTNMNISMAGVKDRQKVRTIAK
FT                   FINDVAISPDGKTIVFTESADDQKAIYAMDAETKKYKAIISDQQAFSLVDSAQPQFSKD
FT                   GKKLYFLAEAKDAKLLEDETGSEARVRTIYSYDMDTKKVSKAWEKTNGIINTFTVIDE"
FT   gene            complement(676086..677078)
FT                   /gene="yeaA"
FT                   /locus_tag="BLi00672"
FT   CDS_pept        complement(676086..677078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeaA"
FT                   /locus_tag="BLi00672"
FT                   /product="YeaA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00672"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39610"
FT                   /protein_id="AAU39610.1"
FT                   /translation="MASAKLQQRLDQYKAIYSELKSDLKWKVTDQRTLMMIASMYVVNK
FT                   RPFDKERFLNLSEAVKQAAGTFSPLRSAHRYTFAAMFDVRFEEPETHIRPFFTLYVKMT
FT                   GNGFKKSIFTYLSALILLTKYRDEHDHDSKINRALSIYKGMKDKHVFLTSAGDYPLSVL
FT                   LAGSDMETGELIDYIEAFYQKLNQAGFRKGNDLQFLSHILSLMPEQDSDQLVARSLRIY
FT                   DELTKKHKRPKPVHYPEIGLLALLENGEKDIDAITIMAGALNSDKLFRWQKDMNLKTAV
FT                   NLYMSEKTEDPALLDTGLYQTLEAVIQAQQTAAIAIMTSSAAASQANGS"
FT   gene            complement(677171..677473)
FT                   /locus_tag="BLi00673"
FT   CDS_pept        complement(677171..677473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00673"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00673"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39611"
FT                   /protein_id="AAU39611.1"
FT                   /translation="MSVPKDAACSMPHDHQRSLHDLCRKYMHYHVVLKMKDGSSVHGIL
FT                   EGVNRQEASVLIPEDVTDERQFYGGYGYPRRRFRRFRRRIFPFVFIAALYPFPYY"
FT   gene            complement(677605..677862)
FT                   /locus_tag="BLi00674"
FT   CDS_pept        complement(677605..677862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00674"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00674"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39612"
FT                   /protein_id="AAU39612.1"
FT                   /translation="MSSYEEYYDNYDPYSPEREKERQSMKARRSADSNKTDKTNKTDKT
FT                   AKADKTDKTRSSDDDRFKCRKRKCFSDDDDDRFKCRRMKC"
FT   gene            678150..678698
FT                   /gene="sipS"
FT                   /locus_tag="BLi00675"
FT   CDS_pept        678150..678698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sipS"
FT                   /locus_tag="BLi00675"
FT                   /product="signal peptidase I SipS"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00675"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39613"
FT                   /protein_id="AAU39613.1"
FT                   /translation="MKNSRKKEILSWVKTLVIAAALVMVCRYFLFTPSTVLGDSMYPTL
FT                   EDGNMVMVSKISDIQRFDKIIFHAPDSDENYVKRVIGLPGDTIEMKDDVLYINGKAYDE
FT                   PYLKKNKQKLTLHEHLTDNFTLEKLTGEQKVPEDHLFVMGDNRQNSKDSRFFGFITMDS
FT                   VVGKVEFRYFPFNEIGGIE"
FT   gene            679150..679434
FT                   /locus_tag="BLi00676"
FT   CDS_pept        679150..679434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00676"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00676"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39614"
FT                   /protein_id="AAU39614.1"
FT                   /translation="MFNRQQIDHLLEEKKGELKKKFGSGFIAVFYISILLSICTFFIEY
FT                   KYFLIVLFAPTIIVMLINPPFSEKKGVFRFIAGLYLLLLALATYFWLRA"
FT   gene            679753..680397
FT                   /gene="yhfK"
FT                   /locus_tag="BLi00677"
FT   CDS_pept        679753..680397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhfK"
FT                   /locus_tag="BLi00677"
FT                   /product="putative NAD(P)-dependent epimerase/dehydratase
FT                   YhfK"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00677"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39615"
FT                   /protein_id="AAU39615.1"
FT                   /translation="MKVFVVGANGQIGRRLTKSLNESSEHQVRAMVRNEEQAQALKQSG
FT                   TETALANLEGTVESIAEAAEGCDAIVFTAGSGGNTGADKTLLVDLDGAVKTIEAAEKAG
FT                   IRRFIMVSTLQAHRRENWNEALKPYYVAKHYADRMLEGSELNYTIIRPGGLLNEPGTGR
FT                   VKAAENLERGTIPREDVADTILAALTEEHTFRRSFDLVSGDQTPAEALKSI"
FT   gene            complement(680440..681318)
FT                   /locus_tag="BLi00678"
FT   CDS_pept        complement(680440..681318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00678"
FT                   /product="putative HTH-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00678"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39616"
FT                   /protein_id="AAU39616.1"
FT                   /translation="MNMNDYERIQNAVQFIEEHLQNDLNITDIAAKSCFSPFHFQRLFQ
FT                   AISGFSVYQYIRNRRLSEAALLLEKTDRSILDIAINFGYGSQEAFSRAFSQYFGITPAK
FT                   YRKAKVKLDFQSKINFLEYKERMTGDMNIPKPHITHLNDIHMIGYEYRTNLNDEKYFED
FT                   IPKFYNDFGRNGYFMQIPQKTDPNMCYGLSCRFQDDGGFSFIIGEAVRETAAGEVPEPL
FT                   IYTKIPGGKYAVFHVNGSTESVQNTRRYIYGSWLMNTNYERTEGPDFEVTDVCRSVPPN
FT                   EMKMTIYIPLL"
FT   gene            complement(681421..682962)
FT                   /gene="cotA"
FT                   /locus_tag="BLi00679"
FT   CDS_pept        complement(681421..682962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cotA"
FT                   /locus_tag="BLi00679"
FT                   /product="outer spore coat protein CotA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00679"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39617"
FT                   /protein_id="AAU39617.1"
FT                   /translation="MKLEKFVDRLPIPQVLQPQSKSKEMTYYEVTMKEFQQQLHRDLPP
FT                   TRLFGYNGVYPGPTFEVQKHEKVAVKWLNKLPDRHFLPVDHTLHDDGHHEHEVKTVVHL
FT                   HGGCTPADSDGYPEAWYTKDFHAKGPFFEREVYEYPNEQDATALWYHDHAMAITRLNVY
FT                   AGLVGLYFIRDREERSLNLPKGEYEIPLLIQDKSFHEDGSLFYPRQPDNPSPDLPDPSI
FT                   VPAFCGDTILVNGKVWPFAELEPRKYRFRILNASNTRIFELYFDHDITCHQIGTDGGLL
FT                   QHPVKVNELVIAPAERCDIIVDFSRAEGKTVTLKKRIGCGGQDADPDTDADIMQFRISK
FT                   PLKQKDTSSLPRILRKRPFYRRHKINALRNLSLGAAVDQYGRPVLLLNNTKWHEPVTET
FT                   PALGSTEIWSIINAGRAIHPIHLHLVQFMILDHRPFDIERYQENGELVFTGPAVPPAPN
FT                   EKGLKDTVKVPPGSVTRIIATFAPYSGRYVWHCHILEHEDYDMMRPLEVTDVRHQ"
FT   gene            683234..684244
FT                   /locus_tag="BLi00680"
FT   CDS_pept        683234..684244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00680"
FT                   /product="acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00680"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39618"
FT                   /protein_id="AAU39618.1"
FT                   /translation="MLQKRIEWIDVSKGVGIILVVLGHTPTPDWLKTFIFAFHMPLFFF
FT                   LSGLVYHDGNMTFTSFLLKKIKTLLLPYFIFSVLAYLFWVLVERHFTFTGSSDVDPVVP
FT                   FKGIFYSMPDDYKLTHNPALWFLTCLFIVEILFFIVKRWGKGRLFIVIAVLVSAALGFL
FT                   NYQYLGIKLPWNIEVALTAIVFYSAGFLLKNNLKEMRDRRMLLLTLLLFIAVGCLQTLN
FT                   VRVDMRANEYGNMALFYMTSFLGTAGVIFSSFHLEKARLLQFLGKNSLIILVLHYPVIR
FT                   MLKAVVYYFTQVSLDETYGSLLWSALYTGMTLLVMVPCIFLLNRYPIVLGRKKCN"
FT   gene            complement(684282..684779)
FT                   /locus_tag="BLi00681"
FT   CDS_pept        complement(684282..684779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00681"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00681"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39619"
FT                   /protein_id="AAU39619.1"
FT                   /translation="MMFASSGSSTQESKSSGSSAKTTAAKTSEEKSNDDAKEKTEFGLN
FT                   ETADLDGTHITVTNVKKSMGNEYFKPNNGNEYVVATLNIENKSDKDISYNPLDFQIQNE
FT                   DGQITHNTFGPSDDNDLSSGNLTPNGKVSGTITFETKKSKTYKVIYTPEFWNDKKITFN
FT                   LK"
FT   gene            685426..686298
FT                   /gene="yeaB"
FT                   /locus_tag="BLi00682"
FT   CDS_pept        685426..686298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeaB"
FT                   /locus_tag="BLi00682"
FT                   /product="cation efflux protein YeaB"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00682"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39620"
FT                   /protein_id="AAU39620.1"
FT                   /translation="MERYDELKKGETGAWVSIIAYLVLSAVKLAVGLAFHSEALRADGL
FT                   NNTTDIIASLAVLIGLRISQKPPDEDHPYGHFRAETIASMIASFIMMVVGLEVLYSSGE
FT                   MLFNPKETTPDMIAAWTAAGSAVVMFLVFLYNKRLAKKVNSHALYAAAADNKSDAYVSI
FT                   GTFAGIFASQFNLAWVDTAAAFIIGLIICKTAWGIFKEAAHSLTDGFDIKHISTYKETI
FT                   RKVPGVGNIKDVKARYLGSAIHVEIIVEVRSDLNIAESHDIADEIERRMQEEHSIVHSH
FT                   VHIEPSKEK"
FT   gene            686410..687420
FT                   /gene="yeaC"
FT                   /locus_tag="BLi00683"
FT   CDS_pept        686410..687420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeaC"
FT                   /locus_tag="BLi00683"
FT                   /product="putative ATPase YeaC"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00683"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39621"
FT                   /protein_id="AAU39621.1"
FT                   /translation="MVKLNKFDSSAMRRKRMSYEEMLHPVLGKVADNIDKVMVGKKHIA
FT                   VLSLTAILANGHVLLEDVPGVGKTMMVRTLAKSTGAEFKRIQFTPDLLPSDVTGVSIYN
FT                   PKTLEFEYRSGPIMGDIILADEINRTSPKTQSALLEAMEEGSVTVDGVTMPLSKPFFVM
FT                   ATQNPVEYEGTYPLPEAQLDRFLFKLRMGYPTVREELQVLDLQENRSPIEEIEPVIEKE
FT                   ELAAFQKEAEKVYVDAAIKEYIVGITQKTRSHSAVYLGVSPRGSIALMKAAQAFAFLYN
FT                   RDYVIPDDIQYLAPFTLAHRMILRSEAKFEGKRPEAVLQDIMSKTEVPVGRPMSS"
FT   gene            687420..688631
FT                   /gene="yeaD"
FT                   /locus_tag="BLi00684"
FT   CDS_pept        687420..688631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeaD"
FT                   /locus_tag="BLi00684"
FT                   /product="YeaD"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00684"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39622"
FT                   /protein_id="AAU39622.1"
FT                   /translation="MRERIGLVMYGWKLFILFLLFASTFCYAMFQGGFVSWFLFYSFLP
FT                   FALYAFLFAFYPLKNLTAERRLSQGQYKAGDQLEAFVVLKRKWPFPIMFMIVEDCLPDS
FT                   LGKNRGSAEAKQLLFPWFKKEIKMAYTIDSVPRGDHRLAKIRVRTGDPLGLLERECEIQ
FT                   LEASFLVLPSYQEIAYRASGGSYDEHAGRVSELRRKDSTLASGIREYQPGDRFAWVDWK
FT                   TSARRSQLMTKEFEQTKGDDLLVFMDQSPSEAFEEIVTFTASIIRSAMRSGTNAGLVSI
FT                   GKERNVFPVRQGEEQLRKLFYYLAIADCNAVQPFHSLIEGELGHSDMRKAVKYIVTSRI
FT                   TIELVQALKKPLSGGRPVICLVKKKGGDLSSEESAAVQHLKARGIEVNVIYGEHFSRGL
FT                   AEAR"
FT   gene            688636..690861
FT                   /gene="yebA"
FT                   /locus_tag="BLi00685"
FT   CDS_pept        688636..690861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yebA"
FT                   /locus_tag="BLi00685"
FT                   /product="putative transmembrane protein YebA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00685"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39623"
FT                   /protein_id="AAU39623.1"
FT                   /translation="MLSGGKRNRFGLLLFYVLTFLLLWEWLRPLQYFTDTGHTVFFILF
FT                   IALVFLLTFFKVPWFIRFPVSLGFVLFALHTIFYEGSVFSPSWIALFFQDLKRNFSYIF
FT                   SGMWRDMSPLFRTLLFYVLLWLLVYLLHYWVIYQRRILFFFIMTVVYVAVIDTFTPFDA
FT                   SYAIVRIVLIGFLLLGLLYLERIRESEALKSSKSRFAKWFAPLLLMTAAAVCIGAVSPK
FT                   ADPVWPDPVPFLQTAATGDFASSGRSKVGYGTNDEALGGPFSKDDTWVFTWQGNERSYF
FT                   RVETKSRYTGKGWIEDEKSGASIQLEEDKLDYQWYDESVKTETRKAIVDIDPAYRYDHV
FT                   LYPIGTTEIKLNNFFVPLRMNLNTEKIKPAGKTGADIQNLESYSVTYKSPVFDVDQLRK
FT                   VSLESEGKWARSHEKYLQLPTSLPDRVKTLAHDLTKDEDNIYDKAKAIEKYLGSSEFSY
FT                   ETEDVAVPKGDQDYVDQFLFETKIGYCDNFSTAMIVLLRSAGIPARWVKGYTSGEYAGT
FT                   TADRKRTMYEVTNNNAHSWVEVYFEGQGWVTFEPTKGFLNPEQLVEESSGQQAGAASDK
FT                   KEDDKKNDEGQRPQDAKEQDNKEKPESQAKRDAKADSHAGSDDADRTLLTGAAVLGLLL
FT                   AFAAVLYYTRVKWMPHIIINRLKKRRDEAVFFKAYDELLRQLKRQGMQKEEGQTLREFA
FT                   KTVDERFQSGDMTALTLQYERALYRKEDAAKLWNDSAELWENLIKKR"
FT   gene            691050..692591
FT                   /gene="guaA"
FT                   /locus_tag="BLi00686"
FT   CDS_pept        691050..692591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="BLi00686"
FT                   /product="GMP synthase GuaA"
FT                   /EC_number="6.3.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00686"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39624"
FT                   /db_xref="GOA:Q65MU0"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65MU0"
FT                   /protein_id="AAU39624.1"
FT                   /translation="MTKLVNEMILVLDFGSQYNQLITRRIREFGVYSELHPHTLTAEEI
FT                   KKMNPKGIILSGGPNSVYDEGSFRCDEKIFELDIPVLGICYGMQLMTHYLGGKVEAASQ
FT                   REYGKANIHIEGEPDLFKDLPNEQVVWMSHGDLVVEVPEGFTVDATSHHCPNSAMSKKD
FT                   KKWYGVQFHPEVRHSEYGNDLLKNFVFGVCECVGEWSMENFIEIEMQKIRETVGDKQVL
FT                   CALSGGVDSSVVAVLIHKAIGDQLTCIFVDHGLLRKGEAEGVMKTFSEGFNMNVIKVDA
FT                   KDRFLNKLKGVSDPEQKRKIIGNEFIYVFDDEAEKLKGIDFLAQGTLYTDIIESGTATA
FT                   QTIKSHHNVGGLPEDMQFELIEPLNTLFKDEVRALGTELGIPDEIVWRQPFPGPGLGIR
FT                   VLGEVTEEKLEIVRESDAILREEIAKADLEKDIWQYFTVLPDIRSVGVMGDARTYDYTI
FT                   GIRAVTSIDGMTSDWARIPWDVLEKISTRIVNEVKHINRVVYDITSKPPATIEWE"
FT   gene            693215..694537
FT                   /gene="pbuG"
FT                   /locus_tag="BLi00688"
FT   CDS_pept        693215..694537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbuG"
FT                   /locus_tag="BLi00688"
FT                   /product="guanine/hypoxanthine permease PbuG"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00688"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39625"
FT                   /protein_id="AAU39625.1"
FT                   /translation="MKRYFQFEELGTNYRREMIGGLTTFLSMAYILIVNPLTLSLASVE
FT                   NFPDALRMDQSAVFTATAVAAAVGCFIMGLLAKYPIALAPGMGLNAFFAFSVILNMQIP
FT                   WQTALSGVMVSGLIFIVLSLSGLREKIINSIPYELKMAVGAGIGLFIAFVGLQGSKIVV
FT                   SNPDTIVSFGNIHSGPVLLTVFGLIITVILMVLRVNGGIFFGMLITAIVGMIFGQIDVP
FT                   DKIVGAVPSLAPTFGQAFIHLHDIFTVQMLVVILTFLFVDFFDTAGTLVGVASQAGLMK
FT                   DNKLPRAGRALLADSSATVAGAILGTSTTTAYVESSAGVAAGARSGFAAIVTGVLFLLS
FT                   LFFSPVLSVITSQVTAPALIIVGVLMVANLNKIDWTKFEIAVPAFFTMIAMPLTYSIAT
FT                   GIAIGFIFYPITMIFKGKAKEIHPIMYGLAVVFILYFIFLK"
FT   gene            694754..695512
FT                   /gene="yebC"
FT                   /locus_tag="BLi00689"
FT   CDS_pept        694754..695512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yebC"
FT                   /locus_tag="BLi00689"
FT                   /product="putative tramsmembrane protein YebC"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00689"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39626"
FT                   /protein_id="AAU39626.1"
FT                   /translation="MIEEHHKRNEDDIEQEPASRMSRNSRKKAKKSKETNPSAAKVKSV
FT                   MESVIAALFRYFSFVLDILKSPVRTALDYDRSYFKYSVISMTLLAVFFSLGNFYQLLAG
FT                   RGRILGFGVSVPFMEVFLVVFIYCMAFMFWMAAASWAVSNFMLRYKASFFDITAKYGSL
FT                   LVPFIVPAALWMIFAIINFTAATVILSIVIFMGLTFGTFTLIQSIYEKSEKPRFDLMYC
FT                   VFTVFLLELVFVGATWKLVGGYLLSSLIPV"
FT   gene            695634..695822
FT                   /gene="yebD"
FT                   /locus_tag="BLi00690"
FT   CDS_pept        695634..695822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yebD"
FT                   /locus_tag="BLi00690"
FT                   /product="YebD"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00690"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39627"
FT                   /protein_id="AAU39627.1"
FT                   /translation="MANFLRKAVKQKKEYLIRQLAKPGRLDNLKDLSSYTLSDLEKEHR
FT                   KLHKLDEVRQRDHKHQL"
FT   gene            696008..696562
FT                   /gene="yebE"
FT                   /locus_tag="BLi00691"
FT   CDS_pept        696008..696562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yebE"
FT                   /locus_tag="BLi00691"
FT                   /product="putative mebrane protein YebE"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00691"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39628"
FT                   /db_xref="GOA:Q65MT6"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="InterPro:IPR022930"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65MT6"
FT                   /protein_id="AAU39628.1"
FT                   /translation="MLHSALLNGVIMVGIILVINIIYVTFLTLRMILTLKGQRYLAAFI
FT                   GTIEMLVYVVGLGLVLDNLNQIQNVIAYAVGFGIGIIVGTKIEEKLALGYITVNAITKE
FT                   LDLDLPKQLREKGYGVTHWVVGGLEGDRTAMQILTPRKYELQLYETIKSIDSKAFIISY
FT                   EPKTIHGGFWVKAVKKRRIKE"
FT   gene            696562..696759
FT                   /gene="yebG"
FT                   /locus_tag="BLi00692"
FT   CDS_pept        696562..696759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yebG"
FT                   /locus_tag="BLi00692"
FT                   /product="YebG"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00692"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39629"
FT                   /protein_id="AAU39629.1"
FT                   /translation="MTKPKKKRFEVTEGETIETVLTKMQEEGYTPVRRMEEPVFKETKE
FT                   NGTIQVVPCGRKIIFEGKLL"
FT   gene            697077..697565
FT                   /gene="purE"
FT                   /locus_tag="BLi00693"
FT   CDS_pept        697077..697565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="BLi00693"
FT                   /product="phosphoribosylaminoimidazole carboxylase PurE"
FT                   /EC_number="5.4.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00693"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39630"
FT                   /protein_id="AAU39630.1"
FT                   /translation="MQPLLGVIMGSTSDWETMKHACGILDELGIPFEKKVVSAHRTPDL
FT                   MFEYAEKARERGLKVIIAGAGGAAHLPGMVAAKTTLPVIGVPVQSKALNGLDSLLSIVQ
FT                   MPGGVPVATVAIGKAGAVNAGLLAAQILSAFDKELAERLDERRESIRQTVLESSDQLV"
FT   gene            697456..698700
FT                   /gene="purK"
FT                   /locus_tag="BLi00694"
FT   CDS_pept        697456..698700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="BLi00694"
FT                   /product="ATP-dependent phosphoribosylaminoimidazole
FT                   carboxylase PurK"
FT                   /EC_number="6.3.4.18"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00694"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39631"
FT                   /protein_id="AAU39631.3"
FT                   /translation="MRRRFCQLLTKSLPKDWTNEGKASDKPCWKAVISLYKQTIFPGAT
FT                   IGIIGGGQLGKMMAVAAKQMGYKIAVVDPVPSSPCGQVADLEITASYNDGEAIRKLAEA
FT                   SDVITYEFENIDYDALNWLKEHAYLPQGSELLLLTQNRETEKKAIASAGCKVAPYRIIH
FT                   DRAELEASVAELGLPAVLKTCRGGYDGKGQHVLKEQAQIGEAAALLQHGTCILESWVPF
FT                   KMELSVIVTRSVHGETTVFPAAENIHKQNILFQSIVPARVDEAIQEQAAALALRLAEKL
FT                   QLVGTLAVELFLKEDGGLLVNELAPRPHNSGHYTLDLCETSQFEQHIRAVCGLPLGKTD
FT                   LLKEGMMVNLLGDEVYMAEEDPELLKEAKLYIYGKHEVKPGRKMGHITFLRTPDNEWIG
FT                   QMTEKWIERDGGRKQ"
FT   gene            698697..699992
FT                   /gene="purB"
FT                   /locus_tag="BLi00695"
FT   CDS_pept        698697..699992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="BLi00695"
FT                   /product="adenylosuccinate lyase PurB"
FT                   /EC_number="4.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00695"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39632"
FT                   /protein_id="AAU39632.1"
FT                   /translation="MIERYSRPEMAAIWTDENRFQAWLEVEILACEAWAELGVIPKEDV
FT                   KVLREKASFDINRIFEIEQDTRHDVVAFTRAVSETLGEEKKWVHYGLTSTDVVDTALSY
FT                   LLKQANEILLKDIERFIDILKEKAKEHKYTVMMGRTHGVHAEPTTFGLKLALWYEEMKR
FT                   NLERFKQAKEGIEVGKISGAVGTYANIDPFVEQYVCEKLGLKAAPISTQTLQRDRHADY
FT                   MAALALVATSIEKFAVEIRGLQKSETREVEEFFAKGQKGSSAMPHKRNPIGSENMTGMA
FT                   RVIRGYMLTAYENVPLWHERDISHSSAERIILPDATIALNYMLNRFGNIVKNLTVFPEN
FT                   MKRNMDRTLGLIYSQRVLLALIDTGMAREEAYDTVQPKAMEAWEKQVPFRQLVEAEEKI
FT                   TSRLSPEQINDCFDYNYHLKNVDYIFERLGLA"
FT   gene            700067..700783
FT                   /gene="purC"
FT                   /locus_tag="BLi00696"
FT   CDS_pept        700067..700783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="BLi00696"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase PurC"
FT                   /EC_number="6.3.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00696"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39633"
FT                   /protein_id="AAU39633.1"
FT                   /translation="MNIVKNELLYEGKAKKIYRTDDDNTLFVEYKNSATAFNGEKKAEI
FT                   DGKGRLNNEISSLIFTRLHEKGINNHFVERISETEQLIKKVTIIPLEVVVRNVVAGSMS
FT                   KRLGIPEGTELGQPIIEFYYKDDALGDPLITEDHIRILKAAEPEQVEKIKSITRQVNEE
FT                   LQTIFAACDVRLIDFKLEFGLDKDGEVLLADEISPDTCRLWDQETNEKLDKDVFRRNLG
FT                   GLTDAYEEIFKRLGGM"
FT   gene            700785..701039
FT                   /gene="purS"
FT                   /locus_tag="BLi00697"
FT   CDS_pept        700785..701039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purS"
FT                   /locus_tag="BLi00697"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit PurS"
FT                   /EC_number="6.3.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00697"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39634"
FT                   /protein_id="AAU39634.1"
FT                   /translation="MYKVKVYVSLKESVLDPQGSAVQHALHSMSYKEVQDVRIGKYMEL
FT                   TIEKSDRDLDVLVKEMCEKLLANTVIEDYRYEVEEVVAQ"
FT   gene            701036..701719
FT                   /gene="purQ"
FT                   /locus_tag="BLi00698"
FT   CDS_pept        701036..701719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purQ"
FT                   /locus_tag="BLi00698"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit PurQ"
FT                   /EC_number="6.3.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00698"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39635"
FT                   /db_xref="GOA:Q65MS9"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65MS9"
FT                   /protein_id="AAU39635.1"
FT                   /translation="MKFAVIVLPGSNCDIDMFHAIKDELGEEAEYVWHTETSLDEYDGV
FT                   LIPGGFSYGDYLRCGAIARFANIMPAVKKAAEEGKPVLGVCNGFQILQELGLLPGAMRR
FT                   NKDLKFICRPVELIVQNNETLFTSSYGKGESITIPVAHGEGNFYCDEETLAGLQENNQI
FT                   AFTYGTDINGSVADIAGVVNEKGNVLGMMPHPERAVDSLLGSADGLKLFQSIVKNWRET
FT                   HVATA"
FT   gene            701703..703931
FT                   /gene="purL"
FT                   /locus_tag="BLi00699"
FT   CDS_pept        701703..703931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purL"
FT                   /locus_tag="BLi00699"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit PurL"
FT                   /EC_number="6.3.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00699"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39636"
FT                   /db_xref="GOA:Q65MS8"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65MS8"
FT                   /protein_id="AAU39636.1"
FT                   /translation="MSLLLEPSQEQIKEEKLYQQMGVSDDEFAMIESILGRLPNYTEIG
FT                   IFSVMWSEHCSYKNSKPILKKFPTKGERVLQGPGEGAGIVDIGDNQAVVFKIESHNHPS
FT                   AIEPYQGAATGVGGIIRDVFSMGARPIAVLNSLRFGELTSPRVKYLFEEVVAGIAGYGN
FT                   CIGIPTVGGEVQFDGCYEGNPLVNAMCVGLINHEDIKKGQAKGVGNTVMYVGAKTGRDG
FT                   IHGATFASEEMSDQSEEKRSAVQVGDPFMEKLLLEACLEVIKSDALVGIQDMGAAGLTS
FT                   SSAEMASKAGSGIEMNLDLIPQRETGMTPYEMMLSESQERMLLVIERGREQEIIDIFDK
FT                   YDLEAVAVGHVTDDKMLRLFHNGEMVAELPVDALAEEAPVYHKPSKVPDYYKEFLETDV
FT                   PAPKVEDAKETLLELLKQPTIASKEWVYDQYDYMVRTNTVVAPGSDAAVLRIRGTKKAL
FT                   AMTTDCNARYLYLDPETGGKIAVAEAARNIVCSGAEPLAVTDNLNFGNPEKPEIFWQIE
FT                   KAADGISEACNVLSTPVIGGNVSLYNESNGSAIYPTPVIGMVGLIEDTEHITTQHFKAA
FT                   GDLIYVIGETFPEFAGSELQKLTEGKIYGKAPAIDLEVEQSRQKALLKAIRSGLVQSAH
FT                   DVSEGGIGVALAESVISSQRLGAHVTLAGEPALLFSETQSRFIVSVKKDHQEAFEKLVK
FT                   DADLIGEVTSDSVLAVQSQEGQQWIHAQTEELESAWKGAIPCLLKSKA"
FT   gene            703853..705337
FT                   /gene="purF"
FT                   /locus_tag="BLi00700"
FT   CDS_pept        703853..705337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="BLi00700"
FT                   /product="amidophosphoribosyltransferase PurF"
FT                   /EC_number="2.4.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00700"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39637"
FT                   /protein_id="AAU39637.1"
FT                   /translation="MDSCADRRARKRMERSYPMLAEIKGLNEECGVFGIWGHEEAPQIT
FT                   YYGLHSLQHRGQEGAGIVATDGEKMSAHKGQGLITEVFQNGELKKVKGKGAIGHVRYAT
FT                   AGGGGFENVQPFLFHSQNNGSLALAHNGNLVNATQLKQQLENQGSIFQTSSDTEVLAHL
FT                   IKRSGHFELKDQIKNALSMLKGAYAFLIMTEKEMIVAHDPNGLRPLSVAMLGDAYVVAS
FT                   ETCAFDVVGATYLRDVEPGEMLIINDEGMKSERFSININRSICSMEYIYFSRPDSNING
FT                   INVHSARKNLGKKLAEESGIEADVVTGVPDSSISAAIGYAEATGIPYELGLIKNRYVGR
FT                   TFIQPSQSLREQGVRMKLSAVRGVVEGKRVVMVDDSIVRGTTSRRIVTMLREAGATEVH
FT                   VRISSPPIAHPCFYGIDTSTHEELIASSHSVEEIRQEIGADTLSFLSIEGLLSGIGRQY
FT                   EGENCGQCMACFTGKYPTEIYQDTVLPHVKEIVLTK"
FT   gene            705458..706501
FT                   /gene="purM"
FT                   /locus_tag="BLi00701"
FT   CDS_pept        705458..706501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="BLi00701"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase
FT                   PurM"
FT                   /EC_number="6.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00701"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39638"
FT                   /db_xref="GOA:Q65MS6"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65MS6"
FT                   /protein_id="AAU39638.1"
FT                   /translation="MLSESYKNAGVDIEAGYEAVKRMKKHVERTKRIGAMGGLGGFGGM
FT                   FDLSELPYKQPVLISGTDGVGTKLKLAFAMDKHDTIGIDAVAMCVNDVLAQGAEPLFFL
FT                   DYLAVGKADPVKIEEIVKGVAEGCVQSGSALVGGETAEMPGLYTEDEYDIAGFSVGAAE
FT                   KDGIVTGENISEGHLLIGLSSSGLHSNGFSLVRKVLLEDAGLNLDETYAPFERPLGEEL
FT                   LEPTKIYVKPVLEAVKSGKIAGMAHVTGGGFIENLPRMMPDGLGVEIDIGSWPVPPIFP
FT                   FIQEKGGLKSEEMFNVFNMGIGFVLAVKEEDMTDVIQTLENNGEKAYLIGRVKAGSGVV
FT                   FGGAGLS"
FT   gene            706498..707085
FT                   /gene="purN"
FT                   /locus_tag="BLi00702"
FT   CDS_pept        706498..707085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="BLi00702"
FT                   /product="phosphoribosylglycinamide formyltransferase PurN"
FT                   /EC_number="2.1.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00702"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39639"
FT                   /protein_id="AAU39639.1"
FT                   /translation="MKKFAVFASGSGTNFEAIERRMREENWDAEIVLVVCDKPDAKVLE
FT                   RAEKAGIPSFAFQPKSFDNKAAFEQVIVEQLRLHGAEWIVLAGYMRLIGDTLLSAYRNK
FT                   IINIHPSLLPAFPGIDAVGQAYRAGVKVAGITVHYVDEGMDTGPIIAQRAVELEKSETL
FT                   ASLEEKIHKLEHELYPEVIKELLELNGRGEKE"
FT   gene            707082..708620
FT                   /gene="purH"
FT                   /locus_tag="BLi00703"
FT   CDS_pept        707082..708620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="BLi00703"
FT                   /product="PurH"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00703"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39640"
FT                   /protein_id="AAU39640.1"
FT                   /translation="MTIKRALISVSDKTNIVPFVKELTELGVEVISTGGTSKLLQENGV
FT                   DVIGISEVTGFPEIMDGRLKTLHPNIHGGLLAVRGNEKHMAQLNEQGIQPIDLVVVNLY
FT                   PFKETVSKEDVTFEEAIENIDIGGPGMLRAAAKNHQDVAVIVDPRDYSPVLNDLKENGS
FT                   VSLEKKRELAAKVFRHTAAYDALIADYLTNVTGEKEPEQFTVTFEKKQSLRYGENPHQE
FT                   AVFYQSALPVKGSIASAEQLHGKELSYNNIKDADAALQIVREFTEPAAVAVKHMNPCGV
FT                   GTGNTIEEAFNKAYAADETSIFGGIIALNREVDKATAETLHKIFLEIIIAPAFSQEALD
FT                   ILTSKKNLRLLTLDVNQPVKNEKQLTSVQGGLLIQDLDMHGFDDADITIPTKREPTEQE
FT                   WADLKLAWKVVKHVKSNAIVLAKDDMTIGVGAGQMNRVGSAKIAIEQAGEKAKGSALGS
FT                   DAFFPMPDTVEEAAKAGVTAIIQPGGSVRDEDSIKKADEYGIAMVFTGIRHFKH"
FT   gene            708634..709902
FT                   /gene="purD"
FT                   /locus_tag="BLi00704"
FT   CDS_pept        708634..709902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="BLi00704"
FT                   /product="phosphoribosylglycinamide ligase PurD"
FT                   /EC_number="6.3.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00704"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39641"
FT                   /protein_id="AAU39641.1"
FT                   /translation="MNVLIIGRGGREHTLAWKAAQSPLVGTVYAAPGNDGMAGTAVLVD
FT                   LDEGNHEGLLAFAKENNIGLTIVGPEVPLIEGLVDAFEEAGLPVFGPSKNAAVIEGSKQ
FT                   FAKDLMKKYQIPTAEYETFTSFENAKAYVEEKGAPIVIKADGLAAGKGVTVAMTAEEAV
FT                   QCLHDFLEDEKFGEASASVVIEEFLSGEEFSLMAFVKGEKVYPMVIAQDHKRAFDGDKG
FT                   PNTGGMGAYSPVPQISDAVVEDAVKTILEPAAEAMVKEGRSFTGVLYAGLMLTEKGTKV
FT                   IEFNARFGDPETQVVLPRLESDLVQVLVDLLADREVELKWKDTAAVTVVLASDGYPESY
FT                   EKGAPIGTLEPDMEQTVVFHAGTKKSGDQFVTNGGRVANVTAFAETFDAAREAAYQAVD
FT                   RVRKPGLFYRMDIGSRALKAAQK"
FT   gene            complement(709952..710530)
FT                   /locus_tag="BLi00705"
FT   CDS_pept        complement(709952..710530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00705"
FT                   /product="putative tetR-like transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00705"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39642"
FT                   /protein_id="AAU39642.1"
FT                   /translation="MADSYRGDKRITKSKTNLKKALFELLAEKEWGKISVQDITQRANL
FT                   NRTTFYQHYQDKYDLLHQHMRDMFEAMKEDIFSPLDIDSSGKKPEAYWYVLRFYHHLQQ
FT                   NSGDFAIIINRRYELNIKELLNDFWNDSFLTGIKKTAAADTDRSVPLDIQRRFVISAFA
FT                   GTAAWWLENGMPYPPELMAESMIKIIQKN"
FT   gene            710669..711892
FT                   /gene="yjiB1"
FT                   /locus_tag="BLi00706"
FT   CDS_pept        710669..711892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjiB1"
FT                   /locus_tag="BLi00706"
FT                   /product="putative cytochrome P450 monooxygenase YjiB"
FT                   /EC_number="1.14.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00706"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39643"
FT                   /protein_id="AAU39643.1"
FT                   /translation="MSQTKQQNPIQKALINGKNRQDPYDPFPWYKKMRTESPIHYDEDS
FT                   KVWSVFRYDDVKRVISDKDFFSNQFPQLGTGNTFAKTMISMDPPKHTRIRSIVNKAFTP
FT                   RVMKEWEPRIRELTNQLLADVRGREEIDLVQDFSYPLPVIVISELLGVPLVYKHHFKEW
FT                   SDLLVSLPKSDRPEDVNEWKNIRDQGEEELTAFFEKMIEEKRQNLGNDLISLLIKAEQE
FT                   GDKLSPDELVPFCNLLLMAGNETTTNLVSNAVYSILETPGVYDELARHPELIPQAVEEA
FT                   VRFRAPAPMIVRFVKQDTEIRGVSLKKGEGVIAFLASANRDETKFERAHEFDIHRHPNP
FT                   HIGFGHGIHFCLGAPLARLEAAIAIEALLKQYASMEKLAVVPMADSSMYGLKHFRLRVK
FT                   SAGETAPN"
FT   gene            712588..713034
FT                   /gene="yybP"
FT                   /locus_tag="BLi00708"
FT   CDS_pept        712588..713034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yybP"
FT                   /locus_tag="BLi00708"
FT                   /product="YybP"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00708"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39644"
FT                   /protein_id="AAU39644.1"
FT                   /translation="MKRILIVLAGIGLLGAGGCGMLDQVNDGLNYTNEAAGYIQKVKTF
FT                   AEEAPSLAEQAVNDTGAKEKLETQLESIQQAAADFNELTPPDAAAEVHNTIEKHNETLQ
FT                   KSAEDVLKSVEEGKLTVEKLEQSELVQSAQQISDVMGQIEKLTE"
FT   gene            713137..713553
FT                   /locus_tag="BLi00709"
FT   CDS_pept        713137..713553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00709"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00709"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39645"
FT                   /protein_id="AAU39645.1"
FT                   /translation="MLPKHSKDQRKQLEVVALSELVPEDQLVRKMEEAMDFSFIYEKVA
FT                   PLYSSKARPSIDPVVLIKMVLIQYVFGHRSMRETIERVFADLKHKRGLRWTTLRGKKKL
FT                   SMQAMLVFAAMNLKNWRIGRGKALIASLFIEKTK"
FT   gene            complement(713632..713862)
FT                   /gene="yezF"
FT                   /locus_tag="BLi00710"
FT   CDS_pept        complement(713632..713862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yezF"
FT                   /locus_tag="BLi00710"
FT                   /product="YezF"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00710"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39646"
FT                   /protein_id="AAU39646.1"
FT                   /translation="MKQNIGLFDAVFRIACGLTILSAAAAKFTRKPWCRMTLFCMFMGA
FT                   MKAASGILRFCPMTYVCQTYMKQQGETGEQS"
FT   gene            713988..715727
FT                   /gene="yerA"
FT                   /locus_tag="BLi00711"
FT   CDS_pept        713988..715727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yerA"
FT                   /locus_tag="BLi00711"
FT                   /product="putative adenine deaminase YerA"
FT                   /EC_number="3.5.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00711"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39647"
FT                   /protein_id="AAU39647.1"
FT                   /translation="MSERTLIWKNKHIRSQVDVVSSRLQPTLLLRNASVLNPYVKQWIP
FT                   ANVWIHHDRIVYVGRDLPKTAVKTTIDCEGKYIVPGYIEPHVHPFQIYNPQTLAEYVSQ
FT                   FGTTTFVNDNLFLLLHCGKKKAFSILEELKKQPVHYYWWSRYDLQTEVLNEDQILSIDY
FT                   RKHWGEHPDVIQGGEMTGWPRLLDGDDLILHCMQCTKRRRKRIEGHFPGASEKTLTKMK
FT                   LFGADADHEAMTGKEVLKRLELGYHVGLRQSSIRPDLRKILRELHEEGFHHYDHMFYTT
FT                   DGATPNFYKEGMTNKLIEIAIEEGVPLIDAYNMASFNIAKYYHMEDILGVVAPGRYATL
FT                   NILNSPDEPNPETVLAKGRLIKSGGINMNAFSVPDWQKGGLVPLNLSYDLTMDDLQFSM
FT                   PLGLKMRNSVIMEPYTIEIDNSVNQLSFDHDESYLSLFDKYGKWRVNTMLKGFATRIQG
FT                   FVSSYSTTGDIIAIGKNKEDMLLAFKRMKEIGGGIVLAENGKILHEIPLHLSGGASIET
FT                   YEKVLEREKALKELLFERGYTFDDPIYTLLFLQSTHLPYIRVTPKGIFDVMKKTVLFPS
FT                   IMR"
FT   gene            715753..716742
FT                   /gene="yerB"
FT                   /locus_tag="BLi00712"
FT   CDS_pept        715753..716742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yerB"
FT                   /locus_tag="BLi00712"
FT                   /product="YerB"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00712"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39648"
FT                   /protein_id="AAU39648.1"
FT                   /translation="MVNRYVRVLLCFASLLLLASCQSQEQQEKEKNIHPLTGLKADGDI
FT                   RQRPIAVVVNNHSKARPQSGLSKADIVIEALSEGPITRLLAIYQSDMPEAVGPVRSARE
FT                   YFIDLALGFDSILVHHGWSPGAKDRLLNGDADHINGMDHDGTLFWRADFREAPHNSYTS
FT                   YKNVKQAADDKGYAIETRTEPLTFKASPDKPSDALYSIRLDYGTKSVTNRVEYGYDKKV
FT                   EGYVRKSDGVLTTDLETEEPVVLQNILIAEAEHHMKDAYGRRDIDLRSGGKGLLLQNGE
FT                   VHRISWKNENGRIIPTADGKTVPFVPGKTWINIVPDLSKVSISKGEGV"
FT   gene            716745..717056
FT                   /gene="yerC"
FT                   /locus_tag="BLi00713"
FT   CDS_pept        716745..717056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yerC"
FT                   /locus_tag="BLi00713"
FT                   /product="putative tryptophan repressor"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00713"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39649"
FT                   /protein_id="AAU39649.1"
FT                   /translation="MQIDKLRGRELDQLFQSILSLKDLEECYRFFDDLCTINEIQSLAQ
FT                   RLEVARMLRDGNTYHKIETETGASTATISRVKRCLNYGNDAYIMALDRVKANQSESSS"
FT   gene            717207..717893
FT                   /gene="pcrB"
FT                   /locus_tag="BLi00714"
FT   CDS_pept        717207..717893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcrB"
FT                   /locus_tag="BLi00714"
FT                   /product="putative geranylgeranylglyceryl phosphate
FT                   synthase PcrB"
FT                   /EC_number="2.5.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00714"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39650"
FT                   /db_xref="GOA:Q65MR4"
FT                   /db_xref="InterPro:IPR008205"
FT                   /db_xref="InterPro:IPR038597"
FT                   /db_xref="InterPro:IPR039074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65MR4"
FT                   /protein_id="AAU39650.1"
FT                   /translation="MYDITEWKHVFKLDPNKDITDDQLEQLCESGTDAVLIGGSDHVTE
FT                   DDVLRLMSKVRRFLVPCVLEVSTIDAIVPGFDLYFIPTVLNSRDTDWIAGLHKKAMKEY
FT                   GELMSPEEIVVEGYCILNQDCKAAALTNADTELDIEDIKAYARVAEHLFRLPVFYLEYS
FT                   GMLGDSETVKETKAVLQETTLFYGGGIKDAETAVKMAEHADVIVVGNAIYENFEEALKT
FT                   VQAVKG"
FT   gene            717953..720172
FT                   /gene="pcrA"
FT                   /locus_tag="BLi00715"
FT   CDS_pept        717953..720172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcrA"
FT                   /locus_tag="BLi00715"
FT                   /product="ATP-dependent DNA helicase PcrA"
FT                   /EC_number="3.6.4.12"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00715"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39651"
FT                   /protein_id="AAU39651.1"
FT                   /translation="MNYISDQLLSGLNKMQQEAVKTTDGPLLIMAGAGSGKTRVLTHRI
FT                   AYLMAEKRVAPWNILAITFTNKAAREMKERVESILGPGADDIWISTFHSMCVRILRRDI
FT                   DRIGINRNFSILDTSDQLSVIKGILKERNIDPKKFDPRSILGSISSAKNELIAPEEYEK
FT                   TAGGFFEQVVSDVYKDYQKKLRKNQSLDFDDLIMTTIVLFDRVPEVLEYYQRKFQYIHV
FT                   DEYQDTNRAQYLLVKKMAQRFQNICVVGDSDQSIYRWRGADIANILSFEKDYPNASVIL
FT                   LEQNYRSTKRILNAANEVIQNNSNRKPKNLWTENDEGAKISYFRGDNEFGEGQFVAGKI
FT                   RELVGSGKRSFSDIAILYRTNAQSRVIEETLMKANINYNIVGGTKFYDRKEIKDILAYL
FT                   RLVANPDDDISFARIVNVPKRGVGATSVDKIAAYADMNGMSLFEALGQVDFIGLSARAA
FT                   NALDEFRQTIENLTNMQEYLSVTELTEEILEKTEYREMLKAEKSLEAQSRLENIDEFLS
FT                   VTKNFEQQSEDKSLVAFLTDLALIADIDQLDQKEEETGNQDAVILMTLHAAKGLEFPVV
FT                   FLMGLEEGVFPHSRSLMEEAEMEEERRLAYVGITRAEEELYLTNARMRTLFGRTNMNPE
FT                   SRFIAEIPEELLDNLNEKKKDLKTPFGRKPERRGPVTRPAASYSKTGGDGVNWAVGDKA
FT                   SHKKWGVGTVVSVKGSGESTELDIAFPSPTGVKRLLAAFAPIEKQ"
FT   gene            720206..722209
FT                   /gene="ligA"
FT                   /locus_tag="BLi00716"
FT   CDS_pept        720206..722209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligA"
FT                   /locus_tag="BLi00716"
FT                   /product="NAD-dependent DNA ligase LigA"
FT                   /EC_number="6.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00716"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39652"
FT                   /db_xref="GOA:Q65MR2"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65MR2"
FT                   /protein_id="AAU39652.1"
FT                   /translation="MEKEAAKRRVEQLHALINKYNYEYHTLDDPSVPDSEYDKLMKELI
FT                   ALEEEHPDLKTPDSPSQRVGGAVLDAFQKVQHKTPMLSLGNAFNEEDLRDFDRRVRQAV
FT                   GDVEYNVEFKIDGLAVSLRYENGVFVRGATRGDGTTGEDITENLKTIRNIPLRMKRDLS
FT                   IEVRGEAFMPKRSFELLNKARIERDEEPFANPRNAAAGSLRQLDPKIAAKRNLDIFVYS
FT                   IAELDEMGVETQSQGLDFLDELGFKTNHERKKCSTIEEVIEIVEELKTKRADLPYEIDG
FT                   IVIKVDSLDQQEELGFTAKSPRWAIAYKFPAEEVVTTLLDIELSVGRTGAVTPTAILEP
FT                   VKVAGTTVQRASLHNEDLIKEKDIRLLDKVVVKKAGDIIPEVVNVLVEQRTGKEKEFNM
FT                   PKECPECGSELVRIEGEVALRCINPECPAQIREGLIHFVSRNAMNIDGLGERVITQLFR
FT                   EDLVHNVADLYKLTREQLINLERMGEKSTDNLLNSIEKSKKNSLERLLFGLGIRFIGAK
FT                   AAKTLAMHFETLDKLKKATKEELIEVDEIGDKMADALVTYFEKEEILKLLDELEELGVN
FT                   TVYKGPKKAAAEASDSYFAGKTIVLTGKLSEMSRNDAKAEIEALGGKITGSVSKKTDLV
FT                   IAGEAAGSKLAKAEDLNIEVWDEARLISELKK"
FT   gene            722225..723415
FT                   /gene="yerH"
FT                   /locus_tag="BLi00717"
FT   CDS_pept        722225..723415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yerH"
FT                   /locus_tag="BLi00717"
FT                   /product="lipoprotein YerH"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00717"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39653"
FT                   /protein_id="AAU39653.1"
FT                   /translation="MKKILCLAAAAGMLMLSACAPNFGGEEEQEMVQKTDKSKEKAIIP
FT                   KYNISDSYYKMVLPFKAGKARGLTTERLNTRLDIDEFETGMMRLAQDSFSTDDYLFQEG
FT                   QYLDEDTVSSWLARKKTGDDLKKAEKDDKNFKNLGLNPALSGSGSTEKQNEESPIYLAH
FT                   MLEHDYLVRKDKDTIELGGVVIGLALNSVHYYRENVGDPQKEVTISDKKLRQEGEKIAE
FT                   EVAKRIRNMDDLKNIPLTIMLYKQAPKSSIVPGNFIAKTDVKAGTSEIGGWDKINEEYT
FT                   FFPSTEGSEKHPDDAELFKRFKNKVDTYFPNYTGVVGTALYKDDQMQDMKINIPMQFYG
FT                   KSEVIAFTQFLTGEVMDYYGKSGLNVEININSSAGQEAVILKKPGDKEPTVHIYDS"
FT   gene            723604..724530
FT                   /locus_tag="BLi00718"
FT   CDS_pept        723604..724530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00718"
FT                   /product="putative HTH-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00718"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39654"
FT                   /protein_id="AAU39654.1"
FT                   /translation="MWEKFYSKNGLAAKNIAKELMNIKAGEKIPRISDYCHKLSIGRGT
FT                   VQSALNLLVDMKAIQLEARGHLGTFLVSKDNNLLLEIAGIAPLIGSMPLPYSRKYEGLA
FT                   TGIVEGFESTGKTVNLIYMRGGVNRIEAVRTKRSDFAIVSKMTADHIIAEYPNLKIFKK
FT                   FGESSYVSSHKIFLAHPDEEIGKDGVRVGVDLESLDQKQLTLAEFENKNAEFVNVNYMQ
FT                   LFDMLLSKQIDAAVWNADDKRMIQTFKAIDFFSPKAKKISKDTTEAVIVIEGDREKEIA
FT                   EKWNLVNEKQILDTQKSVEKGEKIPRY"
FT   gene            724631..724996
FT                   /locus_tag="BLi00719"
FT   CDS_pept        724631..724996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00719"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00719"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39655"
FT                   /protein_id="AAU39655.1"
FT                   /translation="MNQIQLEEKLSILLTSRVITKNAFNTTLNTFVFLSEKLKKEVIKD
FT                   SEMFWTHMAMALTRIKEGESEEVPANAIINEMYETPYKSAIEEVIDFIHSLAGLELPEG
FT                   ELVYFYLHLHKVIESNK"
FT   gene            725009..725368
FT                   /locus_tag="BLi00720"
FT   CDS_pept        725009..725368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00720"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39656"
FT                   /protein_id="AAU39656.1"
FT                   /translation="MVRIVIGGQLKKQAIEKLVKEIGGNNVEVLVKGDLDAVMAVKNNK
FT                   ADYYIGACETGSGGALAMAIALLGKDKCVTLASPSTIKNKEEIEKEVESGKIAFGFTAS
FT                   TSQNILNILIPYLLK"
FT   gene            725513..726814
FT                   /locus_tag="BLi00721"
FT   CDS_pept        725513..726814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00721"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00721"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39657"
FT                   /protein_id="AAU39657.1"
FT                   /translation="MDLSLIQCLVIAAVGALGSILVNRGVAVFNDGLRPIMPEYLEGRM
FT                   TRGELAATSFALSFGLIIGFGIPLSIGATIIIGHSILLACDIIGIWTPENKIGMATAGV
FT                   IGAVYSIGIVLGLQFVVDLFGKFPVNFIDSLSLIGQPIIIAFTVFPAVAVGYQHGLKKV
FT                   AVTAIVTLASFLLFEKFGTFQAAGYEISLSPEGMALLAGMLMMIYYAARIRGGDESTNA
FT                   NLVNIFNERVNRIKKNRWLLALMGGLVSLTSSMLILAVDAMPQALINKELYTEAAIATF
FT                   ARGIGFIPLVFSTAIVTGVYGLAGTTLVFAVGLIFRDIPILAFLLGFLVMYLEVISLSA
FT                   VSKSMDKLPGVREMGEHIRTSLSDVLGMAILIGSAMAGEKIAPGIGFFWVIGFYLINRI
FT                   ASKPLVELAVGPIAVILLGIVANLLYAVGLWQVG"
FT   gene            726841..727725
FT                   /locus_tag="BLi00722"
FT   CDS_pept        726841..727725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00722"
FT                   /product="putative aryldialkylphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00722"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39658"
FT                   /protein_id="AAU39658.1"
FT                   /translation="MLKDGMTYMHEHTTIDLSKVKNNEDCKLDVFPETVREFKSLYEKG
FT                   VRNIVDVTNIGMGRNITYVQKVAKETGINIVFSTGFYQDSFYPIHVFRESKEKLAERMI
FT                   MEIVEGIRGTDANAEVIGEIGTSYNKWTETEQKVFEAVVVAHKQTKKPISTHTSIGTLG
FT                   HEQVEFFKKHEVDLNRVVIGHVDLSGDADYILKMLREGVYVEFDTIGKENYMPDRVRAE
FT                   ILKKIQDKGYIDKVLLSMDITRKSHLVYKGGVGYSYLIDTFIPLLQTYGITGESIDKML
FT                   IKNPRAFMKGESE"
FT   gene            727722..728870
FT                   /locus_tag="BLi00723"
FT   CDS_pept        727722..728870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00723"
FT                   /product="putative PLP-dependent aminotansferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00723"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39659"
FT                   /protein_id="AAU39659.1"
FT                   /translation="MSMDTYPLDSLSIEEAMHRQFKLVDVMTRHFRGEELLSLGDLGVV
FT                   KGINKPRFTKKIEETLADFFGTEKAMLVRGAGTGALRFGFMSFLKPGDEILVHDAPIYP
FT                   TSKTTLESMGILPIYADFHDSEQIKEAILKHPKLKGVLIQHTRQKIDDHYDLAETIKKI
FT                   RSIYSDLVIITDDNYAAMKAEKIGAQLKADLSTFSLFKLLGPEGIGVILGRKNLIEKIE
FT                   KINYSGGSQVQGYEALEALRGLIYAPVMLAIQASVNDQLVHSLNNGAIKGVKKAYLANA
FT                   QSKVLLVEFVKPIAEKVLHHANELGAAPHPIGAESKYEFAPMFYRVSGTFLSADPSLAK
FT                   KMIRINPLRSGPETILRILNTSVHRATEDLSVNSSKGDDINE"
FT   gene            728863..730089
FT                   /locus_tag="BLi00724"
FT   CDS_pept        728863..730089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00724"
FT                   /product="putative phosphopentomutase"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00724"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39660"
FT                   /protein_id="AAU39660.1"
FT                   /translation="MNKRVIIIILDSLGVGYMEDASDYHPSDVGANTFYHILDTVPSLN
FT                   IPNLEKLGINKILHHPKLKKTDHIASYGVLNLMHQGADSFEGHNEIMGTKPKKTYLAPF
FT                   AEHLNHVKLALEDQGYKVNIPNSDLPYLLVNDLVVVADNIETDYGQIYNVSAPLDYIPF
FT                   DEVLKIGRCVRHHVKVNRVIVLGGENVTPEHLQRSVERREDGLIGVNSPKSNVYKQGYQ
FT                   VRHLGFGISPENQLPTLARNRGMEVSLIGKMQDIIYCEGANRFPGVDTEQVMKDIIQEM
FT                   DRVKKGLIAATVQETDLAGHAQNPVRYANRIEMVDRYLPEILRKMTDQDLLMISADHGN
FT                   DPTIGHNQHTREKTYLLAYHKKLSPVHIGERKTLSDIAATSADYLGLRNTENGSSFLHL
FT                   MQKGKEETY"
FT   gene            730089..731240
FT                   /locus_tag="BLi00725"
FT   CDS_pept        730089..731240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00725"
FT                   /product="putative alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00725"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39661"
FT                   /protein_id="AAU39661.1"
FT                   /translation="MFLESTLKYNKKLIEAALSFHQQGIISPNTYVLDLDTVKKNAKVL
FT                   SEKARKQDIELFFMTKQFGRNPLVAQAIAESGIGKAVAVDPWEAITLSQNGIKIGHVGH
FT                   LVQIPIHMIPAILELHPDYVTVFSLENAQNINRVAKKMGRKQKVFLRIANKEDYIYKGQ
FT                   EGGFTFEQIVKDIESIEQLEGLEIAGLTSFPCILIQDGLPAVTPNVASMQTVKSFLMER
FT                   GYKKLEMNMPSATSCATMKLLKENGATQGEPGHALIGTTPIHATKQLAERPAMVYVTEV
FT                   SHISNHHAYVFGGGFYPRSHMKAALVGTNKDHLKKVQAIEMTPDHIDYYGSLNTVEAKV
FT                   GDTAIFAFRTQVFVTNAHIAILKNVAEDPELIGVYDSKGNVIE"
FT   gene            731380..732108
FT                   /locus_tag="BLi00726"
FT   CDS_pept        731380..732108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00726"
FT                   /product="putative glucosamine-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00726"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39662"
FT                   /protein_id="AAU39662.1"
FT                   /translation="MKIIHVSGYEEMSGKSADLMAELIQNSNNPVIGFATGSTPIGLYK
FT                   CLIKKYRQKEISFRNVTAFNLDEYVGLAKENKNSYHYYMNEKLFKHLDISRRNINIPNG
FT                   MAEDLEQECLSYDRLVSEKAIDIQILGMGLNGHIGFNEPGTSFKSRTHIVDLDQSTRQA
FT                   NSRFFRSLDEVPTKALTMGIETIMESKRILLLVSGNEKSEALARLLNSTRVSQEFPASI
FT                   LRKHKDVTVMADDAALNKIH"
FT   gene            complement(732424..733116)
FT                   /gene="sapB"
FT                   /locus_tag="BLi00727"
FT   CDS_pept        complement(732424..733116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sapB"
FT                   /locus_tag="BLi00727"
FT                   /product="putative membrane protein SapB"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00727"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39663"
FT                   /protein_id="AAU39663.1"
FT                   /translation="MDWHIETETLLKLGIATLIGMVIGLERELKNKPLGLKTCIVIAIS
FT                   SCVLTMISIDAAYHFPRSNRIMMDPLRLPAQIISGIGFIGAGVILRKSNDVISGLTTSA
FT                   MIWGAAGLGVAIGAGFYKEAFVSLIFILISVEFLPWIVGKIGPNRLQEKEIRVRMSLND
FT                   KDKLTDILKEMKAKKIRIHSVRIDDMRDNEFPIMETKIMVHKKRYVTDVYYDIKAIDGV
FT                   VGVKCDTL"
FT   gene            complement(733340..734821)
FT                   /gene="opuE"
FT                   /locus_tag="BLi00728"
FT   CDS_pept        complement(733340..734821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opuE"
FT                   /locus_tag="BLi00728"
FT                   /product="sodium/proline symporter OpuE"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00728"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39664"
FT                   /protein_id="AAU39664.1"
FT                   /translation="MSVEVFISLGIYFAAMLLIGWYSYRKTSNLNDYMLGGRGLGPAVT
FT                   ALSAGASDMSGWMLMGLPGAMYVTGLSSAWLAVGLTIGAYVNYLVVAPRLRTYTEVAND
FT                   AITIPDFFENRFNDTTRILRLASAIVIMVFFTLYTSAGMVSGGRLFETAFGLDYKIGLF
FT                   LTAAVVIAYTLFGGFLAVSLTDFVQGLIMFIALVLVPIVAFTQLGGITPTFNVIEEINP
FT                   SLLDFFKGTTVISIISFLAWGLGYFGQPHIIVRFMAISSVKELKPARRIAMGWMIISVI
FT                   GALLVGLTGVAYVHETGTALKDPETIFIVFSKVLFHPLITGFLLSALLAAIMSTVSSQL
FT                   LVTSSAMTEDFYRTFFRRKASDKELVLVGRLSVLLVAVIAILLSLTPNNTILDLVGYAW
FT                   AGFGSAFGPAILLSLYWKRMNQWGALAGMITGAVTVLIWILTGLQEKTGIYEMIPGFFL
FT                   SLIVVYAVSMITNKPAKEARDMFEEMEQTHEEEHS"
FT   gene            735263..735553
FT                   /gene="gatC"
FT                   /locus_tag="BLi00730"
FT   CDS_pept        735263..735553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="BLi00730"
FT                   /product="glutamyl-tRNA synthase gamma subunit GatC"
FT                   /EC_number="6.3.5.7"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00730"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39665"
FT                   /db_xref="GOA:Q65MP9"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65MP9"
FT                   /protein_id="AAU39665.1"
FT                   /translation="MSRISIEEVKHVAHLARLAITDEEAAMFTEQLDSIISFAEELNEV
FT                   DTENVKPTTHVLQMKNIMREDVPDKGLPVEDVVKNAPDHKDGYIRVPSILD"
FT   gene            735575..737032
FT                   /gene="gatA"
FT                   /locus_tag="BLi00731"
FT   CDS_pept        735575..737032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="BLi00731"
FT                   /product="glutamyl-tRNA synthase alpha subunit GatA"
FT                   /EC_number="6.3.5.7"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00731"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39666"
FT                   /db_xref="GOA:Q65MP8"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65MP8"
FT                   /protein_id="AAU39666.1"
FT                   /translation="MSLFDHKISELKRLIHNKEISISDLVDESYKRIHEVDGKVQAFLQ
FT                   LDEEKARAYAKELDEALDTRDEHGLLFGMPIGIKDNIVTKDLRTTCASKILENFDPIYD
FT                   ATVVERLHEAEAVTIGKLNMDEFAMGSSTENSGFKKTKNPWNLETVPGGSSGGSAAAVA
FT                   AGEVPFSLGSDTGGSIRQPASFCGVVGLKPTYGRVSRYGLVAFASSLDQIGPITRSVED
FT                   NAYLLQAISGVDKMDSTSANVDVPDYLSALTGDIKGLKIAVPKEYLGEGVSEEAKQSVL
FT                   EALKVLESLGATWEEVSLPHSKYALATYYLLSSSEASANLARFDGIRYGYRTDNADNLI
FT                   DLYKQTRSEGFGNEVKRRIMLGTFALSSGYYDAYYKKAQKVRTLIKKDFEDVFANYDVI
FT                   IGPTTPTPAFKIGEKTSDPLTMYANDILTIPVNLAGVPGISVPCGFANGLPLGLQIIGK
FT                   HFDESTVYRVAHAFEQATDHHKAKPEL"
FT   gene            737046..738476
FT                   /gene="gatB"
FT                   /locus_tag="BLi00732"
FT   CDS_pept        737046..738476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="BLi00732"
FT                   /product="glutamyl-tRNA synthase beta subunit GatB"
FT                   /EC_number="6.3.5.7"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00732"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39667"
FT                   /db_xref="GOA:Q65MP7"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65MP7"
FT                   /protein_id="AAU39667.1"
FT                   /translation="MNFETVIGLEVHVELKTKSKIFSSSPTPFGAAANTQTSVIDLGYP
FT                   GVLPVLNKEAVNFAMKAAMALNCEIATDTKFDRKNYFYPDNPKAYQISQFDKPIGENGW
FT                   IEIEVGGKTKRIGITRLHLEEDAGKLTHTGDGYSLVDYNRQGTPLVEIVSEPDIRTPEE
FT                   AYAYLEKLKSIIQYTGVSDCKMEEGSLRCDANISLRPIGQEEFGTKTELKNLNSFAFVQ
FT                   KGLEHEEKRQAQVLLSGGVIQQETRRYDEASKTTILMRVKEGSDDYRYFPEPDLVELYI
FT                   DDEWKQRVKDSIPELPDERRKRYIEELGLPAYDAKVLTLTKEMSDFFEAAVEKGADAKL
FT                   ASNWLMGEVSAYLNAQQKELADVELTPEGLAGLVKLIEKGTISSKIAKKVFKELIEKGG
FT                   DAEKIVKEKGLVQISDEATLRKLVTEALDNNPQSIEDFKNGKDRAIGFLVGQIMKASKG
FT                   QANPPMVNKLLLEEINKR"
FT   gene            738661..738963
FT                   /locus_tag="BLi00733"
FT   CDS_pept        738661..738963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00733"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00733"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39668"
FT                   /protein_id="AAU39668.1"
FT                   /translation="MERKDVPEWILALEEEDVEFIKNFMLKSGSLKEIAKSYQVSYPTV
FT                   RVRLDRLIQKIQLIDELENETFVNFIKQLAIDDQISLENAKLIIEKYKKERGVHK"
FT   gene            738960..739241
FT                   /locus_tag="BLi00734"
FT   CDS_pept        738960..739241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00734"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00734"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39669"
FT                   /protein_id="AAU39669.1"
FT                   /translation="MNPIYILLIGFTILGIQYFLSTRNHTFWGAILPTAYIVFLVALSI
FT                   YEGKSFASFFLPLIGGLALLLGEWIKGREALKKKREREMRIMKAMDIK"
FT   gene            complement(739316..740398)
FT                   /gene="gmuG"
FT                   /locus_tag="BLi00735"
FT   CDS_pept        complement(739316..740398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmuG"
FT                   /locus_tag="BLi00735"
FT                   /product="mannan endo-1,4-beta-mannosidase GmuG"
FT                   /EC_number="3.2.1.78"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00735"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39670"
FT                   /protein_id="AAU39670.1"
FT                   /translation="MKKNIVCSIFALLLAFAVSQPSYAHTVSPVNPNAQPTTKAVMNWL
FT                   AHLPNRTESRVMSGAFGGYSLDTFSTAEADRIKQATGQLPAIYGCDYARGWLEPEKIAD
FT                   TIDYSCNRDLIAYWKSGGIPQISMHLANPAFTSGHYKTQISNSQYERILDSSTPEGKRL
FT                   EAMLSKIADGLQELENEGVPVLFRPLHEMNGEWFWWGLTQYNQKDSERISLYKQLYVKI
FT                   YDYMTKTRGLDHLLWVYAPDANRDFKTDFYPGASYVDIVGLDAYFDDPYAIDGYEELTS
FT                   LNKPFAFTEVGPQTTNGGLDYARFIHAIKEKYPKTTYFLAWNDEWSPAVNKGADTLYLH
FT                   PWTLNKGEIWDGDSLTPVVE"
FT   gene            complement(740523..741371)
FT                   /gene="yerO"
FT                   /locus_tag="BLi00736"
FT   CDS_pept        complement(740523..741371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yerO"
FT                   /locus_tag="BLi00736"
FT                   /product="putative tetR-like transcripional regulator YerO"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00736"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39671"
FT                   /protein_id="AAU39671.1"
FT                   /translation="MTEKEEKIIKAGLHLFAKNGFASTTIQDIANECNISKGAFYLHFK
FT                   SKEALLLAIIKYYIDRMMENMKIIQQKNFPPKETFKEQIAYQFSESKEHRDFILVMISE
FT                   HSIPENSKIEEYFKNVSQKFHETYQNALSAAYGDIVKPYLSDLSVIVQGIVQSYQNLFI
FT                   FNELDIDFYELADFIMRRIDDMIDGMVQNGEQPILAGRTYSYYRNAGNTADKHTILREL
FT                   EDAKRQPELSEDILITLDVIEEELRKDSPRAPVLQGMLTNLQHQDNVQHLYGMITRFLH
FT                   S"
FT   gene            741516..744674
FT                   /gene="swrC"
FT                   /locus_tag="BLi00737"
FT   CDS_pept        741516..744674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="swrC"
FT                   /locus_tag="BLi00737"
FT                   /product="putative acriflavin resistance protein SwrC"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00737"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39672"
FT                   /protein_id="AAU39672.1"
FT                   /translation="MNSIINFVLKNKFAVWLMTIIVTVAGIYAGLNMKQESIPDVNMPY
FT                   LTISTTYPGATPSQVADEVTKPVEQAVQNLDGVSVVTSTSYENASSVMIEYDYEKDMDK
FT                   AKTEAAEALANLDLPDNAKEPSISRYSMNSFPILALSVSSDKDDLQSLTKKVEDSLLTK
FT                   LEGLEGVASVQLSGQQVEEVEFSFKKDKLKQYGLDEDTVKQVIQGSDVTTPLGLYTFGK
FT                   EEKSVVVSGDIDTIKDLKNMRIPAASAGGASAQAGAQSAQAAQGAQAQAGAQSAGQAQQ
FT                   SAGVPTVKLSDIATIKDVKKAESISRTNGKDSIGISVIKANDANTVEVADNVKAELEQF
FT                   KKDHKGFKYSSTYDQAEPITESVETMLSKAIFGAIFAVVIILLFLRDIKSTLISVISIP
FT                   LSLLIALLVLNQLDITLNIMTLGAMTVAIGRVVDDSIVVIENIYRRMRLKDEPLRGKAL
FT                   VREATKEMFMPIMSSTIVTIAVFLPLALVGGQIGELFMPFALTIVFALAASLLIAITLV
FT                   PMLAHTLFKKSLTGAPVKAKEHKPGVLANFYKKVLNWSLSHKWITSIIAVLMLVGSLFL
FT                   VPLIGASYLPATKEKMVQITYTPEPGETKKEAEKEAQKAEEILLDRKHVDTVQYTLGAG
FT                   NPLMGGSSNGALFYIKYEEDTPDFDQEKDSVLKDIQKQSKRGEWKTQDFSSSGNNNELT
FT                   YYVYGDSEKEIKGTVKEIEKIMKDQKDLKNVSSGLSSTYDEYTFVADQEKLSKLGLTAS
FT                   QISQALMKETSQAPLTTVKKDGKDLDVTIKTEEETYKSVKDLEDKKITTPTGQEVKIGD
FT                   VAKVKEGTTSDTISKRDGKIYADVTAEVTSDNVTAVSVDVQKNIDKIDLPDNVTIDTGG
FT                   VSADIEDSFTKLGLAMLAAVAIVYLVLVITFGGALAPFAILFSLPFTVIGALVGLYVSG
FT                   ETISLNAMIGMLMLIGIVVTNAIVLIDRVIHKEAEGLSTREALLEAGSTRLRPILMTAI
FT                   ATIGALIPLALGFEGGSQVISKGLGVTVIGGLISSTLLTLLIVPIVYEVLAKFRRKKPG
FT                   MEEE"
FT   gene            744822..745022
FT                   /locus_tag="BLi00738"
FT   CDS_pept        744822..745022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00738"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00738"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39673"
FT                   /protein_id="AAU39673.1"
FT                   /translation="MESKGNSEPSPKIVKRLTWIIPIVLIGVIFLLKNIRNPVTDVLFY
FT                   IVCAGVITLVIFSIMKETKSR"
FT   gene            complement(745113..745655)
FT                   /locus_tag="BLi00739"
FT   CDS_pept        complement(745113..745655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00739"
FT                   /product="putative acyl-CoA N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00739"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39674"
FT                   /protein_id="AAU39674.1"
FT                   /translation="MIKKGTNIYIRPLTAEDAEACLELQNANRPFFEQFSMERNEEFYT
FT                   IEGQKKRLQRLYENMENDEDYYFGIFDPANDALIGTINLFQVLRGSLQSAFIGYFLDQK
FT                   HNGKGYTTEAVKLMVEFAFHDLKLHRIEAGVMPRNIASIRVLEKAGFHKEGIARKNVKI
FT                   NGKWEDHQLLAVINPHD"
FT   gene            complement(745669..746622)
FT                   /locus_tag="BLi00740"
FT   CDS_pept        complement(745669..746622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00740"
FT                   /product="putative inosine-uridine preferring nucleoside
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00740"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39675"
FT                   /protein_id="AAU39675.1"
FT                   /translation="MKKPVYFNHDGGVDDLVSLFLLLQMENVKLIGTSVIPADCYLEPA
FT                   LSASRKIIDRFGSYQVETAASDSRGVHPFPKEWRMHAFYVDALPILNEKGEVRTPVSEL
FT                   PAHLHLIECVRQSPEPVTLLFTGPLTDLARALEEEPAIIKHIAKLVWMGGTFLEKGNVE
FT                   EPEHDGTAEWNAFWDPYSVKTVFESDIQIEMVALESTNQVPLTNEIRSHWASLRKHIGI
FT                   DFIGQCYAMCPPLVHNETNSTYYLWDVLTTLTLGTVDMTRSRSIKAVVHTQSPRQGTTE
FT                   EHPDGRMVKVVDQVDRDQFFAYFEELMKRADRIPSL"
FT   gene            746822..747736
FT                   /gene="dagK"
FT                   /locus_tag="BLi00741"
FT   CDS_pept        746822..747736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dagK"
FT                   /locus_tag="BLi00741"
FT                   /product="putative diacylglycerol/lipide kinase DagK"
FT                   /EC_number="2.7.1.107"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00741"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39676"
FT                   /protein_id="AAU39676.1"
FT                   /translation="MKRARIIYNPTSGREIFKKNLAQVLQKFEQAGYETSCHATTGEGD
FT                   AVQAARHAAEREFDLIVAAGGDGTLNEVINGLAPLEHRPKLGVIPVGTTNDFARALGIP
FT                   REDILKAVDTILEGEARPIDIGRVNGQYFINIAGGGRLTELTYDVPSKLKTMLGHLAYY
FT                   LKGMEMLLPSLRPTEVEIEYDGKLFEGEVMLFLVMLTNSVGGFEKLAPDSSLNDGMFDL
FT                   VILKRANLAEFIRLVGLALRGEHINDEHIIYTKANRVKVTVKDKMLLNLDGEYGGELPG
FT                   EFENLYRHIDVVMSKEKARKLDD"
FT   gene            747785..749173
FT                   /gene="yefA"
FT                   /locus_tag="BLi00742"
FT   CDS_pept        747785..749173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yefA"
FT                   /locus_tag="BLi00742"
FT                   /product="putative RumA-like 23S rRNA methyltransferase
FT                   YefA"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00742"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39677"
FT                   /protein_id="AAU39677.1"
FT                   /translation="MKQKAPVQKNEYYNVVFEDLTHEGAGVAKVDGFPIFVPNALPDEK
FT                   AQIKVTRVKKGFAFGRLIDLKEESRFRTDAPCPIYKQCGGCQLQHINYEGQLLYKQKQV
FT                   KDVLERIGKLDLSRITVHPTLGMEDPWNYRNKAQVPVGEREGGLIAGFYQQRSHEIIDM
FT                   NECLIQQSENDRVVQAIKEICGKYGIKAYNEERHKGWLRHIMVRYGAVTGEMMVVFITR
FT                   TNDFPHKAKIVEEITAAFPHVKSIVQNINPKKTNVIFGDETTVIWGEEYIYDTIGGIKF
FT                   AISARSFYQVNPEQTKVLYDKALEYAELNGEETVIDAYCGIGTISLFLAKQAKKVYGVE
FT                   IVPEAIEDAKRNAELNGIENAEFEVGEAEVVIPKWYEEGIAADTLVVDPPRKGCDEALL
FT                   RTIIEMKPKRVVYVSCNPGTLARDLRVLEDGGYVTREVQPVDMFPHTSHVECVTKLVLK
FT                   GAVD"
FT   gene            749414..749983
FT                   /gene="hsdSIA"
FT                   /locus_tag="BLi00743"
FT   CDS_pept        749414..749983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdSIA"
FT                   /locus_tag="BLi00743"
FT                   /product="type 1 restriction endonuclease HsdSIA"
FT                   /EC_number="3.1.21.3"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00743"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39678"
FT                   /protein_id="AAU39678.1"
FT                   /translation="MKLEDIVTVKIGRNLSRGNVKNDHTLVAYTYEDLMNDLDGSFLDS
FT                   QASFDAGHSNHKESYLSNAGDVVFSFVSSKAGIVSNLNRGKIINQNFAKLMIEHDELDR
FT                   SYLCYALNESYAMKRQMAISMQGSAVPKLTPAILKELEIKLPSIEKQRIIGKAYFCLRK
FT                   RQALAKKQAELEEKLFLEVLKQLDQQ"
FT   gene            750004..751596
FT                   /gene="hsdM1"
FT                   /locus_tag="BLi00744"
FT   CDS_pept        750004..751596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdM1"
FT                   /locus_tag="BLi00744"
FT                   /product="type 1 restriction endonuclease HsdM"
FT                   /EC_number="3.1.21.3"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00744"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39679"
FT                   /protein_id="AAU39679.1"
FT                   /translation="MAELHSKLFSAADNLRSKMDASEYKNYLLGLIFYKYLSDKLLEKV
FT                   VEIAGESLEEYNTQDKQTQLYMESLADEEIKNDLIETLVDTLGYDIEPKYLFSVLANQA
FT                   KQNTFHLNDLNKAFIDLSTKYDQFNGLFDDVDLKSKKLGSDDPQRNITITEVLKKLNDV
FT                   NVIEHNGDVIGDAYEYLISQFASEAGKKAGEFYTPHQVSDMMARIAAIGQEDKKLFSVF
FT                   DPTMGSGSLMLNIRNYINYPDSVKYHGQELNTTTFNLAKMNLILHGVNKEDMRLRNGDT
FT                   LNKDWPTDEPYTFDAVLMNPPYSAKWSADTTFIDDSRFNRYGKLAPKSKADFAFLLHGF
FT                   YHLKDSGTMAIVLPHGVLFRGAAEGVIRKKLLEDGSIDAVIGMPANLFFGTSIPTTVII
FT                   LKKNRSTRDVLFIDASKEFIKGKNQNKLSKENIDKIVETYKKREDVEKYAHVATFEEIK
FT                   ENDFNLNIPRYVDTFEEEEPIDMAAIGSKIKDIRIEKAELESSLYDMISSLQYDEENAD
FT                   WIKGALEVFNRGK"
FT   gene            751586..752779
FT                   /gene="hsdSIB"
FT                   /locus_tag="BLi00745"
FT   CDS_pept        751586..752779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdSIB"
FT                   /locus_tag="BLi00745"
FT                   /product="type 1 restriction endonuclease HsdSIB"
FT                   /EC_number="3.1.21.3"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00745"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39680"
FT                   /protein_id="AAU39680.1"
FT                   /translation="MENKRVPELRFAGFAGDWEERKLGELVEIKSGWTPSDFVETQKCN
FT                   GEIYIKVDDLNYSTRELLDSKMKVAIHAKYHTIKKGSTIFPKRGAAIMTNKVRILGTDG
FT                   YMDTNMMALEPRNINGEFLYTLIDRTGLFKIADTSTIPQINNKHVEPYKILLPNLYEQK
FT                   NIGNFFKQLDDTIALHQQELTTLKQTKQGFLQKMFPKEGESVPEVRFPGFTGEWEQRKA
FT                   DEIFYSVSDKNHSNLPVLSATQEKGMVYRDETGLDINYDVKSTKNYKRVLPGQFVIHLR
FT                   SFQGGFAFSNIEGITSPAYTVLDFKNKEMYYSLFWRCVLASDTFIKRLEAVTYGIRDGK
FT                   SISFSDFSTLKFRVPSHNEQLKIGNFFKQLDDTIALHQCELDTLKETKKAFLQKMFV"
FT   gene            752802..755960
FT                   /gene="hsdR1"
FT                   /locus_tag="BLi00746"
FT   CDS_pept        752802..755960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdR1"
FT                   /locus_tag="BLi00746"
FT                   /product="type 1 restriction endonuclease HsdR"
FT                   /EC_number="3.1.21.3"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00746"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39681"
FT                   /protein_id="AAU39681.1"
FT                   /translation="MTKIPHKDEAQVERRLIEVLGEGHNQWNYRPDLKSEEDLWQNLRQ
FT                   KITQNNLSEIGEHPITDKEFDTIKTELLSKTQTPFDAARWLKGENGIARITIEREDVSL
FT                   GSMSLVLYSNQDIGGGISTYEVVHQIAKQKANLDGRDRRFDVTLLINGLPIVQIELKKV
FT                   SAKDGVFQAFNQIKKYSEEGMFRNNIFSTLQLFVISNEQTTRYFANAMPKDMHKKFVFS
FT                   WRTKDNRKVENLYEFVKQVLNIPDAHRLIADYTIVSEDQDNKAVIVLKPYQIHAIQALF
FT                   TSAMKHQSGFVWHATGSGKTLTSFVSTKLLARKAGVDRTIMLIDRKDLDNQTTTEFTKF
FT                   ASEFNTGISSGDAISNSLIVGTGSAKELSDTLQSDANSNTVIITTRQKLEAALRYAQRQ
FT                   EEQKGTQRFKKLLGQHIVFVVDECHRALSAEGMQVIKGFFPNSTWFGFTGTPIFNENKK
FT                   QAKGQLARTTRDQYGEVLHTYTIKNALDDGAVLGFQVEHEDTIDPTSLNNYIFNQLRQN
FT                   EKYANLTADEINNIIDQMDGTEKEAYLEPSSFESDDHIQKVIHKIFRPDNAYTKFDFQN
FT                   GRPQKSAILTTSSIDMAKRYYRAIKEMMKDSDWLTKEFAGHPIRTGRTIEDPDFPRIAI
FT                   TYSIQENEDNSKQIQDEMKEIIKEYNDYYHTAWSIEDIERYNGDINNRLARKKAEFKEF
FT                   GKQIDLVIVVDRLLTGFDAPTIQTLFVDRNLSYANLIQAFSRTNRTYPGKTKGLVVTFR
FT                   KPSTMEQNVKNATKLYSQAQEESSLVYPTYDESKKRFKKAHKALTTLVPNPTDIDENTS
FT                   LETRIEFVKAFQELNNSYEALVTYNDYNDDMKKSPALQEQVKTLEEYIGIYNTVKGSLE
FT                   DEGNQDGPGPDFSDIEFYGENAVKIYDIDSTYIDRLLETYSANNQNIRDEIENALQKLK
FT                   KSEIVKGVYRKMLNAIDANEIDAEEDILAVKRSFFTKARDKAIHEFANTWFVEEDELHL
FT                   SAIQYVIGINSIPNISKINNSGQFDKYKAVHPDAKPLKYRPEIKRQWKKTLDEVIVPLD
FT                   DELR"
FT   gene            756533..756955
FT                   /gene="mcrA"
FT                   /locus_tag="BLi00747"
FT   CDS_pept        756533..756955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcrA"
FT                   /locus_tag="BLi00747"
FT                   /product="putative 5-methylcytosine-specific restriction
FT                   endonuclease McrA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00747"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39682"
FT                   /protein_id="AAU39682.1"
FT                   /translation="MGYEVSQKRKRPQPIINQGGQRHWTRNASLASKAMMLSNYTCEID
FT                   HTHRTFISKSTNMPYVECHHLVPIAKQEGFKYDLDQLANLVSLCPHCHRLIHYGQDEEK
FT                   EKMLKKLYDQRKDHLKKVGIEITFSELKRIYEVSNI"
FT   gene            757614..759479
FT                   /locus_tag="BLi00748"
FT   CDS_pept        757614..759479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00748"
FT                   /product="beta-glucoside-specific phosphotransferase system
FT                   EIIBCA component"
FT                   /note="BglP-like"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00748"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39683"
FT                   /protein_id="AAU39683.1"
FT                   /translation="MNYIQTARDVLQHVGGKENIAHLEHCSTRLRFTLIDQNKADVPAL
FT                   EKTPGVIAVRMSGQCQVVIGNDVIEVYEELTGLLGGALSGQNGSSHQPKEKRKVGTVLL
FT                   DFIVGVFQPLVPAIAGGGILKSFLLLFSLFGFIDAKGQTYQILNMVGDAPLYFLPLLVA
FT                   VTTANKLKVNPLVALSAVGALILPNMTAMLTEGAQLFSFDVKNIAYAYQVFPVILSVLL
FT                   YAQMEKWFTRISPKPIRIFFVPMMSLVITVPITLLLLGPIGFTAGQGFTALILAMFDKV
FT                   GWIAVAILAAVLPFMVASGMHKAMVPYAVTTMGNLGKEALYLPASLAHNIAESGACFAI
FT                   ALRTKDKVLRSTAISAGISAFFGITEPALYGVTLQNKRVLSSVMIGSFIGGIFIGLVGL
FT                   QAFVLVGPGLASMSMFISDELPRNFMFAVIGFAISFAVAFAAAFILGKDRKTEETEKEA
FT                   EPGAFAEKLGADETFKSPVIGQMISLSDVEDDIFSSKVMGEGIAIIPSKGELYAPVDGE
FT                   ISLLFETNHALGMKTANGVEVLFHIGIDTVQLEGKFFKPLVQAGDKVKAGDLLIQFDLE
FT                   KIKEAGYDPVTLAVITNTDQYDIKVTQLKEVNRQDTLMVVTQLGG"
FT   gene            759482..760951
FT                   /locus_tag="BLi00749"
FT   CDS_pept        759482..760951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00749"
FT                   /product="putative glycoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00749"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39684"
FT                   /protein_id="AAU39684.1"
FT                   /translation="MMTKTKGFPKDFLWGGAIAANQAEGAWNVDGKGPSVADIAMYRSN
FT                   LSVEDYEGHLAVSSENIERAMKDPDVKKYPKRRGIDFYHHYKEDVALFAEMGFKTLRIS
FT                   IAWSRIFPTGEEAEPSEKGLQFYDRLFQEMKKHNIEPIVTLSHYEMPLALSLKYNGWVE
FT                   RKVIDLFVKFANVCFERYKDVVKYWLTFNEIDSIHRHSFITAGIIPDRCPEGKVEETVY
FT                   QALHHQFVASALVTADCHRIIPGSQVGCMLTKLTTYPHTCHPSDVERALKQNLDNYFYA
FT                   DVQVFGEYPPLIKRMLERKNINIKMEADDLAIIKEHTVDFVSFSYYMSLTESAQEGLEK
FT                   TDGNTIRGVKNPYLPSTDWGWQIDPVGLKISLIELYDRYQKPLIIVENGMGAKDVVESD
FT                   GSIHDDYRISYFREHFRQMKEAIEEGVDLFGYTSWGPIDIISAGTSQMSKRYGFIHVDQ
FT                   DDDGNGTLKRSRKDSFYWYKKVIETNGEVLD"
FT   gene            760981..761829
FT                   /locus_tag="BLi00750"
FT   CDS_pept        760981..761829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00750"
FT                   /product="putative RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00750"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39685"
FT                   /protein_id="AAU39685.1"
FT                   /translation="MFKIKKVLNSSVVLAVDQNRQEMVLCGRGIGYGRKPGNMIEEKQA
FT                   DQVFMPVDNMKAKEFLQLLDSIPQEFIELTQQIVQHAEERLKTKLNSGVYFTLMDHLNF
FT                   AVERYKKNINITNRVYWEIKNYYTEEFEAGNYALQLINETFGIQLPKEEAANIAFHLIN
FT                   ALGEETESKDGMKNAKMIGSIVNLVRYTLNMKLDQENIHYSRFITHVKFFVERFYADKL
FT                   LANQENELFEQIANLYPQAMDVAFKIKDYIKQVHGNVIPNDELTYLAVHIHRLISYQQL
FT                   K"
FT   gene            762077..763189
FT                   /gene="rapK"
FT                   /locus_tag="BLi00751"
FT   CDS_pept        762077..763189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rapK"
FT                   /locus_tag="BLi00751"
FT                   /product="response regulator aspartate phosphatase RapK"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00751"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39686"
FT                   /protein_id="AAU39686.1"
FT                   /translation="MSKVASEVVAGVLNEFHLAIKKHDTEQAKHLFDEAKSMFSEMEED
FT                   QNVLAYFSLLEERYRMMLYDARGERLPRESYFNDSQIECIEQTDHMIDYYFYFFEAMHE
FT                   AYNKNVERAISLYKVAEKKLAKVPDQIEAAEFYFKVSWLYMSLRQNAVSLNYARDAMNI
FT                   YKMHDGYEKKLAISQVVMGTNYMQMQRFKDAEKYFEESIEISKKIDDSFLEAMLHHNIS
FT                   ILYSNSGRSQECILAVQHALSNAEWCKSSYYINSLYMLTREFFKIGETEAALFYHKKGQ
FT                   EELKKNGNKHYEKKINIIYELYCHENVKSIKDDIHSLDEMNDLDGVCDLSLLISSYFEK
FT                   KGDDKKALEFVKIFMKAENKMRSLGSEVLS"
FT   gene            763186..763308
FT                   /gene="phrK"
FT                   /locus_tag="BLi05046"
FT   CDS_pept        763186..763308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phrK"
FT                   /locus_tag="BLi05046"
FT                   /product="response regulator aspartate phosphatase RapK
FT                   regulator PhrK"
FT                   /db_xref="EnsemblGenomes-Gn:BLi05046"
FT                   /db_xref="EnsemblGenomes-Tr:AFR74787"
FT                   /protein_id="AFR74787.1"
FT                   /translation="MKKLILCLSLTAMVLGGAALSQSHNQASGGVQTAELPVGG"
FT   gene            763472..764230
FT                   /locus_tag="BLi00753"
FT   CDS_pept        763472..764230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00753"
FT                   /product="putative SAM methytransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00753"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39688"
FT                   /protein_id="AAU39688.1"
FT                   /translation="MNDKTFLSFLKHADKPFSGWDFSFIEDTGRMKSDLLSWSYGSMAL
FT                   SLIQDSESMLDMGTGGGEFLSKLGPFPSSAYATECYLPNVPVAKERLTPLGVQVVQIDD
FT                   DEDLPFESGQFDLIINKHESYSVQEVRRILSKGGRFLTQQVGGLDCEEINEKLGVPLNE
FT                   EFKDWDLETALKEMEKHDFKILKSREECPTQRFYDIGALVYYLKAIPWQALGFEVNQYK
FT                   DELYEIHKMIEEKGYFDVTQYRFMILAEAV"
FT   gene            764633..765376
FT                   /locus_tag="BLi00754"
FT   CDS_pept        764633..765376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00754"
FT                   /product="DUF28 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00754"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39689"
FT                   /db_xref="GOA:Q65MM5"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026562"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65MM5"
FT                   /protein_id="AAU39689.3"
FT                   /translation="MLKESGYIMGRKWNNIKEKKASKDANTSRIYAKFGREIYVAAKQG
FT                   EPDPELNQNLKFVLERAKTYNVPKAIIERAIEKAKGGSEENYDELRYEGFGPNGAMVIV
FT                   DALTNNVNRTAADVRSTFGKNGGNMGVSGSVAYMFDPTAVIGFEGKTADETLELLMEAD
FT                   IDVRDILEEDDAVIVYAEPDQFHAVQEALQNAGITEFTVAELTMLAQNDVALPEDARAQ
FT                   FEKLIDALEDLEDVQQVYHNVDLGA"
FT   gene            765533..765742
FT                   /locus_tag="BLi00755"
FT   CDS_pept        765533..765742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00755"
FT                   /product="putative HTH-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00755"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39690"
FT                   /protein_id="AAU39690.1"
FT                   /translation="MKTLIKEKRTSLNMTQEELAKRLNVSRQTVISLEKGKYKPSLVLA
FT                   HKLAQIFECLIEDLFIFEGDENID"
FT   gene            765735..766049
FT                   /locus_tag="BLi00756"
FT   CDS_pept        765735..766049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00756"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00756"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39691"
FT                   /protein_id="AAU39691.1"
FT                   /translation="MTETMTNILIALAGLGIGVLGIAIVYKVNRRIGKKERLFDERQQK
FT                   ISYQAKALSWNITMAAILIAWALVIIFQGISFSFFLITGLYILQYLSMLITTVYLAQKN
FT                   "
FT   gene            766207..767664
FT                   /gene="yfmT"
FT                   /locus_tag="BLi00757"
FT   CDS_pept        766207..767664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfmT"
FT                   /locus_tag="BLi00757"
FT                   /product="putative aldehyde dehydrogenase YfmT"
FT                   /EC_number="1.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00757"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39692"
FT                   /protein_id="AAU39692.1"
FT                   /translation="MIQITDLNRQYIGGEWRDGQSESVLADLNPFTHKTIASFRKATRE
FT                   DVDAAYKAALEAKKKWDGVNPYEKRAILEKAAAYIEDNREAIVFLIMEELGGTRLKAAF
FT                   EIDLVVNMIKEAAGFPLKMEGKILPSPVDGKENRIYRIPAGVVGVISPFNFPFFLSVKS
FT                   VAPALGAGNGVVLKPHEETPICGGTLIAKIFEEAGLPKGLLNVVVTDIGEIGDSFVEHP
FT                   IPRIISFTGSTKVGSYIGQLAIKHFKKPLLELGGNSALIVLEDADLEYAVNAATFSRFT
FT                   HQGQICMSANRILVQKEVYPEFLKLFSQKVSGLKTGDPLDPETVIGPVINERQAEHLRK
FT                   SIEKGIEEGATPLLKGDIKGNLVEPTILADVTPDMSVAKEELFGPVVCVMPFETEADAV
FT                   EIANDTPFGLSGAVHTGNVESGVAIAKQIETGMIHVNDTTINDEPHVAFGGEKQSGIGR
FT                   LNGEWSLDEFTTLKWISVQHQKRSFPY"
FT   gene            767681..768532
FT                   /gene="yfmS"
FT                   /locus_tag="BLi00758"
FT   CDS_pept        767681..768532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfmS"
FT                   /locus_tag="BLi00758"
FT                   /product="putative methyl-accepting chemotaxis protein
FT                   YfmS"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00758"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39693"
FT                   /protein_id="AAU39693.1"
FT                   /translation="MNEAVKTDIHPLLDAFVKVAPFLNQLIQDDVTVGIYDTEKLIVNI
FT                   PGKTFSLNVKAGDPLQEGDIITDAIRQNKKKVSMVPKELFGFPLAARAIPLHDENGRVI
FT                   GGVGLGTSLEKSDQLHRVAESLSVIVEQTASAIQDIAESVSGFSGQMSDISKQAKEVSE
FT                   SAGEIEKISVTVKGISDQSNLLGLNAAIEAARAGESGKGFSVVADEIRKLATHSKENVG
FT                   QIDQITKKIHALLKDLEHSIEVINEHTSGQAAGVEQISATMQEISSNAQNLAKMAEHQF
FT                   ED"
FT   gene            768678..770102
FT                   /locus_tag="BLi00759"
FT   CDS_pept        768678..770102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00759"
FT                   /product="sodium/sulfate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00759"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39694"
FT                   /protein_id="AAU39694.1"
FT                   /translation="MRVYTTTKLTGLLLGPISFLLILGLIPEAELAYAPRIVLAVTAWT
FT                   AVWWITEAVPIPAASLLPVILLPTLGGLDMETTAKAYGDPIVFMYMGGFIIAIAIEKWN
FT                   LHKRMALHILKRIGAESHRIVLGVMAATAFLSMWISNAATALMMLPVALAVIKEVQEKE
FT                   ILKGESLQKFSKSILLAVAYAASIGGLATLVGSVPNAVFAAMSKQMLNHEIMFFEWFLF
FT                   GFPVSILFLAILYVYLTKIKFKVSAFQGKKPDFIDHDLKALGAMTREEKSVFTVFLLTA
FT                   CLWMFKFILPFQISDTSIAIFGAVLLFLIPSTKDERILEWKDMQSLPWGLLLLFGGGLS
FT                   LAAGFSATNLTAWIGGKLKLLEGHPYLFVLIILTAAILFMTEIMSNTAVANMVIPMTIG
FT                   LGAALQVEPYGLMAAAALASSCAFMLPISTPPNAAVFSSNLLTIKDMVRAGFWLNIAGV
FT                   FLIVISAYFWLPAVFQ"
FT   gene            770187..772076
FT                   /gene="yfmR"
FT                   /locus_tag="BLi00760"
FT   CDS_pept        770187..772076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfmR"
FT                   /locus_tag="BLi00760"
FT                   /product="ABC transporter ATP-binding protein YfmR"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00760"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39695"
FT                   /protein_id="AAU39695.1"
FT                   /translation="MSIFKAEGLYKTYGDKTLFDHISFHIEENERIGLIGPNGTGKSSL
FT                   LKVIAGHESTEKGDITKPGSLHIEYLDQDPDLDGPETVLEHIYSGDSVMMRTMRTYEQA
FT                   LQELNAAPDDPKKQENLLAAQGKMDEHGAWDANTAAKTILTKLGVADVAKEVSSLSGGQ
FT                   KKRVAIAKTLIQPADLLILDEPTNHLDNETIEWLEGYLSGYPGSVVLVTHDRYFLNRVT
FT                   NRIYELDRGRLYTYKGNYEVFLEKRAEREALAEQNETKRQNLLRRELAWLRRGAKARST
FT                   KQKARIQRVEELKEQDAPETGSSLDFAIGSHRLGKQVIEAEGVDISRGGNQLVRSFNEL
FT                   IVPGDRIGIIGPNGIGKTTLLNALAGRIKPDGGQITIGQTVRIGYYTQDHSEMNDALQV
FT                   VEYIKETAEVVKTADGQVVTAEQMLERFLFPRSVQRNLIRKLSGGEKRRLYLLKVLMEE
FT                   PNVLFLDEPTNDLDTETLGVLEDYLEQFPGVVVTVSHDRYFLDRVVDRLLVFEGGGNVS
FT                   RFQGSYSEYMEKQKENSRQKPASEAAEPVKPEKKKRKKLSYKDQLEWDGIEDRIAALEE
FT                   KHKRLEEEIAAAGSDFAKIQTLMEEQAQTAEELEAAMERWTELSLLIEELEQS"
FT   gene            772134..772328
FT                   /locus_tag="BLi00761"
FT   CDS_pept        772134..772328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00761"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00761"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39696"
FT                   /protein_id="AAU39696.1"
FT                   /translation="MPFEELLSCLLMAALCVLLFIKAMGCRKENRRGSLAFFMMFSIVC
FT                   LTTLIIKIVKLGHFFGRAF"
FT   gene            complement(772325..773227)
FT                   /gene="folE2"
FT                   /locus_tag="BLi00762"
FT   CDS_pept        complement(772325..773227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE2"
FT                   /locus_tag="BLi00762"
FT                   /product="GTP cyclohydrolase IB FolE"
FT                   /EC_number="3.5.4.15"
FT                   /note="yciA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00762"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39697"
FT                   /db_xref="GOA:Q65ML7"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65ML7"
FT                   /protein_id="AAU39697.1"
FT                   /translation="MERKLHLPAKPERHRRFGSVEAVKGIKPTDKEQMKDIQNTPNDYF
FT                   FDIDHVGVSNVSHPILIASSLKPFTQTTIGAFSFTTSLARDRKGINMSRLTEQLQRYHE
FT                   ANWTVDFHTLKDFAKDLAGNMEQESASVSVSFPWYFERISPETKLSGLMHADIHMTVSY
FT                   HENKGFSQTAGITAHATTLCPCSKEISEYSAHNQRGIIKITAHINEQAEMPDDFKAELL
FT                   AAAETNASAKLHPVLKRPDEKRVTEQAYENPRFVEDVLRLTAADLYEMDWISAFEIECR
FT                   NEESIHLHDAVARLSFSKC"
FT   gene            773360..774472
FT                   /locus_tag="BLi00763"
FT   CDS_pept        773360..774472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00763"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00763"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39698"
FT                   /protein_id="AAU39698.1"
FT                   /translation="MQHSEIVIVGAGPAGIGMGIVLKKLGFKSFTILEKDRAGASFRSW
FT                   SEEMKLITPSFTGQGFGALDLNAVAPGTSPAFTFQREHLSGREYGDYLALLADHFQLPI
FT                   QEGTSVRSVHKDDGGFSVETDKGTMKAKDVIWGAGEFQFPKYSFHGAEIGIHNSKVARW
FT                   SQFEKAHYYVVGGYESAMDAAVQLASYGSDVTVVMPNSLRENAEADPSRSLSPYTWERL
FT                   EDAYEKGKVQFLEKAVVEKLAKNGPAYDLYLSDGRKIRSETRPIIATGFHSGAKQIEHL
FT                   FEWGENGKPLLTNEDMSTVTDGLYLIGPSVQHQNAVFCFIYKFRQRFAVIAEHLLKKRR
FT                   FSIDEKVLTEYRENQMFLTDLSCCEVQCEC"
FT   gene            774580..775293
FT                   /locus_tag="BLi05005"
FT   CDS_pept        774580..775293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi05005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi05005"
FT                   /db_xref="EnsemblGenomes-Tr:AFR74788"
FT                   /protein_id="AFR74788.1"
FT                   /translation="MKGSTIFAAEREIKSLPGWQAIDTPGIREDGSVSKRALKKEIEKA
FT                   DEVVAVLRGTHFSEELNAVLELIPPEARRVCFIVTFQDKMTDAMRRKLSEQVAKHSLPV
FT                   LLVDTRTVTDDKKERIIAFLRKEAEFHPLKRRRMKQIELESVAVQQSVFHRPVAGPVVS
FT                   AALLCLLFMAPIVLAYHTSEWVQQSADKWAVVRSKMRSGACRHGWARHWRGTMACYPLA
FT                   FTRLFGRFLSFCLCL"
FT   gene            775080..776138
FT                   /locus_tag="BLi00764"
FT   CDS_pept        775080..776138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00764"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00764"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39699"
FT                   /protein_id="AAU39699.3"
FT                   /translation="MFVVYGADRIGLSYIRVGAAICGQMGGCPLQNAVGGLPSWLGAAL
FT                   AGNYGLLSLGIYSFVWAFPVVLFMSIANAAADDSGLKDRIVDSLDPLMRKIGLNGRDLV
FT                   PLLTGFGCNVVAVQQTRSCSMCTRKRCVSFISFGSACSYQIGATLSIFHAAGREWLFIP
FT                   YLAVLVAAAAVHNRIWYRIDQKWAAYFERRQTFLQKPSWKGIVFRVKEVLQQFIFQAMP
FT                   IFLIICLAATVLNELGVIRLVTLLVSPVLSLFGAPEDAAPGLVFSLIRKDGILLFNEGN
FT                   GALLDMLPGATLFLLIYLASTFTPCMVTVWTIAKELGMKTAAAIMGKQMATSVVSVLSI
FT                   MIIWKLTLCIFK"
FT   gene            776204..777403
FT                   /gene="yciC"
FT                   /locus_tag="BLi00765"
FT   CDS_pept        776204..777403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yciC"
FT                   /locus_tag="BLi00765"
FT                   /product="cobalamin synthesis protein YciC"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00765"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39700"
FT                   /protein_id="AAU39700.1"
FT                   /translation="MSKKIPVTVLSGYLGAGKTTLLNHILQNRQGLKVAVIVNDMSEVN
FT                   IDAGLVKQGGLSRTDEKLVEMSNGCICCTLREDLLVEVEKLAKQGNIDYIVIESTGISE
FT                   PIPVAQTFSYIDEELGIDLTRFCRLDTMVTVVDANRFWHDFQSGDSLLDRKEAVGEEDE
FT                   RDIADLLIDQIEFCDVLILNKCDLVSEEDLQKLEKVLKTLQPKANIIRAVKGEVDPKAV
FT                   LNTGLFNFDEASGSAGWIRELNQGHHQHTPETEEYGISSFVYEARRPFHTERFYNWIHS
FT                   LPENVVRAKGIAWCATRNTLALLMSQAGPSVSLEPISYWVAALSKPEQEQILRQNPELL
FT                   KEWNEEFGDRHTKLVFIGLDLSPSEITAEADRCLLTDSEMAADWSLLSDPFDWQIERAR
FT                   "
FT   gene            777572..778357
FT                   /gene="bioW"
FT                   /locus_tag="BLi00766"
FT   CDS_pept        777572..778357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioW"
FT                   /locus_tag="BLi00766"
FT                   /product="6-carboxyhexanoate--CoA ligase BioW"
FT                   /EC_number="6.2.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00766"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39701"
FT                   /db_xref="GOA:Q65ML3"
FT                   /db_xref="InterPro:IPR005499"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65ML3"
FT                   /protein_id="AAU39701.1"
FT                   /translation="MKGEAYYSVRMRASENGPHEEGGKHISGGERLVPFIGLNDAVSDL
FT                   LEKGMSHSRGRPDFMQIQFDLVNEPIKLVQPLRIETNETVSAEEGQALARELISRAGVP
FT                   ESAVEKAFQGIAEYWGVRGAVLFDIHSGRRIDGRKEKGVRVSRLDWPEADFQRWAALCG
FT                   VPPNPRLKEALAIASKVCEHPAVIAELCWSDDPDYITGYVAAKKLGYQRMTKMKEHGDE
FT                   SGCRIFFVDGSADVKSCIDDLEKQPVFIGQEVNHESIIR"
FT   gene            778338..779684
FT                   /gene="bioA"
FT                   /locus_tag="BLi00767"
FT   CDS_pept        778338..779684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioA"
FT                   /locus_tag="BLi00767"
FT                   /product="adenosylmethionine--8-amino-7-oxononanoate
FT                   transaminase BioA"
FT                   /EC_number="2.6.1.62"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00767"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39702"
FT                   /protein_id="AAU39702.1"
FT                   /translation="MNQSFVEKSKQYLWLPFTQMKDYDENPLIIESGQGIKLKDIDGRV
FT                   YYDGFSSVWLNVHGHRKKELDEAIKKQLGKIAHSTLLGMTNVPATELAEVLIKITPENL
FT                   TRVFYSDSGATAMEIALKMAFQYWKNIGKPEKQKFISMKNGYHGDTIGAVSVGAIELFH
FT                   HVYGPLMFESFKVNVPYVYRSKSGNPDECRDECLAELERLLSERHDEIAALSVESMVQG
FT                   ASGMIVMPEGYLAGVRELCTKYDVLMIVDEVATGFGRTGKMFACEHERVQPDLMAAGKA
FT                   ITGGYLPIAVTFATEEIYEAFYDDYNKLKTFFHGHSYTGNQLGCAVALENLRLFESEKI
FT                   VAQVAEKSKILESLFHDLAALPHVGDIRQLGFMSGIELVQSKETRQPYPPEERIGYRVS
FT                   LKMRELGMLTRPLGDVVAFLPPLASTADDLRAMVSIMKEAIQEVTGRAY"
FT   gene            779674..780813
FT                   /gene="bioF"
FT                   /locus_tag="BLi00768"
FT   CDS_pept        779674..780813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioF"
FT                   /locus_tag="BLi00768"
FT                   /product="8-amino-7-oxononanoate synthase BioF"
FT                   /EC_number="2.3.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00768"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39703"
FT                   /db_xref="GOA:Q65ML1"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65ML1"
FT                   /protein_id="AAU39703.1"
FT                   /translation="MRIDEWLSSRLAKTKAAGLYRSLKLPQAERTNWASNDYLGLANDK
FT                   RLIHAAETALRRFGAGSTGSRLTSGNTAWHEKLERKIAGFKQTEAALLFSSGYLANVGV
FT                   LSSLPEKGDVILSDQLNHASIIDGCRLSKADTVVYRHKDMNDLEEKLRAAQSRARRFIV
FT                   TDGVFSMDGTIAPLDEIMLLAKQYRAFVIVDDAHATGVLGEAGRGTSEYFGVSPDVVIG
FT                   TLSKAVGAEGGFVAGSKTLIDFLLNHARTFIFQTAVPPASCAAACKALDIIEDSRAKRR
FT                   LLQSSVNTIKRSLVDIGFTVNGEDTPIIPVMIGDPQKAVQFANGLKEKGIEAPAIRPPT
FT                   VAEGESRIRLTVTAERRLKDIEDLLEGFKLMGRELNLVK"
FT   gene            780810..781517
FT                   /gene="bioD"
FT                   /locus_tag="BLi00769"
FT   CDS_pept        780810..781517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioD"
FT                   /locus_tag="BLi00769"
FT                   /product="dethiobiotin synthase BioD"
FT                   /EC_number="6.3.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00769"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39704"
FT                   /db_xref="GOA:Q65ML0"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65ML0"
FT                   /protein_id="AAU39704.1"
FT                   /translation="MKGFFVTGTDTGVGKTFIACGLAALLKEQHVDVGVFKPFLSGELA
FT                   SDPQSDTALLKNMSETPLTDEEVTPFIFKEPLAPYTAAKLEGRTVGLEDAVNHWKKIKD
FT                   RHECFIVEGAGGIAVPLGEDYFVSDLIKALDLPAVIVARPNLGTINHTYLTAQYAKQMG
FT                   IRVIGIVINGISSRPGLDEQTNPDMIERFCGVPLLGVTPKLEDASPTQIHHMIKDHVDV
FT                   SLIMNQMQMGAEK"
FT   gene            781514..782515
FT                   /gene="bioB"
FT                   /locus_tag="BLi00770"
FT   CDS_pept        781514..782515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioB"
FT                   /locus_tag="BLi00770"
FT                   /product="biotin synthase BioB"
FT                   /EC_number="2.8.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00770"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39705"
FT                   /db_xref="GOA:Q65MK9"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65MK9"
FT                   /protein_id="AAU39705.1"
FT                   /translation="MNQWMELAERVLDGGEVTEKEALSILECPDDDVLLLMHAAFQIRK
FT                   RYYGKKVKLNMIMNAKSGLCPENCGYCSQSSISKAPIDSYRMVDKTTLLEGAKRAHDLN
FT                   IGTYCIVASGRGPSNREVDQVVDAVKEIKETYGLKICACLGLLKPGQAERLKEAGVDRY
FT                   NHNINTSKTNHSNITTSHTYDDRVNTVETAKKSGMSPCSGVIVGMKETKQDVVDMAKSL
FT                   KALDADSIPVNFLHAIDGTPLEGVNELNPLYCLKVLALFRFINPTKEIRISGGREVNLR
FT                   SLQPLGLYAANSIFVGDYLTTAGQNETEDHKMLHDLGFEVESVEEMKASLQR"
FT   gene            782533..783729
FT                   /gene="bioI"
FT                   /locus_tag="BLi00771"
FT   CDS_pept        782533..783729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioI"
FT                   /locus_tag="BLi00771"
FT                   /product="biotin biosynthesis cytochrome P450 enzyme BioI"
FT                   /EC_number="1.14.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00771"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39706"
FT                   /protein_id="AAU39706.1"
FT                   /translation="MTTELHEAGPSLKSDSDFWRDPYLFYDQLRSIHPVYKGTVLKHPG
FT                   WYVTGYEEAAAILKEPAFINRVPLPEASTKYEQLQRLQRNMMLFQNESGHKRMRTIAGK
FT                   EFMPQKTATFRPAIEETVHELLDQLENKKTADMVSEFAFPLASLIIAGMLGVPEEEWYQ
FT                   FRQWTADLIQTIDLTRTRKVMAKGGDTVAKLTAYFKNLIEKRKAHPSEDLISTFAGHEQ
FT                   LADEEVLATCILLVIAGHETTVNLLTNGLFLLMTHPDQLSELKENPLLIESAVEECLRY
FT                   ESPTQLTARTASEDCEINGKIIKKGEHLYILLGAANRDPKIFQNPHLFDITRKPNPHLA
FT                   FGAGAHVCLGSALARLEAQIAIPALLARLPNLKLASTDVPFRRLIGFRSLAELPVILN"
FT   gene            complement(783772..784602)
FT                   /locus_tag="BLi00772"
FT   CDS_pept        complement(783772..784602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00772"
FT                   /product="putative ion transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00772"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39707"
FT                   /protein_id="AAU39707.3"
FT                   /translation="MNTHQNRYSVQSKVSALINCRLFQSFITTVIVLNAISIGLETYAF
FT                   FKPYQKVFFIVDCLFLTIFVIELSLKLFVQKQHFFKNNWNVFDFVIVAGSLILYNTNFV
FT                   SVLRIFRVLRVLRTITSVPSLRRIVNALFMAIPTISSVIILMSIIFYVYAVIGTMFFSA
FT                   IAPEYFGNLQLSLLTLFQTFTLESWASGIFRPIFAESGWSWLYFVSFIVIATFIMINLI
FT                   VGEIVNNAQKISQEIEDETGELKEDTKEIKELRAEVKELKALLQTYITQNEKKD"
FT   gene            784760..785188
FT                   /gene="yfmP"
FT                   /locus_tag="BLi00773"
FT   CDS_pept        784760..785188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfmP"
FT                   /locus_tag="BLi00773"
FT                   /product="HTH-type transcriptional regulator YfmP"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00773"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39708"
FT                   /protein_id="AAU39708.1"
FT                   /translation="MDVEWMKIDQMAKRSGLTKRTIRFYEEIGLLSSPKRTEGGVRLYS
FT                   EDDLEELERVISAKEVLGFSLQELQQFMETGKHLEMNKEGYLLSLDKRERKEKLEDIQR
FT                   MLNEQMRMIDEKIEKFQSFKKRLEGMQAKAENALQSID"
FT   gene            785247..786431
FT                   /gene="yfmO"
FT                   /locus_tag="BLi00774"
FT   CDS_pept        785247..786431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfmO"
FT                   /locus_tag="BLi00774"
FT                   /product="multidrug efflux protein YfmO"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00774"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39709"
FT                   /protein_id="AAU39709.1"
FT                   /translation="MNEQPPENSSMFKQPKAVWAVAFACVISFMGIGLVDPILPAIAQQ
FT                   LHASPSQVSLLFTSYLLVTGFAMLLSGAVSSRIGAKLTLISGLILIIVFAGLGGLSHSI
FT                   SQLVGFRGGWGLGNAMFISTALAVIVSVASGGSAKAIILYEAALGLGISVGPLAGGELG
FT                   TISWRAPFFGVSVLMAAALLAIFFLLPPVQKPQKKISVSAPIKALRYKGLLTLSGAAFL
FT                   YNFGFFTLLAYSPFVLDLNERGLGYVFFGWGLFLAITSVFIAPAVQRIFGTVRSLILLF
FT                   MLFAADLLAIGIWTEHMALVIGAIIIAGGILGMINTILTTAVMEAAPVERSVASSAYSS
FT                   IRFIGGAIAPWIAGVLADHFTAHTPYFAGCIAVLAGIAVLAGGRRYLAGIKAGH"
FT   gene            complement(786474..788030)
FT                   /gene="yfmM1"
FT                   /locus_tag="BLi00775"
FT   CDS_pept        complement(786474..788030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfmM1"
FT                   /locus_tag="BLi00775"
FT                   /product="ABC transporter ATP-binding protein YfmM"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00775"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39710"
FT                   /protein_id="AAU39710.3"
FT                   /translation="MSLLTVTKLSHGFGDRAIFHDISFRLLKGEHVGLIGANGEGKSTF
FT                   MNIITGKLEPDEGKVEWSKNVRVGYLDQHTSLERGQTIRDVLRNAFHYLFAMEEEVNAI
FT                   YTKMGEADPDELEKLLEEVGTIQDALTNNDFYAIDAKVEEIARGLGLNDLGLDRDVAEL
FT                   SGGQRTKVLLAKLLLEKPDILLLDEPTNYLDEQHIEWLKRYLQEYENAFILISHDIPFL
FT                   NSVINLIYHVENQELTRYVGDYNQFREVYEVKKQQLEAAYKKQQQEISELKDFVARNKA
FT                   RVSTRNMAMSRQKKLDKMDMIELPSEKPKPEFHFKQARTSGKLIFETKELVIGYDEPLS
FT                   RPLNLRMERGQKIALYGANGIGKTTLLKSLLGEISPLSGEVERGEHLHIGYFEQEVKET
FT                   NNNTCIEEVWNDFPSFTQYEIRAALAKCGLTTKHIESRVSVLSGGEKAKVRLCKLINSE
FT                   TNLLVLDEPTNHLDVEAKEELKRALKEYKGSVLLISHEPEFYMDIATETWNCESWTTKV
FT                   L"
FT   gene            788168..789298
FT                   /gene="yfmL"
FT                   /locus_tag="BLi00776"
FT   CDS_pept        788168..789298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfmL"
FT                   /locus_tag="BLi00776"
FT                   /product="DEAD-box RNA helicase YfmL"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00776"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39711"
FT                   /protein_id="AAU39711.1"
FT                   /translation="MTERWPFLNKAKPFIQENWKASGFQDPTNVQKNAVDLILDGRDVI
FT                   AESPTGTGKTLAYVLPILEKLEADQKNVQAVILAPSRELVMQIFDVIVEWKKGSDIRAA
FT                   SLIGGANIKKQQEKLKKHPHIIAGTPGRVFELIKMKKLKMHEVKTIVLDETDHLLTPEH
FT                   RGTIQSIIKSTLRDRQLLCFSATLKDDAERELREMTKDAEVLKIKRSKEESAKVKHQFL
FT                   VCDQRDKVKILQKFSRLPGMQALVFVKDIGNLNVYAEKLKFHHVEIGVLHSEAKKIERA
FT                   KILQAFEAGEFTLLLATDIAARGIDIEDLPYVIHADLPNVEGYIHRSGRTGRAGNEGTV
FT                   ISLVNRIEEERLKKLAKKLEIPLQRIVYERGRIIER"
FT   gene            complement(789342..790364)
FT                   /gene="yfmJ"
FT                   /locus_tag="BLi00777"
FT   CDS_pept        complement(789342..790364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfmJ"
FT                   /locus_tag="BLi00777"
FT                   /product="putative NADP-dependent alcohol dehydrogenase
FT                   YfmJ"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00777"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39712"
FT                   /protein_id="AAU39712.1"
FT                   /translation="MPQKQIELARRPQGIPVMDDFRIKETEIPEAKNGEALVKTLYVSV
FT                   DPYMRGRMQDTKSYVEPFPLDEVITGGVIGEVISAKGDKLKKGDIVLGRLGWQEYSAVR
FT                   EDNLQKIDPSLAPVTAFLGILGMTGLTAYFGLLDIGQPKAGETVVVSGAAGAVGSAVGQ
FT                   IAKIKGARVVGIAGSDEKTAYLKEKLGFDEAINYKTTENMASALEQACPDGVDVYFDNV
FT                   GGAISDAVFTLINKFARIPVCGAISSYNVKSAEEDMGPRVQTALIKSSALMKGFVVNDY
FT                   RDRFPEGIKQLAEWVKSGQLQYEETITEGFERIPEAFLGLFEGKNLGKQLIKVADSDNA
FT                   "
FT   gene            complement(790421..790804)
FT                   /gene="yfmB"
FT                   /locus_tag="BLi00778"
FT   CDS_pept        complement(790421..790804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfmB"
FT                   /locus_tag="BLi00778"
FT                   /product="YfmB"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00778"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39713"
FT                   /protein_id="AAU39713.1"
FT                   /translation="MYYFSPEQQYNAWIISDLVKQIFSREGHQEADTHRFESFAARRFG
FT                   INIDYVFSIIMNIGDPEERRTASSTEDLLSSYLLSLLSFITKDMFQYSRENANQYLLNE
FT                   RNADVFHLFLPDSVLKKTFRAIR"
FT   gene            790999..791346
FT                   /gene="yflT"
FT                   /locus_tag="BLi00779"
FT   CDS_pept        790999..791346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yflT"
FT                   /locus_tag="BLi00779"
FT                   /product="general stress protein YflT"
FT                   /note="survival of ethanol stress"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00779"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39714"
FT                   /protein_id="AAU39714.1"
FT                   /translation="MKPVVRQYTNDEKLMKDVEELREIGVAREDIYVLSHDDDRTERLA
FT                   DNADANTIGAEETGIKNAVGNIFNKKGDELRNKIHEIGFSKQEAEQFEKQLDEGKVLLF
FT                   VTDHEKVKSWV"
FT   gene            791456..792892
FT                   /gene="yflS"
FT                   /locus_tag="BLi00780"
FT   CDS_pept        791456..792892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yflS"
FT                   /locus_tag="BLi00780"
FT                   /product="putative malate transporter YflS"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00780"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39715"
FT                   /protein_id="AAU39715.1"
FT                   /translation="MAKEKDAEQKSALNIIPLAVTILVGAVIWFIPSPAGLDPKAWHLF
FT                   AIFVATIIGFISKPLPMGAIAVFALAITALTGTLSIEETLSGFGNKTIWLIVIAFFISR
FT                   GFIKTGLGARIAYLFVRMFGKKTLGLSYSLLVSDLILSPAIPSNTARAGGIIFPIIRSL
FT                   SETFQSTPKDGTERRIGAFLLKVGFQGNLITSAMFLTAMAANPLIAKLAHDVAGVNLTW
FT                   TSWAVAAIVPGLVSLIITPLVIYKLYPPEVKKTPDAAKIATEKLKEMGPFKKSELSMVA
FT                   VFLLVLFLWIFGGNLNIDATTTALIGLAVLLLTQVLTWDDIKKEQGAWDTLTWFAALVM
FT                   LASFLNELGMVGWFSDAMKSYVSGFSWISAFLILIAVYYYSHYFFASATAHISAMYSAF
FT                   LAVIIAAGAPPLLAALSLAFFSNLFASTTHYGAGAAPVFFGAGYIPQSKWWSIGFILSI
FT                   VHIVTWLVVGGLWWKLLGIW"
FT   gene            793020..793598
FT                   /locus_tag="BLi00781"
FT   CDS_pept        793020..793598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00781"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00781"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39716"
FT                   /protein_id="AAU39716.1"
FT                   /translation="MFWSVDFMLLGFLYAIVYFLYDIVKNRKKTSFFRKIVFASFIVYL
FT                   SAVYHYTIGGINIPPQPAYAQMNIQLIPFYFVTEWVQMYQQSGFDWFFWNSVKLTFFNV
FT                   LLLIPLGVYLSVLWRKTSLKKAAVFVFLTSFLIESLQLVLSVTGLIMARTFNVDDLILN
FT                   TAGGVIGFCLTSFMFGAKGSDSRRKGLHF"
FT   gene            complement(793645..794427)
FT                   /locus_tag="BLi00782"
FT   CDS_pept        complement(793645..794427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00782"
FT                   /product="putative beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00782"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39717"
FT                   /protein_id="AAU39717.1"
FT                   /translation="MADSQWFTVTELDESTYAISEYGHWEKVHSYLLIGAKDAVLIDTG
FT                   LGIGSMKTVTDGLTDLPVSVITTHVHWDHIGSHDEYQRIYVHEAEREWLTDGIKGLPIE
FT                   QIRRDVSRDITKPVPAGFSAETYTPFRGEPSGTLQDGDTVGCDSRPLVIYHTPGHSPGH
FT                   ICIFDPASGYLFTGDLLYTGAPIYAFYPTTDPAQLVQSLEKVSAIGRVKKVFGGHHQLG
FT                   LAPDILEEAGHAARHLKKHGLAQHGTGMHRFKSLSFQF"
FT   gene            794530..795327
FT                   /gene="yflN"
FT                   /locus_tag="BLi00783"
FT   CDS_pept        794530..795327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yflN"
FT                   /locus_tag="BLi00783"
FT                   /product="putative beta-lactamase-like protein YflN"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00783"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39718"
FT                   /protein_id="AAU39718.1"
FT                   /translation="MMSDPYMPLTSVNSGVLEEYAEGVFGLTVQIVNVYFIFDPDSREA
FT                   VLIDAGMPKSAPFILREAKERFGDFRLKGIVLTHGHFDHVGALESLLETWPVPVYAHEK
FT                   EMPYLMGKADYPPAKPQVKSGLVAKMSPLFPRHSINISSHVKQLNKDGSLPFLEGWKWI
FT                   ETPGHTPGHVSLFRQSDRTLIAGDAVTTVEQESLFEVAIQKQELNGPPAYFTMDWTKAA
FT                   DSVRKLAGLKPAALLTGHGVPMKGSDFSEALLDLSDRLPASDS"
FT   gene            795536..797179
FT                   /locus_tag="BLi00784"
FT   CDS_pept        795536..797179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00784"
FT                   /product="putative carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00784"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39719"
FT                   /protein_id="AAU39719.1"
FT                   /translation="MKIQKRVQALLATSAMFAGLMLSDAVYAAETPYYGKNYTQPEQVS
FT                   SLYPEPEETFSTPAFVKEGEAFTTQEEMMKFITSLTKKSPNVKIGNIGFSIEKRNIPVL
FT                   YFTKDKQIRSISKKPTVWLQGQIHGNEPAAGESALAIAEKLAGPYGDKVLDKINVIVVP
FT                   RVNPDGSYQFNRRLANGIDGNRDHVKLESPEVRAIHQEFNKYSPEVVIDAHEYGVGQNE
FT                   FQSIGEKGSLKYHDILILSGKNLNIPKSIRHASDSLYVNGVRAKLDEKGFSNDAYYTTG
FT                   KSKDGKIEIYEGGTEARIGRNAFALQPALSFLVESRGIDIGRENFARRVAAQVATHETI
FT                   IDTTVKHAAEIKRLVSKEKLKLIQNGAKVSDKDQVVINSEFAGPFKDTLKVADIASGQA
FT                   VDVPVQYYSASEAVPVLSRTRPTAYLVLPGHQDIEQKLKDQGLKSVTLAFKQKLTAEAY
FT                   EVLSKETAGESEGRPVIKVETKLKKQKKEFPKGTKIYFTAQQQSNLLSIALEPESVDSY
FT                   VSTGYIPSQKGKELPVYRFMLNTKTLNFKE"
FT   gene            797308..798405
FT                   /gene="nos"
FT                   /locus_tag="BLi00785"
FT   CDS_pept        797308..798405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nos"
FT                   /locus_tag="BLi00785"
FT                   /product="nitric oxide synthase oxygenase Nos"
FT                   /EC_number="1.14.13.39"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00785"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39720"
FT                   /protein_id="AAU39720.1"
FT                   /translation="MESHEELWREAKAFIELCYGELSKSEEETRMRLHKIDKEIRETGS
FT                   YTHTLEEIEHGARMAWRNSSRCIGRLFWHSLTVIDQRGVQTEAEVRDALFHHIQLATNG
FT                   GKIRPFITVFPPEQNGQKKVSIWNHQLIRYAGYETEQGVIGDPASLELTKACEALGWKG
FT                   EGTPFDVLPLVFQIDGRPPVWYELPREIVKEVRIEHPEIEGFKSLGLKWYAVPIIADMK
FT                   LEVGGIHYNAAPFNGWYMGTEIGARNLADADRYNALEKVAAIMGLDTERNTSLWKDKAL
FT                   VELNTAVLHSYKKAGVSIVDHHTAASQFKRFEEQEAEAGRELAASWTWLIPPLSPAATH
FT                   IFHSYYENKTLKPNYFYQEKPYLNK"
FT   gene            complement(798493..799131)
FT                   /gene="sdpI"
FT                   /locus_tag="BLi00786"
FT   CDS_pept        complement(798493..799131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdpI"
FT                   /locus_tag="BLi00786"
FT                   /product="immunity protein SdpI"
FT                   /note="protection against SdpC"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00786"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39721"
FT                   /protein_id="AAU39721.1"
FT                   /translation="MRKHIFSLAIIAMNLIMWAIAYPHISGQVPIHWSSSGEIDRYASK
FT                   MEAMLAMIGLLVFVYVLMFLTPKIDPRRKNYQLFSKTYYILINAMLLIFSLINVLVIMT
FT                   GLGYDLPAGSIVPVLVGALLIVIGNYLPRVRSNFFFGIKNPWTLSSDSIWKKTHRFAAK
FT                   VFTLAGLLIAADGLLSISPEIMLPVILATVLAPYIYSYVLYRKEINMKS"
FT   gene            complement(799128..799412)
FT                   /gene="sdpR"
FT                   /locus_tag="BLi00787"
FT   CDS_pept        complement(799128..799412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdpR"
FT                   /locus_tag="BLi00787"
FT                   /product="transcriptional repressor SdpR"
FT                   /note="of the sdpR-sdpI operon"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00787"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39722"
FT                   /protein_id="AAU39722.1"
FT                   /translation="MNQTFKALADPTRRKILNLLKDRDMTAGEISDQFQMSKPSISQHL
FT                   KILKQAELIQDEKKGQYIIYSLNTTMFQEIIGWAFSFTEQAGKDKGDAK"
FT   gene            complement(799519..799791)
FT                   /gene="yflL"
FT                   /locus_tag="BLi00788"
FT   CDS_pept        complement(799519..799791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yflL"
FT                   /locus_tag="BLi00788"
FT                   /product="putative acylphosphatase YflL"
FT                   /EC_number="3.6.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00788"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39723"
FT                   /db_xref="GOA:Q65MJ1"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65MJ1"
FT                   /protein_id="AAU39723.1"
FT                   /translation="MLQYRIIVDGRVQGVGFRYFVQMEADKHKLTGWVRNRDDGTVEIR
FT                   AEGLEESLKQFLKAIQKGSPFSKVTDVKVEETKELDGFQKFNISY"
FT   gene            799903..800553
FT                   /gene="yflK"
FT                   /locus_tag="BLi00789"
FT   CDS_pept        799903..800553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yflK"
FT                   /locus_tag="BLi00789"
FT                   /product="putative molybdenum cofactor sulfurase YflK"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00789"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39724"
FT                   /protein_id="AAU39724.1"
FT                   /translation="MENQEYEIISIHVGRPRTYEFDGKQVETAIVKEPVSGPVYLSRTN
FT                   FEGDGQADLIHHGGEDKAVCVYPADHYMYWESVLKRKLPEAAFGENVTVKGLTEKEVCI
FT                   GDIFKLGEALVQVSQPRQPCFKLAKRLNQKDMVLKVRDTGYSGFYFRVLEEGIVAPDSR
FT                   LQLVSRDAHEATVSYANHLMYHDMGNHPAIRKILEVEALSESWRSSFLKQLSA"
FT   gene            complement(800780..800911)
FT                   /gene="yflJ"
FT                   /locus_tag="BLi00790"
FT   CDS_pept        complement(800780..800911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yflJ"
FT                   /locus_tag="BLi00790"
FT                   /product="YflJ"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00790"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39725"
FT                   /protein_id="AAU39725.1"
FT                   /translation="MHYGSKGWYVEELKKLGMTKYEGRKLQSYKKHFLANLLESVKK"
FT   gene            complement(801043..801198)
FT                   /gene="yflI"
FT                   /locus_tag="BLi00791"
FT   CDS_pept        complement(801043..801198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yflI"
FT                   /locus_tag="BLi00791"
FT                   /product="YflI"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00791"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39726"
FT                   /protein_id="AAU39726.1"
FT                   /translation="MLFAIIGLIFFIESILLIVYAHKKKNGFLKYIGIVLSIAIIVMIV
FT                   TSLTHG"
FT   gene            complement(801284..802036)
FT                   /gene="map2"
FT                   /locus_tag="BLi00792"
FT   CDS_pept        complement(801284..802036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map2"
FT                   /locus_tag="BLi00792"
FT                   /product="methionine aminopeptidase Map"
FT                   /EC_number="3.4.11.18"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00792"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39727"
FT                   /protein_id="AAU39727.1"
FT                   /translation="MIVTNDQELEGLKKIGRIVALAREEMKAKAAPGMSTKELDLIGKE
FT                   VLEAHGAASAPEKEYDFPGTTCISVNDEVAHGIPSESRILKEGDLINIDISAEFGGYYS
FT                   DTGISFVLGKGDEMLHKLCQSAESAFQKGLLQARAGKKQNQIGRAVYNEAKANGFTVIK
FT                   NLTGHGIGRNLHEAPNHILNYYDPFDNALFKNGTVIALEPFVSTKAEHTIEAGDGWTFK
FT                   TPDGSFVAQIEHTIVITKNEPIILTQLD"
FT   gene            complement(802161..804122)
FT                   /gene="ltaS1"
FT                   /locus_tag="BLi00793"
FT   CDS_pept        complement(802161..804122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ltaS1"
FT                   /locus_tag="BLi00793"
FT                   /product="polyglycerolphosphate lipoteichoic acid synthase
FT                   LtaS"
FT                   /EC_number="2.7.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00793"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39728"
FT                   /protein_id="AAU39728.1"
FT                   /translation="MKRFIKERGLAFFLIAAILLWLKTYAAYVIEFNLGITNTVQHILL
FT                   FVNPISSSLFFLGLGLLFKKKIQQTAIIVIHFLMSFLLYANVVYYRFFSDFITLPAIMQ
FT                   AKTNGGQLGDSIFSLMHPLDVLYFIDTFILIGLAVFYNRPSETTTKRPFKIVMGASILV
FT                   FLANLAVAEIDRPELLTRSFDRNYLVKYLGTYNFTIYDAVQNIKSNSQRALASSSDVTE
FT                   VENYIKANHDKPNAEYFGKAKGMNVVYISLESLQTFLIDYKLDGKEVTPFLNSLAHDNE
FT                   TFYFDNFFHQTGQGKTSDAEFMMDNSLYPLSQGSVFINKAQNTLQSAPAILKSQGYTSA
FT                   AFHGNYKTFWNRNEMYKAIGYDKFFDATYYDMSEDKTKNYGLKDKPFFEESMPLLKSLK
FT                   QPFYTKFITLSNHFPFEMDEGDTDFPAGDTGDSVVDHYFQSANYMDQALEQFFNDLKKA
FT                   GLYDNTIVVMYGDHYGISENHNKAMAKVLGKDITPYENAQLQRVPLFIHAPGVKGIKSH
FT                   KYGGEVDVAPTLLHLMGVNTKDYLMSGSDLLSPEHREIIPFRNGDFVSPEYTKTNGNYY
FT                   DTKTGELLNEKDIDPNIEEAVKKELEMSDKIVDGDLLRFYKPKGFKAINPSDYDYTNHN
FT                   PKTSESDAAQTTKSDSGQ"
FT   gene            804384..804770
FT                   /gene="yflB"
FT                   /locus_tag="BLi00794"
FT   CDS_pept        804384..804770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yflB"
FT                   /locus_tag="BLi00794"
FT                   /product="YflB"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00794"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39729"
FT                   /protein_id="AAU39729.1"
FT                   /translation="MDFSSIVSEDKIKQAIKDGEFEGLPGMGKPLKKDDAAHVPEHLRM
FT                   AYRVMKNAGMAGDEGALKKELMTIDDLIAKCADEDERERLIERKTETRLRLDRLADKKG
FT                   MFSKPASAFYKEKVYRRLSGNKKR"
FT   gene            804832..806244
FT                   /gene="yflA1"
FT                   /locus_tag="BLi00795"
FT   CDS_pept        804832..806244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yflA1"
FT                   /locus_tag="BLi00795"
FT                   /product="sodium/alanine symporter YflA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00795"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39730"
FT                   /protein_id="AAU39730.1"
FT                   /translation="MERLLNWVEYISDWLWGPPLIILLTGTGVYLTILLKFFQFRYPLY
FT                   IFKQTIGSVGKKPKGEGTVTPLQALTSALSSTVGAANIVGVPAAIMFGGPGAVFWMWLV
FT                   ALFAMAIKFSESVLAVHYREKNEEGEYVGGPMYYITKGLSMKWLGVFFSVALMIELVPS
FT                   IMVQGNSVSASLAETFSFNRLYTGIGIAFLIGLVVIGGIKRIGKVTELAVPLMAGAYIG
FT                   AGFLIVVTNLSSVPAFFSLIFSNAFTSSSAFGGFAGAAVAETVRWGFARGLYSNEAGMG
FT                   TAPIAHAAAMTDHPVRQGFWAVIGIVVDTLLICTTTAFVVLASGVWTGENASSDPGALA
FT                   AAAFRSYFGPVGGYFVSVSLVFFVLSTITVVIFYGVKQAEFLFGRLAGHVIKFIYLAAV
FT                   VIGAAGGAKAIWGFLDLALVFILLPNILAVLLLSRKVRSLYDEFFTSEKYYLKDIGQQD
FT                   GVYEGDEKVNNL"
FT   gene            806433..807845
FT                   /gene="treP"
FT                   /locus_tag="BLi00796"
FT   CDS_pept        806433..807845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treP"
FT                   /locus_tag="BLi00796"
FT                   /product="trehalose-specific phosphotransferase system
FT                   EIIBC component TreP"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00796"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39731"
FT                   /protein_id="AAU39731.1"
FT                   /translation="MTDLNQSARRIVDAVGGADNIAAVTHCVTRLRFALLDESKVNQEV
FT                   LEQIDVVKGSFSTNGQFQVVIGQGTVNNVYAELVKATGIGESSKDDVKKASEKNMNPLQ
FT                   RAVKTLADIFIPILPAIVTAGLLMGINNILTAQDIFFSGKSIVEVYPQWADLANMINLI
FT                   AGTAFAFLPALIGWSAVKRFGGNPLLGIVLGVMLVHPDLLNAWGYGAAEQSGEIPVWNL
FT                   FGLEVQKVGYQGQVLPILLASYLLAKIERFLTKRTPESIQLLVVAPITLLVTGFASFIV
FT                   LGPITFAIGNVLTSGLIAVFEQFAVLGGLLYGGLYAALVITGMHHTFLAVDLQLIGSKL
FT                   GGTFLWPMLALSNIAQGSAALAMMFIVKDEKQKGLSLTSGISAYLGITEPALFGVNLRY
FT                   RFPFVIAMISSGIAGMFISSQGVLASSVGVGGVPGIFSIMSQYWGAFAIGMAIVLIAPF
FT                   AGTYLYAKLKMK"
FT   gene            807919..809607
FT                   /gene="treA"
FT                   /locus_tag="BLi00797"
FT   CDS_pept        807919..809607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treA"
FT                   /locus_tag="BLi00797"
FT                   /product="trehalose-6-phosphate hydrolase TreA"
FT                   /EC_number="3.2.1.93"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00797"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39732"
FT                   /protein_id="AAU39732.1"
FT                   /translation="METKENPWWKKAVVYQIYPKSFKDTTGNGVGDIRGIIEKLDYIKE
FT                   LACDVIWLTPIYQSPQNDNGYDISDYYSIHEEYGTMADFEELLEEAHKRGIKVIMDLVV
FT                   NHTSTEHRWFKEAASGKENLYRDFYIWKDMKPNGAPPTNWESKFGGSAWEFHAESGQYY
FT                   LHLYDVTQADLNWENEAVRKKVYEMMHFWFEKGIDGFRLDVINVISKDQRFPDDDEGDG
FT                   RRFYTDGPRVHEFLNEMNREVFSKYDSMTVGEMSSTTIADCIRYTNPESRELDMVFNFH
FT                   HLKADYPNGEKWALADFDFLKLKKILSEWQTEMNKGGGWNALFWCNHDQPRIVSRYGDD
FT                   GKYRKKSAKMLATAIHMLQGTPYIYQGEELGMTNPKFDDISLYRDVESLNMYRILKEAG
FT                   KPEAEIIEILKAKSRDNSRTPVQWNGEENAGFTAGTPWIPVPDNYKEINAEEALNDPDS
FT                   IFYHYKKLNELRKEFDIITTGDYQLILEDDQELYAYLRNGADEKLLVINNFYGKETEFQ
FT                   LPDDIDIEGYDAKVLISNDTDLPESFKRFTVKPYQSIVYHLAKPC"
FT   gene            809629..810345
FT                   /gene="treR"
FT                   /locus_tag="BLi00798"
FT   CDS_pept        809629..810345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treR"
FT                   /locus_tag="BLi00798"
FT                   /product="transcription repressor TreR"
FT                   /note="of the treP-treA-treR operon"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00798"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39733"
FT                   /protein_id="AAU39733.1"
FT                   /translation="MKINKYMMIYKQIAEQIDQSILNAGDILPSENDLAEQHDTSRETV
FT                   RKALNVLAQNGYIQKIKGKGSVVLHREKMQFPVSGLVSFKELSETLGKETSTTVHEFGL
FT                   THPDAYIQKQLRTSGDEEVWRVVRSRNINGERIILDKDYFIRKHVPLLTKEICEDSIYQ
FT                   YLEDECGLVISYAHKEIVVEPCTAEDQEYLDLNGYEHIVVVKNFVFLDDTTLFQYTESR
FT                   HRLDKFRFVDFARREK"
FT   gene            810452..811144
FT                   /locus_tag="BLi00799"
FT   CDS_pept        810452..811144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00799"
FT                   /product="putative hexapeptide transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00799"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39734"
FT                   /protein_id="AAU39734.1"
FT                   /translation="MIHETAKIGKNVVLGEHAVIEENVVIGDNVTIGHHAIIKKDTHIG
FT                   SGVKIGDLAVLGKAASSNKKMARQPKQAGAPLRIEDDAIVGASAVIYRDVLLEQGVFVG
FT                   DMASIRENVAIGRESIIGRNAMVENNTRIGSKATIQTGCYITADMTIEDEVFIGPCCST
FT                   SNDKYMGKGNYPYQGPTIKRGAKIGNNATLLPAVVVGEGAVIGAGAVITKDVPAGKTAV
FT                   GNPGRLMK"
FT   gene            811216..815094
FT                   /locus_tag="BLi00800"
FT   CDS_pept        811216..815094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00800"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39735"
FT                   /protein_id="AAU39735.1"
FT                   /translation="MSFKDHCRRKMERMGVEKMSIQNAVMNGGFETGAFSPWVGVNTSV
FT                   TSQFSHSGFFSARFLGGTATSYIAQFVPAGAGEGSEFLVSLAKAGFLPAPSVTIQVTYF
FT                   DSQFNFLGYGLFATVTSSRIPAAENGTWLEVYQTTSPAPLGTTQAFILINNIPQAGTAS
FT                   VFVDDVALLSVEGGGAPTGATGPTGATGPTGATGPTGVTGPTGVTGATGPTGVTGPTGA
FT                   MGPTGATGATGPTGVTGSTGVTGATGATGPTGVTGPTGAMGPTGATGATGATGATGATG
FT                   ATGPTGVTGATGATGPTGVTGATGATGPTGATGATGPTGATGPTGATGATGPTGATGAM
FT                   GPTGATGPTGATGPTGVTGSTGATGATGPTGATGAMGPTGATGPTGATGPTGVTGSTGA
FT                   TGATGPTGATGAMGPTGATGPTGATGPTGVTGPTGETGATGPTGATGPTGVTGATGPTG
FT                   VTGPTGATGATGPTGATGATGATGPTGVTGATGVTGSTGATGPTGATGPTGATGATGAT
FT                   GPTGVTGATGATGPTGVTGPTGATGATGATGATGATGATGPTGVTGAAGATGPTGATGA
FT                   TGPTGVTGAAGATGATGPTGATGATGPTGATGPTGATGATGPTGATGATGPTGVTGPTG
FT                   ATGATGATGPTGVTGATGATGPTGVTGATGPTGETGATGPTGATGPTGATGATGPTGAT
FT                   GAMGPTGATGPTGATGPTGVTGPTGETGATGPTGTTGAMGPTGATGPTGATGPTGVTGS
FT                   TGATGATGATGATGPTGATGPTGATGPTGVTGATGPTGVTGPTGATGATGPTGATGPTG
FT                   VTGPTGATGATGATGPTGATGATGPTGATGPTGATGATGPTGATGAMGPTGATGPTGAT
FT                   GPTGVTGPTGETGATGPTGTTGAMGPTGATGPTGTTGAMGPTGATGPTGTTGAMGPTGA
FT                   TGPTGTTGAMGPTGATGPTGTTGAMGPTGATGPTGTTGAMGPTGATGPTGTTGAMGPTG
FT                   ATGPTGTTGAMGPTGATGPTGATGPTGVTGSTGATGATGATGPTGATGAMGPTGATGPT
FT                   GATGPTGVTGATGPTGVTGPTGATGATGPTGATGATGATGPTGPTGVTGAAGATGPTGV
FT                   TGATGVTGSTGATGATGATGATGPTGVTGAAGATGPTGAAGATGPASPQTAIFFNNLFG
FT                   STSVYNPPTIPLNTEVTVVNVPNVPVTSGQNIKVDYALAVEAVNTANSNIVFEIRLYRG
FT                   GTLVQSRIFNRSLASAGTQRFPLASTIVDTVPATATIDYSVRVAVTTASNVTSAAAFNR
FT                   DLNLIRFP"
FT   gene            815280..818147
FT                   /locus_tag="BLi00801"
FT   CDS_pept        815280..818147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00801"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00801"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39736"
FT                   /protein_id="AAU39736.1"
FT                   /translation="MSIQNSVVNGSFEAGSLSPWAGQNAAVTTQFSHSGFWSATLLGGA
FT                   TVSFIAQFVPVDEGEGLEFLVSLAKSGILPSPQVQIQVSYFDSMFNFLGQGLFINIPFN
FT                   RLPVVQNNAWLEVYQTTSPAPSGSTMAFILINTLPQAGTANVIVDDVALLDIEVADVIG
FT                   PTGPTGATGPTGATGPTGATGPTGATGATGPTGATGATGPTGATGATGPTGATGPTGAT
FT                   GATGPTGATGATGPTGATGPTGATGPTGATGATGATGATGPTGPTGATGATGPTGATGA
FT                   TGPTGATGATGPTGATGATGATGATGATGATGATGATGATGATGPTGPTGATGATGPTG
FT                   ATGPTGATGATGPTGPTGATGPTGATGATGPTGATGATGPTGATGATGATGPTGATGAT
FT                   GATGPTGATGPTGPTGATGATGPTGATGATGATGATGATGPTGATGATGATGPTGATGA
FT                   TGATGATGPTGATGPTGATGATGATGATGATGPTGATGATGPTGATGATGATGATGATG
FT                   PTGATGATGATGATGPTGATGATGATGPTGATGATGATGATGPTGATGATGATGATGAT
FT                   GATGPTGATGATGPTGATGATGATGATGATGPTGATGATGATGATGPTGATGATGATGA
FT                   TGATGPTGATGATGPTGATGATGPTGATGATGATGPTGATGATGPTGATGATGATGPTG
FT                   ATGATGATGATGPTGATGVTGATGATGPTGATGATGATGATGATGPTGATGATGATGPT
FT                   GATGATGPTGATGPTGPTGATGATGATGAIGPTGATGPTGATGATGPTGATGATGPTGP
FT                   TGATGPTGPTGAGLVSALSARNQGTVTVGVGGLVPFATPEESFGTDITQTATTTFTISS
FT                   PGYYSVRFILYTAALSLLGGAQIVVNGTPVSGAFTLISVGTPLVGEAMIEVTAVPSTIQ
FT                   IAVTGLALTLATGNSGHIQIEKLSN"
FT   gene            complement(818494..819588)
FT                   /locus_tag="BLi00802"
FT   CDS_pept        complement(818494..819588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00802"
FT                   /product="putative pyridoxal phosphate-dependent
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00802"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39737"
FT                   /protein_id="AAU39737.1"
FT                   /translation="MIRLIEPYITFEEVQAELKEIFSSGMLTKGPYVRTFADHMRQYVS
FT                   AKHAFLTTSATTALSMCLKSLNVQPGDEVIVSDFSFPATVNVIEDLGAKPVFADVDLET
FT                   FNMLPEELESQITSRTKAVLFVDALGNPTGITNIKQICKEYGLPLVDDAACAIGSSEYG
FT                   CKSGKIADLTCFSFHPRKLLTTGEGGAITTDREELKDWLSVKLNHGAAISDGKLDFIDF
FT                   GYNYRLSDIQAALGIKQLQKLDDIIHRRNLQQKAYSEQLEPLGFQSQKIGPAVVHNIQS
FT                   AVFKVPKNIVRDELIQYLSDCHIESTFGTYCLSGTPYYRRKYQQLKSNSLFLEQHTITL
FT                   PCHDEVDLDHVVSAIQSFIKFKVD"
FT   gene            complement(819585..820130)
FT                   /locus_tag="BLi00803"
FT   CDS_pept        complement(819585..820130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00803"
FT                   /product="putative hexapeptide transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00803"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39738"
FT                   /protein_id="AAU39738.1"
FT                   /translation="MLKQWKSEGKGEFTLSQLGGCGENVVIEDGVRIFHPENIYIGDNV
FT                   YIGHDTILKGYYKHDLIIGSNSWIGQQCFIHGAGGVTIGEFAGIGPNVRIHAAYHTDPD
FT                   KPDSTILFSPLTFAPIHIEENCNIGIGASILAGVTIGAHSKIGANAVVNRNIPPYSIAV
FT                   GVPAKVIKNRRMKDEDLS"
FT   gene            complement(820145..821119)
FT                   /locus_tag="BLi00804"
FT   CDS_pept        complement(820145..821119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00804"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00804"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39739"
FT                   /protein_id="AAU39739.1"
FT                   /translation="MSDMTELSGQHIFITGGAGFIGSSLIGKLIERNSVTVYDNFSRDS
FT                   LRYKPYRDHPHLKVLQGDILDLNALKKAIQGASHIVHAAGIAGIDTVIQNPVKTMQVNM
FT                   IGSANLLEAAAGLTECKRVVCFSTSEVFGQIAFRARETSHTVLGAVGEARWTYAVSKLA
FT                   EEHMAYAYFKELGLPTVTVRPFNVYGPEQVGEGAIKTMVHRALLDEPIYIHGDGTQIRA
FT                   WCYVDDMIDGILRCLTMKEAIGESFNIGNERTVITVYGLASTIIRVLGSKSQIFFGEKK
FT                   EADIELRIPQVNKAKEMLGFSAKVDLEEGIRRTAESIKKNLDQ"
FT   gene            complement(821187..822560)
FT                   /locus_tag="BLi00805"
FT   CDS_pept        complement(821187..822560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00805"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00805"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39740"
FT                   /protein_id="AAU39740.1"
FT                   /translation="MKDFKSDIIHCLEQKEWNKAMKRLKEWEAQGSHNEPDFYFLQASL
FT                   SVYLGHDYNAWLWLWRGLDLFPENRSLNLLMGKVCLRTGREKESAAYLQKGDGAETASW
FT                   PKLDLPVDEKTEPPAGQIRILQGTMEIANQMNTLAKGLSQHGALAHTLNYYPYYLNYAA
FT                   DYTWSLLKERNTPAMNAKLRRLANDLLPSYDLFHFHFGTSFTLDMSDYPILKQAEKPMV
FT                   MHHWGSDVRLYSTLAKTNPYAVVKTKNEARIRYHLKRISQYVQHCIVADMELYEYVKDY
FT                   YEHVHMIPTMIQLDRYTPDYRSNEKPLIVHAPTSPGIKGTRHILKAVESLKEKYDFHFH
FT                   LVQGVSHEQAKKIYQKADLIIDQLHIGSYGLFAVESMAMGKPVICWISDFMKDHYPSEL
FT                   PLIRANPANITEVIENVLKNRDMLPEIGQKGRKYAEVHHDMVKNSKKTLAVYQSLLSE"
FT   gene            complement(822716..824959)
FT                   /locus_tag="BLi00806"
FT   CDS_pept        complement(822716..824959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00806"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00806"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39741"
FT                   /protein_id="AAU39741.1"
FT                   /translation="MDNELEYLLDSVGLSWRETEISQLIFHHKWHDAAQKLEEKLKAAP
FT                   FDPGLLISAAFVCEKKQQAQRASELYDDALLFVRREHRPRLMKEKEDLFKKMVRRPKII
FT                   FFVKPDLDRFLNSVVEHLSGTYRTKKIVVHDLNQIDAGMQWADICWFEWCDDLLIHGSK
FT                   VPSAAAKTLICRLHSYEAFTFYIKKVYWQAVDQVIFDGEHLREYVLDQVKALKKEKTAV
FT                   VPNGIKLDQYTFKQRQKGFHIAYVGYINYKKGPMLLLQAFKALIDKDPRYKLFIAGTFQ
FT                   DARYQLYFKQMIDELRLTDSVQFDGWQDDMNQYLEDKHYLICTSLLESQHMSAMEAMAK
FT                   GIKPLIHNFYGAKTIYDESVVWNTIDEFVAMITSGDYTSLHYRSFIEEHYSYDLSMRKI
FT                   EEMISGFAKQSELTVMPNPPLITVGIINYNYSNFIDECLQSVLNQLYPNIDILIVDDHS
FT                   TDDSMQKISSYQKTHPHIRTICHSENTKLPDLAFKEIFQEAKGEYVLLLSADDFLPHNL
FT                   VIHDFMQCFFEEEGLDYVYGDLLLVDQHGKNAGLWTYQEYGDEELVRTIFQRGGSGIVP
FT                   MVGMFKASYYQQKGFTWLVDPQKPLAGDVLNCLANTKRGWKRRYLKKPVLCYRRHQKNI
FT                   SYQLHKRIQSLVYVMDYIVKEFDESVYFPHIKWKELEENQRQSLKYFSIGKTFWRMARR
FT                   YAQNGYTRHLDQDAKKECIQPLLDKMDEYFQLSLASDNQYERYMKNIKKIQLI"
FT   gene            825154..826236
FT                   /locus_tag="BLi00807"
FT   CDS_pept        825154..826236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00807"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00807"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39742"
FT                   /protein_id="AAU39742.1"
FT                   /translation="MVTISLCMIVKNEEEVLARCLDTVKDIVDEINIVDTGSTDKTVEI
FT                   AKRYTDRVFFFEWIGDFAAARNESFKHATKDYILYLDADDVLLEEDQKKLKELKETLDP
FT                   SVDSVSMYYDAGTDEFGNVTLRYRRNRLVKREKNFKWKGDCHQYLEVFGNIINADISVT
FT                   HKKIRHSVGRNLNIYQKKIDRGDTFTPRDYFYYGNELRENRHYEKAIESYNKNIEMKEG
FT                   WIEDKVYACINKADCHRFLGDMDNELRSLFQSFEFSKTPRAETCSRIGYNFQRRREYKA
FT                   AIYWYELATTLVPDSNKWSFTYPAYYTWYPHLQMCVCYYNLGDFEKSYHHNEEARKYRP
FT                   EDKSVLHNKQLLEGKLGINN"
FT   gene            826359..827468
FT                   /locus_tag="BLi00808"
FT   CDS_pept        826359..827468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00808"
FT                   /product="putative pyridoxal phosphate-dependent
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00808"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39743"
FT                   /protein_id="AAU39743.1"
FT                   /translation="MIPLVNLKRQFQTVKQDILKEFEHVLDSGQYILGPKVEELEKRIA
FT                   EKLGVKEAVAVANGTDALVLTLEAFGIGKGDEVITTPFTFFATAEAVSRVGAEPVFADV
FT                   DPETYNLDPKKIEEKITPATKAIIPVHIFGQPADMDEIMELAKKHGLLVIEDACQAFGA
FT                   SYKERPVGSIGDAACFSFFPTKNLGTLGDGGMVTISDPDAARQLRTLRTHGTSKKYFHD
FT                   KIGFNSRLDELHAAALLILLEKIDGWNEQRRRVASRYREGLKTAEHLTLPAEKEDRTHI
FT                   YHLYCIGAKNRDYIIQSLKEQDIHSGVYYPCCLHLQSVYSSLQYKKGDFPIAESLSETL
FT                   FAIPMDPFLAAEEQDQIISALLKKGGGEK"
FT   gene            827465..828529
FT                   /gene="yrbE"
FT                   /locus_tag="BLi00809"
FT   CDS_pept        827465..828529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrbE"
FT                   /locus_tag="BLi00809"
FT                   /product="putative NAD(P)-dependent oxidoreductase YrbE"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00809"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39744"
FT                   /protein_id="AAU39744.1"
FT                   /translation="MTVHFGLIGCGYMSRKHLQALAECDDAKLSAVSDLQEERMKEAEE
FT                   YYASLAGEESRMTRYPQYQALLSDPKIEAVIIAAVSGLHAEMAKHALLAGKHVIVEKPM
FT                   TLSLRDADELIELAEQNGLKLMVCHQMRHRPIMKKLKETIEEGKLGKIYLGTVSLRLNR
FT                   SPAYYEAASWRGSWEKDGGMLVNQGIHLIDLLQWFLGDVKGVYGDMLGGSGAKETEDVA
FT                   VGILTFASQAKGVVEANIVTQPNNIGSSLSIFGENGTISLEGPALNRISRWYIHGEKAD
FT                   AEEAAKLIDIGGEQTAMYQNFISALKRQDTLLVDGYEGKKAIETIFGIYQSVLQKQPVQ
FT                   LPLSSFQTTDMKNK"
FT   gene            828615..829910
FT                   /locus_tag="BLi00810"
FT   CDS_pept        828615..829910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00810"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00810"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39745"
FT                   /protein_id="AAU39745.1"
FT                   /translation="MSKQEIHNETIAVIGLGFVGLPLAMLLISKGMRVIGVDLDKKKVE
FT                   ALRKGTSYISDINDQAVQDGIGTGFFRPVSDYSLIGEADAVIICVPTPLNDDAGPDLNY
FT                   VKRAAQLIGAHLKKGQLVVLESSTYPGTTRDIVKPILEKSGLVCGKDFYLAYSPERVDP
FT                   GNQFPIEVVPKVVGGATDACLEKVHQLYSGIYEEVVPVTSPETAELTKLLENTYRFINI
FT                   SFINEFAMICDRLGVNVWEVIEAASTKPYGFAAFYPGPGIGGHCIPVDPLYLQFVMKQS
FT                   GLSSDFIELSEATNDRIVRYISERSLQLAGKDKATDARILIYGVTYKRNIADVRESKSL
FT                   DIIEKLIGMGADVSYHDPHVPDLDLSGKKLASVPIDSKMLKEYDCVVILTDHDALPKEL
FT                   LLNHANVIFDTRGVLREAAGKAKVIQLGNGRS"
FT   gene            829991..830902
FT                   /locus_tag="BLi00811"
FT   CDS_pept        829991..830902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00811"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00811"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39746"
FT                   /protein_id="AAU39746.1"
FT                   /translation="MWIGILLMVSGIGISIFAVSLIVSYLFVLPNRSTYEETFFSGLKH
FT                   GEIIDDVFESHDKEELFLTAGDGCRLHALLFPVQKSRKAVIISHGIKWSLFGGYKYVEL
FT                   FQSIGYNVLLCDSRCHGLSGGSHVSYGFYEKDDLARWADELENRFGKDLWIGVLGESLG
FT                   AAAAIELMKQDRRIKFCIADSCFSDLTELCRFQLKAAVKLSVPFLIPLASGLIKRRHGW
FT                   SLADISPVSNLEQSDTPLLIIHGTKDQLVPPEMAKSLYERKKGFKKLYWIEGAGHVGGF
FT                   RHNPEEYLNKIKDFILKIEPAN"
FT   gene            complement(830899..831291)
FT                   /locus_tag="BLi00812"
FT   CDS_pept        complement(830899..831291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00812"
FT                   /product="putative HTH-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00812"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39747"
FT                   /protein_id="AAU39747.1"
FT                   /translation="MKKHPAACEAPDGYSCPVEATIDIIGGKWKSVILYHLIDDKKRFN
FT                   ELRRLIPGVTQRMLTLQLRELERDGIVCRTIYKQVPPKVEYSLTEFGKTLIPIIRQMMN
FT                   WGTSYAGKIKEARQRSAAAEKLESQG"
FT   gene            831422..832105
FT                   /gene="yfkO"
FT                   /locus_tag="BLi00813"
FT   CDS_pept        831422..832105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfkO"
FT                   /locus_tag="BLi00813"
FT                   /product="putative nitroreductase YfkO"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00813"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39748"
FT                   /protein_id="AAU39748.1"
FT                   /translation="MTEQSKKQEILDAFQFRHATKEFDPDRKISDEDFQFILEAGRLSP
FT                   SSVGLEPWQFVVVQNKELREKLRQVSWGAQGQLPTASHFVLLLGRTAKEMRRDSGYVAD
FT                   QLKHVKKMPEDIIENMLKEDGVLESFQDGDFHLYESDRAMFDWVSKQTYIALANMMTAA
FT                   ALIGIDSCPIEGFNYDKVHDILEKEGVLEDGRFDISVMAAFGYRVKEPRPKTRRALDQI
FT                   VKWVE"
FT   gene            complement(832147..836484)
FT                   /gene="yfkN"
FT                   /locus_tag="BLi00814"
FT   CDS_pept        complement(832147..836484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfkN"
FT                   /locus_tag="BLi00814"
FT                   /product="trifunctional nucleotide phosphoesterase protein
FT                   YfkN"
FT                   /EC_number="3.1.3.6"
FT                   /EC_number="3.1.4.16"
FT                   /EC_number="3.1.3.5"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00814"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39749"
FT                   /protein_id="AAU39749.1"
FT                   /translation="MVGIQKRRFSRKNILRILLTSVMILSLLMPNTQTYAEEQNEHPLI
FT                   SLSILGTTDIHAHMMDYDYYADKETAEFGLARTAQLIEKYRSRNPNTILVDNGDLIQGN
FT                   PLGEYIFKHERESIISGTKTHPIIDVMNKLQYDAGTLGNHEFNYGLEFLDGTIKGAEFP
FT                   IVNANIKTPDGKNKYTPYHIEDRTLTDESGRKHQLKVGYIGFVPPQILTWDKKHLDGKI
FT                   TVQDITESAKETIPKMKQEGADVIIAIAHSGIENGEQAAGAENAVYDLALKTEGIDAII
FT                   SGHQHGLFPGTDYPGNGVIDNQKGTINGIPVVMPKNWGSHLGIIDMQLELDGGKWKVKD
FT                   ASAKTEAIAGNVTSRNETVVSAIKDTHEKTLEYVRAPVGQTEADINSFFAQVKDDPSIQ
FT                   IVTDAQKWYAEDVMKGTEYENLPILSAGAPFKAGGRNGADYYTNIKAGNLAIKNIGDLY
FT                   LYDNTLYIVKLTGSEVKDWIEMSAGQFNQIDPSKSGEQALLNPDFRSYNFDVIDGVTYQ
FT                   IDVTQPAKYNASGGVKNPQANRVKQLSYNGKPVRDDQEFLVVTNNYRASGGGGFPHLTQ
FT                   DKVVYAAADENRQVLMNYIMEKKTVNPAADNNWSIAPIKGADVTFESSLLAKPFAEKAN
FT                   DIDFVRESENKGYGVYKLNFDGSEPPVDDENWTLTVMHTNDTHAHLDGAARRAAKVKEI
FT                   RSETENNVLLDAGDVFSGDLYFTKWNGLADLKLMNMMGYDAMTFGNHEFDKGPKVLADF
FT                   LSGNYTAVDPLNRHQLEKPDFPIVSSNVDVSKEPKLRSFQKEPAVLAAGKKKESGIYPY
FT                   ILLDVNGEQVGVFGLTTEDTSYTSSPGPNIAFHDAYQSAEKTVKELKEKEKVNKIIALT
FT                   HLGYNRDLELAKKVKGIDLIIGGHTHTLVDHLKVVENEEPTIVAQVKDYGQFLGRVDVV
FT                   FDENGVVQTDQSRFNLIAIDDKVDEDPPGKEVLDGFKEDIDELKKKKVGYADVPLDGKR
FT                   EHVRSKETNLGNFIADGMLKKAKQAGGADIAITNGGGIRSGIAKGEITLGDVLTVMPFG
FT                   NTLYAADLTGAQIKEALEHGVSQVEEGGGAFPHVSGLSFTFTLSKPKGERILDVNLVND
FT                   KGDAVPLDLDKTYRVATNNFMGGGGDGYSVFKEAKNGVDLGFTDYDIFTEQLALYDSVS
FT                   PNIENRITEVFLPDRQADGSWTLAEKPFETYAKNANQAIAYFPDTEKEHIMLNMTKAQT
FT                   DLVKERTGDPSITLKNDRIAMQLPAVNLASEKTKISIKIAKDIKQAVTKVYDFNIQQNG
FT                   KTVSTFKEPVGLLFQVDAPDKHLSVYYVDRKNNSFTKVTNGYTKGRTVAGYVDHFSEYT
FT                   VMNDNDAGSPSLPTGSGDDDTPDGGSGGEPPASPGAGSGGDGSGGHDSGGADDGNEPSD
FT                   GSNGGFLPDTASNAYHWLMLGLLLLISGSGLYLYQRKRRKLQI"
FT   gene            836713..837228
FT                   /gene="yfkM"
FT                   /locus_tag="BLi00815"
FT   CDS_pept        836713..837228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfkM"
FT                   /locus_tag="BLi00815"
FT                   /product="putative peptidase C56"
FT                   /EC_number="3.2.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00815"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39750"
FT                   /protein_id="AAU39750.1"
FT                   /translation="MSKKIAVVLTDYFEDSEYTEPAKAFKDAGHQLTVIEKEKGKTLKG
FT                   KQGEAQVETDASIDEVSPADFDALLIPGGFSPDILRADQRFVSFAKSFMDDKKPVFAIC
FT                   HGPQLLITAKALDGRGATGYTSIQVDLENAGVKFKDEEVVVCQNQLVTSRTPDDIPAFT
FT                   RESLKLLG"
FT   gene            complement(837269..837484)
FT                   /locus_tag="BLi00816"
FT   CDS_pept        complement(837269..837484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00816"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00816"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39751"
FT                   /db_xref="InterPro:IPR009507"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q65MG3"
FT                   /protein_id="AAU39751.1"
FT                   /translation="MSDQKTAELNKMIEEISQKLNMLNIGVIKAEDFSNEKLEDLEYLH
FT                   QMVMKKKSFSPSEMQAIAEELAALRK"
FT   gene            complement(837574..838932)
FT                   /locus_tag="BLi00817"
FT   CDS_pept        complement(837574..838932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00817"
FT                   /product="putative sodium-alanine symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00817"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39752"
FT                   /protein_id="AAU39752.3"
FT                   /translation="MEFISHIVDTMNGFLWGPPLLILIVGTGIYLTFRLAFLQVRLLPY
FT                   SLKLAFSRHQDKSSEGDISHFQALMTALAATVGTGNIVGVASAVIAGGPGAVFWMWLAA
FT                   FFGMATKYAEAVLAVRFRVKDKNGEMSGGPMYYLEHGLKQKWLGVLFAIFGALAAFGIG
FT                   NMVQSNSVSGVMSSTFSVPAWVTGIIVTTFTALVILGGIKSIGRVTSLFVPVMALFYVI
FT                   AGLIILVTNFELVPGAVGLIFSDAFTGQAVAGGAIGTVIRWGVARGVFSNEAGLGSAPI
FT                   AAAAAKTDMPARQALVSMTQVFIDTLIVCSITGISIVMGNMYLTEKTDALTSMTFAHFL
FT                   GPAGSTIVAIGLLLFAYSTILGWSYYGEKCFTYLLNEKYAIVYRIIFVIAVFFGAVFKN
FT                   DFVWALADMLNGLMAIPNLIGLLGLTGIVVYESKQILAKIKAEKEEKQNSVSV"
FT   gene            839116..839586
FT                   /gene="yfkJ"
FT                   /locus_tag="BLi00818"
FT   CDS_pept        839116..839586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfkJ"
FT                   /locus_tag="BLi00818"
FT                   /product="putative protein-tyrosine-phosphatase YfkJ"
FT                   /EC_number="3.1.3.48"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00818"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39753"
FT                   /protein_id="AAU39753.1"
FT                   /translation="MIKVLFVCLGNICRSPMAEAVFNDMLKKSGLEDRIEADSAGTGSW
FT                   HVGKPPHEGTRSLLSEKKISCEGLYARQITDKDPEAFDYIIAMDAENAGHVRSLAGYGS
FT                   KAVIRRLLDYVEDCETADVPDPYYTGNFEEVYELVAKGCRELLKDIRKEHNL"
FT   gene            839608..839958
FT                   /gene="yfkI"
FT                   /locus_tag="BLi00819"
FT   CDS_pept        839608..839958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfkI"
FT                   /locus_tag="BLi00819"
FT                   /product="YfkI"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00819"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39754"
FT                   /protein_id="AAU39754.1"
FT                   /translation="MKNDRVFIRNILLGASVGAVMSLLHKPTREACGAKLTACKNKVRL
FT                   YRANPGMLTECVKEKMDEAKKLTASISDDLSFLNQQIKELKETTPKVIGLIEETRDHFT
FT                   AKSKGRTEPEKE"
FT   gene            839955..840770
FT                   /gene="yfkH"
FT                   /locus_tag="BLi00820"
FT   CDS_pept        839955..840770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfkH"
FT                   /locus_tag="BLi00820"
FT                   /product="putative ribonuclease-like protein YfkH"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00820"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39755"
FT                   /protein_id="AAU39755.1"
FT                   /translation="MSFLKELGWRFFLHEGPSKSAELAYFFLLSLFPFMIFLLTLIGYL
FT                   PVKTGDVIGLIEQYAPEDTMSVIEETLNTGNRGLLSFGIIAALWSASNGLNAIVRAFNH
FT                   AYEVEENRSFIMVRLTSLLLTAAMVFTILVALLLPVFGRAIGHFIANLDGTPEMFLTAW
FT                   SALRWGISPLVLLIVFTALYFFAPNKRLSFKFVLPGAVAATAGWILVSVLFSYYVSEFA
FT                   NYSATYGSLGGIIVLMIWFYLSGMMIILGGEINALLHKRKIIPEENPRN"
FT   gene            complement(840966..842144)
FT                   /gene="yfkF"
FT                   /locus_tag="BLi00821"
FT   CDS_pept        complement(840966..842144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfkF"
FT                   /locus_tag="BLi00821"
FT                   /product="putative major facilitator superfamily protein
FT                   YfkF"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00821"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39756"
FT                   /protein_id="AAU39756.3"
FT                   /translation="MTRFHFFILVLIVSISGFSQGMLLPVISVIFEQEGHSAALNGLHA
FT                   TGLYIGVLIASPFMEAPLRRLGFKPLIVIGGVMVCASLFAFVFIQSFIVWFFLRLLIGI
FT                   GDHMLHFSTQTWVTTLSSEKKRGRNISLYGLSFGLGFAAGPFLTPLVNIAPSLPFIVSG
FT                   AFSLLAWLFIFCLQNDFPEKSGSESRSDNSLKRFAQAFLLGWVAFLPTFGYGFLETALN
FT                   GNFPVYALRSGISVEGVSIILPAFAIGSIVFQYPLGVLSDKYGRRNVLLVILAVGAGCF
FT                   FAAGFSESVLLLAACFFIAGMAVGSTFSLGISFMADLLPKRLLPAGNLMCGITFSFGSI
FT                   FGPVAGGWYMQIFHNSNLFYLITCVMVLIWIGVLFGKTKKNGALEQSEAAPM"
FT   gene            842245..842625
FT                   /locus_tag="BLi00822"
FT   CDS_pept        842245..842625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00822"
FT                   /product="putative peroxiredoxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00822"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39757"
FT                   /protein_id="AAU39757.1"
FT                   /translation="MEIVWNQNGFEADLEYGKLKISSNEEAGFRPYQLLAASIAACSGT
FT                   VLRKILEKKRIQLKDMIIETKEERISEEAGRIKSIHLHFILKGENLGAEQIKKALRIAL
FT                   KNCAMVRSVENSIDIIETFEIR"
FT   gene            842730..843785
FT                   /gene="yfkE"
FT                   /locus_tag="BLi00823"
FT   CDS_pept        842730..843785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfkE"
FT                   /locus_tag="BLi00823"
FT                   /product="H+/Ca2+ exchanger YfkE"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00823"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39758"
FT                   /protein_id="AAU39758.1"
FT                   /translation="MSRFFFWMMAAGVPLSVAGSLLHWPQVLLFIIYCLTIIALASYMG
FT                   RATESLAIIAGPRIGGLLNATFGNAVELIISIFALREGLIGIVLASLTGSVLGNLLLVA
FT                   GLSFFIGGLKYKRQEFNVYDARHNSGLLMFAVIVAFVIPEVFSAEMTEPRKLSMSVGIS
FT                   IIMILLYLAALYFKLVSHRGVYQTNQNEQEESHEEPEWSGKRATLILFLATVAVAYISE
FT                   HLVHTFDTVAEQFGWSELFIGVIIVAIVGNAAEHASAVIMAYKDKMDVAVEIAIGSTLQ
FT                   IAMFVAPVLVISSLFFPTSMPLVFTLPELVAMASAVLLMIIISNDGDTNWFEGATLLAA
FT                   YIIMGIGFFLL"
FT   gene            843852..844643
FT                   /gene="yfkD"
FT                   /locus_tag="BLi00824"
FT   CDS_pept        843852..844643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfkD"
FT                   /locus_tag="BLi00824"
FT                   /product="YfkD"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00824"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39759"
FT                   /protein_id="AAU39759.1"
FT                   /translation="MKKLLCFTLTAFLSFSFFAVQEADAAKPIKIPSSVTNISKENTYP
FT                   NASQDQPRLQPSELAEELLKTTDIAIENPHLIKMLNESSISGTPLAIGYRATIYLGRWA
FT                   LGYTSNETVANWEYRKINTNRFDNRGGKAPAELTYSQEQTSKIKGGLTAKVPKAEDVKN
FT                   MMMLKAMEKTKLPLAFETVVGSGTKRDQIYKVQPKKLGNLHAYAPAVNEKGKVTYGEVY
FT                   IVLKGNKRKLVVKNITSQGIGAWIPVQDHLTFGFQLSHQPK"
FT   gene            complement(844672..845793)
FT                   /gene="yfkA"
FT                   /locus_tag="BLi00825"
FT   CDS_pept        complement(844672..845793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfkA"
FT                   /locus_tag="BLi00825"
FT                   /product="putative radical SAM protein YfkA"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00825"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39760"
FT                   /protein_id="AAU39760.1"
FT                   /translation="MTEKMQARPITPEYDPWEAYMDVDQFGDIQLTNVEFTTTTLCNMR
FT                   CEHCAVGYTLQTKDPDALPVSLLLKRLDEIPRLRSLSITGGEPMLSLKSVKEYVVPLLK
FT                   YAHERGVRTQINSNLTLDIGRYELIIPYLDVLHISHNWGTVEDFAEIGFAMMDKKPTFA
FT                   QRARYFEKMIENSRTLVDEGVMVSAETMLNKRTLPHIEHIHRQIVEDMKCQRHEVHPMY
FT                   PSDFASALESLSLKDMRKAIHRLLDIRDENTWMLFGTLPFYACSPDPEDHALLQRLREA
FT                   KNVTVRNDPDGRSRLNVNIFDGNIIVTDFGDTPPLGNIQTDSLPSAYAKWRKTELAKEL
FT                   NCHCPHVRCLGPNVLVKNSYYQDVDFTSRTARV"
FT   gene            845937..846122
FT                   /gene="yfjT"
FT                   /locus_tag="BLi00826"
FT   CDS_pept        845937..846122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfjT"
FT                   /locus_tag="BLi00826"
FT                   /product="YfjT"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00826"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39761"
FT                   /protein_id="AAU39761.1"
FT                   /translation="MGNAVHDKEQQVNYLKNRLDMFMSVIDSLDPESTDLEDIDRLISM
FT                   LDDLEAKYERFKKDWK"
FT   gene            846229..847023
FT                   /gene="pdaA"
FT                   /locus_tag="BLi00827"
FT   CDS_pept        846229..847023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdaA"
FT                   /locus_tag="BLi00827"
FT                   /product="polysaccharide deacetylase PdaA"
FT                   /EC_number="3.5.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00827"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39762"
FT                   /protein_id="AAU39762.1"
FT                   /translation="MMKRICAICCGFLLTLAFSGNAEAISNKAIHWGFSKSKNHQPADA
FT                   GQELTNLLQQYDAFYLGNTKEKTIYLTFDNGYENGYTPQVLDVLKKQNVKAAFFVTGHF
FT                   VKDQPELIKRMAEEGHIIGNHSYHHPDLTTKTSRVIQEELESVDEEVYKITGEKNNLYL
FT                   RPPRGIFSERVLEETKKLGYQTVFWSVAFVDWKINAQKGWRYAYDNMMKQAHPGAIYLL
FT                   HTVSRDNAEALDQAITDLKKEGYTFKSLDDLMFEKSMMLETL"
FT   gene            847200..848303
FT                   /locus_tag="BLi00828"
FT   CDS_pept        847200..848303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLi00828"
FT                   /product="putative glycerol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BLi00828"
FT                   /db_xref="EnsemblGenomes-Tr:AAU39763"
FT                   /protein_id="AAU39763.1"
FT                   /translation="MSKSVKSVTSPKKFITGKRLLENLNDYIEDFGDNAYIICDEFILE
FT                   RAQKEAGNSIQKAGNQAVFEKFNYECTQEEIDRNRELARNAGANIIVGIGGGKTLDTAK
FT                   ATAYYEKLPVVIFPTIASTDAPCTALAVIYKHDGSFDRYLFLPTNPDVVLADSEILASA
FT                   PPRFFAAGIGDALATYFEARACFKANGDNLVLMKPSTTGLGLARLCYDTLLENGVKAMQ
FT                   AVKHGVSTRAVEDTIEATIYLSGVGAESGGLAAAHAIHNGMTAVPSLHRAQHGEKVTFG
FT                   LLAQLVLENAPAEELETVIDFIKGVGLPLTLKDLGVDEFVEEEWRQVAQSACAEGDTMG
FT                   NMPFPVTPDDVYNAIVAANAIAESYHD"
FT   gene            comp